BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18477_g2_i3 len=1536 path=[6524:0-142 2718:143-287 6714:288-1535]

Length=1536
                                                                      Score     E

ref|XP_004229941.1|  PREDICTED: myb-related protein Zm38-like           456   4e-155   
ref|XP_006339543.1|  PREDICTED: myb-related protein Zm38-like           456   5e-155   
ref|XP_004240108.1|  PREDICTED: protein ODORANT1-like                   448   2e-151   
ref|XP_009779196.1|  PREDICTED: myb-related protein Zm38-like           436   4e-147   
ref|XP_009629649.1|  PREDICTED: transcription factor MYB28-like         432   7e-146   
ref|XP_009794055.1|  PREDICTED: protein ODORANT1-like                   427   2e-143   
ref|XP_006345595.1|  PREDICTED: protein ODORANT1-like                   427   4e-143   
ref|XP_009587317.1|  PREDICTED: myb-related protein Zm38-like           417   2e-139   
ref|XP_006445088.1|  hypothetical protein CICLE_v10021268mg             417   2e-139   
ref|XP_007051856.1|  Myb domain protein 17 isoform 1                    409   2e-136   
ref|XP_002320117.1|  hypothetical protein POPTR_0014s07700g             399   1e-132   Populus trichocarpa [western balsam poplar]
ref|XP_011035902.1|  PREDICTED: transcription repressor MYB6-like       397   9e-132   
ref|XP_011023364.1|  PREDICTED: transcription repressor MYB6-like...    395   6e-131   
emb|CDP08839.1|  unnamed protein product                                392   8e-130   
ref|XP_011093150.1|  PREDICTED: transcription factor MYB3 isoform X2    386   2e-127   
ref|XP_011093149.1|  PREDICTED: transcription factor MYB3 isoform X1    386   5e-127   
ref|XP_011091956.1|  PREDICTED: myb-related protein Zm38-like           384   6e-127   
ref|XP_002270529.1|  PREDICTED: myb-related protein 308                 383   2e-126   Vitis vinifera
emb|CAN75438.1|  hypothetical protein VITISV_000834                     383   3e-126   Vitis vinifera
ref|XP_002511832.1|  r2r3-myb transcription factor, putative            381   2e-125   Ricinus communis
gb|KDP28653.1|  hypothetical protein JCGZ_14424                         372   3e-122   
ref|XP_010273102.1|  PREDICTED: myb-related protein 308-like            369   7e-121   
ref|XP_010053687.1|  PREDICTED: myb-related protein 308                 364   5e-119   
ref|XP_010255443.1|  PREDICTED: transcription factor MYB3-like          365   5e-119   
gb|AGN52064.1|  MYB-related transcription factor                        360   1e-117   
gb|KHG01165.1|  Transcription factor MYB39 -like protein                358   7e-117   
ref|XP_008232794.1|  PREDICTED: transcription factor MYB3               360   3e-116   
ref|XP_008353981.1|  PREDICTED: myb-related protein Myb4-like           356   5e-115   
gb|KHG09148.1|  Transcription factor MYB28 -like protein                353   7e-115   
ref|XP_007218142.1|  hypothetical protein PRUPE_ppa007268mg             356   1e-114   
ref|XP_010523735.1|  PREDICTED: transcription repressor MYB6            352   2e-114   
emb|CCA29116.1|  putative MYB transcription factor                      353   3e-114   
ref|XP_008362620.1|  PREDICTED: transcription factor MYB51-like         353   3e-114   
ref|XP_010105966.1|  Protein ODORANT1                                   350   3e-113   
ref|XP_010672001.1|  PREDICTED: myb-related protein Myb4                347   2e-112   
gb|AGO03570.1|  MIXTA-like 6                                            340   1e-109   
ref|NP_191684.1|  LATE MERISTEM IDENTITY2                               337   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004306804.1|  PREDICTED: uncharacterized protein LOC101307334    338   2e-108   
ref|XP_010055170.1|  PREDICTED: myb-related protein 340-like isof...    336   5e-108   
ref|XP_008376023.1|  PREDICTED: myb-related protein Hv1                 337   5e-108   
ref|XP_004133870.1|  PREDICTED: transcription repressor MYB6-like       336   6e-108   
ref|XP_010055169.1|  PREDICTED: myb-related protein 340-like isof...    336   2e-107   
ref|XP_004510807.1|  PREDICTED: protein ODORANT1-like                   333   5e-107   
ref|XP_006292176.1|  hypothetical protein CARUB_v10018382mg             333   7e-107   
ref|XP_002876601.1|  AtMYB17                                            332   1e-106   
ref|XP_006402502.1|  hypothetical protein EUTSA_v10006126mg             332   2e-106   
ref|XP_007051857.1|  Myb domain protein 17 isoform 2                    331   2e-106   
ref|XP_010512459.1|  PREDICTED: myb-related protein Zm38-like           330   6e-106   
gb|AGN52097.1|  MYB-related transcription factor                        328   4e-105   
ref|XP_010469050.1|  PREDICTED: transcription repressor MYB5-like       328   4e-105   
ref|XP_010413438.1|  PREDICTED: myb-related protein Zm38-like           327   2e-104   
emb|CDY48934.1|  BnaA09g39030D                                          326   4e-104   
emb|CDX71755.1|  BnaC08g31190D                                          325   5e-104   
ref|XP_009104296.1|  PREDICTED: protein ODORANT1-like                   324   8e-104   
gb|EYU35079.1|  hypothetical protein MIMGU_mgv1a011571mg                324   9e-104   
ref|XP_009116786.1|  PREDICTED: myb-related protein Zm38                325   9e-104   
emb|CDY58788.1|  BnaA07g38030D                                          324   1e-103   
ref|XP_003623894.1|  MYB transcription factor                           323   4e-103   
ref|XP_003618988.1|  Myb-like transcription factor                      323   5e-103   
emb|CDY45703.1|  BnaCnng13680D                                          320   2e-102   
dbj|BAK53863.1|  MYB transcription factor MIXTA-like protein            322   3e-102   
ref|XP_007139892.1|  hypothetical protein PHAVU_008G067300g             321   3e-102   
ref|XP_003552382.1|  PREDICTED: protein ODORANT1                        320   7e-102   
ref|XP_003534572.1|  PREDICTED: protein ODORANT1-like                   320   1e-101   
gb|EPS71496.1|  hypothetical protein M569_03262                         316   2e-101   
ref|XP_007135039.1|  hypothetical protein PHAVU_010G096400g             317   8e-101   
gb|KDP22287.1|  hypothetical protein JCGZ_26118                         313   2e-99    
ref|XP_002267986.1|  PREDICTED: transcription repressor MYB6            311   1e-98    Vitis vinifera
emb|CDX89106.1|  BnaA04g00800D                                          310   5e-98    
gb|AGO03571.1|  MIXTA-like 7                                            308   9e-98    
ref|XP_009138782.1|  PREDICTED: myb-related protein Myb4-like iso...    307   5e-97    
emb|CDP05209.1|  unnamed protein product                                307   1e-96    
ref|XP_003521908.1|  PREDICTED: protein ODORANT1-like                   305   3e-96    
gb|KHN27311.1|  Protein ODORANT1                                        304   4e-96    
ref|XP_011093151.1|  PREDICTED: myb-related protein Pp2 isoform X3      304   6e-96    
dbj|BAA36424.1|  MYB homologue                                          303   1e-95    Perilla frutescens var. crispa
ref|XP_009138781.1|  PREDICTED: myb-related protein Myb4-like iso...    301   9e-95    
ref|XP_004492711.1|  PREDICTED: protein ODORANT1-like                   301   1e-94    
ref|XP_006583311.1|  PREDICTED: protein ODORANT1-like                   299   4e-94    
ref|XP_008794182.1|  PREDICTED: myb-related protein Myb4-like iso...    289   2e-89    
ref|XP_011030104.1|  PREDICTED: transcription repressor MYB6-like       287   5e-89    
ref|XP_008794546.1|  PREDICTED: myb-related protein Myb4-like iso...    286   5e-88    
ref|XP_002318817.2|  hypothetical protein POPTR_0012s13240g             283   2e-87    Populus trichocarpa [western balsam poplar]
ref|XP_008339263.1|  PREDICTED: transcription factor MYB28-like         283   9e-87    
ref|XP_007143400.1|  hypothetical protein PHAVU_007G069400g             279   1e-85    
emb|CBI22754.3|  unnamed protein product                                275   7e-85    
ref|XP_009382382.1|  PREDICTED: myb-related protein Myb4-like           276   1e-84    
ref|XP_002321913.1|  hypothetical protein POPTR_0015s13180g             273   9e-84    Populus trichocarpa [western balsam poplar]
ref|XP_007038674.1|  Myb domain protein 17, putative                    271   1e-83    
gb|ABK26515.1|  unknown                                                 266   2e-80    Picea sitchensis
gb|EMT27766.1|  Transcription factor MYB39                              263   6e-80    
ref|XP_009400270.1|  PREDICTED: myb-related protein Hv1-like            263   9e-80    
ref|XP_004496577.1|  PREDICTED: myb-related protein Myb4-like           263   1e-79    
ref|XP_010525098.1|  PREDICTED: myb-related protein 306 isoform X2      264   2e-79    
ref|XP_009121584.1|  PREDICTED: myb-related protein Hv1                 263   2e-79    
ref|XP_006647594.1|  PREDICTED: myb-related protein Myb4-like           261   2e-79    
ref|XP_003535618.1|  PREDICTED: transcription factor MYB3-like is...    261   3e-79    
gb|KEH43718.1|  myb transcription factor MIXTA-like protein             261   4e-79    
emb|CDY34696.1|  BnaA01g33290D                                          261   1e-78    
ref|XP_003555377.1|  PREDICTED: transcription factor MYB3-like is...    260   1e-78    
gb|AGN52091.1|  MYB-related transcription factor                        261   1e-78    
ref|XP_011076175.1|  PREDICTED: transcription factor MYB3-like          261   1e-78    
ref|XP_006400051.1|  hypothetical protein EUTSA_v10014101mg             261   1e-78    
gb|KHN26659.1|  Myb-related protein Myb4                                259   2e-78    
ref|XP_008439352.1|  PREDICTED: transcription factor MYB34-like         261   3e-78    
ref|XP_006288195.1|  hypothetical protein CARUB_v10001433mg             257   3e-78    
gb|AHN60122.1|  MYB transcription factor 16                             259   4e-78    
emb|CDY37542.1|  BnaA05g34070D                                          260   4e-78    
ref|XP_010525095.1|  PREDICTED: transcription factor MYB122 isofo...    261   4e-78    
emb|CDX69532.1|  BnaA10g18810D                                          259   5e-78    
gb|AHN60121.1|  MYB transcription factor 106                            259   5e-78    
ref|XP_009117713.1|  PREDICTED: transcription factor MYB34-like         259   6e-78    
dbj|BAD25229.1|  putative P-type R2R3 Myb protein                       258   7e-78    Oryza sativa Japonica Group [Japonica rice]
gb|EAY86854.1|  hypothetical protein OsI_08238                          258   7e-78    Oryza sativa Indica Group [Indian rice]
gb|AAF26160.1|AC008261_17  putative Myb-related transcription factor    259   9e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408465.1|  hypothetical protein EUTSA_v10021048mg             259   1e-77    
emb|CDX85555.1|  BnaA02g02580D                                          259   1e-77    
ref|XP_003528577.1|  PREDICTED: transcription factor MYB51-like         261   1e-77    
emb|CDY55802.1|  BnaCnng29120D                                          258   1e-77    
ref|XP_003556724.1|  PREDICTED: transcription factor MYB51-like         261   1e-77    
emb|CDY43270.1|  BnaC05g48630D                                          259   1e-77    
ref|XP_010425344.1|  PREDICTED: protein ODORANT1 isoform X1             259   2e-77    
ref|XP_003621270.1|  MYB transcription factor                           257   2e-77    
ref|XP_003569965.1|  PREDICTED: myb-related protein Myb4-like           256   2e-77    
ref|XP_011098652.1|  PREDICTED: myb-related protein 306-like            259   2e-77    
ref|XP_010425981.1|  PREDICTED: transcription factor MYB34 isofor...    258   2e-77    
ref|XP_010463575.1|  PREDICTED: protein ODORANT1-like isoform X1        258   2e-77    
emb|CDX78625.1|  BnaA03g05370D                                          257   2e-77    
gb|ADD64500.1|  MYBML1                                                  259   2e-77    
ref|XP_010492363.1|  PREDICTED: myb-related protein Hv1-like isof...    258   2e-77    
ref|XP_009131458.1|  PREDICTED: myb-related protein Hv1-like            257   2e-77    
ref|XP_010485421.1|  PREDICTED: protein ODORANT1-like isoform X1        258   3e-77    
ref|XP_006296712.1|  hypothetical protein CARUB_v10013887mg             259   3e-77    
ref|XP_010485422.1|  PREDICTED: transcription factor MYB34-like i...    258   3e-77    
ref|XP_009126044.1|  PREDICTED: transcription factor MYB34-like         256   4e-77    
ref|XP_010424105.1|  PREDICTED: myb-related protein Hv1-like            256   4e-77    
ref|XP_007158642.1|  hypothetical protein PHAVU_002G170000g             259   4e-77    
ref|XP_010492364.1|  PREDICTED: myb-related protein Hv1-like isof...    257   4e-77    
gb|AAO49410.1|AF485892_1  MYB1                                          258   4e-77    Dendrobium sp. XMW-2002-1
ref|NP_001078589.1|  myb domain protein 16                              256   5e-77    Arabidopsis thaliana [mouse-ear cress]
gb|ACN31881.1|  unknown                                                 255   5e-77    Zea mays [maize]
gb|KHN01977.1|  Transcription factor MYB39                              260   5e-77    
ref|XP_003520088.1|  PREDICTED: transcription factor MYB28-like         260   5e-77    
ref|XP_010528356.1|  PREDICTED: transcription factor MYB32-like         257   5e-77    
ref|NP_197035.1|  myb domain protein 16                                 256   5e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288196.1|  hypothetical protein CARUB_v10001433mg             256   5e-77    
ref|XP_002871660.1|  AtMIXTA/AtMYB16                                    256   7e-77    
gb|KFK37575.1|  hypothetical protein AALP_AA3G001200                    256   7e-77    
ref|XP_011048715.1|  PREDICTED: transcription factor MYB39-like         255   8e-77    
ref|XP_007151240.1|  hypothetical protein PHAVU_004G029800g             259   8e-77    
ref|XP_007139534.1|  hypothetical protein PHAVU_008G038000g             257   1e-76    
emb|CDX70606.1|  BnaC03g06900D                                          255   1e-76    
ref|XP_008341595.1|  PREDICTED: transcription factor MYB34-like         258   1e-76    
ref|XP_009360604.1|  PREDICTED: myb-related protein 330-like            257   2e-76    
gb|AFX97765.1|  R2R3-MYB transcription factor                           256   2e-76    
dbj|BAF46264.1|  putative transcription factor                          259   2e-76    Humulus lupulus [common hop]
ref|XP_010453666.1|  PREDICTED: myb-related protein Hv1-like            255   2e-76    
emb|CDY26411.1|  BnaC09g42570D                                          255   2e-76    
gb|AAS10051.1|  MYB transcription factor                                256   2e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010258093.1|  PREDICTED: transcription factor MYB34-like         258   2e-76    
ref|XP_004489411.1|  PREDICTED: transcription factor MYB28-like         258   2e-76    
dbj|BAF49441.1|  transcription factor DcMYB2                            256   2e-76    Daucus carota [carrots]
ref|XP_003533532.1|  PREDICTED: transcription factor MYB39-like i...    257   2e-76    
ref|XP_004304285.1|  PREDICTED: transcription factor MYB39-like         256   2e-76    
gb|EPS71765.1|  protein 1                                               251   3e-76    
ref|XP_009376291.1|  PREDICTED: transcription factor MYB34              257   3e-76    
ref|XP_007046022.1|  Myb domain protein 106, putative                   256   3e-76    
ref|XP_004491833.1|  PREDICTED: transcription factor MYB39-like i...    256   3e-76    
ref|XP_006431202.1|  hypothetical protein CICLE_v10011948mg             256   4e-76    
ref|XP_010088130.1|  Transcription factor                               256   4e-76    
gb|ACJ07153.1|  R2R3 MYB transcription factor                           254   4e-76    Gossypium hirsutum [American cotton]
ref|XP_002283843.1|  PREDICTED: myb-related protein 306-like            256   4e-76    Vitis vinifera
gb|KDO72620.1|  hypothetical protein CISIN_1g016708mg                   256   4e-76    
ref|XP_006438735.1|  hypothetical protein CICLE_v10033327mg             256   4e-76    
gb|AAK19616.1|AF336283_1  GHMYB25                                       254   4e-76    Gossypium hirsutum [American cotton]
ref|XP_007032600.1|  Myb domain protein 106                             256   4e-76    
ref|XP_004491832.1|  PREDICTED: transcription factor MYB39-like i...    255   5e-76    
gb|KHN13211.1|  Transcription factor MYB39                              257   5e-76    
ref|XP_006482628.1|  PREDICTED: transcription factor MYB28-like         256   5e-76    
emb|CDP00365.1|  unnamed protein product                                254   6e-76    
gb|AFK36884.1|  unknown                                                 254   7e-76    
ref|XP_003618530.1|  MYB transcription factor                           254   7e-76    
gb|AGO03566.1|  MIXTA-like 2                                            255   8e-76    
ref|XP_003543812.1|  PREDICTED: protein ODORANT1-like                   256   8e-76    
ref|XP_007217733.1|  hypothetical protein PRUPE_ppa006769mg             256   8e-76    
ref|XP_003554566.1|  PREDICTED: transcription factor MYB51              256   8e-76    
ref|XP_008230795.1|  PREDICTED: myb-related protein 330                 256   8e-76    
gb|AEO27486.1|  MIXTA-like transcription factor                         256   8e-76    
gb|AAV70655.1|  MYB transcription factor MIXTA-like 2                   254   9e-76    Antirrhinum majus [garden snapdragon]
ref|XP_006338434.1|  PREDICTED: myb-related protein 306-like            256   1e-75    
ref|XP_010258286.1|  PREDICTED: transcription factor MYB34-like         256   1e-75    
ref|XP_009402014.1|  PREDICTED: myb-related protein Myb4-like           253   1e-75    
gb|KHG14813.1|  Transcription factor MYB39 -like protein                254   1e-75    
ref|XP_010032514.1|  PREDICTED: myb-related protein 306                 255   2e-75    
gb|KDP27171.1|  hypothetical protein JCGZ_19870                         254   2e-75    
ref|XP_010108699.1|  Transcription factor                               255   2e-75    
ref|XP_004141447.1|  PREDICTED: myb-related protein 306-like            254   2e-75    
ref|XP_009147399.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    254   2e-75    
ref|XP_010670239.1|  PREDICTED: probable serine/threonine-protein...    256   2e-75    
ref|XP_008459338.1|  PREDICTED: myb-related protein 306-like            254   2e-75    
ref|NP_001148496.1|  P-type R2R3 Myb protein                            251   2e-75    Zea mays [maize]
ref|XP_008783569.1|  PREDICTED: transcription factor MYB39-like         254   3e-75    
gb|KGN52476.1|  hypothetical protein Csa_5G637660                       254   3e-75    
ref|XP_006659430.1|  PREDICTED: transcription factor MYB28-like         253   3e-75    
ref|XP_008221584.1|  PREDICTED: myb-related protein 306-like            253   4e-75    
emb|CDX90998.1|  BnaC02g05990D                                          253   4e-75    
gb|ACN69972.1|  MYB transcription factor ML2                            254   4e-75    Thalictrum thalictroides [rue-anemone]
gb|AGN52095.1|  MYB-related transcription factor                        253   4e-75    
ref|XP_009624863.1|  PREDICTED: myb-related protein 306                 254   4e-75    
ref|XP_004973509.1|  PREDICTED: transcription factor MYB32-like         252   5e-75    
emb|CAA78386.1|  protein 1                                              254   5e-75    Petunia x hybrida [garden petunia]
ref|XP_011012944.1|  PREDICTED: myb-related protein 306-like            253   6e-75    
emb|CDP02253.1|  unnamed protein product                                253   6e-75    
ref|XP_004232212.1|  PREDICTED: myb-related protein 306                 254   6e-75    
emb|CAB43399.1|  Myb-related transcription factor mixta-like 1          252   7e-75    Antirrhinum majus [garden snapdragon]
ref|NP_001061874.1|  Os08g0433400                                       252   7e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009792075.1|  PREDICTED: myb-related protein 306-like            254   8e-75    
ref|XP_002882197.1|  hypothetical protein ARALYDRAFT_477416             253   8e-75    
ref|XP_010939829.1|  PREDICTED: snRNA-activating protein complex ...    253   9e-75    
ref|XP_006602925.1|  PREDICTED: transcription factor MYB28-like         253   9e-75    
ref|XP_010937203.1|  PREDICTED: myb-related protein Pp2-like            253   9e-75    
ref|XP_009591172.1|  PREDICTED: transcription factor MYB39-like         252   1e-74    
ref|XP_004228373.1|  PREDICTED: myb-related protein 315-like            251   1e-74    
ref|NP_186763.2|  myb domain protein 106                                253   1e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009405030.1|  PREDICTED: myb-related protein Myb4-like           251   1e-74    
ref|XP_006827320.1|  hypothetical protein AMTR_s00010p00267100          254   1e-74    
ref|XP_002316122.1|  hypothetical protein POPTR_0010s17300g             252   1e-74    Populus trichocarpa [western balsam poplar]
ref|XP_002323871.1|  hypothetical protein POPTR_0017s12230g             253   1e-74    Populus trichocarpa [western balsam poplar]
dbj|BAM71806.1|  R2R3-MYB transcription factor                          251   1e-74    
gb|KHN45518.1|  Transcription factor MYB39                              253   1e-74    
ref|XP_004517012.1|  PREDICTED: myb-related protein 306-like            253   2e-74    
ref|XP_001782039.1|  predicted protein                                  244   2e-74    
ref|XP_002444392.1|  hypothetical protein SORBIDRAFT_07g021210          251   2e-74    Sorghum bicolor [broomcorn]
ref|XP_006483693.1|  PREDICTED: transcription factor MYB29-like         251   2e-74    
ref|XP_010426612.1|  PREDICTED: protein ODORANT1 isoform X3             252   2e-74    
ref|XP_011035792.1|  PREDICTED: protein ODORANT1                        252   3e-74    
ref|XP_009410047.1|  PREDICTED: transcription factor MYB34-like         251   3e-74    
ref|XP_002268469.2|  PREDICTED: myb-related protein 306-like            251   3e-74    Vitis vinifera
emb|CAN77989.1|  hypothetical protein VITISV_028880                     250   4e-74    Vitis vinifera
emb|CDP20238.1|  unnamed protein product                                251   4e-74    
emb|CAA55725.1|  mixta                                                  249   5e-74    Antirrhinum majus [garden snapdragon]
ref|XP_008664664.1|  PREDICTED: myb-related protein Myb4-like iso...    249   5e-74    
ref|XP_008802568.1|  PREDICTED: myb-related protein 306-like            251   6e-74    
ref|XP_011085743.1|  PREDICTED: myb-related protein 306-like            250   6e-74    
ref|XP_006440626.1|  hypothetical protein CICLE_v10023440mg             249   7e-74    
ref|XP_004298414.1|  PREDICTED: uncharacterized protein LOC101300142    251   7e-74    
ref|XP_006477596.1|  PREDICTED: transcription factor MYB28-like         249   8e-74    
gb|KDO55529.1|  hypothetical protein CISIN_1g047101mg                   249   8e-74    
gb|ABQ51227.1|  R2R3-MYB transcription factor MYB11                     253   9e-74    Picea glauca
ref|XP_008366447.1|  PREDICTED: myb-related protein 315-like            247   1e-73    
ref|NP_001140376.1|  putative MYB DNA-binding domain superfamily ...    247   2e-73    Zea mays [maize]
ref|XP_009758169.1|  PREDICTED: transcription factor MYB39-like         248   2e-73    
ref|XP_008678586.1|  PREDICTED: transcription factor MYB32-like         248   2e-73    
gb|AEO27487.1|  MIXTA-like transcription factor                         249   2e-73    
gb|EEE57461.1|  hypothetical protein OsJ_07689                          244   4e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002311317.2|  hypothetical protein POPTR_0008s08870g             248   4e-73    Populus trichocarpa [western balsam poplar]
ref|XP_011071273.1|  PREDICTED: myb-related protein 306-like            246   5e-73    
ref|XP_001768811.1|  predicted protein                                  240   5e-73    
ref|XP_008379378.1|  PREDICTED: transcription factor MYB34              248   5e-73    
ref|XP_004952890.1|  PREDICTED: transcription factor MYB28-like         246   6e-73    
ref|XP_003581451.1|  PREDICTED: myb-related protein Myb4-like           245   7e-73    
emb|CAE04573.1|  OSJNBb0039L24.12                                       244   9e-73    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ31445.1|  hypothetical protein OsJ_15582                          244   1e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009381410.1|  PREDICTED: myb-related protein Hv1                 247   1e-72    
ref|XP_008365407.1|  PREDICTED: transcription factor MYB34-like         247   1e-72    
ref|XP_003574525.1|  PREDICTED: myb-related protein Myb4-like           246   2e-72    
gb|AEV91158.1|  R2R3-MYB protein                                        244   2e-72    
ref|XP_002311313.2|  hypothetical protein POPTR_0008s08920g             246   2e-72    Populus trichocarpa [western balsam poplar]
gb|EYU34643.1|  hypothetical protein MIMGU_mgv1a009252mg                245   3e-72    
ref|XP_006653621.1|  PREDICTED: myb-related protein Myb4-like           243   3e-72    
ref|XP_007046023.1|  Myb domain protein 16, putative                    246   3e-72    
ref|XP_004136689.1|  PREDICTED: transcription factor MYB76-like         241   4e-72    
gb|KEH30787.1|  myb transcription factor mixta-like protein             246   4e-72    
ref|XP_003572652.1|  PREDICTED: myb-related protein Zm38-like           243   4e-72    
gb|AIS35933.1|  MYB transcription factor 16                             244   4e-72    
ref|XP_003607758.1|  MYB transcription factor                           245   6e-72    
dbj|BAJ91587.1|  predicted protein                                      243   8e-72    
ref|NP_001052993.1|  Os04g0461000                                       243   9e-72    Oryza sativa Japonica Group [Japonica rice]
emb|CAH67454.1|  H0219H12.11                                            243   9e-72    Oryza sativa [red rice]
gb|ADZ98878.1|  MYB25-like protein                                      244   9e-72    
ref|XP_004953258.1|  PREDICTED: myb-related protein Myb4-like           242   1e-71    
gb|ADZ98879.1|  MYB25-like protein                                      244   1e-71    
ref|XP_004975862.1|  PREDICTED: myb-related protein Myb4-like           244   1e-71    
gb|AFW71999.1|  putative MYB DNA-binding domain superfamily protein     243   1e-71    
gb|AAL84613.1|AF474116_1  typical P-type R2R3 Myb protein               236   1e-71    
ref|XP_011017669.1|  PREDICTED: transcription factor MYB34-like         244   1e-71    
ref|XP_008669319.1|  PREDICTED: uncharacterized protein LOC103646361    245   1e-71    
gb|ADZ98880.1|  MYB25-like protein                                      243   2e-71    
gb|ADZ98877.1|  MYB25-like protein                                      243   2e-71    
ref|XP_008443379.1|  PREDICTED: transcription factor MYB76-like i...    238   2e-71    
ref|XP_010663350.1|  PREDICTED: transcription factor MYB34-like i...    242   3e-71    
gb|ADZ55318.1|  MYB25-like protein                                      243   3e-71    
gb|AES89955.2|  myb transcription factor mixta-like protein             244   3e-71    
ref|XP_008443378.1|  PREDICTED: transcription factor MYB76-like i...    238   5e-71    
gb|AAU13905.1|  MYB transcription factor MYBML3                         237   6e-71    
ref|XP_010093592.1|  Transcription factor                               241   7e-71    
gb|ACG41144.1|  DNA binding protein                                     241   8e-71    
ref|XP_009356321.1|  PREDICTED: uncharacterized protein LOC103947194    242   8e-71    
ref|XP_003579906.1|  PREDICTED: myb-related protein Myb4-like           240   1e-70    
dbj|BAJ89539.1|  predicted protein                                      240   1e-70    
ref|XP_008664663.1|  PREDICTED: myb-related protein 306-like isof...    241   1e-70    
ref|XP_008443377.1|  PREDICTED: transcription factor MYB76-like i...    236   2e-70    
gb|AAZ20432.1|  MYB13                                                   239   4e-70    
ref|XP_002452859.1|  hypothetical protein SORBIDRAFT_04g033670          238   5e-70    
ref|XP_008661372.1|  PREDICTED: putative homeodomain-like transcr...    237   5e-70    
ref|XP_011017649.1|  PREDICTED: transcription factor MYB76-like         239   7e-70    
gb|AIT52298.1|  MYB family protein                                      239   9e-70    
gb|EMT09276.1|  Transcription factor MYB39                              244   1e-69    
emb|CDP01059.1|  unnamed protein product                                238   1e-69    
ref|XP_011075645.1|  PREDICTED: transcription factor MYB28-like         238   1e-69    
gb|AHI18153.1|  Mixta                                                   236   1e-69    
gb|EYU22401.1|  hypothetical protein MIMGU_mgv1a023545mg                239   1e-69    
ref|XP_011075641.1|  PREDICTED: myb-related protein 306-like            239   1e-69    
ref|XP_006355159.1|  PREDICTED: transcription factor MYB28-like         237   2e-69    
ref|XP_010107438.1|  Myb-related protein Myb4                           236   3e-69    
ref|XP_002446850.1|  hypothetical protein SORBIDRAFT_06g023620          235   3e-69    
gb|AAL90652.1|AF470084_1  P-type R2R3 Myb protein                       232   4e-69    
ref|NP_001047229.1|  Os02g0579300                                       236   4e-69    
tpg|DAA36694.1|  TPA: putative MYB DNA-binding domain superfamily...    235   4e-69    
ref|XP_002452341.1|  hypothetical protein SORBIDRAFT_04g024000          236   4e-69    
ref|XP_008350919.1|  PREDICTED: transcription factor MYB28-like         238   5e-69    
ref|XP_010667573.1|  PREDICTED: myb-related protein 306-like            233   5e-69    
gb|AHI18158.1|  Mixta                                                   234   5e-69    
gb|AGN52045.1|  MYB-related transcription factor                        235   5e-69    
gb|AGD80141.1|  mixta                                                   234   7e-69    
ref|XP_009790391.1|  PREDICTED: myb-related protein 315-like            236   7e-69    
gb|KDP37818.1|  hypothetical protein JCGZ_06720                         237   7e-69    
ref|XP_010274278.1|  PREDICTED: transcription factor MYB39-like         236   8e-69    
gb|EPS64349.1|  hypothetical protein M569_10432                         231   9e-69    
gb|KHG22733.1|  Transcription factor MYB39 -like protein                235   1e-68    
gb|EPS67924.1|  hypothetical protein M569_06849                         231   1e-68    
ref|XP_011090566.1|  PREDICTED: transcription factor MYB39-like         234   1e-68    
gb|AAT66778.1|  Putative MYB related protein, identical                 235   1e-68    
gb|ADV29952.1|  MYB transcription factor MIXTA-like 8 protein           236   1e-68    
gb|ACT78693.1|  mixta-like2 MYB transcription factor                    236   1e-68    
gb|ADV29954.1|  MYB transcription factor MIXTA-like 8 protein           234   2e-68    
gb|AGO03569.1|  MIXTA-like 5                                            235   2e-68    
ref|XP_010904805.1|  PREDICTED: transcription factor MYB3-like          235   2e-68    
ref|XP_004146632.1|  PREDICTED: uncharacterized protein LOC101216901    234   2e-68    
ref|XP_007018775.1|  Myb domain protein 93                              234   2e-68    
emb|CBI40862.3|  unnamed protein product                                234   2e-68    
ref|XP_009594598.1|  PREDICTED: transcription factor MYB39-like         234   2e-68    
ref|XP_007047937.1|  Myb domain protein 93                              234   2e-68    
dbj|BAC75671.1|  transcription factor MYB101                            234   3e-68    
gb|KDP41381.1|  hypothetical protein JCGZ_15788                         234   3e-68    
ref|XP_002266049.1|  PREDICTED: protein ODORANT1                        234   4e-68    
ref|XP_011096186.1|  PREDICTED: protein ODORANT1-like                   235   4e-68    
ref|XP_010269280.1|  PREDICTED: protein ODORANT1                        234   5e-68    
ref|XP_004239392.1|  PREDICTED: myb-related protein Hv1-like            234   5e-68    
ref|XP_009417580.1|  PREDICTED: transcription factor MYB39-like         232   5e-68    
ref|XP_009790156.1|  PREDICTED: protein ODORANT1-like                   233   5e-68    
ref|XP_008441942.1|  PREDICTED: transcription factor MYB86-like         235   6e-68    
ref|XP_003520086.2|  PREDICTED: myb-related protein Zm38-like           232   7e-68    
ref|XP_008669097.1|  PREDICTED: anthocyanin regulatory C1 protein...    235   7e-68    
ref|XP_006841861.1|  hypothetical protein AMTR_s00003p00271440          234   8e-68    
gb|AFW73493.1|  putative MYB DNA-binding domain superfamily protein     232   1e-67    
ref|XP_010645217.1|  PREDICTED: myb-related protein Myb4                232   1e-67    
ref|XP_011071274.1|  PREDICTED: transcription factor MYB28-like         233   1e-67    
gb|KDP20873.1|  hypothetical protein JCGZ_21344                         233   1e-67    
ref|XP_009374421.1|  PREDICTED: transcription factor RAX2               233   1e-67    
ref|XP_008338578.1|  PREDICTED: transcription factor MYB39-like         232   2e-67    
ref|XP_004953959.1|  PREDICTED: transcription factor MYB39-like         232   2e-67    
emb|CBI22245.3|  unnamed protein product                                230   2e-67    
gb|AGN52111.1|  MYB-related transcription factor                        229   2e-67    
ref|XP_008439917.1|  PREDICTED: transcription factor MYB34-like         234   2e-67    
ref|XP_004164066.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    232   2e-67    
ref|XP_010277911.1|  PREDICTED: transcription factor MYB39              233   2e-67    
ref|XP_010027860.1|  PREDICTED: transcription factor MYB34-like         232   2e-67    
ref|XP_004136397.1|  PREDICTED: transcription factor MYB39-like         231   2e-67    
ref|XP_004288189.1|  PREDICTED: uncharacterized protein LOC101292449    232   2e-67    
gb|KHN14496.1|  Transcription factor MYB28                              226   3e-67    
ref|XP_007207610.1|  hypothetical protein PRUPE_ppa019923mg             232   3e-67    
gb|KDP46819.1|  hypothetical protein JCGZ_24028                         231   3e-67    
gb|AGN52110.1|  MYB-related transcription factor                        230   3e-67    
ref|XP_006433987.1|  hypothetical protein CICLE_v10003958mg             231   3e-67    
ref|XP_008465998.1|  PREDICTED: transcription factor MYB39              230   3e-67    
ref|XP_002284142.1|  PREDICTED: transcription factor MYB39              231   4e-67    
ref|XP_004155656.1|  PREDICTED: uncharacterized LOC101206909            233   4e-67    
emb|CDO99644.1|  unnamed protein product                                231   4e-67    
ref|XP_010240896.1|  PREDICTED: transcription factor MYB39-like         231   4e-67    
ref|XP_009621190.1|  PREDICTED: transcription factor MYB34-like         232   4e-67    
ref|XP_008795437.1|  PREDICTED: transcription factor MYB39              231   4e-67    
ref|XP_007029608.1|  Myb domain protein 107                             232   4e-67    
ref|XP_004134963.1|  PREDICTED: uncharacterized protein LOC101206909    233   5e-67    
ref|XP_008775952.1|  PREDICTED: transcription factor MYB39-like         228   5e-67    
ref|XP_009383106.1|  PREDICTED: transcription factor MYB34-like         230   5e-67    
ref|XP_010671094.1|  PREDICTED: transcription factor MYB39              231   6e-67    
ref|XP_009593708.1|  PREDICTED: protein ODORANT1-like                   231   6e-67    
ref|XP_007046021.1|  Myb domain protein 106, putative                   230   6e-67    
ref|XP_007211464.1|  hypothetical protein PRUPE_ppa007438mg             231   6e-67    
ref|XP_006853158.1|  hypothetical protein AMTR_s00038p00183620          231   6e-67    
ref|XP_002305647.1|  putative MYB transcription factor family pro...    232   7e-67    
ref|XP_006421907.1|  hypothetical protein CICLE_v10006455mg             229   7e-67    
ref|XP_010939659.1|  PREDICTED: transcription repressor MYB6-like       230   7e-67    
ref|XP_009621431.1|  PREDICTED: protein ODORANT1-like                   231   7e-67    
ref|XP_009370698.1|  PREDICTED: transcription factor MYB39-like         231   7e-67    
gb|AHI18164.1|  Mixta-like1                                             231   7e-67    
gb|EPS74409.1|  hypothetical protein M569_00345                         224   8e-67    
ref|XP_006490474.1|  PREDICTED: transcription factor MYB76-like         229   8e-67    
ref|XP_007210715.1|  hypothetical protein PRUPE_ppa023143mg             229   8e-67    
ref|XP_004232789.1|  PREDICTED: transcription factor MYB39              231   8e-67    
ref|XP_006597393.1|  PREDICTED: protein ODORANT1-like                   231   9e-67    
ref|XP_006473009.1|  PREDICTED: transcription factor MYB39-like         230   9e-67    
ref|XP_006449197.1|  hypothetical protein CICLE_v10015729mg             231   9e-67    
ref|XP_009801248.1|  PREDICTED: protein ODORANT1-like                   231   9e-67    
ref|XP_008234088.1|  PREDICTED: transcription factor MYB28              230   1e-66    
ref|XP_006660233.1|  PREDICTED: transcription factor MYB39-like         224   1e-66    
ref|XP_008782327.1|  PREDICTED: transcription factor MYB39-like         229   1e-66    
ref|XP_007025822.1|  MYB-like 102                                       231   1e-66    
gb|AGN52050.1|  MYB-related transcription factor                        230   1e-66    
ref|XP_009597076.1|  PREDICTED: protein ODORANT1-like                   230   1e-66    
ref|XP_006347152.1|  PREDICTED: transcription factor MYB86-like         231   1e-66    
gb|EMS67303.1|  Transcription factor MYB39                              229   1e-66    
ref|XP_002316667.2|  hypothetical protein POPTR_0011s04120g             231   1e-66    
ref|XP_002452535.1|  hypothetical protein SORBIDRAFT_04g027540          229   1e-66    
ref|XP_010680536.1|  PREDICTED: transcription factor MYB39-like         229   1e-66    
ref|XP_008239919.1|  PREDICTED: myb-related protein Hv1-like            229   1e-66    
ref|XP_006355158.1|  PREDICTED: transcription factor MYB28-like         229   1e-66    
ref|XP_006467911.1|  PREDICTED: myb-related protein 3R-1-like           230   2e-66    
ref|XP_006344330.1|  PREDICTED: transcriptional activator Myb-like      229   2e-66    
ref|XP_008358698.1|  PREDICTED: LOW QUALITY PROTEIN: protein ODOR...    230   2e-66    
ref|XP_008345730.1|  PREDICTED: transcription factor MYB39-like         229   2e-66    
ref|XP_004500626.1|  PREDICTED: transcription factor MYB39-like         230   2e-66    
ref|XP_008224927.1|  PREDICTED: transcription repressor MYB6-like       230   2e-66    
ref|XP_003527903.1|  PREDICTED: transcription factor MYB39-like         229   2e-66    
ref|XP_004505589.1|  PREDICTED: transcription factor MYB39-like         229   2e-66    
ref|NP_001281023.1|  protein ODORANT1-like                              230   2e-66    
ref|XP_009348003.1|  PREDICTED: protein ODORANT1-like                   230   2e-66    
ref|XP_011001151.1|  PREDICTED: protein ODORANT1                        231   2e-66    
ref|XP_009380857.1|  PREDICTED: myb-related protein 308                 229   2e-66    
ref|XP_010917107.1|  PREDICTED: transcription factor MYB39-like         228   2e-66    
ref|XP_004293589.1|  PREDICTED: transcription factor MYB75-like         230   2e-66    
ref|XP_011016457.1|  PREDICTED: transcription factor MYB39-like         229   2e-66    
ref|XP_002301053.1|  hypothetical protein POPTR_0002s09720g             229   2e-66    
gb|AHI18159.1|  Mixta-like1                                             229   2e-66    
gb|ADV29942.1|  MYB transcription factor MIXTA-like 5 protein           227   3e-66    
ref|XP_010686260.1|  PREDICTED: protein ODORANT1-like                   231   3e-66    
ref|XP_009761686.1|  PREDICTED: protein ODORANT1-like                   229   3e-66    
gb|KHN03903.1|  Transcription factor MYB39                              229   3e-66    
ref|XP_004958010.1|  PREDICTED: uncharacterized protein LOC101782226    229   3e-66    
ref|XP_002891110.1|  AtMYB93                                            230   3e-66    
ref|XP_006655921.1|  PREDICTED: transcription factor MYB39-like         228   3e-66    
ref|XP_010025771.1|  PREDICTED: transcription factor MYB39-like         229   3e-66    
ref|XP_010096796.1|  Transcription factor                               230   3e-66    
emb|CDY03140.1|  BnaC06g08330D                                          229   3e-66    
gb|KEH34935.1|  myb transcription factor                                229   3e-66    
emb|CDY12030.1|  BnaAnng02150D                                          229   3e-66    
ref|XP_004973754.1|  PREDICTED: myb-related protein Hv33-like           228   3e-66    
ref|XP_009114726.1|  PREDICTED: protein ODORANT1 isoform X2             228   4e-66    
ref|XP_009629473.1|  PREDICTED: protein ODORANT1-like                   229   4e-66    
gb|KHN42917.1|  Transcription factor MYB39                              225   4e-66    
ref|XP_010538943.1|  PREDICTED: transcription factor MYB24-like         230   5e-66    
gb|ADV29945.1|  MYB transcription factor MIXTA-like 5 protein           228   5e-66    
gb|ADV29944.1|  MYB transcription factor MIXTA-like 5 protein           227   5e-66    
ref|XP_010907486.1|  PREDICTED: transcription factor MYB39-like         228   5e-66    
gb|KHN07682.1|  Transcription factor MYB39                              228   5e-66    
ref|XP_007136252.1|  hypothetical protein PHAVU_009G031200g             228   5e-66    
ref|NP_001062095.1|  Os08g0486300                                       229   5e-66    
gb|AGO03568.1|  MIXTA-like 4                                            228   5e-66    
ref|XP_008440591.1|  PREDICTED: myb-related protein Hv1                 228   6e-66    
ref|XP_002265296.1|  PREDICTED: myb-related protein Myb4                228   6e-66    
ref|XP_009114725.1|  PREDICTED: protein ODORANT1 isoform X1             229   7e-66    
ref|XP_007046025.1|  Myb domain 16-like protein                         229   7e-66    
ref|XP_011070983.1|  PREDICTED: transcription factor AS1-like           229   7e-66    
ref|XP_008670489.1|  PREDICTED: snRNA-activating protein complex ...    228   7e-66    
ref|XP_010052407.1|  PREDICTED: myb-related protein Hv1                 228   7e-66    
ref|XP_002307080.2|  hypothetical protein POPTR_0005s07590g             228   7e-66    
ref|XP_003529290.1|  PREDICTED: transcription factor MYB32-like         228   7e-66    
ref|XP_009338099.1|  PREDICTED: transcription factor MYB39-like         228   7e-66    
ref|XP_011031021.1|  PREDICTED: myb-related protein 308-like            228   7e-66    
ref|XP_006594633.1|  PREDICTED: protein ODORANT1                        229   7e-66    
ref|XP_006352596.1|  PREDICTED: protein ODORANT1-like                   227   8e-66    
ref|XP_003520138.1|  PREDICTED: transcription factor MYB39-like         227   8e-66    
dbj|BAC75672.1|  transcription factor MYB102                            228   8e-66    
ref|XP_006397419.1|  hypothetical protein EUTSA_v10001820mg             228   8e-66    
ref|XP_002444838.1|  hypothetical protein SORBIDRAFT_07g028990          227   8e-66    
ref|XP_010057758.1|  PREDICTED: transcription factor MYB3-like          228   8e-66    
ref|XP_011022802.1|  PREDICTED: myb-related protein 308-like            228   8e-66    
ref|XP_006364874.1|  PREDICTED: transcription factor MYB39-like         228   8e-66    
ref|XP_004239393.1|  PREDICTED: transcription factor MYB51-like         228   9e-66    
ref|XP_011004803.1|  PREDICTED: transcription factor MYB39-like         228   9e-66    
ref|XP_010267736.1|  PREDICTED: transcription factor MYB39-like         228   1e-65    
ref|XP_010057723.1|  PREDICTED: transcription factor MYB3-like          228   1e-65    
ref|NP_174726.1|  myb domain protein 93                                 228   1e-65    
ref|XP_010461279.1|  PREDICTED: transcription factor MYB39-like         228   1e-65    
ref|XP_004143558.1|  PREDICTED: transcription factor MYB39-like         228   1e-65    
ref|XP_004238528.1|  PREDICTED: transcription factor MYB39              228   1e-65    
ref|XP_011043314.1|  PREDICTED: protein ODORANT1-like                   228   1e-65    
ref|XP_004301783.1|  PREDICTED: transcription factor MYB39-like         227   1e-65    
ref|XP_008679513.1|  PREDICTED: myb-related protein Zm38-like           225   1e-65    
ref|XP_010926300.1|  PREDICTED: transcription factor MYB39-like         226   1e-65    
ref|XP_010478913.1|  PREDICTED: transcription factor MYB39-like         228   1e-65    
ref|XP_009778686.1|  PREDICTED: transcription factor MYB39-like         227   1e-65    
ref|XP_008786382.1|  PREDICTED: transcription factor MYB39-like         223   1e-65    
emb|CDY47094.1|  BnaC03g64160D                                          227   1e-65    
ref|XP_009406494.1|  PREDICTED: transcription factor MYB39-like         228   1e-65    
gb|AFW65120.1|  putative MYB DNA-binding domain superfamily protein     223   1e-65    
ref|XP_010319449.1|  PREDICTED: transcription factor MYB108-like        227   2e-65    
ref|XP_009617932.1|  PREDICTED: transcription factor MYB39-like         227   2e-65    
ref|XP_010087606.1|  Transcription factor                               227   2e-65    



>ref|XP_004229941.1| PREDICTED: myb-related protein Zm38-like [Solanum lycopersicum]
Length=309

 Score =   456 bits (1174),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 242/310 (78%), Positives = 269/310 (87%), Gaps = 1/310 (0%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCCDK GL +GPWTPEEDEKL+ FI KNG GSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRTPCCDKNGLTRGPWTPEEDEKLVQFINKNGHGSWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDI RGPFS EE+KLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG
Sbjct  61    LRPDIIRGPFSPEEQKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             IDPQTHE  S+  G  RR  T+PSARH+AQWESARLEAEARLSRES+ LVPS++G SE D
Sbjct  121   IDPQTHEQYSDPNGLLRRPATSPSARHLAQWESARLEAEARLSRESQFLVPSSVGRSETD  180

Query  874   FFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAGG  1053
             +FLRIWNSEIGE+FRKFKKG K ACQSP SQAS+ TKYGSASG TTE ++ +AGS   G 
Sbjct  181   YFLRIWNSEIGESFRKFKKGEKNACQSPTSQASTCTKYGSASGITTEFELGVAGSPVTGS  240

Query  1054  NPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFLGHTDTYS  1233
             N +E  E K  + YT+D LQGS+TS S+ +EDSSESALQLLLDFP+ NDMSFLGH+D+YS
Sbjct  241   NQHEYKEWKIGQPYTEDFLQGSDTSSSNAMEDSSESALQLLLDFPSNNDMSFLGHSDSYS  300

Query  1234  IYPAFLTEST  1263
             +YP FL+ES+
Sbjct  301   LYP-FLSESS  309



>ref|XP_006339543.1| PREDICTED: myb-related protein Zm38-like [Solanum tuberosum]
Length=309

 Score =   456 bits (1174),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 243/310 (78%), Positives = 269/310 (87%), Gaps = 1/310 (0%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCCDK GL +GPWTPEEDEKLI FI KNG GSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRTPCCDKNGLTRGPWTPEEDEKLIQFINKNGHGSWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRP+I RGPFS EE+KLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG
Sbjct  61    LRPNIIRGPFSPEEQKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             IDPQTHE  S+  G  RR  T+PSARH+AQWESARLEAEARLSRES+ LVPS++G SE D
Sbjct  121   IDPQTHEQYSDPNGLLRRPATSPSARHLAQWESARLEAEARLSRESQFLVPSSVGRSETD  180

Query  874   FFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAGG  1053
             +FLRIWNSEIG++FRKFKKG K ACQSP SQASS TKYGSASG TTE+++ +AGS   G 
Sbjct  181   YFLRIWNSEIGDSFRKFKKGEKNACQSPASQASSCTKYGSASGITTEVELGVAGSPVTGS  240

Query  1054  NPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFLGHTDTYS  1233
             N NE  E K  + YT+D LQGS+TS S+ +EDSSESALQLLLDFP+ NDMSFLGH D+YS
Sbjct  241   NQNEYKEWKIGQPYTEDFLQGSDTSSSNAMEDSSESALQLLLDFPSNNDMSFLGHGDSYS  300

Query  1234  IYPAFLTEST  1263
             +YP FL+ES+
Sbjct  301   LYP-FLSESS  309



>ref|XP_004240108.1| PREDICTED: protein ODORANT1-like [Solanum lycopersicum]
Length=319

 Score =   448 bits (1152),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 230/320 (72%), Positives = 263/320 (82%), Gaps = 8/320 (3%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCCDKKGLKKGPWTPEEDEKL+++IK +G GSWRSLP LAGL RCGKSCRLRWTNY
Sbjct  1     MGRTPCCDKKGLKKGPWTPEEDEKLVEYIKNHGHGSWRSLPHLAGLARCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPFS +EEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG
Sbjct  61    LRPDIKRGPFSHDEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             +DPQTHEPSS   G     PT+ +ARHMAQWESARLEAEARLSRES+ LVPS++G S  D
Sbjct  121   VDPQTHEPSSAPNGQMITPPTSLAARHMAQWESARLEAEARLSRESQPLVPSSVGRSGTD  180

Query  874   FFLRIWNSEIGEAFRKF-KKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAG  1050
             +FLRIWNSE+GE+FRKF KK  +  C+SP SQASSSTK+GS SG TTEMD++ A      
Sbjct  181   YFLRIWNSEVGESFRKFNKKEGRTTCESPASQASSSTKFGSTSGVTTEMDVSFAAYQ---  237

Query  1051  GNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesal-qllldFPTYNDMSFLGHTDT  1227
                NE+ E K ++ YT+D LQG + + S    + S  +  QLLLDFP+ NDMSFLGH+DT
Sbjct  238   ---NEETEWKNSQPYTEDVLQGYDDTSSSSGLEDSSESALQLLLDFPSNNDMSFLGHSDT  294

Query  1228  YSIYPAFLTESTLNCSSAEH  1287
             YS+YP FL+ES+  CSSA+H
Sbjct  295   YSLYPEFLSESSFKCSSAQH  314



>ref|XP_009779196.1| PREDICTED: myb-related protein Zm38-like [Nicotiana sylvestris]
Length=298

 Score =   436 bits (1121),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 246/318 (77%), Positives = 265/318 (83%), Gaps = 25/318 (8%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCCDKKGLKKGPWTPEEDEKL+++IKK+G GSWR LP LAGLLRCGKSCRLRWTNY
Sbjct  1     MGRTPCCDKKGLKKGPWTPEEDEKLVEYIKKHGHGSWRCLPNLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPFS EEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRL SMG
Sbjct  61    LRPDIKRGPFSPEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLFSMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             IDP THEPS+   G  RRLPT+ SARHMAQWESARLEAEARLSRES+LLVPS+ G SE D
Sbjct  121   IDPLTHEPSN---GLLRRLPTSTSARHMAQWESARLEAEARLSRESQLLVPSSAGRSETD  177

Query  874   FFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAGG  1053
             +FLRIWNSEIGEAFRKFK   K  CQSP SQ SSS KYGSASG TTEMD+TLA       
Sbjct  178   YFLRIWNSEIGEAFRKFKTEDK--CQSPASQVSSSAKYGSASGITTEMDLTLA-------  228

Query  1054  NPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFLGHTDTYS  1233
                ED E K ++ YT+D LQGS+TS S ELEDSSESALQLLLDFP+ NDMSFLG      
Sbjct  229   ---EDIEWKDSQPYTEDILQGSDTSSSSELEDSSESALQLLLDFPSSNDMSFLG------  279

Query  1234  IYPAFLTESTLNCSSAEH  1287
                 FL++S+LNCS A+H
Sbjct  280   ----FLSDSSLNCSLADH  293



>ref|XP_009629649.1| PREDICTED: transcription factor MYB28-like [Nicotiana tomentosiformis]
Length=298

 Score =   432 bits (1112),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 246/318 (77%), Positives = 262/318 (82%), Gaps = 25/318 (8%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCCDKKGLKKGPWTPEEDEKL+++IKK G GSWRSLP LAGLLRCGKSCRLRWTNY
Sbjct  1     MGRTPCCDKKGLKKGPWTPEEDEKLVEYIKKYGHGSWRSLPNLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPFS EEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRL SMG
Sbjct  61    LRPDIKRGPFSPEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLFSMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             IDP THEPS+   G  RR PT+ SARHMAQWESARLEAEARLSRES+LLVPS+ G SE D
Sbjct  121   IDPLTHEPSN---GLLRRPPTSTSARHMAQWESARLEAEARLSRESQLLVPSSAGRSETD  177

Query  874   FFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAGG  1053
             +FLRIWNSEIGEAFRKFK   K  C SP SQ SSSTKYGSASG TTEMD+TL        
Sbjct  178   YFLRIWNSEIGEAFRKFKNEDK--CLSPASQVSSSTKYGSASGITTEMDLTLV-------  228

Query  1054  NPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFLGHTDTYS  1233
                ED E K ++ YT+D  QGS+TS S ELEDSSESALQLLLDFP+ NDMSFLG      
Sbjct  229   ---EDTEWKDSQPYTEDIFQGSDTSSSSELEDSSESALQLLLDFPSNNDMSFLG------  279

Query  1234  IYPAFLTESTLNCSSAEH  1287
                 FL+ES+LNCS AEH
Sbjct  280   ----FLSESSLNCSLAEH  293



>ref|XP_009794055.1| PREDICTED: protein ODORANT1-like [Nicotiana sylvestris]
Length=323

 Score =   427 bits (1099),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 243/319 (76%), Positives = 269/319 (84%), Gaps = 2/319 (1%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCDK G+KKGPWTPEEDEKLI+FIKKNG GSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRIPCCDKNGMKKGPWTPEEDEKLIEFIKKNGHGSWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPFS +E+KLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKK LLSMG
Sbjct  61    LRPDIKRGPFSLDEQKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKHLLSMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             IDP THEPSS S G  RR PT+ SARHMAQWESARLEAEARLSRES+LLVPS++  S+ D
Sbjct  121   IDPDTHEPSSASNGLLRRPPTSTSARHMAQWESARLEAEARLSRESQLLVPSSVERSDTD  180

Query  874   FFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDI-TLAGSADAG  1050
              FLR+WNSEIGE FRKFK   K   QSP SQASS TKYGSASG TTE+++  + GS   G
Sbjct  181   HFLRMWNSEIGETFRKFKNREKTDSQSPASQASSCTKYGSASGITTEVELGVVDGSPVTG  240

Query  1051  GNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFLGHTDTY  1230
              N NE  E K  + +T++ LQGSETS  + LEDSSESALQLLLDFP+ ND+SFLGH+D+ 
Sbjct  241   SNLNEYTEWKNGQPHTEEILQGSETSSCNALEDSSESALQLLLDFPSNNDLSFLGHSDSC  300

Query  1231  SIYPAFLTESTLNCSSAEH  1287
             S+YP FL+ES+L C  AEH
Sbjct  301   SMYP-FLSESSLICPKAEH  318



>ref|XP_006345595.1| PREDICTED: protein ODORANT1-like [Solanum tuberosum]
Length=319

 Score =   427 bits (1097),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 228/320 (71%), Positives = 259/320 (81%), Gaps = 8/320 (3%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCC+KKGLKKGPWTPEEDEKL+++IK +G GSWRSLP LAGL RCGKSCRLRWTNY
Sbjct  1     MGRTPCCEKKGLKKGPWTPEEDEKLVEYIKNHGHGSWRSLPHLAGLARCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPFS +EEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG
Sbjct  61    LRPDIKRGPFSHDEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             +DPQTHEPSS   G     PT+ +ARHMAQWESARLEAEARLSRES+ LVPS++G S  D
Sbjct  121   VDPQTHEPSSAPNGLMITPPTSLAARHMAQWESARLEAEARLSRESQPLVPSSVGRSGTD  180

Query  874   FFLRIWNSEIGEAFRKF-KKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAG  1050
             +FLRIWNSE+GEAFRK  KK  +  C+S  SQASSSTK+GS SG TTEMD++ A      
Sbjct  181   YFLRIWNSEVGEAFRKLNKKEGRTTCESSASQASSSTKFGSTSGVTTEMDVSFAAYQ---  237

Query  1051  GNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesal-qllldFPTYNDMSFLGHTDT  1227
                NED E K ++ YT+D LQG + + S    + S  +  QLLLDFP+ NDMSFL H+DT
Sbjct  238   ---NEDTEWKNSQPYTEDVLQGYDDTSSSSGLEDSSESALQLLLDFPSNNDMSFLEHSDT  294

Query  1228  YSIYPAFLTESTLNCSSAEH  1287
             YS+YP FL+E +  CSSAEH
Sbjct  295   YSLYPEFLSERSFKCSSAEH  314



>ref|XP_009587317.1| PREDICTED: myb-related protein Zm38-like [Nicotiana tomentosiformis]
Length=314

 Score =   417 bits (1072),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 236/305 (77%), Positives = 257/305 (84%), Gaps = 1/305 (0%)
 Frame = +1

Query  331   GMGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTN  510
             GMGR PCCDK GLKKGPWTPEEDEKLI FIKKNG GSWRSLPKLAGLLRCGKSCRLRWTN
Sbjct  7     GMGRIPCCDKNGLKKGPWTPEEDEKLIQFIKKNGHGSWRSLPKLAGLLRCGKSCRLRWTN  66

Query  511   YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
             YLRPDIKRGPFS +E+KLVIQLHG LGNRWAAIASQLPGRTDNEIKNLWNTHLKK LLSM
Sbjct  67    YLRPDIKRGPFSLDEQKLVIQLHGFLGNRWAAIASQLPGRTDNEIKNLWNTHLKKHLLSM  126

Query  691   GIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEA  870
             GIDP THEPSS S G  RR PT+ SARHMAQWESARLEAEARLSRES+LLVPS++  S+ 
Sbjct  127   GIDPDTHEPSSASNGLLRRPPTSTSARHMAQWESARLEAEARLSRESQLLVPSSVERSDT  186

Query  871   DFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDI-TLAGSADA  1047
             D FLR+WNSEIGE FRKFK   K   QS  SQASS TKYGSASG TTE+++  +AGS   
Sbjct  187   DHFLRMWNSEIGETFRKFKNREKTDSQSRASQASSCTKYGSASGITTEVELGGVAGSPVT  246

Query  1048  GGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFLGHTDT  1227
             G N NE  E K  + +T+D LQGSETS  + LEDSSESALQLLLDFP+ ND+SFLGH+D+
Sbjct  247   GSNQNEYTEWKNGQPHTEDILQGSETSSCNALEDSSESALQLLLDFPSNNDLSFLGHSDS  306

Query  1228  YSIYP  1242
              S+YP
Sbjct  307   CSMYP  311



>ref|XP_006445088.1| hypothetical protein CICLE_v10021268mg [Citrus clementina]
 ref|XP_006491064.1| PREDICTED: transcription repressor MYB6-like [Citrus sinensis]
 gb|ESR58328.1| hypothetical protein CICLE_v10021268mg [Citrus clementina]
 gb|KDO86094.1| hypothetical protein CISIN_1g021486mg [Citrus sinensis]
Length=312

 Score =   417 bits (1071),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 224/313 (72%), Positives = 255/313 (81%), Gaps = 3/313 (1%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCCDKKGLKKGPW PEEDE L+++IK+NG GSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRTPCCDKKGLKKGPWAPEEDEILVEYIKRNGHGSWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ EEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKR+L MG
Sbjct  61    LRPDIKRGPFTEEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRMLLMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             +DPQTHEP S S GP  + P TP+ RHMAQWESARLEAEARLSRES L    ++G +++D
Sbjct  121   LDPQTHEPFSSS-GPAIKAPATPTTRHMAQWESARLEAEARLSRESLLFNTPSMGKTDSD  179

Query  874   FFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAGG  1053
              FLR+WNSE+GE+FRKF KGVK ACQSP SQ SSSTK GS S  +TE+   LAGS+    
Sbjct  180   HFLRMWNSEVGESFRKFNKGVKTACQSPNSQVSSSTKCGSVSAVSTEIGHNLAGSSATPS  239

Query  1054  NPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFLGHTDTYS  1233
             N NED E K ++S T+D + GS+TS S++L+DSS+S+LQLLLDFP  NDMSFL   D Y 
Sbjct  240   NQNEDTECKSSKSCTEDMVAGSDTSSSNDLQDSSDSSLQLLLDFPINNDMSFL--EDNYF  297

Query  1234  IYPAFLTESTLNC  1272
                A  T  +L C
Sbjct  298   ASSAMFTGDSLIC  310



>ref|XP_007051856.1| Myb domain protein 17 isoform 1 [Theobroma cacao]
 gb|EOX96013.1| Myb domain protein 17 isoform 1 [Theobroma cacao]
Length=320

 Score =   409 bits (1051),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 216/311 (69%), Positives = 252/311 (81%), Gaps = 1/311 (0%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCCD+KGLKKGPW PEEDE L+++IKK+G GSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRTPCCDRKGLKKGPWAPEEDEILVNYIKKHGHGSWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ EEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRL+ MG
Sbjct  61    LRPDIKRGPFTLEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLVCMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             +DPQTHEP +   GP    PT+P+ RHMAQWESARLEAEARLSRES L     +G  ++D
Sbjct  121   LDPQTHEPFT-PCGPTTAAPTSPATRHMAQWESARLEAEARLSRESLLFSSPPLGKPDSD  179

Query  874   FFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAGG  1053
             +FLR+WNSE+GE+FRK  +  K ACQSPISQASSSTK GS S  T ++   +AGS+    
Sbjct  180   YFLRLWNSEVGESFRKLNREDKTACQSPISQASSSTKCGSVSAVTIDICPNIAGSSTPAS  239

Query  1054  NPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFLGHTDTYS  1233
             N  ED   K  +S T+DP+  S++SCS+E EDSS++ALQLLLDFP  NDMSFL + DTY+
Sbjct  240   NQIEDTACKSFKSCTEDPVDASDSSCSNESEDSSDTALQLLLDFPINNDMSFLENVDTYA  299

Query  1234  IYPAFLTESTL  1266
                A LT+++ 
Sbjct  300   TSHAMLTDTSF  310



>ref|XP_002320117.1| hypothetical protein POPTR_0014s07700g [Populus trichocarpa]
 gb|EEE98432.1| hypothetical protein POPTR_0014s07700g [Populus trichocarpa]
Length=316

 Score =   399 bits (1026),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 215/313 (69%), Positives = 246/313 (79%), Gaps = 3/313 (1%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCCDK GLKKG WTPEEDE L+ +IKKNG GSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRTPCCDKNGLKKGAWTPEEDELLVSYIKKNGHGSWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKR PF+ EEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLL +G
Sbjct  61    LRPDIKRHPFTLEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLCLG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             +DPQTHEP + S GP  + P +P+ RHM QWESARLEAEARLSRES L +P   G  + D
Sbjct  121   LDPQTHEPFT-SRGPANKGPASPATRHMTQWESARLEAEARLSRESSLFLPPIPGKIDCD  179

Query  874   FFLRIWNSEIGEAFRKFKK-GVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAG  1050
             +FLRIWNSE+GE+FR+    G K AC SP+SQASSSTK GS S  T ++   LAGS+ A 
Sbjct  180   YFLRIWNSEVGESFRRINMGGAKTACPSPVSQASSSTKCGSISAITADISPNLAGSSAAA  239

Query  1051  GNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFL-GHTDT  1227
              N NED E K  RS  +D + G ++S S E EDS++S LQLLLDFP  NDMSFL G+ D+
Sbjct  240   SNQNEDMECKSCRSDAEDVMAGPDSSSSAESEDSTDSTLQLLLDFPINNDMSFLEGNIDS  299

Query  1228  YSIYPAFLTESTL  1266
             Y+     LT +++
Sbjct  300   YATSSGMLTGTSM  312



>ref|XP_011035902.1| PREDICTED: transcription repressor MYB6-like [Populus euphratica]
Length=316

 Score =   397 bits (1021),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 214/313 (68%), Positives = 245/313 (78%), Gaps = 3/313 (1%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCCDK GLKKG WTPEEDE L+ +IKKNG GSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRTPCCDKNGLKKGAWTPEEDELLVSYIKKNGHGSWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKR PF+ EEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLL +G
Sbjct  61    LRPDIKRHPFTLEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLCLG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             +DPQTHEP + S GP  + P +P+ RHM QWESARLEAEARLSRES L +P   G  + D
Sbjct  121   LDPQTHEPFT-SRGPANKGPASPATRHMTQWESARLEAEARLSRESSLFLPPIPGKIDCD  179

Query  874   FFLRIWNSEIGEAFRKFKK-GVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAG  1050
             +FLRIWNSE+GE+FR+    G K AC SP+SQASSSTK GS S  T ++   L GS+ A 
Sbjct  180   YFLRIWNSEVGESFRRISMGGAKTACPSPVSQASSSTKCGSISAITADISPNLTGSSAAA  239

Query  1051  GNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFL-GHTDT  1227
              N NED E K  RS  +D + G ++S S E EDS++S LQLLLDFP  NDMSFL G+ D+
Sbjct  240   SNQNEDMECKSCRSDAEDVMAGPDSSSSAESEDSTDSTLQLLLDFPINNDMSFLEGNIDS  299

Query  1228  YSIYPAFLTESTL  1266
             Y+     LT +++
Sbjct  300   YATSSGMLTGTSM  312



>ref|XP_011023364.1| PREDICTED: transcription repressor MYB6-like isoform X1 [Populus 
euphratica]
Length=310

 Score =   395 bits (1014),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 217/309 (70%), Positives = 241/309 (78%), Gaps = 4/309 (1%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCCDKKGLKKGPWTPEEDE L+ +IKKNG GSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRTPCCDKKGLKKGPWTPEEDELLVTYIKKNGHGSWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRG F+ EEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLL +G
Sbjct  61    LRPDIKRGAFTLEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLCLG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             IDPQTHEP S S GP  + P +P+ RHMAQWESARLEAE RLSRES L +P  +   + D
Sbjct  121   IDPQTHEPFS-SRGPVIKGPASPATRHMAQWESARLEAEKRLSRESSLFLPPMVEKIDCD  179

Query  874   FFLRIWNSEIGEAFRKFKKG-VKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAG  1050
              FLRIWNSE+GE+FR+   G  K ACQSP+SQASSSTK GS S  T ++   L+ S    
Sbjct  180   HFLRIWNSEVGESFRRINMGDNKTACQSPVSQASSSTKCGSISAITADIIPNLSRSPATA  239

Query  1051  GNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFLG-HTDT  1227
              N NED E K  +SY +D L G   S S ELED ++S LQLLLDFP  NDMSFL  + D+
Sbjct  240   SNQNEDMEWKSPKSYAEDVLAG-SDSSSAELEDLTDSTLQLLLDFPINNDMSFLDKNIDS  298

Query  1228  YSIYPAFLT  1254
             Y+   A LT
Sbjct  299   YATSSAMLT  307



>emb|CDP08839.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   392 bits (1007),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 222/306 (73%), Positives = 249/306 (81%), Gaps = 2/306 (1%)
 Frame = +1

Query  334   MGRTPCCDKK-GLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTN  510
             MGR PCCDK+ GLKKGPWTPEEDEKLI++I KNG GSWRSLP+ AGLLRCGKSCRLRWTN
Sbjct  1     MGRAPCCDKRMGLKKGPWTPEEDEKLIEYINKNGHGSWRSLPRNAGLLRCGKSCRLRWTN  60

Query  511   YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
             YLRPDIKRGPFS +EEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRL+ +
Sbjct  61    YLRPDIKRGPFSPDEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLICL  120

Query  691   GIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEA  870
             GIDPQTHEP S   G  +RLP +PS RHMAQWESARLEAEARLS+ES L VPS+ G S++
Sbjct  121   GIDPQTHEPCSNLSGLLQRLPASPSTRHMAQWESARLEAEARLSKESLLFVPSSTGKSDS  180

Query  871   DFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGS-ASGTTTEMDITLAGSADA  1047
             D  LRIWNSE+GEAFR F K  K AC+S ISQASSSTK GS ASGT  E  + LAG + A
Sbjct  181   DHILRIWNSEVGEAFRNFNKSQKIACESSISQASSSTKCGSAASGTIAERSLCLAGPSVA  240

Query  1048  GGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFLGHTDT  1227
             G N  ED + + +RS  +D    S+++ S++LEDSSES LQLLLDFP  NDMSFL  TD 
Sbjct  241   GVNQIEDTKCQSSRSAFEDIPPRSDSASSNDLEDSSESTLQLLLDFPGTNDMSFLATTDD  300

Query  1228  YSIYPA  1245
             Y +Y A
Sbjct  301   YMMYSA  306



>ref|XP_011093150.1| PREDICTED: transcription factor MYB3 isoform X2 [Sesamum indicum]
Length=307

 Score =   386 bits (991),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 216/314 (69%), Positives = 246/314 (78%), Gaps = 9/314 (3%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCDKKGLKKGPWTPEEDEKL+++I KNG GSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRKPCCDKKGLKKGPWTPEEDEKLVEYINKNGHGSWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ EEEKLVIQLH ILGNRWAAIASQLPGRTDNEIKNLWNTHLKK+LL MG
Sbjct  61    LRPDIKRGPFTVEEEKLVIQLHSILGNRWAAIASQLPGRTDNEIKNLWNTHLKKQLLQMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGG-SEA  870
             IDPQTH+PSS + GP   L ++ S  HM QWESARLEAE RLSR+S LL+P + G  SEA
Sbjct  121   IDPQTHKPSSTAKGPLNCLLSSLSTCHMTQWESARLEAEVRLSRQSLLLIPQSAGNKSEA  180

Query  871   DFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAG  1050
             DFFL++WNS++GE FRK  K  +    S    +SSSTKY   SGT TEM +  AGS    
Sbjct  181   DFFLQLWNSDVGETFRKLDK--RENATSQSPISSSSTKYDKLSGTVTEMALLAAGS----  234

Query  1051  GNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFLGHTDT-  1227
              N N+D E K  +S  +D   GS++S S+E+EDSSES LQLLL+FP+ +DMS LG TD  
Sbjct  235   -NLNDDAECKSGKSCVEDGRPGSDSSSSNEMEDSSESELQLLLNFPSNDDMSLLGQTDCY  293

Query  1228  YSIYPAFLTESTLN  1269
             YS+YP   TEST N
Sbjct  294   YSLYPGIFTESTFN  307



>ref|XP_011093149.1| PREDICTED: transcription factor MYB3 isoform X1 [Sesamum indicum]
Length=342

 Score =   386 bits (991),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 216/314 (69%), Positives = 246/314 (78%), Gaps = 9/314 (3%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCDKKGLKKGPWTPEEDEKL+++I KNG GSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  36    MGRKPCCDKKGLKKGPWTPEEDEKLVEYINKNGHGSWRSLPKLAGLLRCGKSCRLRWTNY  95

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ EEEKLVIQLH ILGNRWAAIASQLPGRTDNEIKNLWNTHLKK+LL MG
Sbjct  96    LRPDIKRGPFTVEEEKLVIQLHSILGNRWAAIASQLPGRTDNEIKNLWNTHLKKQLLQMG  155

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGG-SEA  870
             IDPQTH+PSS + GP   L ++ S  HM QWESARLEAE RLSR+S LL+P + G  SEA
Sbjct  156   IDPQTHKPSSTAKGPLNCLLSSLSTCHMTQWESARLEAEVRLSRQSLLLIPQSAGNKSEA  215

Query  871   DFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAG  1050
             DFFL++WNS++GE FRK  K  +    S    +SSSTKY   SGT TEM +  AGS    
Sbjct  216   DFFLQLWNSDVGETFRKLDK--RENATSQSPISSSSTKYDKLSGTVTEMALLAAGS----  269

Query  1051  GNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFLGHTDT-  1227
              N N+D E K  +S  +D   GS++S S+E+EDSSES LQLLL+FP+ +DMS LG TD  
Sbjct  270   -NLNDDAECKSGKSCVEDGRPGSDSSSSNEMEDSSESELQLLLNFPSNDDMSLLGQTDCY  328

Query  1228  YSIYPAFLTESTLN  1269
             YS+YP   TEST N
Sbjct  329   YSLYPGIFTESTFN  342



>ref|XP_011091956.1| PREDICTED: myb-related protein Zm38-like [Sesamum indicum]
Length=304

 Score =   384 bits (987),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 216/325 (66%), Positives = 242/325 (74%), Gaps = 34/325 (10%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCDKKGLKKGPWTPEEDEKL+++I KNG GSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRAPCCDKKGLKKGPWTPEEDEKLVEYINKNGHGSWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ +EEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLL MG
Sbjct  61    LRPDIKRGPFTPDEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLLMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPST---IGGS  864
             IDPQTHEPS    GP  RLP++PS RHMAQWESARLEAEARLSRES LL+PS+   +G  
Sbjct  121   IDPQTHEPSPVPNGPLNRLPSSPSTRHMAQWESARLEAEARLSRESLLLIPSSASPLGKP  180

Query  865   EADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSAD  1044
             + D+FLR+WNSE+GE FR    G K   QSP+S +S      S SGTTTE+++  A S+ 
Sbjct  181   DTDYFLRLWNSEVGETFRNLSNGEKTDTQSPVSSSSKCG---SLSGTTTEIELIAADSSA  237

Query  1045  AGGNPNEDPEGK--CNR-------SYTDDPLQGsetscsdeledssesalqllldFPT-Y  1194
             A       PE K  CN        S + D L+            SSES LQLLLDFP+  
Sbjct  238   A-------PESKKPCNEYVQARMDSCSSDELED-----------SSESTLQLLLDFPSNN  279

Query  1195  NDMSFLGHTDTYSIYPAFLTESTLN  1269
             NDMSFLG TD YS+YP   T+S  +
Sbjct  280   NDMSFLGQTDCYSLYPGIYTDSHFD  304



>ref|XP_002270529.1| PREDICTED: myb-related protein 308 [Vitis vinifera]
 ref|XP_010661750.1| PREDICTED: myb-related protein 308 [Vitis vinifera]
 ref|XP_010661751.1| PREDICTED: myb-related protein 308 [Vitis vinifera]
 emb|CBI40325.3| unnamed protein product [Vitis vinifera]
Length=302

 Score =   383 bits (983),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 214/315 (68%), Positives = 247/315 (78%), Gaps = 20/315 (6%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCCDK+GLKKGPWTPEED+ L+D+I KNG GSWRSLPK AGLLRCGKSCRLRWTNY
Sbjct  1     MGRTPCCDKRGLKKGPWTPEEDQILVDYINKNGHGSWRSLPKNAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+++EEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLL MG
Sbjct  61    LRPDIKRGPFTTDEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLGMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL--LVPSTIG-GS  864
             +DPQTHEPS+ S GP  + P++PS RHMAQWESARLEAEARLSRES L    P  +G  +
Sbjct  121   LDPQTHEPSATSCGPIAKPPSSPSTRHMAQWESARLEAEARLSRESLLSNPPPPPLGRNN  180

Query  865   EADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSAD  1044
             ++D+FLR+WNSE+GE+FR   KG K  CQSP+SQASSSTK GS SG TT M+     S  
Sbjct  181   DSDYFLRLWNSEVGESFR--NKGQKPTCQSPVSQASSSTKCGSVSGVTT-METCPTVSNK  237

Query  1045  AGGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFL-GHT  1221
                 P              + + GS+ S ++ELEDSS++ALQLL DFP  NDMSFL G+ 
Sbjct  238   IEDTPQ-------------NAMAGSDCSSTNELEDSSDTALQLLFDFPVNNDMSFLEGNL  284

Query  1222  DTYSIYPAFLTESTL  1266
             DTY  +PA L+ES+ 
Sbjct  285   DTYPTFPAMLSESSF  299



>emb|CAN75438.1| hypothetical protein VITISV_000834 [Vitis vinifera]
Length=302

 Score =   383 bits (983),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 214/315 (68%), Positives = 247/315 (78%), Gaps = 20/315 (6%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCCDK+GLKKGPWTPEED+ L+D+I KNG GSWRSLPK AGLLRCGKSCRLRWTNY
Sbjct  1     MGRTPCCDKRGLKKGPWTPEEDQILVDYINKNGHGSWRSLPKNAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+++EEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLL MG
Sbjct  61    LRPDIKRGPFTTDEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLGMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL--LVPSTIG-GS  864
             +DPQTHEPS+ S GP  + P++PS RHMAQWESARLEAEARLSRES L    P  +G  +
Sbjct  121   LDPQTHEPSATSCGPIAKPPSSPSTRHMAQWESARLEAEARLSRESLLSNPPPPPLGRNN  180

Query  865   EADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSAD  1044
             ++D+FLR+WNSE+GE+FR   KG K  CQSP+SQASSSTK GS SG TT M+     S  
Sbjct  181   DSDYFLRLWNSEVGESFR--NKGQKPXCQSPVSQASSSTKCGSVSGVTT-METCPTVSNK  237

Query  1045  AGGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFL-GHT  1221
                 P              + + GS+ S ++ELEDSS++ALQLL DFP  NDMSFL G+ 
Sbjct  238   IEDTPQ-------------NAMAGSDCSSTNELEDSSDTALQLLFDFPVNNDMSFLEGNL  284

Query  1222  DTYSIYPAFLTESTL  1266
             DTY  +PA L+ES+ 
Sbjct  285   DTYPTFPAMLSESSF  299



>ref|XP_002511832.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF50501.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=308

 Score =   381 bits (978),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 216/303 (71%), Positives = 242/303 (80%), Gaps = 4/303 (1%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCCDKKGLKKGPWTPEEDE L+ +IKKNG GSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRTPCCDKKGLKKGPWTPEEDEVLVSYIKKNGHGSWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ EEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLL MG
Sbjct  61    LRPDIKRGPFTLEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLCMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             +DPQTHEP + S GP    P +P+ RHMAQWESARLEAEARLSRES L  P T   ++ D
Sbjct  121   LDPQTHEPFT-SCGPYITAPASPATRHMAQWESARLEAEARLSRESSLFNPPTPKKTDCD  179

Query  874   FFLRIWNSEIGEAFRKFKKGVKFAC--QSPISQASSSTKYGSASG-TTTEMDITLAGSAD  1044
             +FLRIWNSE+GE+FRKF +G K +C   +  SQASSSTKYGS S  TT ++   +AGS+ 
Sbjct  180   YFLRIWNSEVGESFRKFHRGDKASCQSPASASQASSSTKYGSVSALTTVDISPNIAGSST  239

Query  1045  AGGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFLGHTD  1224
                +  ED E K  +SY +D   GS++S S ELEDSS+S LQLLLDFP  NDMSFL    
Sbjct  240   PPSDQIEDTECKSCKSYVEDMNAGSDSSSSIELEDSSDSTLQLLLDFPINNDMSFLEGNS  299

Query  1225  TYS  1233
              +S
Sbjct  300   YFS  302



>gb|KDP28653.1| hypothetical protein JCGZ_14424 [Jatropha curcas]
 gb|AIT52301.1| MYB family protein [Jatropha curcas]
Length=303

 Score =   372 bits (956),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 213/306 (70%), Positives = 241/306 (79%), Gaps = 6/306 (2%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCCDKKGLKKGPWTPEEDE L+++IKKNG GSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRTPCCDKKGLKKGPWTPEEDEILVEYIKKNGHGSWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ EEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRL+ MG
Sbjct  61    LRPDIKRGPFTLEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLVCMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             +DP THEP + S GP  + P +P+ RHM QWESARLEAEARLSRES L  P T G +++D
Sbjct  121   LDPLTHEPFTSS-GPVIKAPASPATRHMTQWESARLEAEARLSRESSLFNPPTPGKTDSD  179

Query  874   FFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAGG  1053
             +FLR+WNSE+GE FRKF +  K    +  SQASSSTK GS S    ++   LAGS+    
Sbjct  180   YFLRMWNSEVGEQFRKFNREDKSP-AASASQASSSTKCGSVS---VDISPNLAGSSTTAS  235

Query  1054  NPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFL-GHTDTY  1230
             N  ED E K  +SY +D   GS++S S ELEDSS+S LQLLLDFP  NDMSFL G  D+Y
Sbjct  236   NQIEDMECKSCKSYAEDMNAGSDSSSSIELEDSSDSTLQLLLDFPINNDMSFLEGDIDSY  295

Query  1231  SIYPAF  1248
             +   A 
Sbjct  296   ATTSAM  301



>ref|XP_010273102.1| PREDICTED: myb-related protein 308-like [Nelumbo nucifera]
 ref|XP_010273103.1| PREDICTED: myb-related protein 308-like [Nelumbo nucifera]
 ref|XP_010273105.1| PREDICTED: myb-related protein 308-like [Nelumbo nucifera]
 ref|XP_010273106.1| PREDICTED: myb-related protein 308-like [Nelumbo nucifera]
Length=315

 Score =   369 bits (948),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 203/314 (65%), Positives = 235/314 (75%), Gaps = 4/314 (1%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCDK+GLKKGPWTPEEDE L+++IKKNG GSWRSLP  AGL RCGKSCRLRWTNY
Sbjct  1     MGRAPCCDKQGLKKGPWTPEEDEILVEYIKKNGHGSWRSLPNHAGLFRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ +EEK++IQLHGILGNRWAAIASQLPGRTDNEIKN WNT LKKRLL MG
Sbjct  61    LRPDIKRGPFTPDEEKIIIQLHGILGNRWAAIASQLPGRTDNEIKNFWNTQLKKRLLCMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGG-SEA  870
             +DPQTH PS  S GP     T+PS RHMAQWESARLEAEARLSRES L         +E 
Sbjct  121   LDPQTHTPSFPSCGPVATPSTSPSTRHMAQWESARLEAEARLSRESLLSNLQLSSTKAEV  180

Query  871   DFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAG  1050
             D+FLRIWNSE+GE+FR+       ACQSPISQ SSSTK+GS SG TTE+   + G     
Sbjct  181   DYFLRIWNSEVGESFRRLSGPDSTACQSPISQVSSSTKWGSGSGLTTEVAPAMTGRLTT-  239

Query  1051  GNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFL-GHTDT  1227
              +  E+ E K ++   DD   GS+ S S+E+ DSS+++LQLLLDFP  +DM F  G  D 
Sbjct  240   -DQPEEVECKNSKGGVDDLAAGSDCSISNEVNDSSDTSLQLLLDFPASDDMGFFQGQMDN  298

Query  1228  YSIYPAFLTESTLN  1269
             +S+ P  L E + N
Sbjct  299   FSLLPNLLDECSFN  312



>ref|XP_010053687.1| PREDICTED: myb-related protein 308 [Eucalyptus grandis]
 gb|KCW78047.1| hypothetical protein EUGRSUZ_D02271 [Eucalyptus grandis]
Length=303

 Score =   364 bits (935),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 201/301 (67%), Positives = 232/301 (77%), Gaps = 5/301 (2%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCCDKK LKKGPWTPEEDE L+++I++NG GSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRTPCCDKKDLKKGPWTPEEDEILVEYIRQNGHGSWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ EEEKLVIQLHGILGNRWAAIA+QLPGRTDNEIKNLWNTHLKKRLL MG
Sbjct  61    LRPDIKRGPFTPEEEKLVIQLHGILGNRWAAIAAQLPGRTDNEIKNLWNTHLKKRLLCMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             +DPQTHEP   + GP    P +   RHMAQWESARLEAEARLSRES L  P  +  ++AD
Sbjct  121   LDPQTHEPFL-TRGPMTNSPASTVTRHMAQWESARLEAEARLSRESNLFNPLPLQKADAD  179

Query  874   FFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAGG  1053
              FLR+WNSE+GE+FRK    +    +SP+S ASS  K  S S  + EM  +L GSA    
Sbjct  180   HFLRLWNSEVGESFRKINMEMG---RSPVSPASSCAKCESNSAISAEMGPSLGGSAAVTN  236

Query  1054  NPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFL-GHTDTY  1230
             + +ED E +  +SY      G+E+S S  LEDSS++ALQLLLDFP  ND+SFL G  D Y
Sbjct  237   DGDEDKECETYKSYFQQMAAGTESSGSSALEDSSDTALQLLLDFPINNDISFLGGDIDQY  296

Query  1231  S  1233
             +
Sbjct  297   A  297



>ref|XP_010255443.1| PREDICTED: transcription factor MYB3-like [Nelumbo nucifera]
Length=314

 Score =   365 bits (936),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 204/314 (65%), Positives = 238/314 (76%), Gaps = 5/314 (2%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCDK+GLKKGPW+PEEDE L+++IKK+G GSWRSLPK AGLLRCGKSCRLRWTNY
Sbjct  1     MGRAPCCDKQGLKKGPWSPEEDEILVEYIKKHGHGSWRSLPKHAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+  EEK +IQLHGILGNRWAAIASQLPGRTDNEIKN WNTHLKKRLLSMG
Sbjct  61    LRPDIKRGPFTHSEEKTIIQLHGILGNRWAAIASQLPGRTDNEIKNFWNTHLKKRLLSMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL-VPSTIGGSEA  870
             +DPQTH P + S G       +PS RHMAQWESARLEAEARLSRES L   PS+   S+ 
Sbjct  121   LDPQTHAPPALSSGLIVTPSASPSTRHMAQWESARLEAEARLSRESLLSNHPSSSKKSDT  180

Query  871   DFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAG  1050
             D+FLR+WNSEIGE+FR+       ACQSP+SQASSSTK+G  SG TTE+       A   
Sbjct  181   DYFLRMWNSEIGESFRRVNGRESLACQSPMSQASSSTKWG--SGMTTEVVPAAMAVALTT  238

Query  1051  GNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFL-GHTDT  1227
               P     G  +RS  ++    S+ S S+EL++SSE++LQLLLDFP   DMSF  G   +
Sbjct  239   DQPERVQCGN-SRSDAEEVAARSDCSSSNELDESSETSLQLLLDFPASEDMSFFQGQMGS  297

Query  1228  YSIYPAFLTESTLN  1269
             +S+ P  L+ES+LN
Sbjct  298   FSLLPNMLSESSLN  311



>gb|AGN52064.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52174.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=296

 Score =   360 bits (925),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 198/321 (62%), Positives = 227/321 (71%), Gaps = 33/321 (10%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCC+KKGLKKGPWTPEED+KL+D+I K+G GSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRAPCCEKKGLKKGPWTPEEDDKLVDYIDKHGHGSWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ +EEKLVIQLH +LGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLL MG
Sbjct  61    LRPDIKRGPFTGDEEKLVIQLHAVLGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLLMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSE--  867
             IDP THEPSS S     R P+ PS RHMAQWE ARLEAEARLSRES L  P    GSE  
Sbjct  121   IDPGTHEPSS-SGALVSRPPSAPSTRHMAQWEGARLEAEARLSRESLLCFPPAAPGSEEG  179

Query  868   -ADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSAD  1044
               D FLR+WNSE+GE FR+    +K   +SP S  S+ST+  S SGTTTE+++ +A +  
Sbjct  180   GGDHFLRLWNSEVGETFRRMN--IKSQPRSPSS--SASTRCRSFSGTTTEIELKVADALA  235

Query  1045  AGGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFLGHTD  1224
                + NE  +       ++  LQ                   LLLD P  NDMSFLG  D
Sbjct  236   KSTSSNETEDS------SESTLQ-------------------LLLDLPNNNDMSFLGDPD  270

Query  1225  TYSIYPAFLTESTLNCSSAEH  1287
              Y++YP F T+S  + S  EH
Sbjct  271   CYTLYPDFSTDSLFHSSPQEH  291



>gb|KHG01165.1| Transcription factor MYB39 -like protein [Gossypium arboreum]
Length=295

 Score =   358 bits (919),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 202/301 (67%), Positives = 229/301 (76%), Gaps = 12/301 (4%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCC++KGLKKGPW PEEDE LI++I K+G GSWRSLPKLAGL RCGKSCRLRWTNY
Sbjct  1     MGRTPCCERKGLKKGPWGPEEDEILINYINKHGHGSWRSLPKLAGLRRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ +EEKLVIQLH ILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLL MG
Sbjct  61    LRPDIKRGPFTLDEEKLVIQLHAILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLCMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL-VPSTIGGSEA  870
             +DP THEP + S GP  R  ++P+ RHMAQWESARLEAEARLS+ S     P T    + 
Sbjct  121   VDPLTHEPVT-SGGPTTRPRSSPATRHMAQWESARLEAEARLSKGSLFFNSPPTSVKPDP  179

Query  871   DFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAG  1050
             DFFLR+WNSE+GE+FRK     K  C+SPISQASSSTK GS SG T ++    AGS+   
Sbjct  180   DFFLRLWNSEVGESFRKLNGEAKTDCRSPISQASSSTKCGSVSGVTVDVGPIAAGSSTPK  239

Query  1051  GNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFLGHTDTY  1230
              +  EDP               S +SCS+E EDSS++ALQLLLDFP  NDMSFL   DTY
Sbjct  240   SSRTEDPIM----------FDASFSSCSNESEDSSDTALQLLLDFPINNDMSFLEDVDTY  289

Query  1231  S  1233
             +
Sbjct  290   A  290



>ref|XP_008232794.1| PREDICTED: transcription factor MYB3 [Prunus mume]
Length=375

 Score =   360 bits (923),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 180/258 (70%), Positives = 204/258 (79%), Gaps = 3/258 (1%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKN-GQGSWRSLPKLAGLLRCGKSCRLRWTN  510
             MGR+PCCD +GLK+GPW+ EEDE L+++I KN G GSWRSLPKLAGLLRCGKSCRLRWTN
Sbjct  1     MGRSPCCDNRGLKRGPWSAEEDEALLNYINKNNGHGSWRSLPKLAGLLRCGKSCRLRWTN  60

Query  511   YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
             YLRPDIKRGPF+ +EEKL++QLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLL M
Sbjct  61    YLRPDIKRGPFTKDEEKLIMQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLLM  120

Query  691   GIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEA  870
             GIDPQTH+P  +S       P + + RHMAQWESARLEAEARLSRES L        SE 
Sbjct  121   GIDPQTHKP-VDSNCLTSTAPASLATRHMAQWESARLEAEARLSRESSLF-SQPPEKSEP  178

Query  871   DFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAG  1050
             D+FLR+WNSE+GEAFR      K AC SPISQASSSTK GS S  TTE+  TL GS+   
Sbjct  179   DYFLRLWNSEVGEAFRNLTTVDKSACPSPISQASSSTKCGSVSAVTTEVGNTLTGSSTMA  238

Query  1051  GNPNEDPEGKCNRSYTDD  1104
             G+ NED E K  ++ T+D
Sbjct  239   GDQNEDMEDKICQTNTED  256



>ref|XP_008353981.1| PREDICTED: myb-related protein Myb4-like [Malus domestica]
 gb|AAZ20433.1| MYB14 [Malus domestica]
Length=351

 Score =   356 bits (913),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 213/354 (60%), Positives = 249/354 (70%), Gaps = 46/354 (13%)
 Frame = +1

Query  334   MGRTPCCD-KKGLKKGPWTPEEDEKLIDFIKKN-GQGSWRSLPKLAGLLRCGKSCRLRWT  507
             MGRTPCCD KK LKKGPW+PEEDE L+++I KN G GSWRSLPKLAGL RCGKSCRLRWT
Sbjct  1     MGRTPCCDNKKDLKKGPWSPEEDELLLNYISKNHGHGSWRSLPKLAGLQRCGKSCRLRWT  60

Query  508   NYLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLS  687
             NYL+PDIKRGPFS +EEKL+IQLHG+LGNRWA IASQLPGRTDNEIKNLWNTHL+K L+S
Sbjct  61    NYLKPDIKRGPFSKDEEKLIIQLHGMLGNRWATIASQLPGRTDNEIKNLWNTHLRKGLVS  120

Query  688   MGIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL--VPSTIGG  861
             MGIDPQTHEP S +         + + RHMAQWESARLEAEARLSR+S L   VP     
Sbjct  121   MGIDPQTHEPLSSNC-LSNNASASAATRHMAQWESARLEAEARLSRDSSLFSRVPEK---  176

Query  862   SEADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSA  1041
             SE+D FLR+WNSE+G++FRK     KFACQSPISQASSSTK GS S  TTE+   L GS+
Sbjct  177   SESDHFLRLWNSEVGKSFRKLSTSDKFACQSPISQASSSTKCGSLSAVTTEVG-NLTGSS  235

Query  1042  DAGGNPNED------------------------------------PEGKCNRSYTDDPLQ  1113
                GN NED                                     E K  +S T+D + 
Sbjct  236   TMAGNHNEDLIYRPFLINTEDVEYKPFQFNTEEVGYKPFQSITEEVEFKICQSNTEDVMA  295

Query  1114  GsetscsdeledssesalqllldFPTYNDMSFL-GHTDTYSIYPAFLTESTLNC  1272
             GS +SCS++LEDSS++ALQLLLD+PT +DMSFL  + + Y+  PA LT ++  C
Sbjct  296   GSVSSCSNDLEDSSDTALQLLLDYPTNDDMSFLENNANDYATTPAELTPNSFIC  349



>gb|KHG09148.1| Transcription factor MYB28 -like protein [Gossypium arboreum]
Length=296

 Score =   353 bits (906),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 196/295 (66%), Positives = 223/295 (76%), Gaps = 4/295 (1%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCDKKGLKKGPW PEEDE L ++IKK+G G WRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRAPCCDKKGLKKGPWAPEEDEILTNYIKKHGHGGWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ EEEKLVIQLH ILGNRWAAIA+Q P RTDNEIKNLWNTHLKKRLL MG
Sbjct  61    LRPDIKRGPFTLEEEKLVIQLHAILGNRWAAIAAQFPRRTDNEIKNLWNTHLKKRLLCMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             +DPQTH+P +   GP    PT+P+ RHMAQWESARLEAEARLS+ES       I   ++D
Sbjct  121   LDPQTHKPFTPCGGPTVAAPTSPATRHMAQWESARLEAEARLSKESLQTNSPPIAKPDSD  180

Query  874   FFLRIWNSEIGEAFRKFKKGVK--FACQSPISQASSSTKYGSASGTTTEMDITLAGSADA  1047
              FLR+WNSE+GE+FRK     K  + C SPISQ SSS K GS S  T ++   +AGS + 
Sbjct  181   HFLRLWNSEVGESFRKINTEYKTVYPCPSPISQTSSSAKCGSVSAVTMDVCPNIAGSLNP  240

Query  1048  GGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFL  1212
               NP E+ E  C         + S++SCS E EDSS++ALQLLLDFP  NDMSFL
Sbjct  241   ASNPIEETE--CKSFIKSCIEERSDSSCSSESEDSSDTALQLLLDFPINNDMSFL  293



>ref|XP_007218142.1| hypothetical protein PRUPE_ppa007268mg [Prunus persica]
 gb|EMJ19341.1| hypothetical protein PRUPE_ppa007268mg [Prunus persica]
Length=375

 Score =   356 bits (913),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 177/258 (69%), Positives = 204/258 (79%), Gaps = 3/258 (1%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKN-GQGSWRSLPKLAGLLRCGKSCRLRWTN  510
             MGR+PCCD +GLK+GPW+ EEDE L+++I KN G GSWRSLPKLAGLLRCGKSCRLRWTN
Sbjct  1     MGRSPCCDNRGLKRGPWSAEEDEALLNYINKNNGHGSWRSLPKLAGLLRCGKSCRLRWTN  60

Query  511   YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
             YLRPDIKRGPF+ +EEKL++QLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLL M
Sbjct  61    YLRPDIKRGPFTKDEEKLIMQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLLM  120

Query  691   GIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEA  870
             GIDPQTH+P  +S       P + + RHMAQWESARLEAEARLSRES L        SE 
Sbjct  121   GIDPQTHKP-VDSNCLTSTAPASLATRHMAQWESARLEAEARLSRESSLF-SQPPEKSEP  178

Query  871   DFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAG  1050
             D+FLR+WNSE+GEAFR      K AC SP+SQASSSTK GS S  TTE+  TL GS+   
Sbjct  179   DYFLRLWNSEVGEAFRNLTTVDKSACPSPMSQASSSTKCGSVSAVTTEVGNTLTGSSTMA  238

Query  1051  GNPNEDPEGKCNRSYTDD  1104
             G+ N+D + K  ++ T+D
Sbjct  239   GDQNDDMDDKICQTNTED  256



>ref|XP_010523735.1| PREDICTED: transcription repressor MYB6 [Tarenaya hassleriana]
Length=300

 Score =   352 bits (903),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 186/319 (58%), Positives = 217/319 (68%), Gaps = 42/319 (13%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCCDKKGLKKGPWTPEEDE L+++IK NG GSWR+LPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRTPCCDKKGLKKGPWTPEEDEILVNYIKSNGHGSWRTLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ +EEKLVIQLH ILGNRWAAIA+QLPGRTDNEIKNLWNTHLKKRLL MG
Sbjct  61    LRPDIKRGPFTPDEEKLVIQLHAILGNRWAAIAAQLPGRTDNEIKNLWNTHLKKRLLCMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             +DPQTHEP + S G  ++ P +P  RHMAQWESARLEAEARLSRES L  PS  G S++D
Sbjct  121   LDPQTHEPIA-SFGAIKQAPASPMTRHMAQWESARLEAEARLSRESMLFTPSPAGKSDSD  179

Query  874   FFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGS--------------ASGTTT  1011
             +FLRIWNSEIGE+FR      + A  SP S+ASSS K  S              +S +  
Sbjct  180   YFLRIWNSEIGESFRNLACREESASLSPNSRASSSLKCESTRLSASNANEESCKSSKSCV  239

Query  1012  EMDITLAGSADAGGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPT  1191
             E ++ + GS  +  N  ED      +   D P+                          +
Sbjct  240   EEEMVVHGSDSSCSNELEDSSDSALQLLLDFPI--------------------------S  273

Query  1192  YNDMSFL-GHTDTYSIYPA  1245
             ++DMSFL  + D Y+  PA
Sbjct  274   HDDMSFLEENIDNYNESPA  292



>emb|CCA29116.1| putative MYB transcription factor [Rosa hybrid cultivar]
Length=329

 Score =   353 bits (905),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 193/307 (63%), Positives = 232/307 (76%), Gaps = 15/307 (5%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKN-GQGSWRSLPKLAGLLRCGKSCRLRWTN  510
             MGRTPCCDKKGLK+GPWTP+EDE L+++I KN G GSWR+LP  AGLLRCGKSCRLRWTN
Sbjct  1     MGRTPCCDKKGLKRGPWTPDEDEILVNYINKNKGHGSWRTLPHHAGLLRCGKSCRLRWTN  60

Query  511   YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
             YLRPDIKRGPF+ EEEKL+IQLHG+LGNRWAAIASQLPGRTDNEIKNLWNTHL+KRL+ M
Sbjct  61    YLRPDIKRGPFTDEEEKLIIQLHGMLGNRWAAIASQLPGRTDNEIKNLWNTHLRKRLIRM  120

Query  691   GIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEA  870
             G++PQ HEP + S G   +   + + RHMAQWESARLEAEARLSRES       +  S++
Sbjct  121   GVNPQNHEPFT-SDGSTSKASASIATRHMAQWESARLEAEARLSRESSNFSTPLLDKSDS  179

Query  871   DFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAG  1050
             D+FLR+W SE+GE+FRKF    K    SPIS+ASSS K GS S  TTE+   L GS+   
Sbjct  180   DYFLRLWYSEVGESFRKFPTAGKTPSDSPISEASSSGKCGSISAVTTEIGHCLMGSSTIA  239

Query  1051  GNPNEDPEGKCNRSYTDDPL-------------QGsetscsdeledssesalqllldFPT  1191
             GN +ED E K  +S T + +             +GS++S S++L+DSSESA+ LLLD+P 
Sbjct  240   GNQDEDIEYKVFKSITGEDMVYRIYKSNTENVTRGSDSSSSNKLDDSSESAMDLLLDYPI  299

Query  1192  YNDMSFL  1212
              NDMSFL
Sbjct  300   NNDMSFL  306



>ref|XP_008362620.1| PREDICTED: transcription factor MYB51-like [Malus domestica]
Length=351

 Score =   353 bits (907),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 213/354 (60%), Positives = 249/354 (70%), Gaps = 46/354 (13%)
 Frame = +1

Query  334   MGRTPCCD-KKGLKKGPWTPEEDEKLIDFIKKN-GQGSWRSLPKLAGLLRCGKSCRLRWT  507
             MGRTPCCD KK LKKGPW+PEEDE L+++I KN G GSWRSLPKLAGL RCGKSCRLRWT
Sbjct  1     MGRTPCCDNKKDLKKGPWSPEEDELLLNYISKNHGHGSWRSLPKLAGLQRCGKSCRLRWT  60

Query  508   NYLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLS  687
             NYL+PDIKRGPFS +EEKL+IQLHG+LGNRWA IASQLPGRTDNEIKNLWNTHL+K L+S
Sbjct  61    NYLKPDIKRGPFSKDEEKLIIQLHGMLGNRWATIASQLPGRTDNEIKNLWNTHLRKGLVS  120

Query  688   MGIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL--VPSTIGG  861
             MGIDPQTHEP S +         + + RHMAQWESARLEAEARLSR+S L   VP     
Sbjct  121   MGIDPQTHEPLSSNC-LSNXASASAATRHMAQWESARLEAEARLSRDSSLFSRVPEK---  176

Query  862   SEADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSA  1041
             SE+D FLR+WNSE+G++FRK     KFACQSPISQASSSTK GS S  TTE+   L GS+
Sbjct  177   SESDHFLRLWNSEVGKSFRKLSTSDKFACQSPISQASSSTKCGSLSAVTTEVG-NLTGSS  235

Query  1042  DAGGNPNED------------------------------------PEGKCNRSYTDDPLQ  1113
                GN NED                                     E K  +S T+D + 
Sbjct  236   TMAGNXNEDLIYRPFLINTEDVEYKPFQFNTEEVGYKPFQSXTEEVEFKICQSNTEDVMA  295

Query  1114  GsetscsdeledssesalqllldFPTYNDMSFL-GHTDTYSIYPAFLTESTLNC  1272
             GS +SCS++LEDSS++ALQLLLD+PT +DMSFL  + + Y+  PA LT ++  C
Sbjct  296   GSVSSCSNDLEDSSDTALQLLLDYPTNDDMSFLENNANDYATTPAELTPNSFIC  349



>ref|XP_010105966.1| Protein ODORANT1 [Morus notabilis]
 gb|EXC06848.1| Protein ODORANT1 [Morus notabilis]
Length=324

 Score =   350 bits (899),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 214/324 (66%), Positives = 244/324 (75%), Gaps = 13/324 (4%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKN-GQGSWRSLPKLAGLLRCGKSCRLRWTN  510
             MGRTPCCDK+GLKKGPWT EEDE L+++IK N G GSWRSLPKLAGLLRCGKSCRLRWTN
Sbjct  1     MGRTPCCDKRGLKKGPWTAEEDEILVNYIKNNNGHGSWRSLPKLAGLLRCGKSCRLRWTN  60

Query  511   YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
             YLRPDIKRGPF+ EEEKL+IQLHG+LGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLL M
Sbjct  61    YLRPDIKRGPFTQEEEKLIIQLHGMLGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLCM  120

Query  691   GIDPQTHEPSSESIGP-QRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSE  867
             GIDP THEP S +  P  +  P +PS RHMAQWESARLEAEARLSRES L  P     + 
Sbjct  121   GIDPLTHEPFSSNHYPTTKSCPPSPSTRHMAQWESARLEAEARLSRESSLFGPQPHTKAN  180

Query  868   ADFFLRIWNSEIGEAFRKFKK-GVKFACQ-SPISQASSSTKYGSASGTTTEMDITLAGSA  1041
             +DFFLR+WNSE+G++FRK  K G K  C  SPISQASSSTK GS S  TTE+D   AG  
Sbjct  181   SDFFLRLWNSEVGDSFRKLSKFGEKIECHSSPISQASSSTKCGSVSALTTEVDPNTAGLE  240

Query  1042  DAGGNPNEDPE--GKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFLG  1215
                G+  E+ E    C  +  D    GS++S S+++EDSS++ALQLLLDFP  NDMSFL 
Sbjct  241   TTVGSQVEEMEYCKSCKSNGEDFMAAGSDSSSSNDMEDSSDTALQLLLDFPINNDMSFL-  299

Query  1216  HTDTYSIY-----PAFLTESTLNC  1272
               +  S Y      A L+ES+  C
Sbjct  300   -EENCSDYGAAADHAMLSESSFIC  322



>ref|XP_010672001.1| PREDICTED: myb-related protein Myb4 [Beta vulgaris subsp. vulgaris]
Length=303

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 194/308 (63%), Positives = 224/308 (73%), Gaps = 14/308 (5%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR+PCCDK GLKKGPWT EEDE L+ +I ++G G+WRSLPK AGLLRCGKSCRLRWTNY
Sbjct  1     MGRSPCCDKLGLKKGPWTTEEDELLVKYINQHGHGNWRSLPKNAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ EEEKLVIQLH ILGNRWAAIA+QLPGRTDNEIKNLWNTHL+KRL+ MG
Sbjct  61    LRPDIKRGPFTPEEEKLVIQLHAILGNRWAAIAAQLPGRTDNEIKNLWNTHLRKRLVCMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             +DPQTHEPS  S GP  + P +PS RH AQWESARLEAEARLS ES L    +    ++D
Sbjct  121   LDPQTHEPSPTSSGPTTKYPASPSTRHKAQWESARLEAEARLSSESLLCNSHSSEILDSD  180

Query  874   FFLRIWNSEIGEAFRKFKKGVKFACQSPISQAS-SSTKYGSASGTTTEMDITLAGSADAG  1050
              FLR+WNSE+GE+FRKF+     ACQSPISQAS S+TK  S SG T +         D  
Sbjct  181   HFLRLWNSEVGESFRKFEMKETIACQSPISQASTSTTKCASTSGLTMDNQEEEIVFKDLI  240

Query  1051  GNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFLGH-TDT  1227
                  D   + + S +++            +EDSSESALQLLLDFP  NDMSFL    D 
Sbjct  241   KTEIVDVNTRSDSSSSNE------------VEDSSESALQLLLDFPGSNDMSFLEDPVDG  288

Query  1228  YSIYPAFL  1251
             YSI+P  +
Sbjct  289   YSIFPWMM  296



>gb|AGO03570.1| MIXTA-like 6 [Erythranthe lewisii]
Length=293

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 190/314 (61%), Positives = 221/314 (70%), Gaps = 23/314 (7%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCC+KKGLKKGPWTPEED+KL+++IK +GQG+WRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRAPCCEKKGLKKGPWTPEEDDKLVEYIKNHGQGNWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ EEEKLVIQLH ILGNRWAAI+SQLPGRTDNEIKNLWNTHLKKRLL MG
Sbjct  61    LRPDIKRGPFTPEEEKLVIQLHAILGNRWAAISSQLPGRTDNEIKNLWNTHLKKRLLLMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVP-STIGGSEA  870
              DP THE  S   G     P++PS RHM QWESARLEAEAR S+ES L +P ST   SE+
Sbjct  121   FDPITHESVSLQNGSLTGPPSSPSTRHMTQWESARLEAEARSSKESILSLPSSTTKHSES  180

Query  871   DFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAG  1050
             DFFLR+WNSE+GE FR      K A   P S +            ++E  I      D  
Sbjct  181   DFFLRLWNSEVGETFRNLDNREKPASVYPFSSS------------SSETTIETVARKD--  226

Query  1051  GNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPT-YNDMSFLGHTDT  1227
                    E +C  S +         S ++ +ED SE  L+LLLDFP+  NDMSFLGH+D 
Sbjct  227   -------EKECRSSKSCTEYMICSNSSNEVVEDESELTLELLLDFPSNNNDMSFLGHSDC  279

Query  1228  YSIYPAFLTESTLN  1269
             Y++YP    E++LN
Sbjct  280   YTLYPGLYNETSLN  293



>ref|NP_191684.1| LATE MERISTEM IDENTITY2 [Arabidopsis thaliana]
 emb|CAB71055.1| putative transcription factor (MYB17) [Arabidopsis thaliana]
 gb|AAS10071.1| MYB transcription factor [Arabidopsis thaliana]
 gb|ACF28390.1| At3g61250 [Arabidopsis thaliana]
 gb|AEE80179.1| LATE MERISTEM IDENTITY2 [Arabidopsis thaliana]
Length=299

 Score =   337 bits (864),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/244 (69%), Positives = 192/244 (79%), Gaps = 10/244 (4%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCCDK GLKKGPWTPEEDE L+  IKKNG GSWR+LPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRTPCCDKIGLKKGPWTPEEDEVLVAHIKKNGHGSWRTLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+++EEKLVIQLH ILGNRWAAIA+QLPGRTDNEIKNLWNTHLKKRLLSMG
Sbjct  61    LRPDIKRGPFTADEEKLVIQLHAILGNRWAAIAAQLPGRTDNEIKNLWNTHLKKRLLSMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGG---S  864
             +DP+THEP   S G  ++ P++P+ RHMAQWESAR+EAEARLSRES L  PS   G   +
Sbjct  121   LDPRTHEPLP-SYGLAKQAPSSPTTRHMAQWESARVEAEARLSRESMLFSPSFYSGVVKT  179

Query  865   EADFFLRIWNSEIGEAFRKFK--KGVKFACQSPISQASSSTKYGSASGTTT----EMDIT  1026
             E D FLRIWNSEIGEAFR            QSP S+A+S++     S T +    E+ + 
Sbjct  180   ECDHFLRIWNSEIGEAFRNLAPLDESTITSQSPCSRATSTSSALLKSSTNSWGGKEVTVA  239

Query  1027  LAGS  1038
             + GS
Sbjct  240   IHGS  243



>ref|XP_004306804.1| PREDICTED: uncharacterized protein LOC101307334 [Fragaria vesca 
subsp. vesca]
Length=340

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 187/308 (61%), Positives = 227/308 (74%), Gaps = 16/308 (5%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKN-GQGSWRSLPKLAGLLRCGKSCRLRWTN  510
             MGRTPCCDK GLK+GPWTP+EDE L+++I KN G GSWRSLP+ AGLLRCGKSCRLRWTN
Sbjct  1     MGRTPCCDKDGLKRGPWTPDEDEILVNYINKNKGHGSWRSLPQHAGLLRCGKSCRLRWTN  60

Query  511   YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
             YLRPDIKRGPF+ EEEKL+IQLHG+LGNRWAAIASQLPGRTDNEIKNLWNTHL+KRL+ M
Sbjct  61    YLRPDIKRGPFTEEEEKLIIQLHGMLGNRWAAIASQLPGRTDNEIKNLWNTHLRKRLIRM  120

Query  691   GIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEA  870
             GI+PQ HEP +   G   +   + + RHMAQWESARLEAEARLSRES       +  S++
Sbjct  121   GINPQNHEPFTPD-GSTSKTSASTTTRHMAQWESARLEAEARLSRESSQFSTPFLEKSDS  179

Query  871   DFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAG  1050
             D+FLR+W SE+GE+FRK     K    SPIS+ASSS K GS S  TTE+     GS+   
Sbjct  180   DYFLRLWYSEVGESFRKLPIAGKTPSDSPISEASSSGKCGSISAVTTEIGHCFMGSSTMA  239

Query  1051  GNPNEDPEGKCNRSYTDDPL--------------QGsetscsdeledssesalqllldFP  1188
                +ED + K  +S T + +              +GS++S S++L+DSSESA+ +LLD+P
Sbjct  240   ATQDEDVKYKVIKSVTGEDMIYRIYKCNTENVMIRGSDSSSSNKLDDSSESAMDMLLDYP  299

Query  1189  TYNDMSFL  1212
               NDMSFL
Sbjct  300   INNDMSFL  307



>ref|XP_010055170.1| PREDICTED: myb-related protein 340-like isoform X2 [Eucalyptus 
grandis]
 ref|XP_010055171.1| PREDICTED: myb-related protein 340-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW71647.1| hypothetical protein EUGRSUZ_E00175 [Eucalyptus grandis]
Length=298

 Score =   336 bits (861),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 186/297 (63%), Positives = 222/297 (75%), Gaps = 7/297 (2%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR+PCC++K LKKGPWTPEED+ LID+I KNG GSWR LPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRSPCCERKDLKKGPWTPEEDQILIDYISKNGHGSWRVLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRG FS +EEKLVIQLHGILGNRWAAIA+QLPGRTDNEIKNLWNTHLKKRLLS G
Sbjct  61    LRPDIKRGSFSLQEEKLVIQLHGILGNRWAAIAAQLPGRTDNEIKNLWNTHLKKRLLSTG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTI-GGSEA  870
             ++P T +P S   G   +LP +   RHMAQWESARLEAEARLSRE+ LL    +   ++ 
Sbjct  121   LNPLTQDPFSPQ-GSMTKLPASSITRHMAQWESARLEAEARLSRETLLLNTLPLQQKTDG  179

Query  871   DFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADAG  1050
             D+FLR+WNSE+GE+FR   +  K A  S +SQASS  +  ++S  T E+  T  G ADA 
Sbjct  180   DYFLRVWNSEVGESFRSINRRSKSASLSAVSQASSCAECETSSVATIEIGTTYLG-ADAD  238

Query  1051  GNPNE---DPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFL  1212
               PN+   D +GK + +   + L  SE S S E + S+ +AL++L DFP  NDMSFL
Sbjct  239   STPNDHDNDADGKSSGAEY-EALATSEYSGSSEFDSSTVTALEMLFDFPIDNDMSFL  294



>ref|XP_008376023.1| PREDICTED: myb-related protein Hv1 [Malus domestica]
Length=334

 Score =   337 bits (864),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 169/247 (68%), Positives = 194/247 (79%), Gaps = 5/247 (2%)
 Frame = +1

Query  334   MGRTPCCD-KKGLKKGPWTPEEDEKLIDFIKKN-GQGSWRSLPKLAGLLRCGKSCRLRWT  507
             MGRTPCCD KK LKKGPW+PEEDE L+++I KN G GSWRSLPKLAGL RCGKSCRLRW 
Sbjct  1     MGRTPCCDNKKDLKKGPWSPEEDELLLNYISKNHGHGSWRSLPKLAGLQRCGKSCRLRWI  60

Query  508   NYLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLS  687
             NYLRP IKRGPF+ +EE+L+IQLHG+LGNRWA IASQLPGRTDNEIKNLWNTHL+KRL++
Sbjct  61    NYLRPXIKRGPFNKDEEQLIIQLHGMLGNRWATIASQLPGRTDNEIKNLWNTHLRKRLIA  120

Query  688   MGIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSE  867
             MGIDPQTHE  + +         + + RHMAQWESARLEAEARLSRES +   +    SE
Sbjct  121   MGIDPQTHELLASNC-LNHNASASAATRHMAQWESARLEAEARLSRESSIFSHAP-EKSE  178

Query  868   ADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADA  1047
             +D FLR+WNS +G++FRK     KFACQSPISQASSSTK G  S  TTE+   L GS+  
Sbjct  179   SDHFLRLWNSNVGKSFRKLTXD-KFACQSPISQASSSTKCGLLSAVTTEVGNNLTGSSTM  237

Query  1048  GGNPNED  1068
              GN NED
Sbjct  238   AGNQNED  244



>ref|XP_004133870.1| PREDICTED: transcription repressor MYB6-like [Cucumis sativus]
 ref|XP_004155820.1| PREDICTED: transcription repressor MYB6-like [Cucumis sativus]
Length=305

 Score =   336 bits (861),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 195/296 (66%), Positives = 225/296 (76%), Gaps = 6/296 (2%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKN-GQGSWRSLPKLAGLLRCGKSCRLRWTN  510
             MGRTPCCDKKGLKKGPWT EEDE LI++I++N G GSWRSLPKLAGLLRCGKSCRLRWTN
Sbjct  1     MGRTPCCDKKGLKKGPWTSEEDELLINYIRENNGHGSWRSLPKLAGLLRCGKSCRLRWTN  60

Query  511   YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
             YLRPDIKRGPF+ EEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLL +
Sbjct  61    YLRPDIKRGPFTPEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLCI  120

Query  691   GIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIG-GSE  867
             GIDPQTHEP + S       P +P+ RHMAQWESARLEAEARLSRES L  P  +   ++
Sbjct  121   GIDPQTHEPFN-SRCSSSTAPASPATRHMAQWESARLEAEARLSRESSLFTPLLMERTTD  179

Query  868   ADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAGSADA  1047
             +DFFL+IWNSE+GE+FR+ +   K  CQS +S  SSS K  S     T   +   GS+  
Sbjct  180   SDFFLQIWNSEVGESFRRCRDD-KTTCQS-LSPLSSSVKCESLFIVATHNRVDYTGSSAM  237

Query  1048  GGNPNEDPEGKCN-RSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFL  1212
               N   +     N +S TD  +  S++S ++E E+SS+SAL LLLDFP  NDMSFL
Sbjct  238   ESNNENEETEYKNFQSMTDIVMSKSDSSSANEFEESSDSALGLLLDFPINNDMSFL  293



>ref|XP_010055169.1| PREDICTED: myb-related protein 340-like isoform X1 [Eucalyptus 
grandis]
Length=334

 Score =   336 bits (861),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 188/304 (62%), Positives = 226/304 (74%), Gaps = 8/304 (3%)
 Frame = +1

Query  316   WGKRVG-MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSC  492
             +G+  G MGR+PCC++K LKKGPWTPEED+ LID+I KNG GSWR LPKLAGLLRCGKSC
Sbjct  30    FGRAFGEMGRSPCCERKDLKKGPWTPEEDQILIDYISKNGHGSWRVLPKLAGLLRCGKSC  89

Query  493   RLRWTNYLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLK  672
             RLRWTNYLRPDIKRG FS +EEKLVIQLHGILGNRWAAIA+QLPGRTDNEIKNLWNTHLK
Sbjct  90    RLRWTNYLRPDIKRGSFSLQEEKLVIQLHGILGNRWAAIAAQLPGRTDNEIKNLWNTHLK  149

Query  673   KRLLSMGIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPST  852
             KRLLS G++P T +P S   G   +LP +   RHMAQWESARLEAEARLSRE+ LL    
Sbjct  150   KRLLSTGLNPLTQDPFSPQ-GSMTKLPASSITRHMAQWESARLEAEARLSRETLLLNTLP  208

Query  853   I-GGSEADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITL  1029
             +   ++ D+FLR+WNSE+GE+FR   +  K A  S +SQASS  +  ++S  T E+  T 
Sbjct  209   LQQKTDGDYFLRVWNSEVGESFRSINRRSKSASLSAVSQASSCAECETSSVATIEIGTTY  268

Query  1030  AGSADAGGNPNE---DPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYND  1200
              G ADA   PN+   D +GK + +   + L  SE S S E + S+ +AL++L DFP  ND
Sbjct  269   LG-ADADSTPNDHDNDADGKSSGAEY-EALATSEYSGSSEFDSSTVTALEMLFDFPIDND  326

Query  1201  MSFL  1212
             MSFL
Sbjct  327   MSFL  330



>ref|XP_004510807.1| PREDICTED: protein ODORANT1-like [Cicer arietinum]
Length=293

 Score =   333 bits (854),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 199/305 (65%), Positives = 230/305 (75%), Gaps = 25/305 (8%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNG-QGSWRSLPKLAGLLRCGKSCRLRWTN  510
             MGRTPCCDK GLKKGPWT EEDE L++FIKKNG  GSWRSLPKLAGLLRCGKSCRLRWTN
Sbjct  1     MGRTPCCDKLGLKKGPWTSEEDEVLVNFIKKNGGHGSWRSLPKLAGLLRCGKSCRLRWTN  60

Query  511   YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
             YLRPDIKRGPF+ EEEKLVIQLH ILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRL+SM
Sbjct  61    YLRPDIKRGPFTPEEEKLVIQLHAILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLISM  120

Query  691   GIDPQTHEP-SSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSE  867
             GIDPQTHEP SS    P  +  ++ + RHMAQWESARLEAEARLS++S L    T   ++
Sbjct  121   GIDPQTHEPISSSHYYPIDKSHSSIATRHMAQWESARLEAEARLSKDSSLFNNKT---TD  177

Query  868   ADFFLRIWNSEIGEAFRKFKKG------VKFACQSPISQASSS----TKYGSASGTTTEM  1017
             +D+FL++WNSE+G++FR  +K        K  CQS +SQ  SS     K GS S TTT  
Sbjct  178   SDYFLKMWNSEVGQSFRTVRKSDFDDDEEKTRCQSCMSQEGSSCNNDNKCGSVSATTT--  235

Query  1018  DITLAGSADAGGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYN  1197
                LA S     N  E+ E K   +Y    + G ++S S++LEDSS++ALQLLLDFP+ N
Sbjct  236   -TDLASSR----NVKEEFEWK---NYKLFDICGYDSSSSNDLEDSSDTALQLLLDFPSNN  287

Query  1198  DMSFL  1212
             DMSFL
Sbjct  288   DMSFL  292



>ref|XP_006292176.1| hypothetical protein CARUB_v10018382mg [Capsella rubella]
 gb|EOA25074.1| hypothetical protein CARUB_v10018382mg [Capsella rubella]
Length=297

 Score =   333 bits (853),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 168/243 (69%), Positives = 195/243 (80%), Gaps = 9/243 (4%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCCDKKGLKKGPWTPEEDE L+  IKKNG GSWR+LPK AGLLRCGKSCRLRWTNY
Sbjct  1     MGRTPCCDKKGLKKGPWTPEEDEVLVAHIKKNGHGSWRTLPKEAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF++EEEKLV+QLH ILGNRWAAIA+QLPGRTDNEIKNLWNTHLKKRLL+MG
Sbjct  61    LRPDIKRGPFTAEEEKLVVQLHAILGNRWAAIAAQLPGRTDNEIKNLWNTHLKKRLLNMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGG---S  864
             +DP+THEP + S G  ++ P++P+ RHMAQWESAR+EAEARLSRES L  PS+ G    +
Sbjct  121   LDPKTHEPIT-SFGLAKQAPSSPTTRHMAQWESARVEAEARLSRESMLFCPSSSGAGVKT  179

Query  865   EADFFLRIWNSEIGEAFRKFKKGVKFAC-QSPISQASSSTKYGSASGTTT----EMDITL  1029
             + D FLRIWNSEIGEAFR      + A  QSP S+ +SS+     S T +    E+ + +
Sbjct  180   DCDHFLRIWNSEIGEAFRNLAPLDESATSQSPCSRTTSSSSALQKSSTKSFGGKEVTVAI  239

Query  1030  AGS  1038
              GS
Sbjct  240   HGS  242



>ref|XP_002876601.1| AtMYB17 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52860.1| AtMYB17 [Arabidopsis lyrata subsp. lyrata]
Length=297

 Score =   332 bits (852),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 174/200 (87%), Gaps = 4/200 (2%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGRTPCCDKKGLKKGPWTPEEDE L+  IKKNG GSWR+LPKLAGLLRCGKSCRLRWTNY
Sbjct  1    MGRTPCCDKKGLKKGPWTPEEDEVLVAHIKKNGHGSWRTLPKLAGLLRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRGPF++EEEKLVIQLH ILGNRWAAIA+QLPGRTDNEIKNLWNTHLKKRLL MG
Sbjct  61   LRPDIKRGPFTAEEEKLVIQLHAILGNRWAAIAAQLPGRTDNEIKNLWNTHLKKRLLCMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGG---S  864
            +DP+THEP   S G  ++ P++P+ RHMAQWESAR+EAEARLSRES L  PS+  G   +
Sbjct  121  LDPRTHEPLP-SYGLAKQAPSSPTTRHMAQWESARVEAEARLSRESMLFSPSSYSGVVKT  179

Query  865  EADFFLRIWNSEIGEAFRKF  924
            + D FLRIWNSEIGEAFR  
Sbjct  180  DCDHFLRIWNSEIGEAFRNL  199



>ref|XP_006402502.1| hypothetical protein EUTSA_v10006126mg [Eutrema salsugineum]
 gb|ESQ43955.1| hypothetical protein EUTSA_v10006126mg [Eutrema salsugineum]
Length=296

 Score =   332 bits (851),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 174/199 (87%), Gaps = 3/199 (2%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGRTPCCDKKGLKKGPWTPEEDE L+++IKKNG GSWR+LPK AGLLRCGKSCRLRWTNY
Sbjct  1    MGRTPCCDKKGLKKGPWTPEEDEILVEYIKKNGHGSWRTLPKNAGLLRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRGPF+ EEEKLV+QLH ILGNRWAAIA+QLPGRTDNEIKNLWNTHLKKRLLSMG
Sbjct  61   LRPDIKRGPFTPEEEKLVVQLHAILGNRWAAIAAQLPGRTDNEIKNLWNTHLKKRLLSMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGG--SE  867
            +DP+THEP   S G  ++ P +P+ RHMAQWESARLEAEARLSRES L  PS  GG  +E
Sbjct  121  LDPKTHEPLP-SHGFAKQAPASPTTRHMAQWESARLEAEARLSRESMLFTPSGGGGAKAE  179

Query  868  ADFFLRIWNSEIGEAFRKF  924
             D FLRIWNSEIGE+FR  
Sbjct  180  CDHFLRIWNSEIGESFRNL  198



>ref|XP_007051857.1| Myb domain protein 17 isoform 2 [Theobroma cacao]
 gb|EOX96014.1| Myb domain protein 17 isoform 2 [Theobroma cacao]
Length=289

 Score =   331 bits (849),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 180/269 (67%), Positives = 212/269 (79%), Gaps = 1/269 (0%)
 Frame = +1

Query  460   LAGLLRCGKSCRLRWTNYLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDN  639
             + GLLRCGKSCRLRWTNYLRPDIKRGPF+ EEEKLVIQLHGILGNRWAAIASQLPGRTDN
Sbjct  12    ITGLLRCGKSCRLRWTNYLRPDIKRGPFTLEEEKLVIQLHGILGNRWAAIASQLPGRTDN  71

Query  640   EIKNLWNTHLKKRLLSMGIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARL  819
             EIKNLWNTHLKKRL+ MG+DPQTHEP +   GP    PT+P+ RHMAQWESARLEAEARL
Sbjct  72    EIKNLWNTHLKKRLVCMGLDPQTHEPFTP-CGPTTAAPTSPATRHMAQWESARLEAEARL  130

Query  820   SRESKLLVPSTIGGSEADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSAS  999
             SRES L     +G  ++D+FLR+WNSE+GE+FRK  +  K ACQSPISQASSSTK GS S
Sbjct  131   SRESLLFSSPPLGKPDSDYFLRLWNSEVGESFRKLNREDKTACQSPISQASSSTKCGSVS  190

Query  1000  GTTTEMDITLAGSADAGGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqlll  1179
               T ++   +AGS+    N  ED   K  +S T+DP+  S++SCS+E EDSS++ALQLLL
Sbjct  191   AVTIDICPNIAGSSTPASNQIEDTACKSFKSCTEDPVDASDSSCSNESEDSSDTALQLLL  250

Query  1180  dFPTYNDMSFLGHTDTYSIYPAFLTESTL  1266
             DFP  NDMSFL + DTY+   A LT+++ 
Sbjct  251   DFPINNDMSFLENVDTYATSHAMLTDTSF  279



>ref|XP_010512459.1| PREDICTED: myb-related protein Zm38-like [Camelina sativa]
Length=299

 Score =   330 bits (847),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 175/200 (88%), Gaps = 4/200 (2%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGRTPCCDKKGLKKGPWT +EDE L+  I+KNG GSWR+LPK AGLLRCGKSCRLRWTNY
Sbjct  1    MGRTPCCDKKGLKKGPWTADEDEILVAHIQKNGHGSWRTLPKQAGLLRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRGPF++EEEKLV+QLH ILGNRWAAIA+QLPGRTDNEIKNLWNTHLKKRLLSMG
Sbjct  61   LRPDIKRGPFTAEEEKLVVQLHAILGNRWAAIAAQLPGRTDNEIKNLWNTHLKKRLLSMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGG---S  864
            +DP+THEP + S G  ++ P++P+ RHMAQWESAR+EAEARLSRES L  PS+ GG   +
Sbjct  121  LDPKTHEPVT-SFGLPKQAPSSPTTRHMAQWESARVEAEARLSRESMLFCPSSAGGAVKT  179

Query  865  EADFFLRIWNSEIGEAFRKF  924
            + D FLRIWNSEIGEAFR  
Sbjct  180  DCDHFLRIWNSEIGEAFRNL  199



>gb|AGN52097.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52207.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=280

 Score =   328 bits (840),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 173/310 (56%), Positives = 200/310 (65%), Gaps = 41/310 (13%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCDKKGLKKGPWTPEEDEKL+++IKK+GQGSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRAPCCDKKGLKKGPWTPEEDEKLVEYIKKHGQGSWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDI+RGPF+++EEKLVIQLH ILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLL MG
Sbjct  61    LRPDIRRGPFTADEEKLVIQLHAILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLQMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEA-  870
             IDP+THE SS S          P +RHMAQWE+ARLEAEARLS+ES  L  S+  G+   
Sbjct  121   IDPRTHEASSSSAA-------CPQSRHMAQWETARLEAEARLSKESMFLASSSPPGAATS  173

Query  871   ------DFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLA  1032
                   D+FLR+WNSE+GE FRK +K          S +S+     S +    E    + 
Sbjct  174   RNPEGGDYFLRLWNSEVGETFRKLRKEASGRTDESPSSSSTKCSTLSEATVKVEKSSCVE  233

Query  1033  GSADAGGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFL  1212
               + +     ED      +   D                           FPT NDMSFL
Sbjct  234   DVSCSSNEMEEDSSESALQLLLD---------------------------FPTNNDMSFL  266

Query  1213  GHTDTYSIYP  1242
                D +  +P
Sbjct  267   SQPDCFGFFP  276



>ref|XP_010469050.1| PREDICTED: transcription repressor MYB5-like [Camelina sativa]
Length=297

 Score =   328 bits (842),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 160/218 (73%), Positives = 181/218 (83%), Gaps = 13/218 (6%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGRTPCCDKKGLKKGPWT +EDE L+  I+KNG GSWRSLPK AGLLRCGKSCRLRWTNY
Sbjct  1    MGRTPCCDKKGLKKGPWTADEDEILVAHIQKNGHGSWRSLPKQAGLLRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRGPF++EEEKLV+QLH ILGNRWAAIA+QLPGRTDNEIKNLWNTHLKKRLLSMG
Sbjct  61   LRPDIKRGPFTAEEEKLVVQLHAILGNRWAAIAAQLPGRTDNEIKNLWNTHLKKRLLSMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGG---S  864
            +DP+THEP + S G  ++ P +P+ RHMAQWESAR+EAEARLSRES L  PS+ GG   +
Sbjct  121  LDPKTHEPIT-SFGLPKQAPPSPTTRHMAQWESARVEAEARLSRESMLFCPSSSGGGVKT  179

Query  865  EADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSS  978
            + D FLRIWNSEIGEAFR           +PI + S+S
Sbjct  180  DCDHFLRIWNSEIGEAFRNL---------APIDEPSTS  208



>ref|XP_010413438.1| PREDICTED: myb-related protein Zm38-like [Camelina sativa]
Length=299

 Score =   327 bits (837),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 174/200 (87%), Gaps = 4/200 (2%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGRTPCCDKKGLKKGPWT +EDE L+  I+KNG GSWR+LPK AGLLRCGKSCRLRWTNY
Sbjct  1    MGRTPCCDKKGLKKGPWTADEDEILVAHIQKNGHGSWRTLPKQAGLLRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRGPF++EEEKLV+QLH ILGNRWAAIA+QLPGRTDNEIKNLWNTHLKKRLLSMG
Sbjct  61   LRPDIKRGPFTAEEEKLVVQLHAILGNRWAAIAAQLPGRTDNEIKNLWNTHLKKRLLSMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIG---GS  864
            +DP+THEP + S G  ++ P++P+ RHMAQWESAR+EAEARLSRES L  PS+ G    +
Sbjct  121  LDPKTHEPIT-SFGLPKQAPSSPTTRHMAQWESARVEAEARLSRESMLFCPSSSGRGVKT  179

Query  865  EADFFLRIWNSEIGEAFRKF  924
            + D FLRIWNSEIGEAFR  
Sbjct  180  DCDHFLRIWNSEIGEAFRNL  199



>emb|CDY48934.1| BnaA09g39030D [Brassica napus]
Length=298

 Score =   326 bits (835),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 173/200 (87%), Gaps = 4/200 (2%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGRTPCCDKKGLKKGPWT EEDE L+++IKKN  GSWR+LPK AGLLRCGKSCRLRWTNY
Sbjct  1    MGRTPCCDKKGLKKGPWTAEEDEILVEYIKKNSHGSWRTLPKNAGLLRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRGPF+ EEEKLV+QLH ILGNRWAAIA+QLPGRTDNEIKNLWNTHLKKRLLSMG
Sbjct  61   LRPDIKRGPFTPEEEKLVVQLHAILGNRWAAIAAQLPGRTDNEIKNLWNTHLKKRLLSMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGG---S  864
            +DP+THEP   S G   + P +P+ RHMAQWESARLEAEARLSRES L  PS++GG   +
Sbjct  121  LDPKTHEPLP-SFGLAIQAPASPTTRHMAQWESARLEAEARLSRESMLFNPSSLGGGGKT  179

Query  865  EADFFLRIWNSEIGEAFRKF  924
            + D FLRIWNSEIG++FR  
Sbjct  180  DCDHFLRIWNSEIGDSFRNL  199



>emb|CDX71755.1| BnaC08g31190D [Brassica napus]
Length=296

 Score =   325 bits (834),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 172/200 (86%), Gaps = 4/200 (2%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGRTPCCDKKGLKKGPWT EEDE L+++IKKN  GSWR+LPK AGLLRCGKSCRLRWTNY
Sbjct  1    MGRTPCCDKKGLKKGPWTAEEDEILVEYIKKNSHGSWRTLPKNAGLLRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRGPF+ EEEKLV+QLH ILGNRWAAIA+QLPGRTDNEIKNLWNTHLKKRLLSMG
Sbjct  61   LRPDIKRGPFTPEEEKLVVQLHAILGNRWAAIAAQLPGRTDNEIKNLWNTHLKKRLLSMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGG---S  864
            +DP+THEP   S G   + P +P+ RHMAQWESARLEAEARLSRES L  PS+ GG   +
Sbjct  121  LDPKTHEPLP-SFGLAIQAPASPTTRHMAQWESARLEAEARLSRESMLFNPSSAGGGGKT  179

Query  865  EADFFLRIWNSEIGEAFRKF  924
            + D FLRIWNS+IGE+FR  
Sbjct  180  DCDHFLRIWNSQIGESFRNL  199



>ref|XP_009104296.1| PREDICTED: protein ODORANT1-like [Brassica rapa]
 ref|XP_009104297.1| PREDICTED: protein ODORANT1-like [Brassica rapa]
Length=282

 Score =   324 bits (831),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 166/246 (67%), Positives = 189/246 (77%), Gaps = 8/246 (3%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCDKKGLKKGPWTPEEDE L+++IK+N  GSWR LPK AGLLRCGKSCRLRWTNY
Sbjct  1     MGRKPCCDKKGLKKGPWTPEEDEILVEYIKQNSHGSWRLLPKKAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ +EEKLV+QLH ILGNRWAAIA+QLPGRTDNEIKNLWNTHLKKR+LSMG
Sbjct  61    LRPDIKRGPFTPQEEKLVVQLHAILGNRWAAIAAQLPGRTDNEIKNLWNTHLKKRMLSMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             +DP+THEP   S G  ++ P + + RHMAQWESARLEAEARLSRES L  PS     E D
Sbjct  121   LDPKTHEPLP-SHGLAKQAPASQTTRHMAQWESARLEAEARLSRESILFNPSCEVKYECD  179

Query  874   FFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITL-AGSADAG  1050
              FLRIWNSEIGE+F    K +    QSP S+ +SS+   +  G  T M I   +GS+   
Sbjct  180   HFLRIWNSEIGESF----KNLTTTSQSPCSRTTSSS--SALVGKETVMGINHGSGSSSPC  233

Query  1051  GNPNED  1068
              N  ED
Sbjct  234   SNNVED  239



>gb|EYU35079.1| hypothetical protein MIMGU_mgv1a011571mg [Erythranthe guttata]
Length=277

 Score =   324 bits (830),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 183/312 (59%), Positives = 212/312 (68%), Gaps = 40/312 (13%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCDKKGLKKGPWTP+EDEKL+D+I  +G GSWRSLPKLAGL RCGKSCRLRW NY
Sbjct  1     MGRAPCCDKKGLKKGPWTPDEDEKLVDYINNHGHGSWRSLPKLAGLFRCGKSCRLRWNNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDI RGPF+ +EEKLVIQLH ILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLL MG
Sbjct  61    LRPDIIRGPFTHDEEKLVIQLHAILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLQMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLV-PSTIGG-SE  867
             I+PQTHEPSS            PS RHMAQWESARLEAEARLS+ES+ L+ PS   G S+
Sbjct  121   INPQTHEPSSTLSN------GLPSTRHMAQWESARLEAEARLSKESRPLINPSPPDGKSD  174

Query  868   ADFFLRIWNSEIGEAFRKFKKGVKFAC-QSPISQASSSTKYGSASGTTTEMDITLAGSAD  1044
              D+F+R+WNSE+GE FRK  K  +++  QSP+   +++           +    L GS  
Sbjct  175   GDYFMRLWNSEVGETFRKVDKKTEYSVSQSPVFSGTTTETGLLTERKNEDF---LTGSDS  231

Query  1045  AGGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFLGHTD  1224
                N                          +  + S  S+LQLLLDFP+ NDMSFLG  D
Sbjct  232   CIDN--------------------------EMDDSSESSSLQLLLDFPSNNDMSFLGQPD  265

Query  1225  TY--SIYPAFLT  1254
              Y  S+YP+  T
Sbjct  266   CYYNSLYPSIFT  277



>ref|XP_009116786.1| PREDICTED: myb-related protein Zm38 [Brassica rapa]
 ref|XP_009116787.1| PREDICTED: myb-related protein Zm38 [Brassica rapa]
Length=292

 Score =   325 bits (832),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 173/200 (87%), Gaps = 4/200 (2%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGRTPCCDKKGLKKGPWT EEDE L+++IKK+  GSWR+LPK AGLLRCGKSCRLRWTNY
Sbjct  1    MGRTPCCDKKGLKKGPWTAEEDEILVEYIKKHSHGSWRTLPKNAGLLRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRGPF+ EEEKLV+QLH ILGNRWAAIA+QLPGRTDNEIKNLWNTHLKKRLL+MG
Sbjct  61   LRPDIKRGPFTPEEEKLVVQLHAILGNRWAAIAAQLPGRTDNEIKNLWNTHLKKRLLNMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGG---S  864
            +DP+THEP   S G   + P +P+ RHMAQWESARLEAEARLSRES L  PS++GG   +
Sbjct  121  LDPKTHEPLP-SFGLAIQAPASPTTRHMAQWESARLEAEARLSRESMLFNPSSLGGGGRT  179

Query  865  EADFFLRIWNSEIGEAFRKF  924
            + D FLRIWNSEIGE+FR  
Sbjct  180  DCDHFLRIWNSEIGESFRNL  199



>emb|CDY58788.1| BnaA07g38030D [Brassica napus]
Length=282

 Score =   324 bits (831),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/246 (67%), Positives = 189/246 (77%), Gaps = 8/246 (3%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCDKKGLKKGPWTPEEDE L+++IK+N  GSWR LPK AGLLRCGKSCRLRWTNY
Sbjct  1     MGRKPCCDKKGLKKGPWTPEEDEILVEYIKQNSHGSWRLLPKKAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ +EEKLV+QLH ILGNRWAAIA+QLPGRTDNEIKNLWNTHLKKR+LSMG
Sbjct  61    LRPDIKRGPFTPQEEKLVVQLHAILGNRWAAIAAQLPGRTDNEIKNLWNTHLKKRILSMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             +DP+THEP   S G  ++ P + + RHMAQWESARLEAEARLSRES L  PS     E D
Sbjct  121   LDPKTHEPLP-SHGLAKQAPASQTTRHMAQWESARLEAEARLSRESILFNPSCEVKYECD  179

Query  874   FFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITL-AGSADAG  1050
              FLRIWNSEIGE+F    K +    QSP S+ +SS+   +  G  T M I   +GS+   
Sbjct  180   HFLRIWNSEIGESF----KNLTTTSQSPCSRTTSSS--SALVGKETVMGINHGSGSSSPC  233

Query  1051  GNPNED  1068
              N  ED
Sbjct  234   SNNVED  239



>ref|XP_003623894.1| MYB transcription factor [Medicago truncatula]
 gb|AES80112.1| myb transcription factor MIXTA-like protein [Medicago truncatula]
Length=304

 Score =   323 bits (829),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 192/310 (62%), Positives = 224/310 (72%), Gaps = 25/310 (8%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNG-QGSWRSLPKLAGLLRCGKSCRLRWTN  510
             MGRTPCCDKKGLKKGPWT EEDE L ++IKKNG  GSWRSLPK+ GLLRCGKSCRLRWTN
Sbjct  1     MGRTPCCDKKGLKKGPWTAEEDEILANYIKKNGGHGSWRSLPKITGLLRCGKSCRLRWTN  60

Query  511   YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
             YLRPDIKRGPF+ EEEKLVIQLH ILGNRWAAIASQLPGRTDNEIKN WNTHLKKRL S+
Sbjct  61    YLRPDIKRGPFTPEEEKLVIQLHAILGNRWAAIASQLPGRTDNEIKNFWNTHLKKRLKSL  120

Query  691   GIDPQTHEP-SSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPS----TI  855
             GIDP+THEP +S +  P  +   + S RHMAQWESARLEAEARLS ES     +    T 
Sbjct  121   GIDPKTHEPVASLTSYPNHKSHASVSTRHMAQWESARLEAEARLSIESSHFNNNPNSFTK  180

Query  856   GGSEADFFLRIWNSEIGEAFRKFKK------GVKFAC-QSPISQAS-SSTKYGSASGTTT  1011
               S +D+FLRIWNSE+G+AFRK +K       +  +C QSPIS  S SS K  S S  T 
Sbjct  181   TDSSSDYFLRIWNSEVGDAFRKVQKPDTDHINIITSCSQSPISAGSLSSNKCDSISAVTA  240

Query  1012  EMDITLAGSADAGGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPT  1191
                I             E+ + +  +   +D L  S++S S++L+DSS++ALQLL DFP 
Sbjct  241   SNSIV-----------KEELDWRNYKFSAEDVLLESDSSSSNDLQDSSDTALQLLFDFPM  289

Query  1192  YNDMSFLGHT  1221
              NDMSFLG++
Sbjct  290   NNDMSFLGNS  299



>ref|XP_003618988.1| Myb-like transcription factor [Medicago truncatula]
 gb|KEH18894.1| myb transcription factor MIXTA-like protein [Medicago truncatula]
Length=297

 Score =   323 bits (827),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 193/311 (62%), Positives = 228/311 (73%), Gaps = 33/311 (11%)
 Frame = +1

Query  334   MGRTPCCDKK-GLKKGPWTPEEDEKLIDFIKKNG-QGSWRSLPKLAGLLRCGKSCRLRWT  507
             MGRTPCCD K GLKKGPWT EEDE L++FIKKNG  GSWRSLPKLAGLLRCGKSCRLRWT
Sbjct  1     MGRTPCCDNKMGLKKGPWTSEEDEVLVNFIKKNGGHGSWRSLPKLAGLLRCGKSCRLRWT  60

Query  508   NYLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLS  687
             NYLRPDIKRGPF+ EEEKLVIQLH ILGNRWA+IASQLPGRTDNEIKNLWNTHLKKRL+ 
Sbjct  61    NYLRPDIKRGPFTPEEEKLVIQLHAILGNRWASIASQLPGRTDNEIKNLWNTHLKKRLIC  120

Query  688   MGIDPQTHEP-SSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL----VPST  852
             MGIDPQTHEP +S    P  +  ++ + RHMAQWESARLEAEARLS+++ L     +PS 
Sbjct  121   MGIDPQTHEPIASSHYFPISKSNSSIATRHMAQWESARLEAEARLSKDTSLFNNGNIPSL  180

Query  853   IGG-SEADFFLRIWNSEIGEAFRKFKKG------VKFACQSPISQASSS----TKYGSAS  999
                 +++D+FL+IWNSE+G++FR  +K        K  CQS +SQ  SS     K GS S
Sbjct  181   ASNKADSDYFLKIWNSEVGQSFRTGRKSDDEDDDDKTKCQSSMSQEGSSCNNNNKCGSVS  240

Query  1000  GTTTEMDITLAGSADAGGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqlll  1179
              TTT  ++             ED E    R+Y    +   ++S S++LEDSS++ALQLLL
Sbjct  241   VTTTTSNVM------------EDFEW---RNYKSFDVGYDDSSSSNDLEDSSDTALQLLL  285

Query  1180  dFPTYNDMSFL  1212
             DFP+ NDMSFL
Sbjct  286   DFPSNNDMSFL  296



>emb|CDY45703.1| BnaCnng13680D [Brassica napus]
Length=282

 Score =   320 bits (821),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 164/246 (67%), Positives = 187/246 (76%), Gaps = 8/246 (3%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCDKKGLKKGPWTPEEDE L+++I KN  GSWR LPK AGLLRCGKSCRLRWTNY
Sbjct  1     MGRKPCCDKKGLKKGPWTPEEDEILVEYINKNSHGSWRLLPKKAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ +EEKLV+QLH ILGNRWAAIA+QLPGRTDNEIKNLWNTHLKKR+LSMG
Sbjct  61    LRPDIKRGPFTPQEEKLVVQLHAILGNRWAAIAAQLPGRTDNEIKNLWNTHLKKRMLSMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             +DP+THEP   S G  ++   + + RHMAQWESARLEAEARLSRES L  PS     E D
Sbjct  121   LDPKTHEPLP-SHGLAKQASASQTTRHMAQWESARLEAEARLSRESMLFNPSCEVKYECD  179

Query  874   FFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITL-AGSADAG  1050
              FLRIWNSEIGE+F    K +    QSP S+ +SS+   +  G  T M I   +GS+   
Sbjct  180   HFLRIWNSEIGESF----KNLTTTSQSPCSRTTSSS--SALVGKETVMGINHGSGSSSPC  233

Query  1051  GNPNED  1068
              N  +D
Sbjct  234   SNNVQD  239



>dbj|BAK53863.1| MYB transcription factor MIXTA-like protein [Torenia fournieri]
Length=323

 Score =   322 bits (825),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 198/315 (63%), Positives = 231/315 (73%), Gaps = 25/315 (8%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCC+KKGLKKG WT EEDEKLID+I K+G GSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRAPCCEKKGLKKGSWTSEEDEKLIDYISKHGHGSWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ EEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLL MG
Sbjct  61    LRPDIKRGPFTLEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLLMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGS---  864
             IDP THEP+S ++    R P +PS RHMAQWESARLEAE+RLSRES L +P  +  S   
Sbjct  121   IDPHTHEPTSLTL--VNRPPPSPSTRHMAQWESARLEAESRLSRESLLSIPPPLPSSSSS  178

Query  865   --EADFFLRIWNSEIGEAFRKF------KKGVKFA---CQSPISQASSSTKYGSASGTTT  1011
               E D FLR+WNSE+G+ FR         +G + +    QSPIS   SS K GS+ G   
Sbjct  179   LQEPDHFLRLWNSEVGDTFRNVHDNSSNNRGTETSNAVSQSPIS--CSSIKCGSSLGV--  234

Query  1012  EMDITLAGSADAGGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPT  1191
                ++     D+  +   D +  C  S +    + ++++CS+E+EDSSES LQLLLDFP 
Sbjct  235   ---MSTVPEEDSSSDIANDRD--CKISASSLIKRETDSTCSNEMEDSSESTLQLLLDFPG  289

Query  1192  YNDMSFLGHTDTYSI  1236
              NDMSFL  T+ YS+
Sbjct  290   NNDMSFLESTECYSL  304



>ref|XP_007139892.1| hypothetical protein PHAVU_008G067300g [Phaseolus vulgaris]
 gb|ESW11886.1| hypothetical protein PHAVU_008G067300g [Phaseolus vulgaris]
Length=308

 Score =   321 bits (823),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 190/310 (61%), Positives = 219/310 (71%), Gaps = 28/310 (9%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNG-QGSWRSLPKLAGLLRCGKSCRLRWTN  510
             MGRTPCCDKKGLKKGPWT EEDE L  +IKKNG  GSWRSLP++AGLLRCGKSCRLRWTN
Sbjct  1     MGRTPCCDKKGLKKGPWTAEEDEILASYIKKNGGHGSWRSLPRMAGLLRCGKSCRLRWTN  60

Query  511   YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
             YLRPDIKRGPF+ EEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRL SM
Sbjct  61    YLRPDIKRGPFTQEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLKSM  120

Query  691   GIDPQTHEPSSESIG-PQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIG---  858
             G+DP+THEP + S   P  +   + S RHMAQWESARLEAEARLS ES     +T     
Sbjct  121   GLDPRTHEPLASSPSYPFHKAHASVSTRHMAQWESARLEAEARLSNESTRFSQNTTNPNS  180

Query  859   ---GSEADFFLRIWNSEIGEAFRKF---------KKGVKFACQSPISQASSSTKYGSASG  1002
                 +++D+FLRIWNSE+GEAFR           K     +C SP+S  SSS K  S   
Sbjct  181   DAKTTDSDYFLRIWNSEVGEAFRNVVVQHKADDNKITTTSSCPSPLSAGSSSNKCES---  237

Query  1003  TTTEMDITLAGSADAGGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllld  1182
                     +A +AD      E       +   +   +GS++S S+++EDSS++ALQLLLD
Sbjct  238   --------IATNADLASIAQEITPSNFVKQELEWRTRGSDSSSSNDMEDSSDTALQLLLD  289

Query  1183  FPTYNDMSFL  1212
             FP  NDMSFL
Sbjct  290   FPINNDMSFL  299



>ref|XP_003552382.1| PREDICTED: protein ODORANT1 [Glycine max]
 gb|KHM99396.1| Myb-related protein Pp2 [Glycine soja]
Length=316

 Score =   320 bits (821),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 191/319 (60%), Positives = 220/319 (69%), Gaps = 38/319 (12%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNG-QGSWRSLPKLAGLLRCGKSCRLRWTN  510
             MGRTPCCDKKGLKKGPWT EEDE L  +IKKNG  GSWRSLP++AGLLRCGKSCRLRWTN
Sbjct  1     MGRTPCCDKKGLKKGPWTAEEDEILSSYIKKNGGHGSWRSLPRMAGLLRCGKSCRLRWTN  60

Query  511   YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
             YLRPDIKRGPF+ EEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRL SM
Sbjct  61    YLRPDIKRGPFTLEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLKSM  120

Query  691   GIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL--------VP  846
             G+DP+THEP + S  P  + P + S RHMAQWESARLEAEARLS ES             
Sbjct  121   GLDPKTHEPLASSTYPFHKAPASVSTRHMAQWESARLEAEARLSNESSRFSHNTTNNSNS  180

Query  847   STIGGSEADFFLRIWNSEIGEAFRKFKK---------------GVKFACQSPISQASSST  981
                  +++D+FLRIWNSE+GEAFR                       +C SP+S  SSS 
Sbjct  181   DNNKTTDSDYFLRIWNSEVGEAFRNVHHHKADDDNNNNKITTNTPTSSCHSPLSTGSSSN  240

Query  982   KYGSASGTTTEMDITLAGSADAGGNPNE--DPEGKCNRSYTDDPLQGsetscsdeledss  1155
             K  S           +A +AD   N  E   P     + + +   +GS++S S+++EDSS
Sbjct  241   KCES-----------IATNADLASNAPEIITPSSIVKQEF-EWGTRGSDSSSSNDMEDSS  288

Query  1156  esalqllldFPTYNDMSFL  1212
             ++ALQLLLDFP  NDMSFL
Sbjct  289   DTALQLLLDFPINNDMSFL  307



>ref|XP_003534572.1| PREDICTED: protein ODORANT1-like [Glycine max]
 gb|KHN29374.1| Protein ODORANT1 [Glycine soja]
Length=315

 Score =   320 bits (820),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 190/318 (60%), Positives = 219/318 (69%), Gaps = 37/318 (12%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNG-QGSWRSLPKLAGLLRCGKSCRLRWTN  510
             MGRTPCCDKKGLKKGPWT EEDE L  +IKKNG  GSWRSLP++AGLLRCGKSCRLRWTN
Sbjct  1     MGRTPCCDKKGLKKGPWTAEEDEILSSYIKKNGGHGSWRSLPRMAGLLRCGKSCRLRWTN  60

Query  511   YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
             YLRPDIKRGPF+ EEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRL  M
Sbjct  61    YLRPDIKRGPFTLEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLKRM  120

Query  691   GIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL--------VP  846
             G+DP+THEP + S  P  + P + S RHMAQWESARLEAEARLS ES             
Sbjct  121   GLDPKTHEPLASSTYPFHKAPASISTRHMAQWESARLEAEARLSNESSRFSHNNNTNPNS  180

Query  847   STIGGSEADFFLRIWNSEIGEAFRKFKKGVK--------------FACQSPISQASSSTK  984
                  +++D+FLRIWNSE+GEAFR                      +C SP+S  SSS K
Sbjct  181   DNNKTTDSDYFLRIWNSEVGEAFRNVHHHKADNDNNKIITTNTPTSSCHSPLSAGSSSNK  240

Query  985   YGSASGTTTEMDITLAGSADAGGNPNE--DPEGKCNRSYTDDPLQGsetscsdeledsse  1158
               S           +A +AD   N  E   P     + + +   +GS++S S+++EDSS+
Sbjct  241   CES-----------IATNADLASNEQEIITPSSIVKQEF-EWGTRGSDSSSSNDMEDSSD  288

Query  1159  salqllldFPTYNDMSFL  1212
             +ALQLLLDFP  NDMSFL
Sbjct  289   TALQLLLDFPINNDMSFL  306



>gb|EPS71496.1| hypothetical protein M569_03262, partial [Genlisea aurea]
Length=207

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 174/199 (87%), Gaps = 5/199 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR PCCDKKGLKKGPWT EED+KL++FIK+NG GSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  11   MGRAPCCDKKGLKKGPWTSEEDDKLVEFIKRNGHGSWRSLPKLAGLLRCGKSCRLRWTNY  70

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRGPF+ EEEKLV+QLH ILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRL+ MG
Sbjct  71   LRPDIKRGPFTVEEEKLVVQLHAILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLILMG  130

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL-VPSTIGGS-E  867
            IDPQTHEP+S +         +P+ RHMAQWESARLEAEARLS+ES LL  P  IGG+ E
Sbjct  131  IDPQTHEPASSAATAAA---ASPATRHMAQWESARLEAEARLSQESFLLSAPPAIGGTQE  187

Query  868  ADFFLRIWNSEIGEAFRKF  924
            +DFFLR+WNSE+GE FRK 
Sbjct  188  SDFFLRLWNSEVGETFRKL  206



>ref|XP_007135039.1| hypothetical protein PHAVU_010G096400g [Phaseolus vulgaris]
 gb|ESW07033.1| hypothetical protein PHAVU_010G096400g [Phaseolus vulgaris]
Length=278

 Score =   317 bits (811),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 177/300 (59%), Positives = 204/300 (68%), Gaps = 30/300 (10%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNG-QGSWRSLPKLAGLLRCGKSCRLRWTN  510
             MGR PCCDK GLKKGPWT EEDE L+++I  NG  GSWRSLPKLAGLLRCGKSCRLRWTN
Sbjct  1     MGRKPCCDKMGLKKGPWTAEEDEILVNYINMNGGHGSWRSLPKLAGLLRCGKSCRLRWTN  60

Query  511   YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
             YLRPDIKRG F+ EEEKL+IQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRL+ M
Sbjct  61    YLRPDIKRGSFTLEEEKLIIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLICM  120

Query  691   GIDPQTHEPSSESIGPQ-RRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSE  867
             G+DPQTH+P S S  P  +    + S RHMAQWESARLEAEARLSRE  L   S    ++
Sbjct  121   GLDPQTHQPLSSSCNPDGKAHAASTSTRHMAQWESARLEAEARLSREPYLFNNSN--KTD  178

Query  868   ADFFLRIWNSEIGEAFRKFKKG-VKFACQSPIS----QASSSTKYGSASGTTTEMDITLA  1032
             +D+FLR+WNSE+G++FR   K   K  CQSPIS     A+++T   S   +  + D+   
Sbjct  179   SDYFLRMWNSEVGQSFRDVHKSDNKGGCQSPISLGSLSATTTTDLASNPASIVKEDLVWG  238

Query  1033  GSADAGGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFL  1212
             GS     + +   E +      D  LQ                   LLLDFP  NDMSFL
Sbjct  239   GSKKIASDSSSSSELE--EDSCDTSLQ-------------------LLLDFPINNDMSFL  277



>gb|KDP22287.1| hypothetical protein JCGZ_26118 [Jatropha curcas]
 gb|AIT52300.1| MYB family protein [Jatropha curcas]
Length=306

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 178/308 (58%), Positives = 214/308 (69%), Gaps = 14/308 (5%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTPCCDK G+KKG W+PEED  LI +I+K+G GSWRSLPK AGLLRCGKSCRLRWTNY
Sbjct  1     MGRTPCCDKDGVKKGAWSPEEDRILIQYIQKHGHGSWRSLPKNAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPFS EEE  +I+LHG+LGN+WAAIA QLPGRTDNEIKN WNTHLKKRL S  
Sbjct  61    LRPDIKRGPFSPEEEDTIIRLHGMLGNKWAAIAGQLPGRTDNEIKNFWNTHLKKRLYSTA  120

Query  694   IDPQTHE--PSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSE  867
                Q H+   SSE I  +     + S RHM QWESAR+EAEARLS E+ LL PS+    E
Sbjct  121   QKLQIHQSWSSSEPIAIK---CESASTRHMVQWESARVEAEARLSMETLLLNPSSSVKME  177

Query  868   ADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSAS---GTTTEMDITLAGS  1038
              D+FL++WNSE+GE+FR  K  V  AC+SPISQ  SSTK GS S   G+  +M      +
Sbjct  178   RDYFLQLWNSEVGESFRSIKGKVGGACESPISQTCSSTKLGSGSVDNGSKLQMTPIKIST  237

Query  1039  ADAGGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFL-G  1215
             ++      ED     N     D +  S++  S +  DSS++AL+LLLD P  NDM FL G
Sbjct  238   SNDTAREQED-----NSKLNADIMTASDSISSSQFTDSSDTALKLLLDVPCINDMEFLEG  292

Query  1216  HTDTYSIY  1239
              T+ +S +
Sbjct  293   QTEHFSSF  300



>ref|XP_002267986.1| PREDICTED: transcription repressor MYB6 [Vitis vinifera]
Length=296

 Score =   311 bits (798),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 176/297 (59%), Positives = 213/297 (72%), Gaps = 10/297 (3%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCDK G+K+G WTPEEDE LID+IKKNG G WRSLPK AGLLRCGKSCRLRWTNY
Sbjct  1     MGRKPCCDKHGVKRGAWTPEEDEILIDYIKKNGHGRWRSLPKHAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ EEE  +IQLH +LGNRWAAIAS++PGRTDNEIKN WNTHLKKRLL   
Sbjct  61    LRPDIKRGPFTPEEETAIIQLHSMLGNRWAAIASKIPGRTDNEIKNFWNTHLKKRLLGNH  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
              + QT    S  + P      +PS RHMAQWESAR+EAEARLS ES LL P+++  +++D
Sbjct  121   QNQQTQW--SSVLEPSNAQSKSPSTRHMAQWESARVEAEARLSMESLLLRPASMSKNDSD  178

Query  874   FFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAG----SA  1041
             +FLRIWNSE+G++FRK       ACQSPIS  S STK+   SG++  M    AG    ++
Sbjct  179   YFLRIWNSEVGDSFRKKNGQYGVACQSPIS--SLSTKF--RSGSSLTMQRGPAGTSTSTS  234

Query  1042  DAGGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFL  1212
                 +  ++ E K + +Y  D + GS+ S S EL  SS+ + +LLLDF   NDM FL
Sbjct  235   TTITSKQKNMEPKSHTAYAQDMMTGSDDSSSYELGYSSDISFRLLLDFQGDNDMGFL  291



>emb|CDX89106.1| BnaA04g00800D [Brassica napus]
Length=284

 Score =   310 bits (793),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR PCCDK+GLKKGPWTPEEDE L+++IK+N  GSWR+LPK AGLLRCGKSCRLRWTNY
Sbjct  1    MGRKPCCDKEGLKKGPWTPEEDEILVEYIKQNSHGSWRTLPKKAGLLRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ EEEKLV+QLH ILGNRWAAIA+QLPGRTDNEIKNLWNTHLKK LLSMG
Sbjct  61   LRPDIKRGSFTPEEEKLVVQLHAILGNRWAAIAAQLPGRTDNEIKNLWNTHLKKHLLSMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
            +DP+THE  + S G  +  P +P+ RHMAQWESAR+EAEARLS+ES L         + D
Sbjct  121  LDPKTHEALA-SYGLAKHAPASPTTRHMAQWESARVEAEARLSKESMLFSSCVEVKYDCD  179

Query  874  FFLRIWNSEIGEAFRKF  924
             FLRIWNS+IGE+FR  
Sbjct  180  HFLRIWNSKIGESFRNI  196



>gb|AGO03571.1| MIXTA-like 7 [Erythranthe lewisii]
Length=276

 Score =   308 bits (790),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 177/317 (56%), Positives = 206/317 (65%), Gaps = 51/317 (16%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCDKKGLKKGPWTP+EDEKL+D+I K+G GSWRSLPKLAGL RCGKSCRLRW NY
Sbjct  1     MGRAPCCDKKGLKKGPWTPDEDEKLVDYINKHGHGSWRSLPKLAGLFRCGKSCRLRWNNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDI RGPF+ EEEKLVIQLH ILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLL MG
Sbjct  61    LRPDIIRGPFTPEEEKLVIQLHAILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLQMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTI-----G  858
             +DPQTHEP S   G    L TT   RHMAQWESARLEAEARLS+ES+  +PS+      G
Sbjct  121   VDPQTHEPYSTLNG----LTTT---RHMAQWESARLEAEARLSKESQPSIPSSSSSSSDG  173

Query  859   GSEADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQAS--SSTKYGSASGTTTEMDITLA  1032
                 D+FLR+WNSE+GE FRK  K  +++       +S  ++T+ G  +   T  D+ ++
Sbjct  174   KWGGDYFLRLWNSEVGETFRKVDKKREYSVSQSPVVSSSGTTTEAGLLTERKTNEDVCMS  233

Query  1033  GSADAGGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFL  1212
                    N  ED      +   D                           FP+ NDMSFL
Sbjct  234   -------NEMEDSSESSLQLLLD---------------------------FPSDNDMSFL  259

Query  1213  GH-TDTYS--IYPAFLT  1254
                 D+Y   +YP+  T
Sbjct  260   EQPADSYYSLLYPSIFT  276



>ref|XP_009138782.1| PREDICTED: myb-related protein Myb4-like isoform X2 [Brassica 
rapa]
Length=284

 Score =   307 bits (786),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 169/213 (79%), Gaps = 3/213 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR PCCDK+GLKKGPWTPEEDE L+++IK+N  GSWR+LPK AGLLRCGKSCRLRWTNY
Sbjct  1    MGRKPCCDKEGLKKGPWTPEEDEILVEYIKQNSHGSWRTLPKKAGLLRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            L PDIKRG F+ EEEKLV+QLH ILGNRWAAIA+QLPGRTDNEIKNLWNTHLKK LLSMG
Sbjct  61   LIPDIKRGSFTPEEEKLVVQLHAILGNRWAAIAAQLPGRTDNEIKNLWNTHLKKHLLSMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
            +DP+THE  + S G  +  P +P+ RHMAQWESAR+EAEARLS+ES L         + D
Sbjct  121  LDPKTHEALA-SYGLAKHAPASPTTRHMAQWESARVEAEARLSKESMLFSSCVEVKYDCD  179

Query  874  FFLRIWNSEIGEAFRKFKKGVK--FACQSPISQ  966
             FLRIWNS+IGE+FR      K     QSP S+
Sbjct  180  HFLRIWNSKIGESFRNIASCDKSTTTSQSPCSR  212



>emb|CDP05209.1| unnamed protein product [Coffea canephora]
Length=307

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 178/313 (57%), Positives = 220/313 (70%), Gaps = 18/313 (6%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR+PCCDK+ +KKG W+PEED+ L+D+I KNG G+WRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRSPCCDKEAVKKGAWSPEEDKTLVDYINKNGHGTWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRP IKRGPF  EEE  ++QLH +LGN+WAAIAS LPGRTDNEIKN WN+HLKKR     
Sbjct  61    LRPGIKRGPFCPEEEASIMQLHTMLGNKWAAIASHLPGRTDNEIKNFWNSHLKKR-AKAS  119

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
             +D      +S+  G +     TPS RHM QWESARLEAEARLS +  LL  S+   +E D
Sbjct  120   LDQPESILTSDDFGLE-----TPSTRHMVQWESARLEAEARLSMDPLLLSSSSAAKTECD  174

Query  874   FFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDIT-LAGSADAG  1050
             +FLR+WNSE+GE+FR   +GV  ACQSP+S  SSS K  S S  TT+ D   + GSADA 
Sbjct  175   YFLRLWNSEVGESFR---QGV--ACQSPLSPVSSSIKDESTSVVTTQTDSARIFGSADAT  229

Query  1051  GNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFLGH-TDT  1227
              N  ++    C+ S  ++ L GS++S S EL++SSE+ ++LL D P  NDM FL    D 
Sbjct  230   ENQKQEEHMSCHNS--EELLTGSDSSKSHELDNSSETKMRLLQDLPNGNDMEFLQEPIDD  287

Query  1228  YSIY---PAFLTE  1257
              S+Y   P  LT+
Sbjct  288   VSMYLQEPISLTD  300



>ref|XP_003521908.1| PREDICTED: protein ODORANT1-like [Glycine max]
Length=273

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/222 (68%), Positives = 175/222 (79%), Gaps = 8/222 (4%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNG-QGSWRSLPKLAGLLRCGKSCRLRWTN  510
            MGR PCCDK GLKKGPWT EEDE L+++I KNG  GSWRSLP LAGLLRCGKSCRLRWTN
Sbjct  1    MGRKPCCDKMGLKKGPWTAEEDEILVNYINKNGGHGSWRSLPNLAGLLRCGKSCRLRWTN  60

Query  511  YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
            YLRPDIKRG F+ E+EKL+IQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRL+ M
Sbjct  61   YLRPDIKRGSFTLEDEKLIIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLICM  120

Query  691  GIDPQTHEPSSESIGPQRR--LPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGS  864
            G+DPQTH+P +    P  +    ++ S RHMAQWESARLEAEARLSRE  L   +    +
Sbjct  121  GLDPQTHQPLASPHNPNDKAHASSSTSTRHMAQWESARLEAEARLSREPHLYYNN--NKT  178

Query  865  EADFFLRIWNSEIGEAFR---KFKKGVKFACQSPISQASSST  981
            ++D+FLRIWNS++GE+FR   K +  +K   QS  +  +S T
Sbjct  179  DSDYFLRIWNSDLGESFRDVHKLESSIKCESQSATTDLASLT  220



>gb|KHN27311.1| Protein ODORANT1 [Glycine soja]
Length=273

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 150/222 (68%), Positives = 175/222 (79%), Gaps = 8/222 (4%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNG-QGSWRSLPKLAGLLRCGKSCRLRWTN  510
            MGR PCCDK GLKKGPWT EEDE L+++I KNG  GSWRSLP LAGLLRCGKSCRLRWTN
Sbjct  1    MGRKPCCDKMGLKKGPWTAEEDEILVNYINKNGGHGSWRSLPNLAGLLRCGKSCRLRWTN  60

Query  511  YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
            YLRPDIKRG F+ E+EKL+IQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRL+ M
Sbjct  61   YLRPDIKRGSFTLEDEKLIIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLICM  120

Query  691  GIDPQTHEPSSESIGPQRR--LPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGS  864
            G+DPQTH+P +    P  +    ++ S RHMAQWESARLEAEARLSRE  L   +    +
Sbjct  121  GLDPQTHQPLASPHNPNDKAHASSSTSTRHMAQWESARLEAEARLSREPHLY--NNNNKT  178

Query  865  EADFFLRIWNSEIGEAFR---KFKKGVKFACQSPISQASSST  981
            ++D+FLRIWNS++GE+FR   K +  +K   QS  +  +S T
Sbjct  179  DSDYFLRIWNSDLGESFRDVHKLESSIKCESQSATTDLASLT  220



>ref|XP_011093151.1| PREDICTED: myb-related protein Pp2 isoform X3 [Sesamum indicum]
Length=288

 Score =   304 bits (779),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 178/272 (65%), Positives = 206/272 (76%), Gaps = 9/272 (3%)
 Frame = +1

Query  460   LAGLLRCGKSCRLRWTNYLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDN  639
             + GLLRCGKSCRLRWTNYLRPDIKRGPF+ EEEKLVIQLH ILGNRWAAIASQLPGRTDN
Sbjct  24    VTGLLRCGKSCRLRWTNYLRPDIKRGPFTVEEEKLVIQLHSILGNRWAAIASQLPGRTDN  83

Query  640   EIKNLWNTHLKKRLLSMGIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARL  819
             EIKNLWNTHLKK+LL MGIDPQTH+PSS + GP   L ++ S  HM QWESARLEAE RL
Sbjct  84    EIKNLWNTHLKKQLLQMGIDPQTHKPSSTAKGPLNCLLSSLSTCHMTQWESARLEAEVRL  143

Query  820   SRESKLLVPSTIGG-SEADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSA  996
             SR+S LL+P + G  SEADFFL++WNS++GE FRK  K  +    S    +SSSTKY   
Sbjct  144   SRQSLLLIPQSAGNKSEADFFLQLWNSDVGETFRKLDK--RENATSQSPISSSSTKYDKL  201

Query  997   SGTTTEMDITLAGSADAGGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqll  1176
             SGT TEM +  AGS     N N+D E K  +S  +D   GS++S S+E+EDSSES LQLL
Sbjct  202   SGTVTEMALLAAGS-----NLNDDAECKSGKSCVEDGRPGSDSSSSNEMEDSSESELQLL  256

Query  1177  ldFPTYNDMSFLGHTDT-YSIYPAFLTESTLN  1269
             L+FP+ +DMS LG TD  YS+YP   TEST N
Sbjct  257   LNFPSNDDMSLLGQTDCYYSLYPGIFTESTFN  288



>dbj|BAA36424.1| MYB homologue, partial [Perilla frutescens var. crispa]
Length=282

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 183/285 (64%), Positives = 212/285 (74%), Gaps = 11/285 (4%)
 Frame = +1

Query  436   GSWRSLPKLAGLLRCGKSCRLRWTNYLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIAS  615
             GSWRSLPKLAGLLRCGKSCRL WTNYLRPDIKRGPFS+EEEKLVIQLHGILGNRWAAIAS
Sbjct  1     GSWRSLPKLAGLLRCGKSCRLPWTNYLRPDIKRGPFSTEEEKLVIQLHGILGNRWAAIAS  60

Query  616   QLPGRTDNEIKNLWNTHLKKRLLSMGIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESA  795
             QLPGRTDNEIKNLWNTHLKKRLL MGIDP THEPS  S G   R P++PS RHMAQWES 
Sbjct  61    QLPGRTDNEIKNLWNTHLKKRLLLMGIDPHTHEPSLTSNGLLTRPPSSPSTRHMAQWESP  120

Query  796   RLEAEARLSRESKLLVPSTIGGSEADFFLRIWNSEIGEAFRKFKKGVK--FACQSPISQA  969
             RL+AEARLS+ES L + + +  SEAD FLR+ NSE+GE FRK K G K      S    +
Sbjct  121   RLDAEARLSKESLLSIHAPLPKSEADHFLRLSNSEVGETFRKIKNGEKAEPPSPSQSPGS  180

Query  970   SSSTKYGSASGTTTEMDITLAGSADAGGNPNEDPEGKCNRSYTDDPLQGsetscsdeled  1149
             S+STK  S SGTTTE+ +          +   + + K +++ T+    G+++S S+E+ED
Sbjct  181   SASTKCCSFSGTTTEIGLQ---------SGLHETDCKSSKTCTEYVRTGTDSSSSNEMED  231

Query  1150  ssesalqllldFPTYNDMSFLGHTDTYSIYPAFLTESTLNCSSAE  1284
             SSES LQLLLDFP  NDMSFLG+ D YS+YP F   S  + SS E
Sbjct  232   SSESTLQLLLDFPCKNDMSFLGNADCYSLYPGFTNGSLYDSSSQE  276



>ref|XP_009138781.1| PREDICTED: myb-related protein Myb4-like isoform X1 [Brassica 
rapa]
Length=290

 Score =   301 bits (772),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 169/219 (77%), Gaps = 9/219 (4%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPK------LAGLLRCGKSCR  495
            MGR PCCDK+GLKKGPWTPEEDE L+++IK+N  GSWR+LPK      L GLLRCGKSCR
Sbjct  1    MGRKPCCDKEGLKKGPWTPEEDEILVEYIKQNSHGSWRTLPKKADFSSLLGLLRCGKSCR  60

Query  496  LRWTNYLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKK  675
            LRWTNYL PDIKRG F+ EEEKLV+QLH ILGNRWAAIA+QLPGRTDNEIKNLWNTHLKK
Sbjct  61   LRWTNYLIPDIKRGSFTPEEEKLVVQLHAILGNRWAAIAAQLPGRTDNEIKNLWNTHLKK  120

Query  676  RLLSMGIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTI  855
             LLSMG+DP+THE  + S G  +  P +P+ RHMAQWESAR+EAEARLS+ES L      
Sbjct  121  HLLSMGLDPKTHEALA-SYGLAKHAPASPTTRHMAQWESARVEAEARLSKESMLFSSCVE  179

Query  856  GGSEADFFLRIWNSEIGEAFRKFKKGVK--FACQSPISQ  966
               + D FLRIWNS+IGE+FR      K     QSP S+
Sbjct  180  VKYDCDHFLRIWNSKIGESFRNIASCDKSTTTSQSPCSR  218



>ref|XP_004492711.1| PREDICTED: protein ODORANT1-like [Cicer arietinum]
Length=303

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 180/311 (58%), Positives = 211/311 (68%), Gaps = 34/311 (11%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNG-QGSWRSLPKLAGLLRCGKSCRLRWTN  510
             MGRTPCC+KKGLKKGPWT EEDE L ++I KNG  GSW  LPK+ GLLRCGKSCRLRWTN
Sbjct  1     MGRTPCCEKKGLKKGPWTTEEDEILANYINKNGGHGSWHELPKITGLLRCGKSCRLRWTN  60

Query  511   YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
             YLRPDIKRGPF+ EEEKLVIQLH ILGNRWAAIASQLPGRTDNEIKN WNTHLKKRL SM
Sbjct  61    YLRPDIKRGPFTPEEEKLVIQLHAILGNRWAAIASQLPGRTDNEIKNFWNTHLKKRLESM  120

Query  691   GIDPQTHEPSSESIG-PQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGG--  861
             GIDP+THEP + S   P     ++ S RHMAQWESARLEAEARLS ++     +      
Sbjct  121   GIDPKTHEPVASSTSYPNHNSHSSVSTRHMAQWESARLEAEARLSIDTSNFNNNNNKSKN  180

Query  862   -------SEADFFLRIWNSEIGEAFRKFKK----GVKF---ACQSPISQASSSTKYGSAS  999
                      +D+FLRIWNS +G+AFR  +K      K+    CQSP            +S
Sbjct  181   PNSISETDSSDYFLRIWNSAVGDAFRDIRKHDTDNNKYKTSCCQSP------------SS  228

Query  1000  GTTTEMDITLAGSADAGGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqlll  1179
               T E    LA +        E+ E +  +   +D + GS++S S++LEDS ++ALQLLL
Sbjct  229   AVTAE----LASNNQLSNGVKEEFEWRNYKFCVEDMIHGSDSSSSNDLEDSPDTALQLLL  284

Query  1180  dFPTYNDMSFL  1212
             DFP  NDMSFL
Sbjct  285   DFPMNNDMSFL  295



>ref|XP_006583311.1| PREDICTED: protein ODORANT1-like [Glycine max]
 gb|KHN04658.1| Protein ODORANT1 [Glycine soja]
Length=274

 Score =   299 bits (766),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 166/202 (82%), Gaps = 9/202 (4%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNG-QGSWRSLPKLAGLLRCGKSCRLRWTN  510
            MGR PCCDK GLKKG WT EEDE L+++I KNG  GSWRSLPKLAGLLRCGKSCRLRWTN
Sbjct  1    MGRKPCCDKMGLKKGSWTAEEDEILVNYINKNGGHGSWRSLPKLAGLLRCGKSCRLRWTN  60

Query  511  YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
            YLRPDIKRG F+ EEEKL+IQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRL+ M
Sbjct  61   YLRPDIKRGSFTLEEEKLIIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLICM  120

Query  691  GIDPQTHEP--SSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGS  864
            G+DPQTH+P  S  ++  +    +T S RHMAQWE+ARLEAEARLSRE     P     +
Sbjct  121  GLDPQTHQPLASPHNLNDKAHASST-STRHMAQWETARLEAEARLSRE-----PHFNNKT  174

Query  865  EADFFLRIWNSEIGEAFRKFKK  930
            ++D+FLRIWNSE+GE+FR   K
Sbjct  175  DSDYFLRIWNSEVGESFRDVHK  196



>ref|XP_008794182.1| PREDICTED: myb-related protein Myb4-like isoform X1 [Phoenix 
dactylifera]
Length=333

 Score =   289 bits (739),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 162/215 (75%), Gaps = 19/215 (9%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR  CCDK+GLKKGPWTPEED+ L+D+I+ NG GSWRSLP+LAGLLRCGKSCRLRWTNY
Sbjct  1    MGRARCCDKQGLKKGPWTPEEDKILVDYIQSNGHGSWRSLPQLAGLLRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRGPF+ EE+K +IQLHGI+GN+W+ IA+ LPGRTDNEIKN WNTHLK+RLL MG
Sbjct  61   LRPDIKRGPFTLEEQKSIIQLHGIVGNKWSTIAAHLPGRTDNEIKNYWNTHLKRRLLRMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTT------PSARHMAQWESARLEAEARLSRESKLLV----  843
            I+P T+ P++ +  P             P+ RHMAQWESARLEAEARLSRES L      
Sbjct  121  INPDTYAPATFTSSPGTTGGGASSSSSFPATRHMAQWESARLEAEARLSRESLLFSSAAS  180

Query  844  ---------PSTIGGSEADFFLRIWNSEIGEAFRK  921
                      ST      DFFLRIWNSE+G+AFRK
Sbjct  181  ASVSTSHHSESTHPKPGPDFFLRIWNSEVGDAFRK  215



>ref|XP_011030104.1| PREDICTED: transcription repressor MYB6-like [Populus euphratica]
Length=298

 Score =   287 bits (734),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 176/255 (69%), Gaps = 13/255 (5%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCDK G+KKGPWTPEED+ L+ +I+K+G G WRSLPK AGLLRCGKSCRLRWTNY
Sbjct  1     MGRVPCCDKDGVKKGPWTPEEDQLLVQYIQKHGLGCWRSLPKNAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPFS  EE  V+ LHG+LGN+WA +ASQLPGRTDNEIKN WNTHLKKRL S+G
Sbjct  61    LRPDIKRGPFSPAEEATVVHLHGMLGNKWAYMASQLPGRTDNEIKNFWNTHLKKRLTSIG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
                Q ++ SS S  P      +PSARHM QWESAR+EAEARLS++S L+ P++   S  D
Sbjct  121   PKLQINQSSSSS-EPINIKSKSPSARHMVQWESARVEAEARLSKQSLLIKPTSTAKSHPD  179

Query  874   FFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSA----------SGTTTEMDI  1023
              FL++W SE+GE FR  ++     C+S +S    S K  S             TTT +D 
Sbjct  180   IFLQLWKSEVGETFRIIEEKDGKTCESLVSDTPPSIKNESVFLDDTVSPKPFKTTTFIDT  239

Query  1024  TLAGSADAGGNPNED  1068
             T     +    PNED
Sbjct  240   T--QEQEDTCKPNED  252



>ref|XP_008794546.1| PREDICTED: myb-related protein Myb4-like isoform X2 [Phoenix 
dactylifera]
Length=355

 Score =   286 bits (732),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 154/259 (59%), Positives = 178/259 (69%), Gaps = 40/259 (15%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR PCCDK+GLKKGPWTPEED+ L+D+I+ NG GSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1    MGRAPCCDKQGLKKGPWTPEEDKILVDYIQTNGHGSWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRGPF+ EE+K +IQLHGI+GN+W+ IA+QLPGRTDNEIKN WNTHLKKRLL MG
Sbjct  61   LRPDIKRGPFTPEEQKSIIQLHGIVGNKWSTIAAQLPGRTDNEIKNYWNTHLKKRLLRMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTT-------------PSARHMAQWESARLEAEARLSRESK  834
            I+P T+ P++    P                    P+ RHMAQWESARLEAEARLSRES 
Sbjct  121  INPDTYAPAASPSSPGGAGAGAGAGGGASSSSSAFPATRHMAQWESARLEAEARLSRESL  180

Query  835  LLVPSTIGGS----------------------EADFFLRIWNSEIGEAFRKFKKGVKFAC  948
            L   +    +                      E DFFLRIWNSE+G+AFRK     + + 
Sbjct  181  LFSSAASSSAAAAAAVAAAAGSIHSDSPHPKPEPDFFLRIWNSEVGDAFRKPLSAPRES-  239

Query  949  QSPI---SQASSSTKYGSA  996
             SPI   S  SSSTK+ SA
Sbjct  240  -SPIAGSSPESSSTKHSSA  257



>ref|XP_002318817.2| hypothetical protein POPTR_0012s13240g [Populus trichocarpa]
 gb|ABK95454.1| unknown [Populus trichocarpa]
 gb|EEE97037.2| hypothetical protein POPTR_0012s13240g [Populus trichocarpa]
Length=298

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/241 (59%), Positives = 170/241 (71%), Gaps = 11/241 (5%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCDK  +KKGPWTPEED+ L+ +I+K+G G WRSLPK AGLLRCGKSCRLRWTNY
Sbjct  1     MGRVPCCDKDEVKKGPWTPEEDQLLVQYIQKHGLGCWRSLPKNAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPFS  EE  ++ LHG+LGN+WA +ASQLPGRTDNEIKN WNTHLKKRL S+G
Sbjct  61    LRPDIKRGPFSPAEEATIVHLHGMLGNKWAYMASQLPGRTDNEIKNFWNTHLKKRLTSIG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
                Q ++ SS S  P      +PSARHM QWESAR+EAEARLS++S L+ P++   S  D
Sbjct  121   PKLQINQSSSSS-EPINIKCKSPSARHMVQWESARVEAEARLSKQSLLIKPTSTAKSRPD  179

Query  874   FFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSA----------SGTTTEMDI  1023
              FL++W SE+GE FR  ++     C+S +S    S K  S             TTT MD 
Sbjct  180   IFLQLWKSEVGETFRITEEKYGKTCESLVSDTPPSIKNESVFLDDTVSPKPFKTTTFMDT  239

Query  1024  T  1026
             T
Sbjct  240   T  240



>ref|XP_008339263.1| PREDICTED: transcription factor MYB28-like [Malus domestica]
Length=346

 Score =   283 bits (723),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 177/308 (57%), Positives = 209/308 (68%), Gaps = 44/308 (14%)
 Frame = +1

Query  466   GLLRCGKSCRLRWTNYLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEI  645
             GL RCGKSCRLRWTNYL+PDIKRGPFS +EEKL+IQLHG+LGNRWA IASQLPGRTDNEI
Sbjct  42    GLQRCGKSCRLRWTNYLKPDIKRGPFSKDEEKLIIQLHGMLGNRWATIASQLPGRTDNEI  101

Query  646   KNLWNTHLKKRLLSMGIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSR  825
             KNLWNTHL+K L+SMGIDPQTHEP S +         + + RHMAQWESARLEAEARLSR
Sbjct  102   KNLWNTHLRKGLVSMGIDPQTHEPLSSNC-LSNXASASAATRHMAQWESARLEAEARLSR  160

Query  826   ESKLL--VPSTIGGSEADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSAS  999
             +S L   VP     SE+D FLR+WNSE+G++FRK     KFACQSPISQASSSTK GS S
Sbjct  161   DSSLFSRVPEK---SESDHFLRLWNSEVGKSFRKLSTSDKFACQSPISQASSSTKCGSLS  217

Query  1000  GTTTEMDITLAGSADAGGNPNED------------------------------------P  1071
               TTE+   L GS+   GN NED                                     
Sbjct  218   AVTTEVG-NLTGSSTMAGNXNEDLIYRPFLINTEDVEYKPFQFNTEEVGYKPFQSXTEEV  276

Query  1072  EGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFL-GHTDTYSIYPAF  1248
             E K  +S T+D + GS +SCS++LEDSS++ALQLLLD+PT +DMSFL  + + Y+  PA 
Sbjct  277   EFKICQSNTEDVMAGSVSSCSNDLEDSSDTALQLLLDYPTNDDMSFLENNANDYATTPAE  336

Query  1249  LTESTLNC  1272
             LT ++  C
Sbjct  337   LTPNSFIC  344



>ref|XP_007143400.1| hypothetical protein PHAVU_007G069400g [Phaseolus vulgaris]
 ref|XP_007143401.1| hypothetical protein PHAVU_007G069400g [Phaseolus vulgaris]
 gb|ESW15394.1| hypothetical protein PHAVU_007G069400g [Phaseolus vulgaris]
 gb|ESW15395.1| hypothetical protein PHAVU_007G069400g [Phaseolus vulgaris]
Length=321

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 165/229 (72%), Gaps = 3/229 (1%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MG+ PCC+K G+K+G WTPEED+ L+D+IK++G GSWR+LPK AGLLRCGKSCRLRW NY
Sbjct  1     MGKAPCCEKHGVKRGAWTPEEDQALVDYIKEHGHGSWRTLPKHAGLLRCGKSCRLRWINY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRP IKRGPF+SEEE  ++QLHG+LGNRWAAIASQLPGRTDNEIKN WNTHLKKRLL   
Sbjct  61    LRPGIKRGPFTSEEESTIVQLHGMLGNRWAAIASQLPGRTDNEIKNYWNTHLKKRLLRSC  120

Query  694   IDPQTHEPSSESIGPQRRLPT-TPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEA  870
                   E  S  I  Q  + + +PS RHM QWES R+EAEARLS ES LL       +  
Sbjct  121   --HSLREKQSCLILDQTIVKSESPSTRHMVQWESVRVEAEARLSMESSLLNSWPTSTTCP  178

Query  871   DFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEM  1017
             D FL +WNSE+G++FR  K       QSPIS  S S+K  S S  + ++
Sbjct  179   DHFLHLWNSEVGKSFRMVKGKEGVVSQSPISHLSFSSKLESCSDVSVQV  227



>emb|CBI22754.3| unnamed protein product [Vitis vinifera]
Length=269

 Score =   275 bits (703),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 162/297 (55%), Positives = 198/297 (67%), Gaps = 37/297 (12%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCDK G+K+G WTPEEDE LID+IKKNG G WRSLPK AGLLRCGKSCRLRWTNY
Sbjct  1     MGRKPCCDKHGVKRGAWTPEEDEILIDYIKKNGHGRWRSLPKHAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ EEE  +IQLH +LGNRWAAIAS++PGRTDNEIKN WNTHLKKRLL   
Sbjct  61    LRPDIKRGPFTPEEETAIIQLHSMLGNRWAAIASKIPGRTDNEIKNFWNTHLKKRLLGNH  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
              + QT                             ++EAEARLS ES LL P+++  +++D
Sbjct  121   QNQQT-----------------------------QVEAEARLSMESLLLRPASMSKNDSD  151

Query  874   FFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDITLAG----SA  1041
             +FLRIWNSE+G++FRK       ACQSPIS  S STK+   SG++  M    AG    ++
Sbjct  152   YFLRIWNSEVGDSFRKKNGQYGVACQSPIS--SLSTKF--RSGSSLTMQRGPAGTSTSTS  207

Query  1042  DAGGNPNEDPEGKCNRSYTDDPLQGsetscsdeledssesalqllldFPTYNDMSFL  1212
                 +  ++ E K + +Y  D + GS+ S S EL  SS+ + +LLLDF   NDM FL
Sbjct  208   TTITSKQKNMEPKSHTAYAQDMMTGSDDSSSYELGYSSDISFRLLLDFQGDNDMGFL  264



>ref|XP_009382382.1| PREDICTED: myb-related protein Myb4-like [Musa acuminata subsp. 
malaccensis]
Length=315

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/242 (61%), Positives = 169/242 (70%), Gaps = 28/242 (12%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCDK GLKKGPWTPEED+ L+D+I+ +G GSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1     MGRAPCCDKSGLKKGPWTPEEDKILVDYIQSHGHGSWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF+ EE+K +IQLH I+GN+W+ IA+QLPGRTDNEIKN WNTHLKKRLL MG
Sbjct  61    LRPDIKRGPFTPEEQKSIIQLHAIVGNKWSTIAAQLPGRTDNEIKNFWNTHLKKRLLRMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGS---  864
             +    H   S+S           S+RHMAQWESARLEAEARLSRES     ++   +   
Sbjct  121   L---LHPDPSDSSP------AAASSRHMAQWESARLEAEARLSRESLFAHSASAAAAAAV  171

Query  865   ------------EADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTT  1008
                         E DFFLRIWNSEIG+AFRK       +     S  SS T+  SA+   
Sbjct  172   TNPAVNLPPLKPEPDFFLRIWNSEIGDAFRK----TAASATDESSPESSFTRQSSAAAVK  227

Query  1009  TE  1014
             TE
Sbjct  228   TE  229



>ref|XP_002321913.1| hypothetical protein POPTR_0015s13180g [Populus trichocarpa]
 gb|EEF06040.1| hypothetical protein POPTR_0015s13180g [Populus trichocarpa]
Length=296

 Score =   273 bits (698),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 159/221 (72%), Gaps = 3/221 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR PCCD+ G+KKGPWTPEED  L+ +I+KNG GSW SLPK AGL RCGKSCRLRWTNY
Sbjct  1    MGRGPCCDQDGVKKGPWTPEEDHLLVQYIQKNGFGSWHSLPKKAGLFRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS  EE  +I LHGILGNRWA IASQLPGRTDNEIKN WN+HLKKRL S+G
Sbjct  61   LRPDIKRGRFSPAEEATIIHLHGILGNRWAHIASQLPGRTDNEIKNFWNSHLKKRLASIG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
               Q ++ SS +  P   +  +PS  HM QWESAR+EAEARLS +S L+  ++      D
Sbjct  121  PKLQINQSSSSN--PINIMCESPSC-HMVQWESARVEAEARLSMQSLLVKHTSTVKGHPD  177

Query  874  FFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSA  996
             F+++WNSE+GEAFR  K      C+S +S A    K  S 
Sbjct  178  IFMQLWNSEVGEAFRNVKGKDVETCESLVSDAHPCVKIESV  218



>ref|XP_007038674.1| Myb domain protein 17, putative [Theobroma cacao]
 gb|EOY23175.1| Myb domain protein 17, putative [Theobroma cacao]
Length=250

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/245 (60%), Positives = 174/245 (71%), Gaps = 13/245 (5%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGRTP CDK+G+KKG WTPEED+ L+ +IKK+G   WR+LP LAGL RCGKSCRLRWTNY
Sbjct  1     MGRTPSCDKEGMKKGAWTPEEDKLLVHYIKKHGHDCWRTLPMLAGLRRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPFSSEEE  +I+LHG+LGNRWAAIAS LPGRTDNEIKN WNTHLKKRLLS G
Sbjct  61    LRPDIKRGPFSSEEEACIIRLHGMLGNRWAAIASHLPGRTDNEIKNFWNTHLKKRLLSTG  120

Query  694   IDPQTHEPSSESIGPQRRLPTT-----PSARHMAQWESARLEAEARLSRESKLLVPSTIG  858
                QT      S+ P    P+T     PS RH  Q ES RLE EARLS ES +L  S+  
Sbjct  121   NILQT------SLSPSDCEPSTLKSELPSTRHTVQCESFRLEGEARLSIESSMLRSSSTS  174

Query  859   GSEADFFLRIWNSEIGEAFRKFKKGVKF--ACQSPISQASSSTKYGSASGTTTEMDITLA  1032
              ++ D FL++WNS++GE FR   K  K   A ++P+SQ SS TK  S+S  T E   +++
Sbjct  175   KTDCDIFLKLWNSDVGEKFRNIAKLPKKEEASETPMSQTSSWTKLESSSCITCEERSSIS  234

Query  1033  GSADA  1047
               +D 
Sbjct  235   CGSDT  239



>gb|ABK26515.1| unknown [Picea sitchensis]
Length=330

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 143/170 (84%), Gaps = 2/170 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR PCC+K GLKKGPWTPEED+KL+ +I+++G GSWR+LP+ AGLLRCGKSCRLRW NY
Sbjct  1    MGRAPCCEKVGLKKGPWTPEEDQKLVAYIQEHGHGSWRALPQKAGLLRCGKSCRLRWANY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS++EE+ +IQLH +LGNRW+ IA+ LP RTDNEIKN WNTHLKKRLL MG
Sbjct  61   LRPDIKRGKFSAQEEQTIIQLHALLGNRWSTIATHLPKRTDNEIKNYWNTHLKKRLLQMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSAR--HMAQWESARLEAEARLSRESKL  837
            IDP TH+P SESI    R  +  S+   HMAQWESARLEAE+RL+RESKL
Sbjct  121  IDPVTHKPKSESIMAVGRQSSNGSSNLSHMAQWESARLEAESRLARESKL  170



>gb|EMT27766.1| Transcription factor MYB39 [Aegilops tauschii]
Length=278

 Score =   263 bits (671),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 169/257 (66%), Gaps = 33/257 (13%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCD+KGLKKGPWTPEED++L+DFI+ NG GSWR LPKLA L RCGKSCRLRWTNY
Sbjct  1     MGRAPCCDRKGLKKGPWTPEEDKQLVDFIQANGHGSWRLLPKLAELNRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF++EE+K ++QLHGI+GN+W+ IA+QLPGRTDNEIKN WNTHLKK+L  MG
Sbjct  61    LRPDIKRGPFTAEEQKSIVQLHGIVGNKWSMIAAQLPGRTDNEIKNYWNTHLKKQLRRMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIG-----  858
             +D     P++            P+ARHMAQWE+ARLEAEARLS  S     +T       
Sbjct  121   LDEPPPGPTA----------GCPAARHMAQWETARLEAEARLSLLSSSGAAATATTSGSA  170

Query  859   ---------------GSEADFFLRIWNSEIGEAFRKFKKGVKFACQS---PISQASSSTK  984
                               AD FLR+WNS+IG +FRK    V    +    P   +S+++ 
Sbjct  171   SSSSTAAAGAAVAERAKPADVFLRLWNSDIGSSFRKAAAPVSVKEEEAVVPGDDSSAASN  230

Query  985   YGSASGTTTEMDITLAG  1035
                A+    +M +  AG
Sbjct  231   EMDAAAAEYQMFLDFAG  247



>ref|XP_009400270.1| PREDICTED: myb-related protein Hv1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009400271.1| PREDICTED: myb-related protein Hv1-like [Musa acuminata subsp. 
malaccensis]
Length=307

 Score =   263 bits (672),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 155/218 (71%), Gaps = 28/218 (13%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK+GLKKGPWTPEED+ L+DFI+ +G GSWRSLPKLAGLLRCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKQGLKKGPWTPEEDKILVDFIQSHGHGSWRSLPKLAGLLRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRGPF+ EE+K +IQLH ILGN+W+AIA+QLPGRTDNE+KN WNTHLKKRLL   
Sbjct  61   LRPDIKRGPFTPEEDKSIIQLHAILGNKWSAIAAQLPGRTDNEVKNYWNTHLKKRLLVHQ  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIG-----  858
                 H              +T +  HMAQWESARLEAEARLSRES L   ST       
Sbjct  121  HHHHNHHQRLHMSS------STATGSHMAQWESARLEAEARLSRESFLFSSSTTAAASSA  174

Query  859  -----------------GSEADFFLRIWNSEIGEAFRK  921
                              +E DFFLRIWNSE+G AFR+
Sbjct  175  APFAGAVSEPDSDLPPRAAEPDFFLRIWNSEVGAAFRR  212



>ref|XP_004496577.1| PREDICTED: myb-related protein Myb4-like [Cicer arietinum]
Length=305

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 153/200 (77%), Gaps = 7/200 (4%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MG+ PCCDK G+K+G WTPEED+ L+D+I  +G GSWR+LPK AGLLRCGKSCRLRW NY
Sbjct  1    MGKAPCCDKHGVKRGAWTPEEDQTLVDYINNHGHGSWRTLPKHAGLLRCGKSCRLRWINY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRP IKRGPF+ EEE  +IQLH +LGNRWAAIASQL GRTDNEIKN WNTHLKKR+L   
Sbjct  61   LRPGIKRGPFTDEEESTIIQLHAMLGNRWAAIASQLQGRTDNEIKNYWNTHLKKRVL---  117

Query  694  IDPQTHEPSSESIGPQRRLPT-TPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEA  870
               ++ E     +   R + T +PS RHM QWESAR+EAEARLS +S  L  ++   +  
Sbjct  118  ---RSLEAKRPCVMADRIVQTNSPSTRHMVQWESARVEAEARLSMDSTSLNSASTTKTCP  174

Query  871  DFFLRIWNSEIGEAFRKFKK  930
            D+FL++W+SE+G++FRK K+
Sbjct  175  DYFLQLWHSEVGQSFRKIKE  194



>ref|XP_010525098.1| PREDICTED: myb-related protein 306 isoform X2 [Tarenaya hassleriana]
Length=363

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 146/172 (85%), Gaps = 5/172 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ FI+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAFIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFTLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSESI---GPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+P +E++   G Q +   T S  HMAQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKPKNETLLSSGGQSKNAATLS--HMAQWESARLEAEARLARESKLL  170



>ref|XP_009121584.1| PREDICTED: myb-related protein Hv1 [Brassica rapa]
Length=321

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 167/237 (70%), Gaps = 16/237 (7%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1     MGRSPCCDKLGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61    LRPDIKRGKFNLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL----VPSTI--  855
             IDP TH+P +E+  P        +  HMAQWESARLEAEARL+RESKLL     PS+   
Sbjct  121   IDPVTHKPKNET--PLGLSKNAATLSHMAQWESARLEAEARLARESKLLHYQSKPSSYHH  178

Query  856   GGSEADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDIT  1026
              G      L  W ++  +  ++         +SP S  S S     ++G + +M+ T
Sbjct  179   HGFTYKTLLTNWTTKTNQDQQQL--------ESPTSTVSFSDMKEPSTGVSAKMEFT  227



>ref|XP_006647594.1| PREDICTED: myb-related protein Myb4-like [Oryza brachyantha]
Length=291

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/242 (55%), Positives = 162/242 (67%), Gaps = 28/242 (12%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCDKKGLKKGPWTPEED+ L+D+I+ NG GSWR LPKLAGL RCGKSCRLRWTNY
Sbjct  1     MGRAPCCDKKGLKKGPWTPEEDKLLVDYIQANGHGSWRLLPKLAGLNRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRGPF++EE+K ++QLHGI+GN+W+ IA+QLPGRTDNEIKN WNTHLKK+L  MG
Sbjct  61    LRPDIKRGPFTAEEQKSIVQLHGIVGNKWSMIAAQLPGRTDNEIKNYWNTHLKKQLRRMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIG-----  858
             +D     P++            P+ARHMAQWE+ARLEAE RLS  S     +        
Sbjct  121   LDEPPPGPAA----------GCPAARHMAQWETARLEAEVRLSLLSSSGAAAATTITATT  170

Query  859   -------------GSEADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSAS  999
                           + AD FLR+WNS+IG++FRK          S +   + + K   A+
Sbjct  171   SASSSSTAGPVPVATPADVFLRLWNSDIGDSFRKLAAAAVAESPSTVKATNDAVKQEEAA  230

Query  1000  GT  1005
              T
Sbjct  231   AT  232



>ref|XP_003535618.1| PREDICTED: transcription factor MYB3-like isoform X1 [Glycine 
max]
 ref|XP_006589547.1| PREDICTED: transcription factor MYB3-like isoform X2 [Glycine 
max]
 gb|KHN21736.1| Myb-related protein Myb4 [Glycine soja]
Length=309

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 148/198 (75%), Gaps = 1/198 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MG+ PCC+K G+++G WTPEED+ L+D+I K+G GSWRSLPK AGLLRCGKSCRLRW NY
Sbjct  1    MGKAPCCEKHGVRRGAWTPEEDQSLVDYIHKHGHGSWRSLPKHAGLLRCGKSCRLRWINY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRP IKRGPF+SEEE  ++QLHG+LGNRWA+IASQLPGRTDNEIKN WNTHLKKRLL   
Sbjct  61   LRPGIKRGPFTSEEESTIVQLHGMLGNRWASIASQLPGRTDNEIKNYWNTHLKKRLLR-S  119

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
               Q  +       P      +PS RHM QWES R+EAEARLS ES +L       +  D
Sbjct  120  CYSQRAKQLCVIPDPTIVKSESPSTRHMVQWESVRVEAEARLSMESTMLNSWPTSKTCPD  179

Query  874  FFLRIWNSEIGEAFRKFK  927
             FL++WNSE+G++FR  K
Sbjct  180  HFLQLWNSEVGKSFRMIK  197



>gb|KEH43718.1| myb transcription factor MIXTA-like protein [Medicago truncatula]
Length=295

 Score =   261 bits (667),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 159/217 (73%), Gaps = 12/217 (6%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MG+ PCC+K G+K+G WTPEEDE L+D+I K+G GSWR+LPK AGLLRCGKSCRLRW NY
Sbjct  1    MGKAPCCEKHGVKRGAWTPEEDEALVDYITKHGHGSWRTLPKHAGLLRCGKSCRLRWINY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRP IKRG F++EEE  +IQLH +LGNRWAAIA+QLPGRTDNEIKN WNTHLKKR+    
Sbjct  61   LRPGIKRGSFTNEEETTIIQLHAMLGNRWAAIAAQLPGRTDNEIKNYWNTHLKKRV----  116

Query  694  IDPQTHEPSSESIGPQRRLPT-TPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEA  870
               Q+       + P R + + +PS RHM QWESAR+EAE RLS ES LL   +   +  
Sbjct  117  --RQSLGEKHPCLLPDRNVQSNSPSTRHMVQWESARVEAETRLSLESTLLNSGSTTKTYP  174

Query  871  DFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSST  981
            D+FL++W+S++G+   KF+ GV   CQS +S   S +
Sbjct  175  DYFLQLWHSDVGD---KFRAGV--VCQSIVSLEESCS  206



>emb|CDY34696.1| BnaA01g33290D [Brassica napus]
Length=337

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 143/173 (83%), Gaps = 6/173 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I++NG GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKAGLKKGPWTPEEDQKLLAYIEENGHGSWRSLPEKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ L  RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLAKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSESI----GPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+  +E++    G  +    T S  HMAQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKHKNETLMSSTGQSKSAAATLS--HMAQWESARLEAEARLARESKLL  171



>ref|XP_003555377.1| PREDICTED: transcription factor MYB3-like isoform X1 [Glycine 
max]
 ref|XP_006606110.1| PREDICTED: transcription factor MYB3-like isoform X2 [Glycine 
max]
Length=309

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 150/200 (75%), Gaps = 5/200 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MG+ PCC+K G+++G WTPEED+ L+D+I+K+G GSWRSLPK AGLLRCGKSCRLRW NY
Sbjct  1    MGKAPCCEKHGVRRGAWTPEEDQALVDYIQKHGHGSWRSLPKHAGLLRCGKSCRLRWINY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRP IKRGPF+SEEE  ++QLHG+LGNRWA+IASQLPGRTDNEIKN WNTHLKKRLL   
Sbjct  61   LRPGIKRGPFTSEEESTIVQLHGMLGNRWASIASQLPGRTDNEIKNFWNTHLKKRLLR--  118

Query  694  IDPQTHEPSSESIGPQRRL--PTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSE  867
                +       + P + +    +PS RHM QWES R+E EARLS ES +L       + 
Sbjct  119  -SCHSQRAKQLCVIPDQSIVKSESPSTRHMVQWESVRVETEARLSLESTMLNSWPTSKTC  177

Query  868  ADFFLRIWNSEIGEAFRKFK  927
             D FL++W+SE+G++FR  K
Sbjct  178  PDHFLQLWHSEVGKSFRMIK  197



>gb|AGN52091.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52201.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=330

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 144/175 (82%), Gaps = 1/175 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIQEHGHGSWRALPPKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIAS LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIASHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIG  858
            IDP TH+P + ++G  +      +  HMAQWESARLEAEAR+ RESK LV ++ G
Sbjct  121  IDPTTHKPKNHALGCSQP-KEIANLSHMAQWESARLEAEARIVRESKQLVSNSYG  174



>ref|XP_011076175.1| PREDICTED: transcription factor MYB3-like [Sesamum indicum]
Length=320

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 166/229 (72%), Gaps = 13/229 (6%)
 Frame = +1

Query  349   CCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNYLRPDI  528
             CC+++G+K+G WT EED+ L+DFI +NG G+WR+LPKLAGLLRCGKSCRLRWTNYLRP+I
Sbjct  22    CCEREGVKRGVWTAEEDKILVDFITENGHGTWRNLPKLAGLLRCGKSCRLRWTNYLRPNI  81

Query  529   KRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMGIDPQT  708
             KRGPFS+EEE  +I LHG LGN+WAAIAS LPGRTDN+IKN WN+HL+KR+ +  +D   
Sbjct  82    KRGPFSTEEENTIIHLHGTLGNKWAAIASHLPGRTDNDIKNFWNSHLRKRVSNKALD---  138

Query  709   HEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSE--ADFFL  882
              +P S S     +   TPS RHM QWES R+EAE+RLS  +K L   T  GS+   D+FL
Sbjct  139   -QPPSSSKSVDIK-SDTPSTRHMVQWESVRVEAESRLS--NKPLPLRTPSGSKLGGDYFL  194

Query  883   RIWNSEIGEAFRKFKKGVK----FACQSPISQASSSTKYGSASGTTTEM  1017
             R+WNS++GE+FR   +        A  SP SQ SS TK  S S +TT M
Sbjct  195   RLWNSQVGESFRNINEITNECEGAASHSPTSQTSSLTKAESGSRSTTIM  243



>ref|XP_006400051.1| hypothetical protein EUTSA_v10014101mg [Eutrema salsugineum]
 dbj|BAJ34432.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41504.1| hypothetical protein EUTSA_v10014101mg [Eutrema salsugineum]
Length=326

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 167/240 (70%), Gaps = 19/240 (8%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1     MGRSPCCDKLGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61    LRPDIKRGKFNLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694   IDPQTHEPSSE----SIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL-----VP  846
             IDP TH+P +E    S+G  +   T     HMAQWESARLEAEARL+RESKLL       
Sbjct  121   IDPVTHKPKNETPLSSLGLSKNAAT---LSHMAQWESARLEAEARLARESKLLHYQSKTS  177

Query  847   STIGGSEADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDIT  1026
             S   G      +  W ++  E  ++         +SP S  S S    S++G  T+++  
Sbjct  178   SIHHGFTHKALITNWTTKPNEDQQQ-------QLESPTSTVSFSEMKESSNGIPTKIEFV  230



>gb|KHN26659.1| Myb-related protein Myb4 [Glycine soja]
Length=309

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 150/200 (75%), Gaps = 5/200 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MG+ PCC+K G+++G WTPEED+ L+D+I+K+G GSWRSLPK AGLLRCGKSCRLRW NY
Sbjct  1    MGKAPCCEKHGVRRGAWTPEEDQALVDYIQKHGHGSWRSLPKHAGLLRCGKSCRLRWINY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRP IKRGPF+SEEE  ++QLHG+LGNRWA+IASQLPGRTDNEIKN WNTHLKKRLL   
Sbjct  61   LRPGIKRGPFTSEEESTIVQLHGMLGNRWASIASQLPGRTDNEIKNFWNTHLKKRLLR--  118

Query  694  IDPQTHEPSSESIGPQRRL--PTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSE  867
                +       + P + +    +PS RHM QWES R+E EARLS ES +L       + 
Sbjct  119  -SCHSQIAKQLCVIPDQSIVKSESPSTRHMVQWESVRVETEARLSLESTMLNSWPTSKTC  177

Query  868  ADFFLRIWNSEIGEAFRKFK  927
             D FL++W+SE+G++FR  K
Sbjct  178  PDHFLQLWHSEVGKSFRMIK  197



>ref|XP_008439352.1| PREDICTED: transcription factor MYB34-like [Cucumis melo]
Length=348

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 157/251 (63%), Positives = 183/251 (73%), Gaps = 5/251 (2%)
 Frame = +1

Query  466   GLLRCGKSCRLRWTNYLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEI  645
             GLLRCGKSCRLRWTNYLRPDIKRGPF+ EEEKLVIQLHGILGNRWAAIASQLPGRTDNEI
Sbjct  89    GLLRCGKSCRLRWTNYLRPDIKRGPFTPEEEKLVIQLHGILGNRWAAIASQLPGRTDNEI  148

Query  646   KNLWNTHLKKRLLSMGIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSR  825
             KNLWNTHLKKRLL +GIDPQTHEP +         P +P+ RHMAQWESARLEAEARLSR
Sbjct  149   KNLWNTHLKKRLLCIGIDPQTHEPFNSRCSSS-TAPASPATRHMAQWESARLEAEARLSR  207

Query  826   ESKLLVPSTIG-GSEADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASG  1002
             ES L  P  +   +++DFFL+IWNSE+GE+FR+ ++  K  CQS  S  SSS K  S   
Sbjct  208   ESSLFTPLLMDRTTDSDFFLQIWNSEVGESFRRCRED-KTTCQSQ-SPLSSSVKCESLFI  265

Query  1003  TTTEMDITLAGSADAGGNPNEDPEGKCN-RSYTDDPLQGsetscsdeledssesalqlll  1179
               T   +   GS+    N   +     N +S TD  +  S++S ++E E+SS+SAL LLL
Sbjct  266   VATHDRVDYTGSSAMESNNENEETEYKNFQSMTDIVMSKSDSSSANEFEESSDSALGLLL  325

Query  1180  dFPTYNDMSFL  1212
             DFP  NDMSFL
Sbjct  326   DFPINNDMSFL  336



>ref|XP_006288195.1| hypothetical protein CARUB_v10001433mg [Capsella rubella]
 gb|EOA21093.1| hypothetical protein CARUB_v10001433mg [Capsella rubella]
Length=246

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 144/172 (84%), Gaps = 5/172 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  32   MGRSPCCDKLGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNY  91

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  92   LRPDIKRGKFNLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  151

Query  694  IDPQTHEPSSESIGPQRRLPTTPSA---RHMAQWESARLEAEARLSRESKLL  840
            IDP TH+P +E+  P   L  + +A    H AQWESARLEAEARL+RESKLL
Sbjct  152  IDPVTHKPKNET--PLSSLGLSKNAAILSHTAQWESARLEAEARLARESKLL  201



>gb|AHN60122.1| MYB transcription factor 16 [Brassica napus]
Length=310

 Score =   259 bits (662),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 150/193 (78%), Gaps = 6/193 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWT EED+KL+ +I ++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKMGLKKGPWTSEEDQKLLAYIDEHGHGSWRSLPEKAGLHRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFNLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSE----SIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGG  861
            IDP TH+P +E    ++G   +   T S  HMAQWESARLEAEARL+RESKLL   T   
Sbjct  121  IDPVTHKPKNETPLSTLGGLSKNAATLS--HMAQWESARLEAEARLARESKLLHYQTKVS  178

Query  862  SEADFFLRIWNSE  900
            S     L I +S+
Sbjct  179  SSHHDHLNIISSD  191



>emb|CDY37542.1| BnaA05g34070D [Brassica napus]
Length=338

 Score =   260 bits (664),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 144/173 (83%), Gaps = 7/173 (4%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  19   MGRSPCCDKDGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNY  78

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  79   LRPDIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  138

Query  694  IDPQTHEPSSESI----GPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+  +E++    G  + L T     HMAQWESARLEAEARL+RESKLL
Sbjct  139  IDPVTHKHKNETLLSSTGQSKNLAT---LSHMAQWESARLEAEARLARESKLL  188



>ref|XP_010525095.1| PREDICTED: transcription factor MYB122 isoform X1 [Tarenaya hassleriana]
 ref|XP_010525096.1| PREDICTED: transcription factor MYB122 isoform X1 [Tarenaya hassleriana]
 ref|XP_010525097.1| PREDICTED: transcription factor MYB122 isoform X1 [Tarenaya hassleriana]
Length=369

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 146/177 (82%), Gaps = 5/177 (3%)
 Frame = +1

Query  319  GKRVGMGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRL  498
            G    + R+PCCDK GLKKGPWTPEED+KL+ FI+++G GSWRSLP+ AGL RCGKSCRL
Sbjct  2    GSARNLRRSPCCDKVGLKKGPWTPEEDQKLLAFIEEHGHGSWRSLPEKAGLQRCGKSCRL  61

Query  499  RWTNYLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKR  678
            RWTNYLRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKR
Sbjct  62   RWTNYLRPDIKRGKFTLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKR  121

Query  679  LLSMGIDPQTHEPSSESI---GPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            L+ MGIDP TH+P +E++   G Q +   T S  HMAQWESARLEAEARL+RESKLL
Sbjct  122  LVKMGIDPVTHKPKNETLLSSGGQSKNAATLS--HMAQWESARLEAEARLARESKLL  176



>emb|CDX69532.1| BnaA10g18810D [Brassica napus]
Length=322

 Score =   259 bits (662),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 164/238 (69%), Gaps = 17/238 (7%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1     MGRSPCCDKLGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKK L+ MG
Sbjct  61    LRPDIKRGKFNLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKLLVKMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIG-----  858
             IDP TH+P +E+  P        +  HMAQWESARLEAEARL+RESKLL   T       
Sbjct  121   IDPVTHKPKNET--PLGLSKNAATLSHMAQWESARLEAEARLARESKLLHYQTKASTHHH  178

Query  859   --GSEADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTTTEMDIT  1026
               G      L  W ++  +  ++         +SP S  S S     ++G + +M+ T
Sbjct  179   HHGFTHKTLLTNWTTKTNQDQQQL--------ESPTSTVSFSDMKEPSTGLSAKMEFT  228



>gb|AHN60121.1| MYB transcription factor 106 [Brassica napus]
Length=337

 Score =   259 bits (663),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 143/173 (83%), Gaps = 6/173 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKAGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ L  RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLAKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSESI----GPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+  +E++    G  +    T S  HMAQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKHKNETLMSSTGQSKSAAATLS--HMAQWESARLEAEARLARESKLL  171



>ref|XP_009117713.1| PREDICTED: transcription factor MYB34-like [Brassica rapa]
Length=337

 Score =   259 bits (663),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 143/173 (83%), Gaps = 6/173 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKAGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ L  RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLAKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSESI----GPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+  +E++    G  +    T S  HMAQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKHKNETLMSSTGQSKSAAATLS--HMAQWESARLEAEARLARESKLL  171



>dbj|BAD25229.1| putative P-type R2R3 Myb protein [Oryza sativa Japonica Group]
Length=300

 Score =   258 bits (659),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 155/225 (69%), Gaps = 42/225 (19%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR PCCDKKGLKKGPWTPEED+ L+D+I+ NG GSWR LPKLAGL RCGKSCRLRWTNY
Sbjct  1    MGRAPCCDKKGLKKGPWTPEEDKLLVDYIQANGHGSWRLLPKLAGLNRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRGPF++EE+K ++QLHGI+GN+W+ IA+QLPGRTDNEIKN WNTHLKK+L  MG
Sbjct  61   LRPDIKRGPFTAEEQKSIVQLHGIVGNKWSMIAAQLPGRTDNEIKNYWNTHLKKQLRRMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPS--------  849
            +D     P++            P+ARHMAQWE+ARLEAEARLS    LL  S        
Sbjct  121  LDDPPPGPAA----------GCPAARHMAQWETARLEAEARLS----LLSSSGAAATTTI  166

Query  850  --------------------TIGGSEADFFLRIWNSEIGEAFRKF  924
                                    S AD FLR+WNS IG++FRK 
Sbjct  167  TAATTTTSASSSSTTAGPVAAAATSPADVFLRLWNSSIGDSFRKL  211



>gb|EAY86854.1| hypothetical protein OsI_08238 [Oryza sativa Indica Group]
Length=300

 Score =   258 bits (659),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 155/225 (69%), Gaps = 42/225 (19%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR PCCDKKGLKKGPWTPEED+ L+D+I+ NG GSWR LPKLAGL RCGKSCRLRWTNY
Sbjct  1    MGRAPCCDKKGLKKGPWTPEEDKLLVDYIQANGHGSWRLLPKLAGLNRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRGPF++EE+K ++QLHGI+GN+W+ IA+QLPGRTDNEIKN WNTHLKK+L  MG
Sbjct  61   LRPDIKRGPFTAEEQKSIVQLHGIVGNKWSMIAAQLPGRTDNEIKNYWNTHLKKQLRRMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPS--------  849
            +D     P++            P+ARHMAQWE+ARLEAEARLS    LL  S        
Sbjct  121  LDDPPPGPAA----------GCPAARHMAQWETARLEAEARLS----LLSSSGAAATTTI  166

Query  850  --------------------TIGGSEADFFLRIWNSEIGEAFRKF  924
                                    S AD FLR+WNS IG++FRK 
Sbjct  167  TAATTTTSTSSSSTTAGPVAAAATSPADVFLRLWNSSIGDSFRKL  211



>gb|AAF26160.1|AC008261_17 putative Myb-related transcription factor [Arabidopsis thaliana]
 gb|AAF65559.1|AF249309_1 putative transcription factor [Arabidopsis thaliana]
Length=345

 Score =   259 bits (662),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKAGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLIKMG  120

Query  694  IDPQTHEPSSESIGPQR-RLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+  +E++     +     +  HMAQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKHKNETLSSSTGQSKNAATLSHMAQWESARLEAEARLARESKLL  170



>ref|XP_006408465.1| hypothetical protein EUTSA_v10021048mg [Eutrema salsugineum]
 gb|ESQ49918.1| hypothetical protein EUTSA_v10021048mg [Eutrema salsugineum]
Length=349

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 141/170 (83%), Gaps = 1/170 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+ +G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKAGLKKGPWTPEEDQKLLAYIEDHGHGSWRSLPEKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ L  RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLAKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+  +E+ + P  +     +  HMAQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKHKNETLLSPTGQSKNAATLSHMAQWESARLEAEARLARESKLL  170



>emb|CDX85555.1| BnaA02g02580D [Brassica napus]
Length=359

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 150/193 (78%), Gaps = 6/193 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWT EED+KL+ +I ++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  50   MGRSPCCDKMGLKKGPWTSEEDQKLLAYIDEHGHGSWRSLPEKAGLHRCGKSCRLRWTNY  109

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  110  LRPDIKRGKFNLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  169

Query  694  IDPQTHEPSSE----SIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGG  861
            IDP TH+P +E    ++G   +   T S  HMAQWESARLEAEARL+RESKLL   T   
Sbjct  170  IDPVTHKPKNETPLSTLGGLSKNAATLS--HMAQWESARLEAEARLARESKLLHYQTKVS  227

Query  862  SEADFFLRIWNSE  900
            S     L I +S+
Sbjct  228  SSHHEHLNIISSD  240



>ref|XP_003528577.1| PREDICTED: transcription factor MYB51-like [Glycine max]
Length=422

 Score =   261 bits (668),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 146/177 (82%), Gaps = 2/177 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K+GLKKGPWTPEED+KL+ +I++ G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKEGLKKGPWTPEEDQKLMAYIEEFGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+QLP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIAAQLPKRTDNEIKNYWNTHLKKRLTRMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSAR--HMAQWESARLEAEARLSRESKLLVPSTIG  858
            IDP TH+P ++++G      T  +A   HMAQWESARLEAEARL RESKL V + +G
Sbjct  121  IDPTTHKPKTDALGGSGGGQTRDAANLSHMAQWESARLEAEARLVRESKLQVQNNLG  177



>emb|CDY55802.1| BnaCnng29120D [Brassica napus]
Length=327

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 143/173 (83%), Gaps = 6/173 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKAGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ L  RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLAKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSESI----GPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+  +E++    G  +    T S  HMAQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKHKNETLMSSTGQSKSAAATLS--HMAQWESARLEAEARLARESKLL  171



>ref|XP_003556724.1| PREDICTED: transcription factor MYB51-like [Glycine max]
Length=426

 Score =   261 bits (667),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 146/179 (82%), Gaps = 2/179 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I++ G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLMAYIEEFGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+QLP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIAAQLPKRTDNEIKNYWNTHLKKRLTRMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSAR--HMAQWESARLEAEARLSRESKLLVPSTIGGS  864
            IDP TH+P ++++G      T  +A   HMAQWESARLEAEARL RESKL V + +G +
Sbjct  121  IDPTTHKPKTDALGGAGGGQTRDAANLSHMAQWESARLEAEARLVRESKLQVQNNLGSN  179



>emb|CDY43270.1| BnaC05g48630D [Brassica napus]
Length=344

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 144/173 (83%), Gaps = 7/173 (4%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  19   MGRSPCCDKDGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNY  78

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  79   LRPDIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  138

Query  694  IDPQTHEPSSESI----GPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+  +E++    G  + L T     HMAQWESARLEAEAR++RESKLL
Sbjct  139  IDPVTHKHKNETLLSSTGQSKNLATLS---HMAQWESARLEAEARIARESKLL  188



>ref|XP_010425344.1| PREDICTED: protein ODORANT1 isoform X1 [Camelina sativa]
Length=354

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKAGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRLL MG
Sbjct  61   LRPDIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLLKMG  120

Query  694  IDPQTHEPSSESIGPQR-RLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+  +E++     +     +  HMAQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKHKNETLSSSTGQSKNAATLSHMAQWESARLEAEARLARESKLL  170



>ref|XP_003621270.1| MYB transcription factor [Medicago truncatula]
 gb|AES77488.1| myb transcription factor mixta-like protein [Medicago truncatula]
Length=309

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWT EED+KL+ +I+++G GSWRSLP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKVGLKKGPWTSEEDQKLLSYIEEHGHGSWRSLPTKAGLERCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH  LGNRW++IA++LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSVQEEQTIIQLHAFLGNRWSSIATRLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +E++ P+       +  H AQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKPKNETLLPENHSKNVANLSHKAQWESARLEAEARLVRESKL  168



>ref|XP_003569965.1| PREDICTED: myb-related protein Myb4-like [Brachypodium distachyon]
Length=286

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/255 (53%), Positives = 162/255 (64%), Gaps = 32/255 (13%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCD KGLKKGPWT EED+ L+DFI+ NG GSWR LPKLAGL RCGKSCRLRWTNY
Sbjct  1     MGRAPCCDNKGLKKGPWTLEEDKVLVDFIQANGHGSWRLLPKLAGLNRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRG F+ EE+K ++QLHGI+GN+W+ IA+QLPGRTDNEIKN WNTHLKK+L  MG
Sbjct  61    LRPDIKRGAFTDEEQKSIVQLHGIVGNKWSMIAAQLPGRTDNEIKNYWNTHLKKQLRRMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLS-----------------  822
             +D     P+             P+ARHMAQWE+ARLEAEARLS                 
Sbjct  121   LDEPPPGPTG----------GCPAARHMAQWETARLEAEARLSLLSSSAAAAAAATATTT  170

Query  823   -----RESKLLVPSTIGGSEADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKY  987
                    +     +      AD FLR+WNS+IG +FRK + G      S   +A  + K 
Sbjct  171   TTTSGSAASSSSSAAADSKPADVFLRLWNSDIGSSFRKVEAGHGPPVSSAKEEAHDAVKP  230

Query  988   GSASGTTTEMDITLA  1032
                  +++EMD   A
Sbjct  231   QGDESSSSEMDAASA  245



>ref|XP_011098652.1| PREDICTED: myb-related protein 306-like [Sesamum indicum]
Length=384

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/278 (50%), Positives = 173/278 (62%), Gaps = 29/278 (10%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1     MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61    LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLDKMG  120

Query  694   IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL----------  840
             IDP TH+P +++ +    +     +  HMAQWESARLEAEARL R+SKL           
Sbjct  121   IDPVTHKPKNDTLVASDGQSKNAANLSHMAQWESARLEAEARLVRQSKLRPGSSTSYQTQ  180

Query  841   ----------VPSTIGGSEADFFLRIWNSEI--------GEAFRKFKKGVKFACQSPISQ  966
                       V    G S     L+ WN  +        G +      G     +SP S 
Sbjct  181   SSEFASTSSPVQKPAGPSRCLDVLKAWNGVVWGKANEAAGASGGVSAVGTGGDLESPTST  240

Query  967   ASSSTKYGSASGTTTEMDITLAGSADAGGNPNEDPEGK  1080
              SS+   G +S    E+    +G+ D GG   ++ EG+
Sbjct  241   LSSAAGVGESSTAFVELVRNSSGTCDGGGTMKDESEGE  278



>ref|XP_010425981.1| PREDICTED: transcription factor MYB34 isoform X2 [Camelina sativa]
Length=352

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKAGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRLL MG
Sbjct  61   LRPDIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLLKMG  120

Query  694  IDPQTHEPSSESIGPQR-RLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+  +E++     +     +  HMAQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKHKNETLSSSTGQSKNAATLSHMAQWESARLEAEARLARESKLL  170



>ref|XP_010463575.1| PREDICTED: protein ODORANT1-like isoform X1 [Camelina sativa]
 ref|XP_010463576.1| PREDICTED: protein ODORANT1-like isoform X2 [Camelina sativa]
Length=354

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKAGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRLL MG
Sbjct  61   LRPDIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLLKMG  120

Query  694  IDPQTHEPSSESIGPQR-RLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+  +E++     +     +  HMAQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKHKNETLSSSTGQSKNAATLSHMAQWESARLEAEARLARESKLL  170



>emb|CDX78625.1| BnaA03g05370D [Brassica napus]
Length=322

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 144/172 (84%), Gaps = 5/172 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWT EED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKLGLKKGPWTQEEDQKLLAYIEEHGYGSWRSLPEKAGLHRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFNLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSA---RHMAQWESARLEAEARLSRESKLL  840
            IDP TH+P +E+  P   L  T +A    HMAQWESARLEAEARL+RESK+L
Sbjct  121  IDPVTHKPKNET--PLSSLGLTKNAAILSHMAQWESARLEAEARLARESKIL  170



>gb|ADD64500.1| MYBML1 [Dendrobium crumenatum]
Length=368

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+K+G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEKHGHGSWRALPTKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSMQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESIGP-QRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEA  870
            IDP TH+P S+++           +  HMAQWESARLEAEARL RESKL   STI  + A
Sbjct  121  IDPITHKPKSDNLSSVDGHSKCAANLNHMAQWESARLEAEARLVRESKLR--STIPSNTA  178

Query  871  DFF  879
            + F
Sbjct  179  NAF  181



>ref|XP_010492363.1| PREDICTED: myb-related protein Hv1-like isoform X1 [Camelina 
sativa]
Length=335

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/262 (53%), Positives = 172/262 (66%), Gaps = 25/262 (10%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1     MGRSPCCDKLGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61    LRPDIKRGKFNLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSA---RHMAQWESARLEAEARLSRESKLL--------  840
             IDP TH+P +E+  P   L  + +A    H AQWESARLEAEARL+RESKLL        
Sbjct  121   IDPVTHKPKNET--PLSSLGLSKNAAILSHTAQWESARLEAEARLARESKLLHLQHYQTK  178

Query  841   VPSTIGGSEADF----FLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGTT  1008
             V S        F     L  W ++  E +         A Q  + ++ +ST   S     
Sbjct  179   VSSHHHHHHHGFTHKSLLTNWTTKTNEEYN--------AEQQQLDESPTSTVSFSEMKEP  230

Query  1009  TEMDITLAGSADAGGNPNEDPE  1074
                 I   GS+  G +  ++PE
Sbjct  231   NPTKIEFVGSSTGGLSLMKEPE  252



>ref|XP_009131458.1| PREDICTED: myb-related protein Hv1-like [Brassica rapa]
Length=326

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 144/172 (84%), Gaps = 5/172 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWT EED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKLGLKKGPWTQEEDQKLLAYIEEHGYGSWRSLPEKAGLHRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFNLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSA---RHMAQWESARLEAEARLSRESKLL  840
            IDP TH+P +E+  P   L  T +A    HMAQWESARLEAEARL+RESK+L
Sbjct  121  IDPVTHKPKNET--PLSSLGLTKNAAILSHMAQWESARLEAEARLARESKIL  170



>ref|XP_010485421.1| PREDICTED: protein ODORANT1-like isoform X1 [Camelina sativa]
Length=354

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKAGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRLL MG
Sbjct  61   LRPDIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLLKMG  120

Query  694  IDPQTHEPSSESIGPQR-RLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+  +E++     +     +  HMAQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKHKNETLSSSTGQSKNAATLSHMAQWESARLEAEARLARESKLL  170



>ref|XP_006296712.1| hypothetical protein CARUB_v10013887mg [Capsella rubella]
 gb|EOA29610.1| hypothetical protein CARUB_v10013887mg [Capsella rubella]
Length=396

 Score =   259 bits (663),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 143/172 (83%), Gaps = 1/172 (1%)
 Frame = +1

Query  328  VGMGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWT  507
            + MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWT
Sbjct  41   IIMGRSPCCDKAGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWT  100

Query  508  NYLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLS  687
            NYLRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRLL 
Sbjct  101  NYLRPDIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLLK  160

Query  688  MGIDPQTHEPSSESIGPQR-RLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            MGIDP TH+  +E++     +     +  HMAQWESARLEAEARL+RESKLL
Sbjct  161  MGIDPVTHKHKNETLSSSTGQSKNAATLSHMAQWESARLEAEARLARESKLL  212



>ref|XP_010485422.1| PREDICTED: transcription factor MYB34-like isoform X2 [Camelina 
sativa]
Length=352

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKAGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRLL MG
Sbjct  61   LRPDIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLLKMG  120

Query  694  IDPQTHEPSSESIGPQR-RLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+  +E++     +     +  HMAQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKHKNETLSSSTGQSKNAATLSHMAQWESARLEAEARLARESKLL  170



>ref|XP_009126044.1| PREDICTED: transcription factor MYB34-like [Brassica rapa]
Length=310

 Score =   256 bits (655),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 137/235 (58%), Positives = 164/235 (70%), Gaps = 18/235 (8%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR+PC DK GLKKGPWT EED+KL+ +I ++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1     MGRSPCYDKMGLKKGPWTSEEDQKLLAYIDEHGHGSWRSLPEKAGLHRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61    LRPDIKRGKFNLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694   IDPQTHEPSSE----SIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGG  861
             IDP TH+P +E    S+G   +   T S  HMAQWESARLEAEARL+RESKLL   T   
Sbjct  121   IDPVTHKPKNETPLSSLGGLSKNAATLS--HMAQWESARLEAEARLARESKLLHYQTKVS  178

Query  862   SEADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSS---TKYGSASGTTTEM  1017
             S     L I +S+         K  +   +SP S  S S   T++  +S T   M
Sbjct  179   SSHHDHLNIISSD---------KQKQQQLESPTSTVSFSEGKTEFVGSSSTCLNM  224



>ref|XP_010424105.1| PREDICTED: myb-related protein Hv1-like [Camelina sativa]
Length=309

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 144/172 (84%), Gaps = 5/172 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKLGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ ++QLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFNLQEEQTIVQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSA---RHMAQWESARLEAEARLSRESKLL  840
            IDP TH+P +E+  P   L  + +A    H AQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKPKNET--PLSSLGLSKNAAILSHTAQWESARLEAEARLARESKLL  170



>ref|XP_007158642.1| hypothetical protein PHAVU_002G170000g [Phaseolus vulgaris]
 gb|ESW30636.1| hypothetical protein PHAVU_002G170000g [Phaseolus vulgaris]
Length=399

 Score =   259 bits (662),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 145/177 (82%), Gaps = 2/177 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I++ G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDKKLMAYIEEFGHGSWRALPSKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+QLP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIAAQLPKRTDNEIKNYWNTHLKKRLTRMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSAR--HMAQWESARLEAEARLSRESKLLVPSTIG  858
            IDP TH+P ++++G      +  +A   HMAQWESARLEAEARL RESKL V + +G
Sbjct  121  IDPTTHKPKTDALGGSGGCQSKDAANLSHMAQWESARLEAEARLVRESKLQVQNNLG  177



>ref|XP_010492364.1| PREDICTED: myb-related protein Hv1-like isoform X2 [Camelina 
sativa]
Length=331

 Score =   257 bits (656),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 144/172 (84%), Gaps = 5/172 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKLGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFNLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSA---RHMAQWESARLEAEARLSRESKLL  840
            IDP TH+P +E+  P   L  + +A    H AQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKPKNET--PLSSLGLSKNAAILSHTAQWESARLEAEARLARESKLL  170



>gb|AAO49410.1|AF485892_1 MYB1 [Dendrobium sp. XMW-2002-1]
Length=367

 Score =   258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+K+G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEKHGHGSWRALPNKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSMQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESIGPQR-RLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P S+++         T +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPITHKPKSDNLSSADGHSKCTANLNHMAQWESARLEAEARLVRESKL  169



>ref|NP_001078589.1| myb domain protein 16 [Arabidopsis thaliana]
 gb|AED92147.1| myb domain protein 16 [Arabidopsis thaliana]
Length=315

 Score =   256 bits (655),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 144/172 (84%), Gaps = 5/172 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKLGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFNLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSA---RHMAQWESARLEAEARLSRESKLL  840
            IDP TH+P +E+  P   L  + +A    H AQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKPKNET--PLSSLGLSKNAAILSHTAQWESARLEAEARLARESKLL  170



>gb|ACN31881.1| unknown [Zea mays]
 gb|AFW72525.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04391.1| MYB transcription factor, partial [Zea mays]
Length=293

 Score =   255 bits (652),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 155/217 (71%), Gaps = 31/217 (14%)
 Frame = +1

Query  334  MGRTPCCDK-KGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTN  510
            MGR PCCD+ KGLKKGPWTPEED+ L+D+I+ NG GSWR LPKLAGL RCGKSCRLRWTN
Sbjct  1    MGRAPCCDRTKGLKKGPWTPEEDKLLVDYIQTNGHGSWRLLPKLAGLNRCGKSCRLRWTN  60

Query  511  YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
            YLRPDIKRGPF+SEE+K ++QLH I+GN+W+ IA+QLPGRTDNEIKN WNTHLKK+L  M
Sbjct  61   YLRPDIKRGPFTSEEQKSIVQLHAIVGNKWSMIAAQLPGRTDNEIKNYWNTHLKKQLRRM  120

Query  691  GIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSE-  867
            G+D     P++            PSARHMAQWE+ARLEAEARLS  +     S+ G    
Sbjct  121  GLDEPPPGPAA----------GCPSARHMAQWETARLEAEARLSLLATAASSSSCGAIAA  170

Query  868  -------------------ADFFLRIWNSEIGEAFRK  921
                               AD FLR+W+S+IG++FR+
Sbjct  171  TSASSSSSTVDLKTACARPADIFLRLWSSDIGDSFRR  207



>gb|KHN01977.1| Transcription factor MYB39 [Glycine soja]
Length=428

 Score =   260 bits (664),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 139/168 (83%), Gaps = 3/168 (2%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KLI FI+K+G GSWR+LP  AGL RCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKTGLKKGPWTPEEDQKLIAFIEKHGHGSWRALPAKAGLRRCGKSCRLRWSNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIAS LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIASHLPKRTDNEIKNYWNTHLKKRLDKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +ES+   +      +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPTTHKPKNESLAYSK---DGSNLGHMAQWESARLEAEARLVRESKL  165



>ref|XP_003520088.1| PREDICTED: transcription factor MYB28-like [Glycine max]
Length=429

 Score =   260 bits (664),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 139/168 (83%), Gaps = 3/168 (2%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KLI FI+K+G GSWR+LP  AGL RCGKSCRLRW+NY
Sbjct  1    MGRSPCCEKTGLKKGPWTPEEDQKLIAFIEKHGHGSWRALPAKAGLRRCGKSCRLRWSNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIAS LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIASHLPKRTDNEIKNYWNTHLKKRLDKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +ES+   +      +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPTTHKPKNESLAYSK---DGSNLGHMAQWESARLEAEARLVRESKL  165



>ref|XP_010528356.1| PREDICTED: transcription factor MYB32-like [Tarenaya hassleriana]
Length=332

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 138/170 (81%), Gaps = 2/170 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEEDEKL+ +++++G G WRSLP  AGL RCGKSCRLRW NY
Sbjct  1    MGRSPCCDKDGLKKGPWTPEEDEKLLAYVEQHGHGGWRSLPSKAGLHRCGKSCRLRWINY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FSS+EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSSQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNHWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESIGPQR--RLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +E++      +     +  HMAQWESARLEAEARL RE+KL
Sbjct  121  IDPVTHKPKNETLLTMSTGQTKNVVNLSHMAQWESARLEAEARLVREAKL  170



>ref|NP_197035.1| myb domain protein 16 [Arabidopsis thaliana]
 gb|AAK43932.1|AF370613_1 myb-related protein-like [Arabidopsis thaliana]
 emb|CAB89341.1| myb-related protein-like [Arabidopsis thaliana]
 gb|AAS10094.1| MYB transcription factor [Arabidopsis thaliana]
 dbj|BAF00400.1| myb-related protein - like [Arabidopsis thaliana]
 gb|ABI49476.1| At5g15310 [Arabidopsis thaliana]
 gb|AED92146.1| myb domain protein 16 [Arabidopsis thaliana]
Length=326

 Score =   256 bits (655),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 144/172 (84%), Gaps = 5/172 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKLGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFNLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSA---RHMAQWESARLEAEARLSRESKLL  840
            IDP TH+P +E+  P   L  + +A    H AQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKPKNET--PLSSLGLSKNAAILSHTAQWESARLEAEARLARESKLL  170



>ref|XP_006288196.1| hypothetical protein CARUB_v10001433mg [Capsella rubella]
 gb|EOA21094.1| hypothetical protein CARUB_v10001433mg [Capsella rubella]
Length=328

 Score =   256 bits (655),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 144/172 (84%), Gaps = 5/172 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKLGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFNLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSA---RHMAQWESARLEAEARLSRESKLL  840
            IDP TH+P +E+  P   L  + +A    H AQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKPKNET--PLSSLGLSKNAAILSHTAQWESARLEAEARLARESKLL  170



>ref|XP_002871660.1| AtMIXTA/AtMYB16 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47919.1| AtMIXTA/AtMYB16 [Arabidopsis lyrata subsp. lyrata]
Length=327

 Score =   256 bits (655),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 144/172 (84%), Gaps = 5/172 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKLGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFNLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSA---RHMAQWESARLEAEARLSRESKLL  840
            IDP TH+P +E+  P   L  + +A    H AQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKPKNET--PLSSLGLSKNAAILSHTAQWESARLEAEARLARESKLL  170



>gb|KFK37575.1| hypothetical protein AALP_AA3G001200 [Arabis alpina]
Length=320

 Score =   256 bits (654),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 141/170 (83%), Gaps = 1/170 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            M R+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MVRSPCCDKAGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSESIGPQR-RLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+  +E++     +     +  HMAQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKHKNETLSSSSGQSKNAATLSHMAQWESARLEAEARLARESKLL  170



>ref|XP_011048715.1| PREDICTED: transcription factor MYB39-like [Populus euphratica]
Length=293

 Score =   255 bits (651),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 136/254 (54%), Positives = 165/254 (65%), Gaps = 22/254 (9%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR PCCD+ G+KKGPWT EED  L+ +I+KNG  SW SLPK AGL RCGKSCRLRWTNY
Sbjct  1     MGRGPCCDQDGVKKGPWTAEEDYLLVQYIQKNGFVSWHSLPKKAGLFRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRG FS  EE  +I LHGILGNRWA IASQLPGRTDNEIKN WN+HLKKRL S+G
Sbjct  61    LRPDIKRGRFSPAEEATIIHLHGILGNRWAHIASQLPGRTDNEIKNFWNSHLKKRLASIG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEAD  873
                Q ++ S+    P   +  +P   HM QWESAR+E EARLS +S L+  ++      D
Sbjct  121   PKLQINQSSN----PINIMCESPYC-HMVQWESARVE-EARLSMQSLLVKHTSTVKGHPD  174

Query  874   FFLRIWNSEIGEAFRKFKKGVKFACQSPISQA----------------SSSTKYGSASGT  1005
              F+++WNSE+GEAFR  K      C+S +S A                ++  K  ++  T
Sbjct  175   IFIQLWNSEVGEAFRNIKGKDVETCESLVSDAHPCVNIEPVLLDDTAPATPNKTSTSIDT  234

Query  1006  TTEMDITLAGSADA  1047
             T E + T   SAD 
Sbjct  235   TQEQEDTCKPSADV  248



>ref|XP_007151240.1| hypothetical protein PHAVU_004G029800g [Phaseolus vulgaris]
 gb|ESW23234.1| hypothetical protein PHAVU_004G029800g [Phaseolus vulgaris]
Length=408

 Score =   259 bits (661),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++ +    +  T  +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKPKNDALLSSDGQTKTAANLSHMAQWESARLEAEARLVRESKL  169



>ref|XP_007139534.1| hypothetical protein PHAVU_008G038000g [Phaseolus vulgaris]
 gb|ESW11528.1| hypothetical protein PHAVU_008G038000g [Phaseolus vulgaris]
Length=381

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLERCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSMQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLDKMG  120

Query  694  IDPQTHEPSSESI-GPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++I   +    +  +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKPKNDAILSTEGHSKSASNLSHMAQWESARLEAEARLVRESKL  169



>emb|CDX70606.1| BnaC03g06900D [Brassica napus]
Length=323

 Score =   255 bits (652),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 144/172 (84%), Gaps = 5/172 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWT EED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKLGLKKGPWTQEEDQKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFNLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSA---RHMAQWESARLEAEARLSRESKLL  840
            IDP TH+P +E+  P   L  + +A    HMAQWESARLEAEARL+RESK+L
Sbjct  121  IDPVTHKPKNET--PLSSLGLSKNASILSHMAQWESARLEAEARLARESKIL  170



>ref|XP_008341595.1| PREDICTED: transcription factor MYB34-like [Malus domestica]
Length=388

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 138/170 (81%), Gaps = 2/170 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPTKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESI--GPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P ++++            +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKPKNDALLXSADGHSKNVSNLSHMAQWESARLEAEARLVRESKL  170



>ref|XP_009360604.1| PREDICTED: myb-related protein 330-like [Pyrus x bretschneideri]
Length=389

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 138/170 (81%), Gaps = 2/170 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPTKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESI--GPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P ++++            +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKPKNDALLSSADGHSKNVSNLSHMAQWESARLEAEARLVRESKL  170



>gb|AFX97765.1| R2R3-MYB transcription factor [Dendrobium hybrid cultivar]
Length=367

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 142/278 (51%), Positives = 167/278 (60%), Gaps = 35/278 (13%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR+PCCDK GLKKGPWTPEED+KL+ +I+K+G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1     MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEKHGHGSWRALPNKAGLQRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61    LRPDIKRGKFSMQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694   IDPQTHEPSSESIGPQR-RLPTTPSARHMAQWESARLEAEARLSRESKLL----------  840
             IDP TH+P S+++           +  HMAQWESARLEAEARL RESKL           
Sbjct  121   IDPITHKPKSDNLSSADGHSKCAANLNHMAQWESARLEAEARLVRESKLRSSTIPSNTTT  180

Query  841   -------------VPSTIGGSEADFFLRIWNSEIGE--AFRKFKKGVKFACQSPISQASS  975
                          VP T   S     L  W     +  A     +G     +SP S  S 
Sbjct  181   TFTPKNQPLLPPPVPMTPAASPCLDVLSAWQGAWAKPAANNSLGRGYTIDLESPTSTLSF  240

Query  976   STKYGSASGTTTEMDITLAGSADAGGNPNEDPEGKCNR  1089
             S            M  T++G   A  +  ED + KC R
Sbjct  241   SDNM---------MAPTISGMGIAEDSTREDQQWKCLR  269



>dbj|BAF46264.1| putative transcription factor [Humulus lupulus]
Length=464

 Score =   259 bits (663),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSESIGPQRRLP-TTPSARHMAQWESARLEAEARLSRESKLLV  843
            IDP TH+P  +++G     P    +  HMAQWESARLEAEARL RESKLLV
Sbjct  121  IDPVTHKPKIDALGSGSGNPKDAANLSHMAQWESARLEAEARLVRESKLLV  171



>ref|XP_010453666.1| PREDICTED: myb-related protein Hv1-like [Camelina sativa]
Length=330

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 143/172 (83%), Gaps = 5/172 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKG WTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKLGLKKGSWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSA---RHMAQWESARLEAEARLSRESKLL  840
            IDP TH+P +E+  P   L  + +A    H AQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKPKNET--PLSSLGLSKNAAILSHTAQWESARLEAEARLARESKLL  170



>emb|CDY26411.1| BnaC09g42570D [Brassica napus]
Length=321

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 140/169 (83%), Gaps = 2/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+P CDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPYCDKLGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFNLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+P +E+  P        +  HMAQWESARLEAEAR +RESKLL
Sbjct  121  IDPVTHKPKNET--PLGLSKNAATLSHMAQWESARLEAEARFARESKLL  167



>gb|AAS10051.1| MYB transcription factor [Arabidopsis thaliana]
Length=345

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 141/170 (83%), Gaps = 1/170 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+P CDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPSCDKAGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLIKMG  120

Query  694  IDPQTHEPSSESIGPQR-RLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+  +E++     +     +  HMAQWESARLEAEARL+RESKLL
Sbjct  121  IDPVTHKHKNETLSSSTGQSKNAATLSHMAQWESARLEAEARLARESKLL  170



>ref|XP_010258093.1| PREDICTED: transcription factor MYB34-like [Nelumbo nucifera]
Length=404

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESIGP-QRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P S+++     +  T  +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKPKSDALSSVDGQSKTAATLSHMAQWESARLEAEARLVRESKL  169



>ref|XP_004489411.1| PREDICTED: transcription factor MYB28-like [Cicer arietinum]
Length=421

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPSKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++ +    +  T  +  HMAQWESARLEAEARL RESK+
Sbjct  121  IDPITHKPKNDTLVSNDGQSKTAANLSHMAQWESARLEAEARLVRESKI  169



>dbj|BAF49441.1| transcription factor DcMYB2 [Daucus carota]
Length=375

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 141/170 (83%), Gaps = 2/170 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPSKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSESIGPQR--RLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++I       L +T +  HMAQWESARLEAEARL R+SKL
Sbjct  121  IDPVTHKPKNDAILSSHDGHLKSTANLSHMAQWESARLEAEARLVRQSKL  170



>ref|XP_003533532.1| PREDICTED: transcription factor MYB39-like isoform X1 [Glycine 
max]
 ref|XP_006587742.1| PREDICTED: transcription factor MYB39-like isoform X2 [Glycine 
max]
 gb|KHN11626.1| Transcription factor MYB39 [Glycine soja]
Length=390

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 142/172 (83%), Gaps = 7/172 (4%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW++IA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSMQEEQTIIQLHALLGNRWSSIATHLPKRTDNEIKNYWNTHLKKRLDKMG  120

Query  694  IDPQTHEPSSESI----GPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P ++++    GP +      +  HMAQWESARLEAEARL+RESKL
Sbjct  121  IDPVTHKPKNDALLSTEGPSK---IAANISHMAQWESARLEAEARLARESKL  169



>ref|XP_004304285.1| PREDICTED: transcription factor MYB39-like [Fragaria vesca subsp. 
vesca]
Length=371

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 140/170 (82%), Gaps = 2/170 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPIKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSAR--HMAQWESARLEAEARLSRESKL  837
            IDP TH+P ++++       +  +A   HMAQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKPKNDALLSAHDGQSKNAANLSHMAQWESARLEAEARLVRESKL  170



>gb|EPS71765.1| protein 1, partial [Genlisea aurea]
Length=211

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 138/169 (82%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDHKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFTLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH P +++ +    +  +  +  HMAQWESARLEAEARL R+SKL
Sbjct  121  IDPVTHTPKNDALLSNDGQAKSAANLSHMAQWESARLEAEARLVRQSKL  169



>ref|XP_009376291.1| PREDICTED: transcription factor MYB34 [Pyrus x bretschneideri]
Length=389

 Score =   257 bits (656),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 138/170 (81%), Gaps = 2/170 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPTKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESI--GPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P  +++      +     +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKPKKDNLLSSADGQSKNASNLSHMAQWESARLEAEARLVRESKL  170



>ref|XP_007046022.1| Myb domain protein 106, putative [Theobroma cacao]
 gb|EOY01854.1| Myb domain protein 106, putative [Theobroma cacao]
Length=372

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 140/170 (82%), Gaps = 1/170 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRW NY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWINY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPT-TPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+P ++++G     P    +  HMAQWESARLEAEARL RESKL+
Sbjct  121  IDPVTHKPKTDALGSASGNPKDAANLSHMAQWESARLEAEARLVRESKLV  170



>ref|XP_004491833.1| PREDICTED: transcription factor MYB39-like isoform X2 [Cicer 
arietinum]
Length=361

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I++NG GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEENGHGSWRALPSKAGLERCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW++IA+ LP RTDNEIKN WNTHLKK+L  +G
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSSIATHLPKRTDNEIKNYWNTHLKKKLTKLG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+  +ESI       +  +  HMAQWESARLEAEARL +ESK+
Sbjct  121  IDPVTHKSKNESIFSDGHSKSAANLSHMAQWESARLEAEARLVKESKI  168



>ref|XP_006431202.1| hypothetical protein CICLE_v10011948mg [Citrus clementina]
 gb|ESR44442.1| hypothetical protein CICLE_v10011948mg [Citrus clementina]
Length=384

 Score =   256 bits (654),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++ +    +   + +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKPKNDALLSSDGQNKNSANLSHMAQWESARLEAEARLVRESKL  169



>ref|XP_010088130.1| Transcription factor [Morus notabilis]
 ref|XP_010105021.1| Transcription factor [Morus notabilis]
 gb|EXB31942.1| Transcription factor [Morus notabilis]
 gb|EXC03130.1| Transcription factor [Morus notabilis]
Length=389

 Score =   256 bits (655),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 140/171 (82%), Gaps = 5/171 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESI---GPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P ++ +   G Q +     +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKPKNDLLSNDGAQSK--NAANLSHMAQWESARLEAEARLVRESKL  169



>gb|ACJ07153.1| R2R3 MYB transcription factor [Gossypium hirsutum]
Length=309

 Score =   254 bits (648),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 142/173 (82%), Gaps = 2/173 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRW NY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLLAYIEQHGHGSWRALPLKAGLQRCGKSCRLRWINY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPT-TPSARHMAQWESARLEAEARLSRESKLLVPS  849
            IDP TH+P ++++G     P    +  HMAQWESARLEAEARL RESK LVPS
Sbjct  121  IDPVTHKPKTDALGSTTGNPKDAANLSHMAQWESARLEAEARLVRESK-LVPS  172



>ref|XP_002283843.1| PREDICTED: myb-related protein 306-like [Vitis vinifera]
Length=393

 Score =   256 bits (655),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPSKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P S++ +    +     +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKPKSDALLSSDGQSKNAANLSHMAQWESARLEAEARLVRESKL  169



>gb|KDO72620.1| hypothetical protein CISIN_1g016708mg [Citrus sinensis]
Length=384

 Score =   256 bits (654),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++ +    +   + +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKPKNDALLSSDGQNKNSANLSHMAQWESARLEAEARLVRESKL  169



>ref|XP_006438735.1| hypothetical protein CICLE_v10033327mg [Citrus clementina]
 gb|ESR51975.1| hypothetical protein CICLE_v10033327mg [Citrus clementina]
 gb|KDO82998.1| hypothetical protein CISIN_1g039016mg [Citrus sinensis]
Length=367

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 139/169 (82%), Gaps = 3/169 (2%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ FI+++G GSWR+LP  AGL RCGKSCRLRW NY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLLAFIEQHGHGSWRALPAKAGLQRCGKSCRLRWINY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIAAHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+P +  +G  +    T +  HMAQWESARLEAEARL RESKL+
Sbjct  121  IDPVTHKPKTNPLGQPK---DTANLSHMAQWESARLEAEARLVRESKLV  166



>gb|AAK19616.1|AF336283_1 GHMYB25 [Gossypium hirsutum]
Length=309

 Score =   254 bits (648),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 142/173 (82%), Gaps = 2/173 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRW NY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLLAYIEQHGHGSWRALPLKAGLQRCGKSCRLRWINY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPT-TPSARHMAQWESARLEAEARLSRESKLLVPS  849
            IDP TH+P ++++G     P    +  HMAQWESARLEAEARL RESK LVPS
Sbjct  121  IDPVTHKPKTDALGSTTGNPIDAANLSHMAQWESARLEAEARLVRESK-LVPS  172



>ref|XP_007032600.1| Myb domain protein 106 [Theobroma cacao]
 gb|EOY03526.1| Myb domain protein 106 [Theobroma cacao]
Length=401

 Score =   256 bits (655),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P S++ +    +     +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKPKSDALLSTDGQSKNAANLSHMAQWESARLEAEARLVRESKL  169



>ref|XP_004491832.1| PREDICTED: transcription factor MYB39-like isoform X1 [Cicer 
arietinum]
Length=364

 Score =   255 bits (652),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I++NG GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEENGHGSWRALPSKAGLERCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW++IA+ LP RTDNEIKN WNTHLKK+L  +G
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSSIATHLPKRTDNEIKNYWNTHLKKKLTKLG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+  +ESI       +  +  HMAQWESARLEAEARL +ESK+
Sbjct  121  IDPVTHKSKNESIFSDGHSKSAANLSHMAQWESARLEAEARLVKESKI  168



>gb|KHN13211.1| Transcription factor MYB39 [Glycine soja]
Length=411

 Score =   257 bits (656),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++ +    +  T  +  HMAQWESARLEAEARL RESK+
Sbjct  121  IDPVTHKPKNDALLSSDGQSKTAANLSHMAQWESARLEAEARLVRESKI  169



>ref|XP_006482628.1| PREDICTED: transcription factor MYB28-like [Citrus sinensis]
Length=388

 Score =   256 bits (654),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++ +    +   + +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKPKNDALLSSDGQNKNSANLSHMAQWESARLEAEARLVRESKL  169



>emb|CDP00365.1| unnamed protein product [Coffea canephora]
Length=323

 Score =   254 bits (648),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 138/169 (82%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKG WT EED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGTWTAEEDQKLLTYIERHGHGSWRALPSKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIAAHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+P + + G  ++     +  HMAQWESARLEAEARL RESKLL
Sbjct  121  IDPATHKPKTNAFGCSQQ-KDAANLSHMAQWESARLEAEARLVRESKLL  168



>gb|AFK36884.1| unknown [Medicago truncatula]
Length=357

 Score =   254 bits (650),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 137/171 (80%), Gaps = 3/171 (2%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I ++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIDEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ L  RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLAKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSESI---GPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P ++++          T  +  HMAQWESARLEAEARL RESK+
Sbjct  121  IDPVTHKPKNDALLSSSDNAHSKTASNLSHMAQWESARLEAEARLVRESKI  171



>ref|XP_003618530.1| MYB transcription factor [Medicago truncatula]
 gb|AES74748.1| myb transcription factor mixta-like protein [Medicago truncatula]
 gb|AFK45247.1| unknown [Medicago truncatula]
Length=357

 Score =   254 bits (650),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 137/171 (80%), Gaps = 3/171 (2%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I ++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIDEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ L  RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLAKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSESI---GPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P ++++          T  +  HMAQWESARLEAEARL RESK+
Sbjct  121  IDPVTHKPKNDALLSSSDNAHSKTASNLSHMAQWESARLEAEARLVRESKI  171



>gb|AGO03566.1| MIXTA-like 2 [Erythranthe lewisii]
Length=382

 Score =   255 bits (652),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 141/275 (51%), Positives = 173/275 (63%), Gaps = 25/275 (9%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1     MGRSPCCDKIGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPSKAGLQRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61    LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694   IDPQTHEPSSESIGPQRRLPTTPSAR--HMAQWESARLEAEARLSRESKLLVPS--TIGG  861
             IDP TH+P +++I       +  +A   HMAQWESARLEAEARL R+SKL   S  +I  
Sbjct  121   IDPVTHKPKNDAILTSNDGESKNAANLSHMAQWESARLEAEARLVRQSKLRAGSSNSIQA  180

Query  862   SEADF------------------FLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKY  987
               ++F                   L+ WN  +  A      G      SP S  SS+   
Sbjct  181   QNSEFASTSSQLQKPVVPARCLDVLKAWNGGVWSAGGGGGGGEL---GSPTSTLSSAAGV  237

Query  988   GSASGTTTEMDITLAGSADAGGNPNEDPEGKCNRS  1092
             G +S    E      GS +  G   E+ E +  R+
Sbjct  238   GESSAALLEFVGNSFGSCEDSGMMKEESEEEWKRA  272



>ref|XP_003543812.1| PREDICTED: protein ODORANT1-like [Glycine max]
Length=422

 Score =   256 bits (655),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++ +    +  T  +  HMAQWESARLEAEARL RESK+
Sbjct  121  IDPVTHKPKNDALLSSDGQSKTAANLSHMAQWESARLEAEARLVRESKI  169



>ref|XP_007217733.1| hypothetical protein PRUPE_ppa006769mg [Prunus persica]
 gb|EMJ18932.1| hypothetical protein PRUPE_ppa006769mg [Prunus persica]
Length=396

 Score =   256 bits (653),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 141/176 (80%), Gaps = 2/176 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPTKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESI--GPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTI  855
            IDP TH+P ++++            +  HMAQWESARLEAEARL RESKL   S++
Sbjct  121  IDPVTHKPKNDALLSTVDGHSKNASNLSHMAQWESARLEAEARLVRESKLRSHSSL  176



>ref|XP_003554566.1| PREDICTED: transcription factor MYB51 [Glycine max]
Length=410

 Score =   256 bits (654),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTH+KKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHIKKRLTKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++ +    +  T  +  HMAQWESARLEAEARL RESK+
Sbjct  121  IDPVTHKPKNDALLSSDGQSKTAANLSHMAQWESARLEAEARLVRESKI  169



>ref|XP_008230795.1| PREDICTED: myb-related protein 330 [Prunus mume]
Length=396

 Score =   256 bits (653),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 142/176 (81%), Gaps = 2/176 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPTKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESI--GPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTI  855
            IDP TH+P ++++      +     +  HMAQWESARLEAEARL RESKL   S++
Sbjct  121  IDPVTHKPKNDALLSTVDGQSKNASNLSHMAQWESARLEAEARLVRESKLRSHSSL  176



>gb|AEO27486.1| MIXTA-like transcription factor [Lotus japonicus]
Length=408

 Score =   256 bits (654),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 144/187 (77%), Gaps = 5/187 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+ CCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSQCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL----LVPSTIG  858
            IDP TH+P +++ +    +  T  +  HMAQWESARLEAEARL RESKL    L    +G
Sbjct  121  IDPVTHKPKNDALLSSDGQSKTAANLSHMAQWESARLEAEARLVRESKLRSHSLQNHHLG  180

Query  859  GSEADFF  879
             S    F
Sbjct  181  SSHHHVF  187



>gb|AAV70655.1| MYB transcription factor MIXTA-like 2 [Antirrhinum majus]
Length=352

 Score =   254 bits (649),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 140/173 (81%), Gaps = 1/173 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPARAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG  S +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKISLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESIGPQR-RLPTTPSARHMAQWESARLEAEARLSRESKLLVPS  849
            IDP TH+P S+++     +     +  HMAQWESARLEAEARL R+SKL  PS
Sbjct  121  IDPVTHKPKSDTLMSNDGQSKNAANLSHMAQWESARLEAEARLVRQSKLQPPS  173



>ref|XP_006338434.1| PREDICTED: myb-related protein 306-like [Solanum tuberosum]
Length=417

 Score =   256 bits (654),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 141/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFTLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++ +    +     +  HMAQWESARLEAEARL+R+SKL
Sbjct  121  IDPVTHKPKNDALLSNDGQSKNAANLSHMAQWESARLEAEARLARQSKL  169



>ref|XP_010258286.1| PREDICTED: transcription factor MYB34-like [Nelumbo nucifera]
Length=400

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 140/171 (82%), Gaps = 5/171 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSE---SIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P S+   S+  Q +   T S  HMAQWESARLEAE RL RESKL
Sbjct  121  IDPVTHKPKSDALSSVDGQSKTAATLS--HMAQWESARLEAETRLVRESKL  169



>ref|XP_009402014.1| PREDICTED: myb-related protein Myb4-like [Musa acuminata subsp. 
malaccensis]
Length=333

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 140/174 (80%), Gaps = 1/174 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I+K+G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLLAYIEKHGNGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGEFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESIGP-QRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPST  852
            IDP TH+  S+++      L +  +  HMAQWESARLEAEARL+RESK    S 
Sbjct  121  IDPCTHKAKSDTLSSGDGHLKSVANLSHMAQWESARLEAEARLARESKFRAASN  174



>gb|KHG14813.1| Transcription factor MYB39 -like protein [Gossypium arboreum]
Length=359

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 141/170 (83%), Gaps = 2/170 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G+GSWRSLP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGRGSWRSLPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSAR--HMAQWESARLEAEARLSRESKL  837
            IDP TH+P ++++       +  +A   HMAQWESARLEAEARL RESK+
Sbjct  121  IDPITHKPKNDALLSTTDGQSKNAANLSHMAQWESARLEAEARLVRESKI  170



>ref|XP_010032514.1| PREDICTED: myb-related protein 306 [Eucalyptus grandis]
 gb|KCW51905.1| hypothetical protein EUGRSUZ_J01362 [Eucalyptus grandis]
Length=411

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I++NG GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEENGHGSWRALPSKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++ +    +  +     H+AQWESARLEAEARL+RESKL
Sbjct  121  IDPVTHKPKNDALVSSDGQSKSAAKLSHLAQWESARLEAEARLARESKL  169



>gb|KDP27171.1| hypothetical protein JCGZ_19870 [Jatropha curcas]
 gb|AIT52299.1| MYB family protein [Jatropha curcas]
Length=378

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 138/169 (82%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I ++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIDEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++ +    +     +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKPKNDALLSSDGQTKNAANLSHMAQWESARLEAEARLVRESKL  169



>ref|XP_010108699.1| Transcription factor [Morus notabilis]
 gb|EXC20010.1| Transcription factor [Morus notabilis]
Length=406

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPT-TPSARHMAQWESARLEAEARLSRESK  834
            IDP TH+P + ++G     P    +  HMAQWESARLEAEARL RESK
Sbjct  121  IDPVTHKPKTNALGSGTGNPKDAANLSHMAQWESARLEAEARLVRESK  168



>ref|XP_004141447.1| PREDICTED: myb-related protein 306-like [Cucumis sativus]
 ref|XP_004170982.1| PREDICTED: myb-related protein 306-like [Cucumis sativus]
Length=371

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+D+IK++G GSWR+LP  AGL RCGKSCRLRW NY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLDYIKEHGHGSWRALPSKAGLQRCGKSCRLRWINY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++ +       +  +  H+AQWESARLEAEARL RES+L
Sbjct  121  IDPVTHKPKNDALLTADGHSKSAANLSHIAQWESARLEAEARLVRESRL  169



>ref|XP_009147399.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB34 [Brassica 
rapa]
Length=360

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 143/175 (82%), Gaps = 7/175 (4%)
 Frame = +1

Query  328  VGMGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWT  507
            + M  +PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWT
Sbjct  41   IIMFTSPCCDKDGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWT  100

Query  508  NYLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLS  687
            NYLRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ 
Sbjct  101  NYLRPDIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVK  160

Query  688  MGIDPQTHEPSSESI----GPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            MGIDP TH+  +E++    G  + L T     HMAQWESARLEAEARL+RESKLL
Sbjct  161  MGIDPVTHKHKNETLLSSTGQSKNLAT---LSHMAQWESARLEAEARLARESKLL  212



>ref|XP_010670239.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Beta vulgaris subsp. vulgaris]
Length=454

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 142/175 (81%), Gaps = 4/175 (2%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G G+WR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKMGLKKGPWTPEEDQKLLAYIEEHGHGNWRALPTKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSE----SIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVP  846
            IDP TH+P  +    +I   ++     +  HMAQWESARLEAEARL+R+SK+ +P
Sbjct  121  IDPVTHKPKHDALFAAIDGGKQSKNAANLSHMAQWESARLEAEARLARQSKIRLP  175



>ref|XP_008459338.1| PREDICTED: myb-related protein 306-like [Cucumis melo]
Length=398

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+D+IK++G GSWR+LP  AGL RCGKSCRLRW NY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLDYIKEHGHGSWRALPSKAGLQRCGKSCRLRWINY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++ +       +  +  H+AQWESARLEAEARL RES+L
Sbjct  121  IDPVTHKPKNDALLTADGHSKSAANLSHIAQWESARLEAEARLVRESRL  169



>ref|NP_001148496.1| P-type R2R3 Myb protein [Zea mays]
 gb|ACG31729.1| P-type R2R3 Myb protein [Zea mays]
Length=295

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 155/217 (71%), Gaps = 31/217 (14%)
 Frame = +1

Query  334  MGRTPCCDK-KGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTN  510
            MGR PCCD+ KGLKKGPWTPEED+ L+D+I+ NG GSWR LPKLAGL RCGKSCRLRWTN
Sbjct  1    MGRAPCCDRTKGLKKGPWTPEEDKLLVDYIQTNGHGSWRLLPKLAGLNRCGKSCRLRWTN  60

Query  511  YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
            YLRPDIKRGPF++EE+K ++QLH I+GN+W+ IA+QLPGRTDNEIKN WNTHLKK+L  M
Sbjct  61   YLRPDIKRGPFTAEEQKSIVQLHAIVGNKWSMIAAQLPGRTDNEIKNYWNTHLKKQLRRM  120

Query  691  GIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSE-  867
            G+D     P++            P+ARHMAQWE+ARLEAEARLS  +     S+ G    
Sbjct  121  GLDEPPPGPAA----------GCPAARHMAQWETARLEAEARLSLLATAASSSSCGAIAA  170

Query  868  -------------------ADFFLRIWNSEIGEAFRK  921
                               AD FLR+W+S+IG++FR+
Sbjct  171  TSASSSSSTVDLKTACARPADIFLRLWSSDIGDSFRR  207



>ref|XP_008783569.1| PREDICTED: transcription factor MYB39-like [Phoenix dactylifera]
Length=400

 Score =   254 bits (650),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 141/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESIGP-QRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P S+++     +  ++ +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKPKSDALSSGDGQAKSSANLSHMAQWESARLEAEARLVRESKL  169



>gb|KGN52476.1| hypothetical protein Csa_5G637660 [Cucumis sativus]
Length=398

 Score =   254 bits (650),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+D+IK++G GSWR+LP  AGL RCGKSCRLRW NY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLDYIKEHGHGSWRALPSKAGLQRCGKSCRLRWINY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++ +       +  +  H+AQWESARLEAEARL RES+L
Sbjct  121  IDPVTHKPKNDALLTADGHSKSAANLSHIAQWESARLEAEARLVRESRL  169



>ref|XP_006659430.1| PREDICTED: transcription factor MYB28-like [Oryza brachyantha]
Length=357

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 141/176 (80%), Gaps = 3/176 (2%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKIGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEP---SSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPST  852
            IDP TH+    +  S    +    T S  HMAQWESARLEAEARL+RESK+ + ++
Sbjct  121  IDPVTHKAINGTLNSTAGDKSAKATASLSHMAQWESARLEAEARLARESKMRIAAS  176



>ref|XP_008221584.1| PREDICTED: myb-related protein 306-like [Prunus mume]
Length=376

 Score =   253 bits (647),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 136/173 (79%), Gaps = 0/173 (0%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I+ +G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLLTYIEHHGHGSWRALPPKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH ++GNRW+AIA+ LP RTDNEIKN WNTHLKKRL  +G
Sbjct  61   LRPDIKRGKFSLQEEQSIIQLHALIGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLTKLG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPST  852
            IDP TH+P               +  HMAQWESARLEAEARL RESKL V ST
Sbjct  121  IDPMTHKPRHHHGSGSGHAKDAANISHMAQWESARLEAEARLVRESKLQVIST  173



>emb|CDX90998.1| BnaC02g05990D [Brassica napus]
Length=358

 Score =   253 bits (645),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 148/193 (77%), Gaps = 6/193 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PC DK GLKKGPWT EED+KL+ +I ++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  51   MGRSPCWDKMGLKKGPWTSEEDQKLLAYIDEHGYGSWRSLPEKAGLHRCGKSCRLRWTNY  110

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  111  LRPDIKRGKFNLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  170

Query  694  IDPQTHEPSS----ESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGG  861
            IDP TH+P +     S+G   +   T S  HMAQWESARLEAEARL+RESKLL   T   
Sbjct  171  IDPVTHKPKNATPLSSLGGISKNAATLS--HMAQWESARLEAEARLARESKLLHYQTKVS  228

Query  862  SEADFFLRIWNSE  900
            S     L I +S+
Sbjct  229  SSHHDHLNIISSD  241



>gb|ACN69972.1| MYB transcription factor ML2 [Thalictrum thalictroides]
Length=405

 Score =   254 bits (649),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 138/169 (82%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  +G
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLSKLG  120

Query  694  IDPQTHEPSSESIGP-QRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P S+++           +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKPKSDALSSIDGHTKADSNLSHMAQWESARLEAEARLVRESKL  169



>gb|AGN52095.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52205.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=357

 Score =   253 bits (645),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 141/172 (82%), Gaps = 1/172 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKIGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPTKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVP  846
            IDP TH+P +++ +    +  +  +  HMAQWESARLEAEARL R+SKL  P
Sbjct  121  IDPVTHKPKNDALLSSDGQSKSAANLSHMAQWESARLEAEARLVRQSKLRGP  172



>ref|XP_009624863.1| PREDICTED: myb-related protein 306 [Nicotiana tomentosiformis]
Length=406

 Score =   254 bits (649),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFTLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++ +    +     +  HMAQWESARLEAEARL R+SKL
Sbjct  121  IDPVTHKPKNDTLLSNDGQSKNAANLSHMAQWESARLEAEARLVRQSKL  169



>ref|XP_004973509.1| PREDICTED: transcription factor MYB32-like [Setaria italica]
Length=357

 Score =   252 bits (644),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 7/188 (4%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKIGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESI---GPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL----VPST  852
            IDP TH+  S ++      +      S  HMAQWESARLEAEARL+RESK+      P+T
Sbjct  121  IDPVTHKSISGTLTGTADDKSAKVAASLSHMAQWESARLEAEARLARESKMRTAAPTPTT  180

Query  853  IGGSEADF  876
            + G + + 
Sbjct  181  LHGQQTNV  188



>emb|CAA78386.1| protein 1 [Petunia x hybrida]
Length=421

 Score =   254 bits (649),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFTLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSESIGPQR-RLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P ++++     +     +  HMAQWESARLEAEARL R+SKL
Sbjct  121  IDPVTHKPKNDALLSHDGQSKNAANLSHMAQWESARLEAEARLVRQSKL  169



>ref|XP_011012944.1| PREDICTED: myb-related protein 306-like [Populus euphratica]
Length=382

 Score =   253 bits (646),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 137/172 (80%), Gaps = 1/172 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            M RT CCDK GLKKGPWTPEED+KL+ +++++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MVRTQCCDKVGLKKGPWTPEEDQKLLAYVEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+ IA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSVIATHLPKRTDNEIKNYWNTHLKKRLDKMG  120

Query  694  IDPQTHEPSSESIGP-QRRLPTTPSARHMAQWESARLEAEARLSRESKLLVP  846
            IDP TH+P ++S G             HMAQWESARLEAEARL RESK+++P
Sbjct  121  IDPVTHKPKADSFGSGSGHSKGAAHLSHMAQWESARLEAEARLVRESKVIIP  172



>emb|CDP02253.1| unnamed protein product [Coffea canephora]
Length=389

 Score =   253 bits (647),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSIQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESI-GPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++I     +     +  HMAQWESARLEAEARL R+SKL
Sbjct  121  IDPVTHKPKTDAILSNDGQSKHAANLSHMAQWESARLEAEARLVRQSKL  169



>ref|XP_004232212.1| PREDICTED: myb-related protein 306 [Solanum lycopersicum]
Length=417

 Score =   254 bits (649),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPTKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ L  RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFTLQEEQTIIQLHALLGNRWSAIATHLSKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++ +    +     +  HMAQWESARLEAEARL+R+SKL
Sbjct  121  IDPVTHKPKNDALLSNDGQSKNAANLSHMAQWESARLEAEARLARQSKL  169



>emb|CAB43399.1| Myb-related transcription factor mixta-like 1 [Antirrhinum majus]
Length=359

 Score =   252 bits (643),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK  LK+GPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRW+NY
Sbjct  1    MGRSPCCDKVSLKRGPWTPEEDQKLLSYIQEHGHGSWRALPSKAGLQRCGKSCRLRWSNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH  LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQAIIQLHAFLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+P S  +    +     +  HMAQWESARL+AEARL RES+L+
Sbjct  121  IDPMTHKPKSHDVLGCGQPKVVANLSHMAQWESARLQAEARLVRESRLV  169



>ref|NP_001061874.1| Os08g0433400 [Oryza sativa Japonica Group]
 emb|CAD44619.1| MYB27 protein [Oryza sativa Japonica Group]
 dbj|BAD09835.1| MYB27 protein [Oryza sativa Japonica Group]
 dbj|BAF23788.1| Os08g0433400 [Oryza sativa Japonica Group]
 gb|EAZ07091.1| hypothetical protein OsI_29338 [Oryza sativa Indica Group]
 gb|EAZ42840.1| hypothetical protein OsJ_27428 [Oryza sativa Japonica Group]
Length=357

 Score =   252 bits (643),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 142/176 (81%), Gaps = 3/176 (2%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKIGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPSKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESI---GPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPST  852
            IDP TH+  + ++      +    T S  HMAQWESARLEAEARL+RESK+ + ++
Sbjct  121  IDPVTHKAINGTLNNTAGDKSAKVTASLSHMAQWESARLEAEARLARESKMRIAAS  176



>ref|XP_009792075.1| PREDICTED: myb-related protein 306-like [Nicotiana sylvestris]
Length=412

 Score =   254 bits (648),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  61   LRPDIKRGKFTLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++ +    +     +  HMAQWESARLEAEARL R+SKL
Sbjct  121  IDPVTHKPKNDTLLSNDGQSKYAANLSHMAQWESARLEAEARLVRQSKL  169



>ref|XP_002882197.1| hypothetical protein ARALYDRAFT_477416 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58456.1| hypothetical protein ARALYDRAFT_477416 [Arabidopsis lyrata subsp. 
lyrata]
Length=390

 Score =   253 bits (646),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 141/169 (83%), Gaps = 5/169 (3%)
 Frame = +1

Query  343  TPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNYLRP  522
            +PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNYLRP
Sbjct  49   SPCCDKAGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNYLRP  108

Query  523  DIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMGIDP  702
            DIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MGIDP
Sbjct  109  DIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMGIDP  168

Query  703  QTHEPSSESIGP---QRRLPTTPSARHMAQWESARLEAEARLSRESKLL  840
             TH+  +E++     Q +   T S  HMAQWESARLEAEARL+RESKLL
Sbjct  169  VTHKHKNETLSSTTGQSKNAATLS--HMAQWESARLEAEARLARESKLL  215



>ref|XP_010939829.1| PREDICTED: snRNA-activating protein complex subunit 4-like [Elaeis 
guineensis]
Length=385

 Score =   253 bits (645),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 141/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K+GLKKGPWTPEED+KL+ +I++NG GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKEGLKKGPWTPEEDQKLLAYIEENGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSMQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESIGP-QRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P S+++     +  +  +  HMAQWESARLEAE RL+RES+L
Sbjct  121  IDPVTHKPKSDALSSGDGQSKSAANLSHMAQWESARLEAEVRLARESRL  169



>ref|XP_006602925.1| PREDICTED: transcription factor MYB28-like [Glycine max]
 gb|KHN13599.1| Transcription factor MYB39 [Glycine soja]
Length=396

 Score =   253 bits (646),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 139/169 (82%), Gaps = 7/169 (4%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSMQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLDKMG  120

Query  694  IDPQTHEPSSESI----GPQRRLPTTPSARHMAQWESARLEAEARLSRE  828
            IDP TH+P ++++    GP +   +  +  HMAQWESARLEAEARL RE
Sbjct  121  IDPVTHKPKNDALVSTEGPSK---SAANLSHMAQWESARLEAEARLVRE  166



>ref|XP_010937203.1| PREDICTED: myb-related protein Pp2-like [Elaeis guineensis]
Length=398

 Score =   253 bits (646),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 141/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESIGP-QRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P S+++     +  ++ +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKPKSDALSSGDGQSKSSANLSHMAQWESARLEAEARLVRESKL  169



>ref|XP_009591172.1| PREDICTED: transcription factor MYB39-like [Nicotiana tomentosiformis]
Length=358

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 138/179 (77%), Gaps = 5/179 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ FI+K G GSWR+LP  AGL RCGKSCRLRW NY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLMAFIEKYGCGSWRALPAKAGLKRCGKSCRLRWINY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIAAHLPNRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTIGGSEA  870
            IDP TH+P +   G         +  HMAQWE+ARLEAEARL RESK  + +  G + A
Sbjct  121  IDPTTHKPKTNIFGKD-----AANLSHMAQWENARLEAEARLVRESKKQISNQFGPNLA  174



>ref|XP_004228373.1| PREDICTED: myb-related protein 315-like [Solanum lycopersicum]
Length=334

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 134/167 (80%), Gaps = 7/167 (4%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+D+I+KNG GSWR+LP  AGL RCGKSCRLRW NY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLMDYIEKNGCGSWRALPTKAGLKRCGKSCRLRWINY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ L  RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLANRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESK  834
            IDP TH+P S   G       + +  HMAQWE ARLEAEARL RESK
Sbjct  121  IDPNTHKPKSNIFG-------SANLSHMAQWEKARLEAEARLVRESK  160



>ref|NP_186763.2| myb domain protein 106 [Arabidopsis thaliana]
 gb|AEE73615.1| myb domain protein 106 [Arabidopsis thaliana]
Length=388

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 140/170 (82%), Gaps = 1/170 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            M  +PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNY
Sbjct  44   MIISPCCDKAGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNY  103

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL+ MG
Sbjct  104  LRPDIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLIKMG  163

Query  694  IDPQTHEPSSESIGPQR-RLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+  +E++     +     +  HMAQWESARLEAEARL+RESKLL
Sbjct  164  IDPVTHKHKNETLSSSTGQSKNAATLSHMAQWESARLEAEARLARESKLL  213



>ref|XP_009405030.1| PREDICTED: myb-related protein Myb4-like [Musa acuminata subsp. 
malaccensis]
Length=355

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 139/173 (80%), Gaps = 1/173 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I+K+G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLLAYIEKHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGEFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPS  849
            IDP TH+  S++ +       +  +  HMAQWESARLEAEARL RESKL   S
Sbjct  121  IDPCTHKAKSDALVSADGHSKSAANLSHMAQWESARLEAEARLVRESKLRTAS  173



>ref|XP_006827320.1| hypothetical protein AMTR_s00010p00267100 [Amborella trichopoda]
 gb|ERM94557.1| hypothetical protein AMTR_s00010p00267100 [Amborella trichopoda]
Length=443

 Score =   254 bits (648),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 142/171 (83%), Gaps = 5/171 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGLLRCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPVKAGLLRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPRRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSES---IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++   +  Q +   T S  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKPKTDALCLVDGQSKNAATLS--HMAQWESARLEAEARLVRESKL  169



>ref|XP_002316122.1| hypothetical protein POPTR_0010s17300g [Populus trichocarpa]
 gb|EEF02293.1| hypothetical protein POPTR_0010s17300g [Populus trichocarpa]
Length=382

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 138/173 (80%), Gaps = 1/173 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            M R+ CCDK GLKKGPWTPEED+KL+ +++++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MVRSQCCDKVGLKKGPWTPEEDQKLLAYVEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+ IA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSVIATHLPKRTDNEIKNYWNTHLKKRLDKMG  120

Query  694  IDPQTHEPSSESIGP-QRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPS  849
            IDP TH+P ++S G             HMAQWESARLEAEARL RESK+++P+
Sbjct  121  IDPMTHKPKADSFGSGSGHSKGAAHLSHMAQWESARLEAEARLVRESKVIIPN  173



>ref|XP_002323871.1| hypothetical protein POPTR_0017s12230g [Populus trichocarpa]
 gb|EEF04004.1| hypothetical protein POPTR_0017s12230g [Populus trichocarpa]
Length=401

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 139/171 (81%), Gaps = 5/171 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSE---SIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+  ++   SI  Q +     +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKSKNDALLSIDGQSK--NAANLSHMAQWESARLEAEARLVRESKL  169



>dbj|BAM71806.1| R2R3-MYB transcription factor [Gentiana triflora]
Length=360

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 141/175 (81%), Gaps = 1/175 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPANAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHL+KRL  MG
Sbjct  61   LRPDIKRGKFSVQEEQTIIQLHALLGNRWSAIAAHLPKRTDNEIKNYWNTHLRKRLAKMG  120

Query  694  IDPQTHEPSSESI-GPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPSTI  855
            IDP TH+P ++++     +     +  HMAQWESARLEAEARL R+SKL   +T 
Sbjct  121  IDPVTHKPKTDTLFSGDGQTKHAANLSHMAQWESARLEAEARLVRQSKLRSSNTF  175



>gb|KHN45518.1| Transcription factor MYB39 [Glycine soja]
Length=410

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  A + RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKADIQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTH+KKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHIKKRLTKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P +++ +    +  T  +  HMAQWESARLEAEARL RESK+
Sbjct  121  IDPVTHKPKNDALLSSDGQSKTAANLSHMAQWESARLEAEARLVRESKI  169



>ref|XP_004517012.1| PREDICTED: myb-related protein 306-like [Cicer arietinum]
Length=406

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/195 (64%), Positives = 150/195 (77%), Gaps = 5/195 (3%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KLI +I++ G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLIAYIEEFGHGSWRALPSKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+QLP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIAAQLPRRTDNEIKNYWNTHLKKRLTRMG  120

Query  694  IDPQTHEPSSESIGPQRRLPT----TPSARHMAQWESARLEAEARLSRES-KLLVPSTIG  858
            IDP TH+P ++++G           + +  HMAQWESARLEAEARL RE+ KL V   + 
Sbjct  121  IDPTTHKPKTDTLGSSSSASHYSKDSANLSHMAQWESARLEAEARLVRETNKLKVQKQLE  180

Query  859  GSEADFFLRIWNSEI  903
             S A    R++ ++I
Sbjct  181  SSTAQPPARLFLNKI  195



>ref|XP_001782039.1| predicted protein [Physcomitrella patens]
 gb|EDQ53182.1| predicted protein [Physcomitrella patens]
Length=168

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 135/166 (81%), Gaps = 3/166 (2%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAG-LLRCGKSCRLRWTN  510
            MGRTPCCDK GLKKGPWTP+ED+KL+ +I++NG GSWR+LPK AG LLRCGKSCRLRWTN
Sbjct  1    MGRTPCCDKMGLKKGPWTPDEDQKLVTYIQRNGHGSWRALPKHAGRLLRCGKSCRLRWTN  60

Query  511  YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
            YLRPDIKRG FS EEE+++I LHGILGNRW+AIA+ LPGRTDNEIKN WNTHL+KRLL M
Sbjct  61   YLRPDIKRGRFSFEEEQVIIHLHGILGNRWSAIAAHLPGRTDNEIKNYWNTHLRKRLLQM  120

Query  691  GIDPQTHEPSSESIGPQRRLP--TTPSARHMAQWESARLEAEARLS  822
            GIDP TH+  S  +     L    + +  HM+QW+  R+E EARLS
Sbjct  121  GIDPVTHKVRSNLLIENLDLKPMVSSTLSHMSQWDRVRMEMEARLS  166



>ref|XP_002444392.1| hypothetical protein SORBIDRAFT_07g021210 [Sorghum bicolor]
 gb|EES13887.1| hypothetical protein SORBIDRAFT_07g021210 [Sorghum bicolor]
Length=356

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 138/171 (81%), Gaps = 3/171 (2%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ FI+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKIGLKKGPWTPEEDQKLLAFIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPNRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESI---GPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+  S ++      +      S  HMAQWESARLEAEARL+RESK+
Sbjct  121  IDPVTHKSLSGTLTGTTNNKSAKAAASLSHMAQWESARLEAEARLARESKI  171



>ref|XP_006483693.1| PREDICTED: transcription factor MYB29-like [Citrus sinensis]
Length=367

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 138/169 (82%), Gaps = 3/169 (2%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ FI+++G GSWR+LP  AGL R GKSCRLRW NY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLLAFIEQHGHGSWRALPAKAGLQRWGKSCRLRWINY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIAAHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLL  840
            IDP TH+P +  +G  +    T +  HMAQWESARLEAEARL RESKL+
Sbjct  121  IDPVTHKPKTNPLGQPK---DTANLSHMAQWESARLEAEARLVRESKLV  166



>ref|XP_010426612.1| PREDICTED: protein ODORANT1 isoform X3 [Camelina sativa]
Length=397

 Score =   252 bits (643),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 139/167 (83%), Gaps = 1/167 (1%)
 Frame = +1

Query  343  TPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNYLRP  522
            +PCCDK GLKKGPWTPEED+KL+ +I+++G GSWRSLP+ AGL RCGKSCRLRWTNYLRP
Sbjct  47   SPCCDKAGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNYLRP  106

Query  523  DIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMGIDP  702
            DIKRG F+ +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRLL MGIDP
Sbjct  107  DIKRGKFTVQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLLKMGIDP  166

Query  703  QTHEPSSESIGPQR-RLPTTPSARHMAQWESARLEAEARLSRESKLL  840
             TH+  +E++     +     +  HMAQWESARLEAEARL+RESKLL
Sbjct  167  VTHKHKNETLSSSTGQSKNAATLSHMAQWESARLEAEARLARESKLL  213



>ref|XP_011035792.1| PREDICTED: protein ODORANT1 [Populus euphratica]
Length=404

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 138/169 (82%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+  +++ +    +     +  HMAQWESARLEAEARL RESKL
Sbjct  121  IDPVTHKSKNDALLSVDGQSKNAANLSHMAQWESARLEAEARLVRESKL  169



>ref|XP_009410047.1| PREDICTED: transcription factor MYB34-like [Musa acuminata subsp. 
malaccensis]
Length=374

 Score =   251 bits (640),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 139/173 (80%), Gaps = 1/173 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I+K+G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKIGLKKGPWTPEEDQKLLAYIEKHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGEFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESIGPQRRLP-TTPSARHMAQWESARLEAEARLSRESKLLVPS  849
            IDP TH+   +++      P    +  HMAQWESARLEAEARL+RESKL   S
Sbjct  121  IDPCTHKAKIDTLSSANGHPKKVANLSHMAQWESARLEAEARLARESKLRAAS  173



>ref|XP_002268469.2| PREDICTED: myb-related protein 306-like [Vitis vinifera]
Length=371

 Score =   251 bits (640),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 136/169 (80%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKG WTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKVGLKKGSWTPEEDQKLMSYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSESIGPQR-RLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P S ++G    +     +  HMAQWESARLEAEAR  RE KL
Sbjct  121  IDPVTHKPKSYALGSATGQSKDAANLSHMAQWESARLEAEARFVREYKL  169



>emb|CAN77989.1| hypothetical protein VITISV_028880 [Vitis vinifera]
Length=371

 Score =   250 bits (639),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 136/169 (80%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKG WTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKVGLKKGSWTPEEDQKLMSYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEPSSESIGPQR-RLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P S ++G    +     +  HMAQWESARLEAEAR  RE KL
Sbjct  121  IDPVTHKPKSYALGSATGQSKDAANLSHMAQWESARLEAEARFVREYKL  169



>emb|CDP20238.1| unnamed protein product [Coffea canephora]
Length=400

 Score =   251 bits (642),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 141/174 (81%), Gaps = 2/174 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFI-KKNGQGSWRSLPKLAGLLRCGKSCRLRWTN  510
            MGR+PCC+K GL+KG WTPEED+KL+ +I +++G  SWR+LP  AGL RCGKSCRLRWTN
Sbjct  1    MGRSPCCEKLGLRKGTWTPEEDQKLLSYIEQQHGHSSWRALPAKAGLERCGKSCRLRWTN  60

Query  511  YLRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSM  690
            YLRPDIKRG FSS+E++ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  M
Sbjct  61   YLRPDIKRGKFSSQEDQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLTKM  120

Query  691  GIDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKLLVPST  852
            GIDP TH P + ++G   +   T +  HMAQWESARLEAE+RL RESKLL  ST
Sbjct  121  GIDPSTHRPKTNALGSAHQ-KDTANLSHMAQWESARLEAESRLVRESKLLSLST  173



>emb|CAA55725.1| mixta [Antirrhinum majus]
 prf||2013346A myb-related protein
Length=321

 Score =   249 bits (635),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            M R+PCCDK G+KKGPWT +ED+KL+ +I+++G GSWRSLP  AGL RCGKSCRLRW NY
Sbjct  1    MVRSPCCDKVGVKKGPWTVDEDQKLLAYIEEHGHGSWRSLPLKAGLQRCGKSCRLRWANY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRGPFS +EE+ +IQLH +LGNRW+AIAS LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGPFSLQEEQTIIQLHALLGNRWSAIASHLPKRTDNEIKNYWNTHLKKRLTRMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P + +I    +     +  H+AQWESARL+AE RL RES+L
Sbjct  121  IDPVTHKPHTHNILGHGQPKDVANLNHIAQWESARLQAERRLVRESRL  168



>ref|XP_008664664.1| PREDICTED: myb-related protein Myb4-like isoform X2 [Zea mays]
Length=356

 Score =   249 bits (637),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 169/255 (66%), Gaps = 31/255 (12%)
 Frame = +1

Query  334   MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
             MGR+PCC+K GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1     MGRSPCCEKIGLKKGPWTPEEDQKLLAYIQEHGHGSWRALPVKAGLQRCGKSCRLRWTNY  60

Query  514   LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
             LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61    LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPNRTDNEIKNYWNTHLKKRLAKMG  120

Query  694   IDPQTHEP-SSESIGPQRRLPTTPSA--RHMAQWESARLEAEARLSRESKLLV-------  843
             IDP TH+  S   IG      T  +A   HMAQWESARLEAEARL+RESK+         
Sbjct  121   IDPVTHKSISGTRIGTTNDKSTKAAASLSHMAQWESARLEAEARLARESKIRTATPTPTA  180

Query  844   ----PSTIGGSEADFFLRIWNSEIGEAFRKFKKGVKFACQSPISQASSSTKYGSASGT--  1005
                 P+ +  S A   L + ++          +G K   +SP    S+ T  GS SGT  
Sbjct  181   LHAQPTILPASAASPCLDVLHA---------WQGAKIDLESP---TSTLTFTGSNSGTLP  228

Query  1006  ---TTEMDITLAGSA  1041
                T  +D++ +  A
Sbjct  229   TPRTNRLDVSESNCA  243



>ref|XP_008802568.1| PREDICTED: myb-related protein 306-like [Phoenix dactylifera]
Length=388

 Score =   251 bits (640),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K+GLKKGPWTPEED+KL+  I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKEGLKKGPWTPEEDQKLLACIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSMQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSESIGPQRRLP-TTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH+P S+++      P +  +  HMAQWESARLEAEARL RES+L
Sbjct  121  IDPVTHKPKSDALSSCDGQPRSAANLSHMAQWESARLEAEARLVRESRL  169



>ref|XP_011085743.1| PREDICTED: myb-related protein 306-like [Sesamum indicum]
Length=379

 Score =   250 bits (639),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 138/169 (82%), Gaps = 1/169 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK G+KKGPWTPEEDEKL+ +I++ G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKIGVKKGPWTPEEDEKLLAYIQQYGHGSWRALPPKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSFQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSES-IGPQRRLPTTPSARHMAQWESARLEAEARLSRESKL  837
            IDP TH P +++ +    +     +  H+AQWESARLEAEARL+R+SKL
Sbjct  121  IDPVTHRPKNDTLLSGDGQSKNAANLSHIAQWESARLEAEARLARQSKL  169



>ref|XP_006440626.1| hypothetical protein CICLE_v10023440mg [Citrus clementina]
 gb|ESR53866.1| hypothetical protein CICLE_v10023440mg [Citrus clementina]
Length=342

 Score =   249 bits (636),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PC D  GLK+GPWTPEED+KL+D+IKK+G GSWRSLP+ A L RCGKSCRLRWTNY
Sbjct  1    MGRSPCSDTNGLKRGPWTPEEDQKLLDYIKKHGHGSWRSLPEKADLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS  EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTH+KKRL  MG
Sbjct  61   LRPDIKRGKFSLHEEQTIIQLHALLGNRWSAIAAHLPKRTDNEIKNYWNTHIKKRLARMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPS-ARHMAQWESARLEAEARLSRESK  834
            IDP TH P   S+      P   S   HMAQWE+ARLEAEARL RESK
Sbjct  121  IDPMTHRPKIPSLASADGDPKKASNLSHMAQWENARLEAEARLVRESK  168



>ref|XP_004298414.1| PREDICTED: uncharacterized protein LOC101300142 [Fragaria vesca 
subsp. vesca]
Length=416

 Score =   251 bits (641),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCC+K GLKKGPWTPEED+KL+ +I++ G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCEKVGLKKGPWTPEEDQKLLSYIQEYGHGSWRALPAKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIANHLPKRTDNEIKNYWNTHLKKRLTKMG  120

Query  694  IDPQTHEP-SSESIGP-QRRLPTTPSARHMAQWESARLEAEARLSRESKLLV  843
            IDP TH+P   E+ G          +  HMAQWESARLEAEARL RESK L+
Sbjct  121  IDPVTHKPKHHEAYGSGSGHGKDAANLSHMAQWESARLEAEARLVRESKQLI  172



>ref|XP_006477596.1| PREDICTED: transcription factor MYB28-like [Citrus sinensis]
Length=344

 Score =   249 bits (635),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PC D  GLK+GPWTPEED+KL+D+IKK+G GSWRSLP+ A L RCGKSCRLRWTNY
Sbjct  1    MGRSPCSDTNGLKRGPWTPEEDQKLLDYIKKHGHGSWRSLPEKADLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS  EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTH+KKRL  MG
Sbjct  61   LRPDIKRGKFSLHEERTIIQLHALLGNRWSAIAAHLPKRTDNEIKNYWNTHIKKRLARMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPS-ARHMAQWESARLEAEARLSRESK  834
            IDP TH P   S+      P   S   HMAQWE+ARLEAEARL RESK
Sbjct  121  IDPTTHRPKIPSLASADGDPKKASNLSHMAQWENARLEAEARLVRESK  168



>gb|KDO55529.1| hypothetical protein CISIN_1g047101mg [Citrus sinensis]
Length=344

 Score =   249 bits (635),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PC D  GLK+GPWTPEED+KL+D+IKK+G GSWRSLP+ A L RCGKSCRLRWTNY
Sbjct  1    MGRSPCSDTNGLKRGPWTPEEDQKLLDYIKKHGHGSWRSLPEKADLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS  EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTH+KKRL  MG
Sbjct  61   LRPDIKRGKFSLHEEQTIIQLHALLGNRWSAIAAHLPKRTDNEIKNYWNTHIKKRLARMG  120

Query  694  IDPQTHEPSSESIGPQRRLPTTPS-ARHMAQWESARLEAEARLSRESK  834
            IDP TH P   S+      P   S   HMAQWE+ARLEAEARL RESK
Sbjct  121  IDPMTHRPKIPSLASADGDPKKASNLSHMAQWENARLEAEARLVRESK  168



>gb|ABQ51227.1| R2R3-MYB transcription factor MYB11 [Picea glauca]
Length=499

 Score =   253 bits (647),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 131/161 (81%), Gaps = 3/161 (2%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR PCCDK GLKKGPWTPEED+KL D+I+++G GSWR+LPK AGLLRCGKSCRLRWTNY
Sbjct  1    MGRAPCCDKDGLKKGPWTPEEDQKLTDYIQRHGHGSWRTLPKHAGLLRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS EEE+ ++QLHG+LGN+W+AIAS LPGRTDNEIKN WNTHLKKRLL MG
Sbjct  61   LRPDIKRGKFSFEEEQTIVQLHGVLGNKWSAIASHLPGRTDNEIKNYWNTHLKKRLLQMG  120

Query  694  IDPQTHEPSSE--SIGPQRRLPTTPSARHM-AQWESARLEA  807
            IDP TH P  +  +     +L    S  HM AQWE ARLEA
Sbjct  121  IDPVTHRPRIDLFNFSNMTQLLAPASLSHMAAQWERARLEA  161



>ref|XP_008366447.1| PREDICTED: myb-related protein 315-like [Malus domestica]
Length=305

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 135/166 (81%), Gaps = 6/166 (4%)
 Frame = +1

Query  334  MGRTPCCDKKGLKKGPWTPEEDEKLIDFIKKNGQGSWRSLPKLAGLLRCGKSCRLRWTNY  513
            MGR+PCCDK GLKKGPWTPEED+KL+ +I+++G GSWR+LP  AGL RCGKSCRLRWTNY
Sbjct  1    MGRSPCCDKVGLKKGPWTPEEDQKLLAYIEEHGHGSWRALPTKAGLQRCGKSCRLRWTNY  60

Query  514  LRPDIKRGPFSSEEEKLVIQLHGILGNRWAAIASQLPGRTDNEIKNLWNTHLKKRLLSMG  693
            LRPDIKRG FS +EE+ +IQLH +LGNRW+AIA+ LP RTDNEIKN WNTHLKKRL  MG
Sbjct  61   LRPDIKRGKFSLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLAKMG  120

Query  694  IDPQTHEPSSE----SIGPQRRLPTTPSARHMAQWESARLEAEARL  819
            IDP TH+P  +    S+  Q +  +  S  HMAQWESARLEAEARL
Sbjct  121  IDPVTHKPKKDNLLSSVDGQSKNASNLS--HMAQWESARLEAEARL  164



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4235478590672