BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18476_g1_i1 len=1753 path=[1:0-1752]

Length=1753
                                                                      Score     E

emb|CDP14213.1|  unnamed protein product                                675   0.0      
ref|XP_007028566.1|  Ankyrin repeat family protein / BTB/POZ doma...    669   0.0      
gb|KHG11076.1|  Regulatory NPR5 -like protein                           669   0.0      
ref|XP_002275980.1|  PREDICTED: regulatory protein NPR5                 668   0.0      Vitis vinifera
emb|CAN80112.1|  hypothetical protein VITISV_010389                     668   0.0      Vitis vinifera
gb|KDP26222.1|  hypothetical protein JCGZ_22468                         664   0.0      
ref|XP_011075394.1|  PREDICTED: regulatory protein NPR5-like            663   0.0      
gb|KHG10935.1|  Regulatory NPR5 -like protein                           660   0.0      
ref|XP_009609217.1|  PREDICTED: regulatory protein NPR5-like            659   0.0      
ref|XP_002308905.1|  ankyrin repeat family protein                      657   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002531503.1|  aberrant large forked product, putative            656   0.0      Ricinus communis
ref|XP_006491569.1|  PREDICTED: regulatory protein NPR5-like isof...    656   0.0      
ref|XP_008240732.1|  PREDICTED: regulatory protein NPR5                 655   0.0      
ref|XP_007204386.1|  hypothetical protein PRUPE_ppa004578mg             654   0.0      
ref|XP_006421265.1|  hypothetical protein CICLE_v10004795mg             654   0.0      
ref|XP_011027294.1|  PREDICTED: regulatory protein NPR5                 652   0.0      
ref|XP_009799339.1|  PREDICTED: regulatory protein NPR5-like            652   0.0      
ref|XP_008392381.1|  PREDICTED: regulatory protein NPR5-like            652   0.0      
gb|AFK30388.1|  BOP1                                                    649   0.0      
ref|XP_008387416.1|  PREDICTED: regulatory protein NPR5-like isof...    649   0.0      
ref|XP_009784747.1|  PREDICTED: regulatory protein NPR5-like            647   0.0      
gb|AFK30390.1|  BOP4                                                    644   0.0      
ref|XP_009615711.1|  PREDICTED: regulatory protein NPR5-like            644   0.0      
gb|AFK30389.1|  BOP3                                                    643   0.0      
ref|XP_004303610.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    643   0.0      
ref|XP_008443289.1|  PREDICTED: regulatory protein NPR5                 642   0.0      
ref|XP_010525497.1|  PREDICTED: regulatory protein NPR5-like isof...    642   0.0      
ref|XP_008387415.1|  PREDICTED: regulatory protein NPR5-like isof...    642   0.0      
gb|AGO64649.1|  blade-on-petiole                                        639   0.0      
ref|XP_010273271.1|  PREDICTED: regulatory protein NPR5-like            639   0.0      
ref|XP_010525496.1|  PREDICTED: regulatory protein NPR5-like isof...    638   0.0      
ref|XP_004136653.1|  PREDICTED: regulatory protein NPR5-like            638   0.0      
ref|XP_010277606.1|  PREDICTED: regulatory protein NPR5-like            637   0.0      
ref|XP_007145550.1|  hypothetical protein PHAVU_007G248000g             635   0.0      
ref|XP_004237330.1|  PREDICTED: regulatory protein NPR5-like            634   0.0      
ref|XP_003518145.1|  PREDICTED: regulatory protein NPR5-like            634   0.0      
ref|XP_010672970.1|  PREDICTED: regulatory protein NPR5-like            634   0.0      
ref|XP_006364431.1|  PREDICTED: regulatory protein NPR5-like            632   0.0      
ref|XP_006402903.1|  hypothetical protein EUTSA_v10005948mg             632   0.0      
emb|CDY06929.1|  BnaA04g23860D                                          632   0.0      
ref|XP_002881770.1|  hypothetical protein ARALYDRAFT_903451             632   0.0      
ref|XP_010508725.1|  PREDICTED: regulatory protein NPR5                 631   0.0      
ref|XP_006411403.1|  hypothetical protein EUTSA_v10016568mg             630   0.0      
ref|XP_010554791.1|  PREDICTED: regulatory protein NPR5-like            630   0.0      
emb|CDY14765.1|  BnaC04g47620D                                          629   0.0      
ref|XP_010036340.1|  PREDICTED: regulatory protein NPR5-like            629   0.0      
gb|KFK36987.1|  hypothetical protein AALP_AA4G197800                    629   0.0      
ref|XP_010543719.1|  PREDICTED: regulatory protein NPR5 isoform X2      628   0.0      
ref|XP_004514968.1|  PREDICTED: regulatory protein NPR5-like            628   0.0      
gb|EYU18655.1|  hypothetical protein MIMGU_mgv11b023775mg               628   0.0      
ref|XP_007162101.1|  hypothetical protein PHAVU_001G124100g             627   0.0      
ref|NP_181668.1|  NPR1 like protein BOP2                                625   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004249233.1|  PREDICTED: regulatory protein NPR5                 625   0.0      
gb|AEM62768.1|  BTB/POZ ankyrin repeat protein                          625   0.0      
gb|AET34790.1|  BTB/POZ ankyrin repeat protein                          624   0.0      
ref|XP_010505917.1|  PREDICTED: regulatory protein NPR5-like            625   0.0      
ref|XP_006294095.1|  hypothetical protein CARUB_v10023088mg             624   0.0      
ref|XP_010543641.1|  PREDICTED: regulatory protein NPR5 isoform X1      623   0.0      
ref|XP_004249234.1|  PREDICTED: regulatory protein NPR5-like            623   0.0      
gb|AET34792.1|  BTB/POZ ankyrin repeat protein                          622   0.0      
ref|XP_010102740.1|  Regulatory protein                                 623   0.0      
gb|KEH41446.1|  BTB/POZ ankyrin repeat protein                          622   0.0      
ref|XP_009627132.1|  PREDICTED: regulatory protein NPR5-like isof...    622   0.0      
gb|AET34786.1|  BTB/POZ ankyrin repeat protein                          622   0.0      
ref|XP_006351282.1|  PREDICTED: regulatory protein NPR5-like            622   0.0      
gb|AAO22795.1|  unknown protein                                         621   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006491570.1|  PREDICTED: regulatory protein NPR5-like isof...    619   0.0      
ref|XP_006351262.1|  PREDICTED: regulatory protein NPR5-like            620   0.0      
ref|XP_009141987.1|  PREDICTED: regulatory protein NPR5-like            619   0.0      
ref|XP_009627133.1|  PREDICTED: regulatory protein NPR5-like isof...    618   0.0      
ref|XP_002876399.1|  hypothetical protein ARALYDRAFT_324222             617   0.0      
ref|XP_009627131.1|  PREDICTED: regulatory protein NPR5-like isof...    617   0.0      
ref|XP_003521136.1|  PREDICTED: regulatory protein NPR5-like            616   0.0      
ref|XP_010056313.1|  PREDICTED: regulatory protein NPR5                 616   0.0      
ref|XP_003625012.1|  BOP/NPR1/NIM1-like regulatory protein              615   0.0      
emb|CDY23854.1|  BnaC04g01830D                                          615   0.0      
ref|XP_011033136.1|  PREDICTED: regulatory protein NPR5-like isof...    613   0.0      
ref|XP_010427578.1|  PREDICTED: regulatory protein NPR6                 614   0.0      
ref|NP_001276282.1|  regulatory protein NPR5-like                       614   0.0      
ref|NP_191272.1|  protein BLADE ON PETIOLE 1                            613   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009775137.1|  PREDICTED: regulatory protein NPR5-like isof...    614   0.0      
gb|KFK34952.1|  hypothetical protein AALP_AA5G215400                    613   0.0      
ref|XP_011033137.1|  PREDICTED: regulatory protein NPR5-like isof...    611   0.0      
ref|XP_002323261.1|  ankyrin repeat family protein                      610   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004150250.1|  PREDICTED: regulatory protein NPR5-like            612   0.0      
ref|XP_004493408.1|  PREDICTED: regulatory protein NPR5-like            611   0.0      
ref|XP_009775136.1|  PREDICTED: regulatory protein NPR5-like isof...    609   0.0      
ref|XP_010504634.1|  PREDICTED: regulatory protein NPR6-like            609   0.0      
ref|XP_009142739.1|  PREDICTED: regulatory protein NPR5                 609   0.0      
ref|XP_006292732.1|  hypothetical protein CARUB_v10018976mg             607   0.0      
ref|XP_010516320.1|  PREDICTED: regulatory protein NPR6-like            604   0.0      
ref|XP_009384381.1|  PREDICTED: regulatory protein NPR6-like            605   0.0      
ref|XP_010938612.1|  PREDICTED: regulatory protein NPR5-like            600   0.0      
ref|XP_009399975.1|  PREDICTED: regulatory protein NPR6-like            596   0.0      
ref|XP_009401048.1|  PREDICTED: regulatory protein NPR6-like            596   0.0      
ref|XP_011078926.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    590   0.0      
ref|XP_010909412.1|  PREDICTED: regulatory protein NPR6-like isof...    593   0.0      
gb|ABE11621.1|  ankyrin-repeat protein                                  590   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009116421.1|  PREDICTED: regulatory protein NPR6                 587   0.0      
emb|CDY06130.1|  BnaA09g36500D                                          587   0.0      
ref|XP_008800205.1|  PREDICTED: regulatory protein NPR5-like            589   0.0      
ref|XP_006646676.1|  PREDICTED: regulatory protein NPR5-like            586   0.0      
ref|XP_009391550.1|  PREDICTED: regulatory protein NPR5                 587   0.0      
gb|EPS72362.1|  hypothetical protein M569_02396                         582   0.0      
ref|XP_004971245.1|  PREDICTED: regulatory protein NPR5-like            585   0.0      
emb|CDX72067.1|  BnaC08g28070D                                          583   0.0      
ref|XP_008798547.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    585   0.0      
ref|NP_001140651.1|  hypothetical protein                               582   0.0      Zea mays [maize]
ref|XP_009386839.1|  PREDICTED: regulatory protein NPR5 isoform X2      578   0.0      
ref|XP_009386610.1|  PREDICTED: regulatory protein NPR5-like            577   0.0      
ref|XP_009414176.1|  PREDICTED: regulatory protein NPR5-like            574   0.0      
emb|CDY30971.1|  BnaC04g24530D                                          574   0.0      
dbj|BAJ86934.1|  predicted protein                                      576   0.0      
ref|XP_003565065.1|  PREDICTED: regulatory protein NPR5-like            576   0.0      
ref|XP_008808778.1|  PREDICTED: regulatory protein NPR6-like            575   0.0      
ref|XP_010922182.1|  PREDICTED: regulatory protein NPR6-like            575   0.0      
emb|CDM86436.1|  unnamed protein product                                573   0.0      
ref|XP_009386840.1|  PREDICTED: regulatory protein NPR5 isoform X3      570   0.0      
ref|XP_009104042.1|  PREDICTED: regulatory protein NPR6-like isof...    569   0.0      
ref|XP_009386838.1|  PREDICTED: regulatory protein NPR6 isoform X1      570   0.0      
gb|EPS73625.1|  hypothetical protein M569_01131                         563   0.0      
emb|CDX67678.1|  BnaA07g17180D                                          564   0.0      
gb|EMT28620.1|  Regulatory protein NPR1                                 566   0.0      
emb|CBI30078.3|  unnamed protein product                                550   0.0      
ref|XP_010931998.1|  PREDICTED: regulatory protein NPR5-like            543   0.0      
gb|AHF20179.1|  NPR1-like protein                                       536   0.0      
ref|XP_006605205.1|  PREDICTED: regulatory protein NPR5-like            527   8e-180   
ref|XP_010931584.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    515   3e-174   
gb|EAZ14831.1|  hypothetical protein OsJ_04757                          505   2e-171   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95778.1|  ankyrin repeat family protein, putative, expressed      504   5e-170   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ17398.1|  hypothetical protein OsJ_32922                          503   3e-169   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065717.1|  Os11g0141900                                       500   2e-168   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004977500.1|  PREDICTED: regulatory protein NPR5-like            499   2e-168   
gb|EAY79901.1|  hypothetical protein OsI_35064                          500   3e-168   Oryza sativa Indica Group [Indian rice]
gb|EAY79893.1|  hypothetical protein OsI_35056                          504   1e-167   Oryza sativa Indica Group [Indian rice]
ref|XP_002442682.1|  hypothetical protein SORBIDRAFT_08g001180          498   1e-167   Sorghum bicolor [broomcorn]
emb|CBX24422.1|  hypothetical_protein                                   494   1e-165   
dbj|BAJ90297.1|  predicted protein                                      492   3e-165   
emb|CBX25371.1|  hypothetical_protein                                   492   5e-165   
ref|XP_008662362.1|  PREDICTED: regulatory protein NPR6-like            495   2e-164   
gb|EMT02606.1|  Regulatory protein NPR1                                 483   3e-161   
ref|XP_003578950.1|  PREDICTED: regulatory protein NPR6-like            482   4e-161   
ref|XP_002450246.1|  hypothetical protein SORBIDRAFT_05g002500          477   2e-159   Sorghum bicolor [broomcorn]
ref|XP_006843393.1|  hypothetical protein AMTR_s00053p00115370          474   8e-159   
ref|XP_008669884.1|  PREDICTED: regulatory protein NPR5-like            463   4e-154   
gb|EMS68804.1|  Regulatory protein NPR5                                 419   1e-137   
ref|XP_008457939.1|  PREDICTED: regulatory protein NPR5-like            406   6e-134   
emb|CDX79940.1|  BnaA05g02160D                                          401   3e-132   
gb|EAY77216.1|  hypothetical protein OsI_05187                          400   1e-131   Oryza sativa Indica Group [Indian rice]
ref|NP_001045396.1|  Os01g0948900                                       399   3e-131   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD87216.1|  non-inducible immunity 1-like                          390   5e-128   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008674530.1|  PREDICTED: regulatory protein NPR5-like            388   5e-127   
ref|XP_010909415.1|  PREDICTED: regulatory protein NPR5-like isof...    389   2e-125   
ref|XP_002459094.1|  hypothetical protein SORBIDRAFT_03g045730          384   2e-125   Sorghum bicolor [broomcorn]
ref|XP_002986952.1|  hypothetical protein SELMODRAFT_125007             384   8e-124   
ref|XP_002977926.1|  hypothetical protein SELMODRAFT_107813             384   9e-124   
ref|XP_009104044.1|  PREDICTED: regulatory protein NPR6-like isof...    382   1e-123   
ref|XP_009139335.1|  PREDICTED: regulatory protein NPR6-like            377   2e-123   
emb|CDX76040.1|  BnaA04g03040D                                          377   5e-123   
emb|CDY35774.1|  BnaC02g38200D                                          375   1e-122   
ref|XP_002961253.1|  hypothetical protein SELMODRAFT_74877              349   9e-111   
ref|XP_002969487.1|  hypothetical protein SELMODRAFT_91240              347   4e-110   
emb|CBX25466.1|  hypothetical_protein                                   349   5e-110   
ref|XP_001757508.1|  predicted protein                                  344   6e-108   
ref|NP_001066113.2|  Os12g0138500                                       337   2e-107   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001784176.1|  predicted protein                                  338   3e-107   
emb|CBX25284.1|  hypothetical_protein                                   343   3e-106   
ref|XP_010931590.1|  PREDICTED: regulatory protein NPR5-like            332   2e-105   
ref|XP_006665200.1|  PREDICTED: regulatory protein NPR5-like            328   4e-105   
gb|AFW55825.1|  hypothetical protein ZEAMMB73_056831                    323   5e-102   
gb|AET34794.1|  BTB/POZ ankyrin repeat protein                          316   8e-100   
ref|XP_001759240.1|  predicted protein                                  306   1e-93    
tpg|DAA39223.1|  TPA: hypothetical protein ZEAMMB73_394788              290   3e-89    
ref|XP_006663189.1|  PREDICTED: regulatory protein NPR5-like            227   9e-67    
ref|XP_008466954.1|  PREDICTED: regulatory protein NPR5-like            210   1e-60    
ref|NP_001190116.1|  protein BLADE ON PETIOLE 1                         203   5e-58    
gb|AFW83978.1|  hypothetical protein ZEAMMB73_767493                    203   2e-57    
ref|XP_008348376.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    194   2e-50    
ref|XP_011085427.1|  PREDICTED: regulatory protein NPR3-like            192   7e-50    
ref|XP_009399066.1|  PREDICTED: regulatory protein NPR3-like isof...    191   3e-49    
gb|AHF20181.1|  ankyrin-repeat protein                                  190   5e-49    
ref|XP_008229582.1|  PREDICTED: regulatory protein NPR3-like            187   5e-48    
ref|XP_008451832.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    185   2e-47    
ref|XP_004169978.1|  PREDICTED: regulatory protein NPR3-like            183   1e-46    
ref|XP_004147747.1|  PREDICTED: regulatory protein NPR3-like            183   1e-46    
ref|XP_002300863.2|  hypothetical protein POPTR_0002s05740g             179   4e-46    Populus trichocarpa [western balsam poplar]
ref|XP_008787319.1|  PREDICTED: regulatory protein NPR3-like            181   4e-46    
ref|XP_009399065.1|  PREDICTED: regulatory protein NPR3-like isof...    181   9e-46    
ref|XP_007214958.1|  hypothetical protein PRUPE_ppa003232mg             180   1e-45    
ref|XP_010911274.1|  PREDICTED: regulatory protein NPR5-like            168   3e-45    
ref|XP_009356589.1|  PREDICTED: regulatory protein NPR3-like            177   1e-44    
ref|XP_011026213.1|  PREDICTED: regulatory protein NPR3-like            177   1e-44    
gb|KEH28396.1|  NPR1/NIM1-like regulatory protein, putative             175   1e-44    
ref|XP_009377037.1|  PREDICTED: regulatory protein NPR3-like            177   2e-44    
ref|XP_010942675.1|  PREDICTED: regulatory protein NPR3-like            176   3e-44    
ref|XP_008806697.1|  PREDICTED: regulatory protein NPR3-like            176   3e-44    
ref|XP_008383328.1|  PREDICTED: regulatory protein NPR3-like            176   4e-44    
ref|XP_010908601.1|  PREDICTED: regulatory protein NPR3-like            176   4e-44    
gb|ACE86413.1|  NPR1-like protein                                       176   4e-44    Musa ABB Group [cooking banana]
ref|XP_011040366.1|  PREDICTED: regulatory protein NPR3-like isof...    176   5e-44    
ref|XP_011040365.1|  PREDICTED: regulatory protein NPR3-like isof...    175   5e-44    
ref|XP_003519533.1|  PREDICTED: regulatory protein NPR3-like isof...    174   1e-43    
ref|XP_002322351.2|  ankyrin repeat family protein                      174   1e-43    Populus trichocarpa [western balsam poplar]
ref|XP_003617362.1|  NPR1-1 protein                                     174   2e-43    
ref|XP_010092646.1|  Regulatory protein                                 172   5e-43    
ref|XP_006853358.1|  hypothetical protein AMTR_s00032p00112510          172   5e-43    
gb|ABA38903.1|  NPR1-like protein                                       167   7e-43    Pyrus communis
ref|XP_008342333.1|  PREDICTED: regulatory protein NPR3-like            172   8e-43    
ref|XP_011096773.1|  PREDICTED: regulatory protein NPR3-like            171   9e-43    
gb|AIM54370.1|  nonexpressor of pathogenesis-related protein 1          172   1e-42    
ref|XP_007141442.1|  hypothetical protein PHAVU_008G195900g             171   1e-42    
ref|XP_003545296.1|  PREDICTED: regulatory protein NPR3-like            171   1e-42    
gb|EYU42809.1|  hypothetical protein MIMGU_mgv1a003347mg                171   2e-42    
gb|KDP22628.1|  hypothetical protein JCGZ_02854                         171   2e-42    
ref|XP_009357279.1|  PREDICTED: regulatory protein NPR3-like            170   3e-42    
gb|KHG00475.1|  Regulatory NPR3 -like protein                           169   5e-42    
gb|KHN11992.1|  Regulatory protein NPR3                                 169   5e-42    
gb|AEE81755.1|  regulatory protein NPR2                                 169   6e-42    
ref|XP_002520549.1|  Regulatory protein NPR1, putative                  169   1e-41    Ricinus communis
gb|ACJ04030.1|  NPR1-like protein                                       168   1e-41    Musa ABB Group [cooking banana]
gb|ABA38911.1|  NPR1-like protein                                       163   2e-41    Prunus avium [gean]
ref|XP_004303897.1|  PREDICTED: regulatory protein NPR3-like            167   3e-41    
gb|KDO44757.1|  hypothetical protein CISIN_1g007550mg                   166   3e-41    
ref|XP_009357280.1|  PREDICTED: regulatory protein NPR3-like isof...    167   3e-41    
gb|KDO77445.1|  hypothetical protein CISIN_1g007849mg                   166   4e-41    
gb|KGN53513.1|  hypothetical protein Csa_4G063470                       162   4e-41    
ref|XP_002307566.2|  hypothetical protein POPTR_0005s22770g             167   4e-41    Populus trichocarpa [western balsam poplar]
gb|AHF20180.1|  ankyrin-repeat protein                                  167   4e-41    
ref|XP_011032773.1|  PREDICTED: regulatory protein NPR3-like            167   5e-41    
ref|XP_008371834.1|  PREDICTED: regulatory protein NPR3 isoform X1      166   5e-41    
gb|KDO77446.1|  hypothetical protein CISIN_1g007849mg                   166   6e-41    
gb|KEH37013.1|  regulatory protein NPR1                                 165   6e-41    
gb|AGL61506.1|  NPR1                                                    166   8e-41    
gb|ABA38910.1|  NPR1-like protein                                       161   8e-41    Prunus avium [gean]
ref|XP_009341186.1|  PREDICTED: regulatory protein NPR3-like isof...    166   9e-41    
gb|KDO44755.1|  hypothetical protein CISIN_1g007550mg                   166   1e-40    
gb|KDO44756.1|  hypothetical protein CISIN_1g007550mg                   166   1e-40    
ref|XP_010272311.1|  PREDICTED: regulatory protein NPR3 isoform X1      165   1e-40    
ref|XP_010272312.1|  PREDICTED: regulatory protein NPR3 isoform X2      165   1e-40    
ref|XP_006468441.1|  PREDICTED: regulatory protein NPR3-like            165   1e-40    
ref|XP_002274045.1|  PREDICTED: regulatory protein NPR3 isoform X1      165   1e-40    Vitis vinifera
gb|KDO77444.1|  hypothetical protein CISIN_1g007849mg                   165   1e-40    
ref|XP_004486433.1|  PREDICTED: regulatory protein NPR3-like isof...    165   1e-40    
ref|XP_009602190.1|  PREDICTED: regulatory protein NPR3-like            165   1e-40    
ref|XP_004486434.1|  PREDICTED: regulatory protein NPR3-like isof...    165   1e-40    
emb|CDP17620.1|  unnamed protein product                                165   2e-40    
ref|XP_009133120.1|  PREDICTED: regulatory protein NPR4                 165   2e-40    
ref|XP_011001309.1|  PREDICTED: regulatory protein NPR3-like            164   2e-40    
ref|XP_006376994.1|  hypothetical protein POPTR_0012s11900g             164   2e-40    
gb|AAT57642.1|  NIM1-like protein 1                                     164   2e-40    Helianthus annuus
ref|XP_003594464.1|  NPR1-1 protein                                     164   2e-40    
emb|CDP17457.1|  unnamed protein product                                164   3e-40    
gb|ABK62792.1|  NPR-1                                                   164   3e-40    Pyrus pyrifolia [sha li]
ref|NP_001289241.1|  uncharacterized protein LOC103945128               164   4e-40    
ref|XP_006280229.1|  hypothetical protein CARUB_v10026146mg             164   4e-40    
ref|XP_009397343.1|  PREDICTED: regulatory protein NPR3-like            164   4e-40    
gb|ABN45747.1|  nonexpressor of pathogenesis-related genes 3            164   5e-40    Nicotiana glutinosa
ref|XP_008225741.1|  PREDICTED: regulatory protein NPR3-like            164   5e-40    
ref|XP_007214668.1|  hypothetical protein PRUPE_ppa003290mg             163   5e-40    
ref|XP_009629505.1|  PREDICTED: regulatory protein NPR3-like            163   7e-40    
gb|ACC77697.1|  NPR1-like protein                                       162   1e-39    Malus domestica [apple tree]
ref|NP_001280793.1|  regulatory protein NPR3-like                       162   1e-39    
ref|XP_004303898.1|  PREDICTED: regulatory protein NPR3-like            162   1e-39    
ref|XP_006437091.1|  hypothetical protein CICLE_v10031020mg             162   1e-39    
ref|XP_010056640.1|  PREDICTED: regulatory protein NPR3-like            162   2e-39    
emb|CDX78955.1|  BnaA01g10220D                                          161   2e-39    
gb|ABA38902.1|  NPR1-like protein                                       157   3e-39    Pyrus communis
ref|XP_004491374.1|  PREDICTED: regulatory protein NPR3-like            161   3e-39    
gb|EEC71545.1|  hypothetical protein OsI_03882                          160   4e-39    Oryza sativa Indica Group [Indian rice]
gb|ADP95762.1|  npr1 protein                                            161   4e-39    
gb|ACU78081.1|  NPR1-like protein                                       160   4e-39    
ref|NP_001234562.1|  NIM1-like protein 1                                160   5e-39    
emb|CDX99350.1|  BnaC01g12020D                                          160   6e-39    
ref|NP_193701.2|  NPR1-like protein 4                                   160   7e-39    Arabidopsis thaliana [mouse-ear cress]
gb|AHA43769.1|  NPR3                                                    160   7e-39    
emb|CAA19683.1|  putative protein                                       160   8e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004970097.1|  PREDICTED: regulatory protein NPR3-like            160   8e-39    
ref|XP_009777172.1|  PREDICTED: regulatory protein NPR3-like isof...    159   9e-39    
gb|AGI38074.1|  nonexpressor of pathogenesis-related protein 1          158   9e-39    
ref|XP_009621669.1|  PREDICTED: regulatory protein NPR3-like            159   1e-38    
ref|XP_009357282.1|  PREDICTED: regulatory protein NPR3-like isof...    159   1e-38    
gb|AGI38065.1|  nonexpressor of pathogenesis-related protein 1          158   1e-38    
ref|XP_006644769.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    159   1e-38    
ref|XP_002865280.1|  hypothetical protein ARALYDRAFT_494469             159   2e-38    
gb|EYU43699.1|  hypothetical protein MIMGU_mgv1a003483mg                159   2e-38    
gb|AGI38077.1|  nonexpressor of pathogenesis-related protein 1          157   2e-38    
ref|XP_004288961.1|  PREDICTED: regulatory protein NPR2-like            159   2e-38    
gb|AGI38064.1|  nonexpressor of pathogenesis-related protein 1          157   2e-38    
ref|XP_008371836.1|  PREDICTED: regulatory protein NPR3 isoform X2      158   2e-38    
gb|AAT57641.1|  NIM1-like protein 1                                     158   2e-38    
gb|AGI38075.1|  nonexpressor of pathogenesis-related protein 1          157   2e-38    
ref|NP_001233844.1|  NIM1-like protein 2                                158   2e-38    
ref|XP_007213800.1|  hypothetical protein PRUPE_ppa003221mg             158   3e-38    
ref|XP_009776511.1|  PREDICTED: regulatory protein NPR3-like isof...    158   3e-38    
gb|KHG09335.1|  Regulatory NPR3 -like protein                           158   3e-38    
gb|ABF48718.1|  ankyrin repeat BTB/POZ domain-containing protein        159   3e-38    
ref|XP_009777160.1|  PREDICTED: regulatory protein NPR3-like isof...    158   3e-38    
gb|AGI38062.1|  nonexpressor of pathogenesis-related protein 1          157   3e-38    
gb|ACJ45012.1|  NPR1-1 protein                                          157   4e-38    
gb|AGI38071.1|  nonexpressor of pathogenesis-related protein 1          156   4e-38    
dbj|BAD53355.1|  putative NPR1                                          158   4e-38    
ref|XP_003569900.1|  PREDICTED: regulatory protein NPR3-like            158   4e-38    
ref|XP_009341187.1|  PREDICTED: regulatory protein NPR3-like isof...    157   4e-38    
ref|NP_001044363.1|  Os01g0767900                                       158   4e-38    
gb|AGI38061.1|  nonexpressor of pathogenesis-related protein 1          156   5e-38    
gb|AGI38060.1|  nonexpressor of pathogenesis-related protein 1          156   5e-38    
ref|XP_006398160.1|  hypothetical protein EUTSA_v10000824mg             157   5e-38    
gb|AGI38063.1|  nonexpressor of pathogenesis-related protein 1          156   5e-38    
ref|NP_001147587.1|  regulatory protein NPR1                            157   5e-38    
ref|XP_009786050.1|  PREDICTED: regulatory protein NPR3-like isof...    157   6e-38    
gb|AGI38066.1|  nonexpressor of pathogenesis-related protein 1          156   6e-38    
gb|AFW84951.1|  regulatory protein NPR1                                 157   6e-38    
ref|XP_010536418.1|  PREDICTED: regulatory protein NPR3-like isof...    157   6e-38    
ref|XP_006285143.1|  hypothetical protein CARUB_v10006486mg             157   6e-38    
ref|XP_010481651.1|  PREDICTED: regulatory protein NPR3-like            157   7e-38    
ref|XP_008225738.1|  PREDICTED: regulatory protein NPR3-like            157   7e-38    
ref|XP_009786055.1|  PREDICTED: regulatory protein NPR3-like isof...    157   7e-38    
gb|KDP33858.1|  hypothetical protein JCGZ_07429                         157   7e-38    
ref|NP_001238658.1|  NPR1-1 protein                                     157   7e-38    
ref|XP_008459083.1|  PREDICTED: regulatory protein NPR3-like            157   8e-38    
gb|ACJ45014.1|  NPR1-2 protein                                          155   1e-37    
emb|CDY26398.1|  BnaA02g23720D                                          156   1e-37    
ref|XP_004497710.1|  PREDICTED: regulatory protein NPR3-like            156   1e-37    
ref|XP_010441782.1|  PREDICTED: regulatory protein NPR3                 156   1e-37    
ref|XP_010494583.1|  PREDICTED: regulatory protein NPR3                 156   1e-37    
ref|XP_010915287.1|  PREDICTED: regulatory protein NPR1-like isof...    155   2e-37    
gb|AGI38069.1|  nonexpressor of pathogenesis-related protein 1          154   2e-37    
ref|XP_006413942.1|  hypothetical protein EUTSA_v10024752mg             154   2e-37    
gb|KCW89778.1|  hypothetical protein EUGRSUZ_A02033                     154   2e-37    
ref|XP_010915286.1|  PREDICTED: regulatory protein NPR1-like isof...    155   2e-37    
ref|XP_002514127.1|  Regulatory protein NPR1, putative                  155   2e-37    
gb|KFK41854.1|  hypothetical protein AALP_AA2G179400                    155   2e-37    
ref|XP_006366625.1|  PREDICTED: regulatory protein NPR3-like            155   3e-37    
ref|XP_010093184.1|  Regulatory protein                                 155   3e-37    
ref|NP_001238674.1|  NPR1-2 protein                                     155   3e-37    
ref|XP_009128768.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    155   3e-37    
ref|NP_199324.2|  NPR1-like protein 3                                   155   4e-37    
gb|KCW89777.1|  hypothetical protein EUGRSUZ_A02033                     154   4e-37    
dbj|BAB09496.1|  regulatory protein NPR1-like; transcription fact...    155   4e-37    
ref|XP_006353069.1|  PREDICTED: regulatory protein NPR3-like            154   5e-37    
ref|XP_010538609.1|  PREDICTED: regulatory protein NPR3-like            154   6e-37    
gb|KHN38349.1|  Regulatory protein NPR3                                 153   6e-37    
ref|XP_010439666.1|  PREDICTED: regulatory protein NPR4-like            154   7e-37    
ref|XP_010434372.1|  PREDICTED: regulatory protein NPR4                 153   1e-36    
ref|XP_002867926.1|  predicted protein                                  153   1e-36    
ref|XP_006853864.1|  hypothetical protein AMTR_s00036p00114630          153   1e-36    
ref|XP_006413943.1|  hypothetical protein EUTSA_v10024752mg             153   1e-36    
ref|XP_010054033.1|  PREDICTED: regulatory protein NPR3-like            152   2e-36    
gb|AGC39275.1|  NPR1-like3 protein                                      152   2e-36    
gb|KHN14362.1|  Regulatory protein NPR3                                 152   2e-36    
ref|XP_007024872.1|  NPR1-like protein 4                                152   2e-36    
gb|AGI38068.1|  nonexpressor of pathogenesis-related protein 1          151   3e-36    
gb|AGI38059.1|  nonexpressor of pathogenesis-related protein 1          151   3e-36    
ref|XP_008782513.1|  PREDICTED: regulatory protein NPR1                 152   3e-36    
ref|XP_009101624.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    152   4e-36    
ref|XP_010449314.1|  PREDICTED: regulatory protein NPR4-like            151   7e-36    
gb|EEE52742.1|  hypothetical protein OsJ_35171                          141   1e-35    
ref|XP_004293734.1|  PREDICTED: regulatory protein NPR3-like isof...    150   2e-35    
ref|XP_010925463.1|  PREDICTED: regulatory protein NPR1-like            149   2e-35    
ref|XP_002464110.1|  hypothetical protein SORBIDRAFT_01g012450          149   2e-35    
ref|XP_004293735.1|  PREDICTED: regulatory protein NPR3-like isof...    149   2e-35    
ref|XP_010262064.1|  PREDICTED: regulatory protein NPR1-like            149   3e-35    
gb|AFO10948.1|  non-expressor of PR1-like protein                       148   3e-35    
ref|XP_010090069.1|  Regulatory protein                                 149   4e-35    
gb|KHG24206.1|  Regulatory NPR1 -like protein                           148   6e-35    
ref|XP_010536434.1|  PREDICTED: regulatory protein NPR3-like isof...    147   6e-35    
ref|XP_008793215.1|  PREDICTED: regulatory protein NPR1-like            146   8e-35    
gb|AHG52897.1|  putative regulatory protein NPR1                        146   8e-35    
gb|AHF20183.1|  non-expressor of pr1                                    147   1e-34    
emb|CDM84353.1|  unnamed protein product                                147   2e-34    
ref|XP_009412232.1|  PREDICTED: regulatory protein NPR1-like            147   2e-34    
ref|XP_007048936.1|  NPR1-like protein 3, putative                      147   2e-34    
ref|XP_004982222.1|  PREDICTED: regulatory protein NPR3-like            147   2e-34    
gb|AHF20182.1|  non-expressor of pr1                                    146   2e-34    
ref|XP_009402935.1|  PREDICTED: regulatory protein NPR1-like            146   3e-34    
gb|AAM62410.1|AF480488_1  NPR1                                          146   3e-34    
gb|ABX71071.1|  NPR1                                                    146   3e-34    
ref|XP_011078001.1|  PREDICTED: regulatory protein NPR1-like isof...    146   4e-34    
gb|AAR87166.1|  expressed protein (with alternative splicing)           145   4e-34    
ref|NP_001050850.1|  Os03g0667100                                       145   4e-34    
gb|AAR87167.1|  expressed protein (with alternative splicing)           145   5e-34    
gb|EAY91301.1|  hypothetical protein OsI_12918                          146   9e-34    
ref|XP_002308281.1|  Regulatory protein NPR1                            144   1e-33    
gb|ABL63913.1|  NPR1-like protein                                       144   1e-33    
ref|XP_009606361.1|  PREDICTED: regulatory protein NPR1                 144   1e-33    
emb|CAP12787.1|  NPR1 protein                                           143   2e-33    
gb|AAS57869.1|  NPR1                                                    142   2e-33    
gb|ABM64782.1|  regulatory protein NPR1                                 144   2e-33    
emb|CDM81617.1|  unnamed protein product                                141   3e-33    
ref|XP_002456404.1|  hypothetical protein SORBIDRAFT_03g035720          144   3e-33    
ref|XP_010242246.1|  PREDICTED: regulatory protein NPR1-like            143   3e-33    
ref|XP_007147518.1|  hypothetical protein PHAVU_006G131400g             143   4e-33    
ref|XP_011003334.1|  PREDICTED: regulatory protein NPR1                 142   5e-33    
ref|XP_009802447.1|  PREDICTED: regulatory protein NPR1                 142   5e-33    
gb|KDO40806.1|  hypothetical protein CISIN_1g007758mg                   140   5e-33    
ref|XP_010655930.1|  PREDICTED: regulatory protein NPR3 isoform X2      141   6e-33    
ref|XP_007202872.1|  hypothetical protein PRUPE_ppa015728mg             142   6e-33    
dbj|BAJ94508.1|  predicted protein                                      142   6e-33    
gb|AEY99652.1|  NPR1-1                                                  142   6e-33    
ref|XP_007012791.1|  Regulatory protein isoform 2                       140   7e-33    
gb|AAS55117.1|  NPR1                                                    142   7e-33    
ref|XP_008391028.1|  PREDICTED: regulatory protein NPR1                 141   1e-32    
ref|XP_006651667.1|  PREDICTED: regulatory protein NPR4-like            140   1e-32    
ref|XP_006357709.1|  PREDICTED: regulatory protein NPR1-like            141   1e-32    
gb|ABG38308.1|  NPR1                                                    141   2e-32    
ref|XP_006484993.1|  PREDICTED: regulatory protein NPR4-like isof...    140   2e-32    
ref|XP_006437097.1|  hypothetical protein CICLE_v10031343mg             139   2e-32    
ref|XP_006484994.1|  PREDICTED: regulatory protein NPR4-like isof...    139   2e-32    
tpg|DAA52628.1|  TPA: hypothetical protein ZEAMMB73_148488              140   3e-32    
ref|XP_006484992.1|  PREDICTED: regulatory protein NPR4-like isof...    140   4e-32    
gb|ABC54558.1|  nonexpresser of pathogenesis-related 1                  140   4e-32    
ref|XP_011078003.1|  PREDICTED: regulatory protein NPR1-like isof...    140   4e-32    
ref|XP_008242373.1|  PREDICTED: regulatory protein NPR1                 140   5e-32    
ref|XP_003534926.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    139   5e-32    
ref|XP_007012790.1|  Regulatory protein isoform 1                       140   5e-32    
ref|XP_006484986.1|  PREDICTED: regulatory protein NPR4-like isof...    138   5e-32    
ref|XP_006484985.1|  PREDICTED: regulatory protein NPR4-like isof...    139   6e-32    
gb|EEE55442.1|  hypothetical protein OsJ_03589                          135   8e-32    
gb|ABR23001.1|  NPR1                                                    139   8e-32    
ref|NP_001234558.1|  non-inducible immunity 1                           139   8e-32    
gb|KDO39256.1|  hypothetical protein CISIN_1g045501mg                   136   1e-31    
gb|ADI24348.1|  non-expressor of PR1                                    138   2e-31    
emb|CAN67078.1|  hypothetical protein VITISV_004499                     139   2e-31    
ref|XP_006484984.1|  PREDICTED: regulatory protein NPR4-like isof...    138   2e-31    
emb|CAJ19095.1|  NPR1-like 1 protein                                    138   2e-31    
ref|XP_009361630.1|  PREDICTED: regulatory protein NPR1                 138   2e-31    
ref|XP_006451500.1|  hypothetical protein CICLE_v10007832mg             138   2e-31    
ref|XP_006451499.1|  hypothetical protein CICLE_v10007832mg             137   2e-31    
ref|XP_006437106.1|  hypothetical protein CICLE_v10030929mg             138   4e-31    
ref|XP_009388569.1|  PREDICTED: regulatory protein NPR1-like            137   4e-31    
gb|EYU28391.1|  hypothetical protein MIMGU_mgv1a003409mg                137   4e-31    
gb|AGI38070.1|  nonexpressor of pathogenesis-related protein 1          134   1e-30    
gb|KDO39823.1|  hypothetical protein CISIN_1g008204mg                   135   2e-30    
gb|EMS60174.1|  Regulatory protein NPR4                                 132   4e-30    
ref|XP_009408867.1|  PREDICTED: regulatory protein NPR1-like            134   4e-30    
gb|ABI93182.1|  NPR1-like protein                                       134   5e-30    
ref|XP_002455011.1|  hypothetical protein SORBIDRAFT_03g002980          134   5e-30    
gb|KDO40807.1|  hypothetical protein CISIN_1g014994mg                   131   6e-30    
ref|XP_006437094.1|  hypothetical protein CICLE_v10031258mg             132   6e-30    
ref|XP_002281475.1|  PREDICTED: regulatory protein NPR1                 134   6e-30    
gb|ABA41259.1|  NPR1-like protein                                       127   6e-30    
tpg|DAA52994.1|  TPA: regulatory protein NPR1                           133   7e-30    
gb|EMT27860.1|  Regulatory protein NPR1                                 133   7e-30    
ref|NP_001042286.1|  Os01g0194300                                       133   1e-29    
gb|AAX18700.1|  NPR1-like 1                                             133   1e-29    
ref|XP_009392990.1|  PREDICTED: regulatory protein NPR1-like isof...    132   1e-29    
ref|XP_010047548.1|  PREDICTED: regulatory protein NPR1 isoform X2      132   1e-29    
gb|AGH18701.1|  NPR1-like 1 protein                                     132   1e-29    
ref|XP_006645596.1|  PREDICTED: regulatory protein NPR1-like            131   1e-29    
gb|AAP92751.1|  NPR1-like protein                                       132   2e-29    
ref|XP_009392989.1|  PREDICTED: regulatory protein NPR1-like isof...    132   2e-29    
ref|XP_006484991.1|  PREDICTED: regulatory protein NPR4-like isof...    132   2e-29    
ref|XP_010047547.1|  PREDICTED: regulatory protein NPR1 isoform X1      132   3e-29    
dbj|BAJ91588.1|  predicted protein                                      131   3e-29    
dbj|BAJ90272.1|  predicted protein                                      131   4e-29    
gb|ABA60140.1|  NPR1-like protein                                       125   4e-29    
gb|ABA60139.1|  NPR1-like protein                                       125   5e-29    
ref|XP_004968514.1|  PREDICTED: regulatory protein NPR1-like            130   6e-29    
ref|XP_010230579.1|  PREDICTED: regulatory protein NPR1 isoform X3      130   7e-29    
gb|ABA60144.1|  NPR1-like protein                                       125   7e-29    
ref|XP_010230578.1|  PREDICTED: regulatory protein NPR1 isoform X1      130   9e-29    
gb|ABA60146.1|  NPR1-like protein                                       125   1e-28    
gb|ABA60145.1|  NPR1-like protein                                       124   1e-28    
gb|ABA41258.1|  NPR1-like protein                                       124   1e-28    
ref|XP_003564857.1|  PREDICTED: regulatory protein NPR1 isoform X2      129   1e-28    
ref|XP_008807141.1|  PREDICTED: regulatory protein NPR1-like            129   1e-28    
gb|ABA60143.1|  NPR1-like protein                                       124   1e-28    
gb|EMT27088.1|  hypothetical protein F775_31940                         128   1e-28    
gb|ABA41270.1|  NPR1-like protein                                       124   2e-28    
ref|XP_006391648.1|  hypothetical protein EUTSA_v10023365mg             129   2e-28    
ref|XP_006448743.1|  hypothetical protein CICLE_v10017873mg             128   2e-28    
dbj|BAJ87143.1|  predicted protein                                      129   3e-28    
ref|NP_001152107.1|  LOC100285744                                       127   3e-28    
emb|CDP03145.1|  unnamed protein product                                128   4e-28    
ref|XP_008380174.1|  PREDICTED: regulatory protein NPR3-like            126   4e-28    
gb|AES65476.2|  regulatory protein NPR1                                 128   5e-28    
ref|XP_003595225.1|  NPR1                                               128   5e-28    
ref|XP_009385600.1|  PREDICTED: regulatory protein NPR1-like isof...    126   1e-27    
gb|KFK36581.1|  hypothetical protein AALP_AA4G142100                    127   1e-27    
ref|XP_003561461.1|  PREDICTED: regulatory protein NPR3-like            127   1e-27    
gb|EAZ10881.1|  hypothetical protein OsJ_00725                          128   1e-27    
gb|ABA41263.1|  NPR1-like protein                                       122   1e-27    
gb|ABA41272.1|  NPR1-like protein                                       121   2e-27    
ref|XP_009385599.1|  PREDICTED: regulatory protein NPR1-like isof...    126   2e-27    
gb|ABA38912.1|  NPR1-like protein                                       121   2e-27    
ref|XP_009139916.1|  PREDICTED: regulatory protein NPR2                 126   2e-27    
gb|ABA38913.1|  NPR1-like protein                                       121   2e-27    
emb|CDX94376.1|  BnaC01g18080D                                          126   3e-27    
gb|ABA38918.1|  NPR1-like protein                                       121   3e-27    
gb|ABB59685.1|  NPR1-like protein                                       121   3e-27    
gb|AAM88865.2|AF527176_1  putative NPR1                                 125   3e-27    
emb|CDX82577.1|  BnaC07g02890D                                          125   4e-27    
ref|XP_002886354.1|  non-expressor of PR1                               125   4e-27    
gb|ABB59684.1|  NPR1-like protein                                       120   4e-27    
ref|XP_006485155.1|  PREDICTED: regulatory protein NPR4-like            125   5e-27    
gb|ABA38914.1|  NPR1-like protein                                       120   5e-27    
gb|AAV52267.1|  putative NPR1 transcriptional factor                    125   5e-27    
ref|XP_009139896.1|  PREDICTED: regulatory protein NPR1-like            125   5e-27    
emb|CDX89362.1|  BnaA01g15310D                                          125   6e-27    
gb|ABR46021.1|  non-expressor of PR1                                    125   7e-27    



>emb|CDP14213.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/493 (81%), Positives = 421/493 (85%), Gaps = 22/493 (4%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             ++EDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD+P 
Sbjct  2     SLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDTPA  61

Query  288   sds-pgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEP  464
                  GSRMG   AGA A+SPRGS  QVIPVNSVGYEVFLLM+QFLYSGQVSIVPQKHEP
Sbjct  62    GLDPSGSRMG-GPAGALASSPRGSNSQVIPVNSVGYEVFLLMLQFLYSGQVSIVPQKHEP  120

Query  465   RPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVL  644
             RPNC ERGCWHTHCTSAVDLALDTL+AARSFGVEQLALLTQKQLASMVEKASIEDVM+VL
Sbjct  121   RPNCGERGCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQLASMVEKASIEDVMKVL  180

Query  645   IASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKssla--rssllah  818
             IAS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR K+SL         H
Sbjct  181   IASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKTSLVRGSLMPHHH  240

Query  819   hhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSRE  998
             HHH HD+ AAA+LE QKIRRMRRALDSSDVELVKLMVMGEGLNLD+ALALHYAVENCSRE
Sbjct  241   HHHNHDISAAAELEGQKIRRMRRALDSSDVELVKLMVMGEGLNLDDALALHYAVENCSRE  300

Query  999   VVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDI  1178
             VVKALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DGITPLDI
Sbjct  301   VVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGITPLDI  360

Query  1179  LRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPA  1358
             LRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREEG     N  +SA IYP 
Sbjct  361   LRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEG---NANAPASATIYP-  416

Query  1359  ALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTRQNS  1538
                MSEEH      SS  SGN+ NLNLDSR+VYLNLGA  ++G  G H         Q  
Sbjct  417   --PMSEEH-----TSSSSSGNMANLNLDSRMVYLNLGAAASAGQMGRHGS-------QGG  462

Query  1539  GDPPSMYHHSHEY  1577
              DP   +HHSH+Y
Sbjct  463   CDPSIYHHHSHDY  475



>ref|XP_007028566.1| Ankyrin repeat family protein / BTB/POZ domain-containing protein 
[Theobroma cacao]
 gb|EOY09068.1| Ankyrin repeat family protein / BTB/POZ domain-containing protein 
[Theobroma cacao]
Length=481

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/502 (78%), Positives = 420/502 (84%), Gaps = 31/502 (6%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS+ E+SLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD 
Sbjct  1     MSSFEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDP  60

Query  282   pgsdspg-sRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKH  458
             P    P  SRM        +A+  GS P VIPVNSVGYEVFLL++QFLYSGQVSIVPQKH
Sbjct  61    PSGLDPVGSRMN-----PASAAAAGSRPGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKH  115

Query  459   EPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMR  638
             EPRPNC ER CWHTHCTSAVDLAL+TL+AAR FGVEQLALLTQKQLASMVEKASIEDVM+
Sbjct  116   EPRPNCSERACWHTHCTSAVDLALETLAAARYFGVEQLALLTQKQLASMVEKASIEDVMK  175

Query  639   VLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllah  818
             VLIAS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR KSSLAR  L+ H
Sbjct  176   VLIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSLARRPLITH  235

Query  819   hhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSRE  998
             HHH HDL + ADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSRE
Sbjct  236   HHHHHDLTSTADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSRE  295

Query  999   VVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDI  1178
             VVK LLELGAADVNY AG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPLDI
Sbjct  296   VVKTLLELGAADVNYRAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDI  355

Query  1179  LRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPA  1358
             LRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA+VISREEG   + N  +S  IYP 
Sbjct  356   LRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVISREEG---SANAPTSTAIYP-  411

Query  1359  ALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGA---------VENSGGGGHHNQR  1511
                MS+EH+     SS    N+  LNLDSRLVYLNLGA         +E      H++QR
Sbjct  412   --PMSDEHN-----SSSSGSNLATLNLDSRLVYLNLGATGSTQMGSRMEGDDDSSHNSQR  464

Query  1512  EAMTTRQNSGDPPSMYHHSHEY  1577
             EAM    N  D P+MYHHSH++
Sbjct  465   EAM----NRHD-PTMYHHSHDF  481



>gb|KHG11076.1| Regulatory NPR5 -like protein [Gossypium arboreum]
Length=490

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/511 (77%), Positives = 418/511 (82%), Gaps = 40/511 (8%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS++++SLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD 
Sbjct  1     MSSLDESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDP  60

Query  282   pgsdspg-sRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKH  458
             P    P  SRM       G  S  GS P VIPVNSVGYEVFLL++QFLYSGQVSIVPQKH
Sbjct  61    PAGLDPVGSRMN-----RGGGSTAGSRPGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKH  115

Query  459   EPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMR  638
             EPRPNC ER CWHTHCTSAVDLALDTL+AAR FGVEQLALLTQKQLASMVEKASIEDVM+
Sbjct  116   EPRPNCSERACWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLASMVEKASIEDVMK  175

Query  639   VLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarss----  806
             VLIAS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR KSSLAR S    
Sbjct  176   VLIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSLARRSLIPH  235

Query  807   -----llahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALH  971
                     H H  HDL AAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALH
Sbjct  236   HHHHHHHHHPHPHHDLTAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALH  295

Query  972   YAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRT  1151
             YAVENCSREVVK LLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT
Sbjct  296   YAVENCSREVVKTLLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRT  355

Query  1152  ADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannn  1331
              DG+TPLDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREEG   + N 
Sbjct  356   VDGVTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEG---SVNP  412

Query  1332  sssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGA---------VENS  1484
              +S  IYP    MS+EH+     SS    N+ NLNLDSRLVYLNLGA         +E  
Sbjct  413   PTSTAIYP---PMSDEHN-----SSSSGNNLANLNLDSRLVYLNLGATASTQMGSRMEGD  464

Query  1485  GGGGHHNQREAMTTRQNSGDPPSMYHHSHEY  1577
                 H++QREAM         P+MYHHSH++
Sbjct  465   DDSSHNSQREAMNRHD-----PTMYHHSHDF  490



>ref|XP_002275980.1| PREDICTED: regulatory protein NPR5 [Vitis vinifera]
Length=490

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/501 (80%), Positives = 422/501 (84%), Gaps = 23/501 (5%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T+EDSLRSLSLDYLNLLINGQAFSDVTF+VEGRLVHAHRCILAARSLFFRKFFCGPD P 
Sbjct  2     TLEDSLRSLSLDYLNLLINGQAFSDVTFNVEGRLVHAHRCILAARSLFFRKFFCGPDPPA  61

Query  288   sds-pgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEP  464
                  GSRMG   A A A SPRG    VIPVNSVGYEVFLL++QFLYSGQVSIVPQKHEP
Sbjct  62    GLDPGGSRMG-SAAAALATSPRGGNSHVIPVNSVGYEVFLLVLQFLYSGQVSIVPQKHEP  120

Query  465   RPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVL  644
             RPNC ERGCWHTHCTSAVDLALDTL+AARSFGVEQLALLTQKQLASMVEKASIEDVM+VL
Sbjct  121   RPNCGERGCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQLASMVEKASIEDVMKVL  180

Query  645   IASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhh  824
             IAS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR KSSLAR SL+ HHH
Sbjct  181   IASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSLARRSLMPHHH  240

Query  825   hrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVV  1004
             H  D+GAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVV
Sbjct  241   HHQDIGAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVV  300

Query  1005  KALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILR  1184
             KALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPLD+LR
Sbjct  301   KALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDVLR  360

Query  1185  TLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAAL  1364
             TLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA+V+SREEG   + N  SS  IYP   
Sbjct  361   TLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEG---SANAPSSTTIYPPMS  417

Query  1365  AMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGG---------GHHNQREA  1517
                         SS  S N+ +LNLDSRLVYLNLGA  +   G          H+NQREA
Sbjct  418   DDHH--------SSSSSSNMASLNLDSRLVYLNLGATGSGQMGSRMDREDDVSHNNQREA  469

Query  1518  MTTRQNSGD-PPSMYHHSHEY  1577
             M    + G    SMYHHSHEY
Sbjct  470   MNRHGSQGGCDTSMYHHSHEY  490



>emb|CAN80112.1| hypothetical protein VITISV_010389 [Vitis vinifera]
Length=490

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/501 (80%), Positives = 421/501 (84%), Gaps = 23/501 (5%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T+EDSLRSLSLDYLNLLINGQAFSDVTF+VEGRLVHAHRCILAARSLFFRKFFCGPD P 
Sbjct  2     TLEDSLRSLSLDYLNLLINGQAFSDVTFNVEGRLVHAHRCILAARSLFFRKFFCGPDPPA  61

Query  288   sds-pgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEP  464
                  G RMG   A A A SPRG    VIPVNSVGYEVFLL++QFLYSGQVSIVPQKHEP
Sbjct  62    GLDPGGXRMG-SAAAALATSPRGGNSHVIPVNSVGYEVFLLVLQFLYSGQVSIVPQKHEP  120

Query  465   RPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVL  644
             RPNC ERGCWHTHCTSAVDLALDTL+AARSFGVEQLALLTQKQLASMVEKASIEDVM+VL
Sbjct  121   RPNCGERGCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQLASMVEKASIEDVMKVL  180

Query  645   IASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhh  824
             IAS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR KSSLAR SL+ HHH
Sbjct  181   IASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSLARRSLMPHHH  240

Query  825   hrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVV  1004
             H  D+GAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVV
Sbjct  241   HHQDIGAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVV  300

Query  1005  KALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILR  1184
             KALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPLD+LR
Sbjct  301   KALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDVLR  360

Query  1185  TLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAAL  1364
             TLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA+V+SREEG   + N  SS  IYP   
Sbjct  361   TLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEG---SANAPSSTTIYPPMS  417

Query  1365  AMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGG---------GHHNQREA  1517
                         SS  S N+ +LNLDSRLVYLNLGA  +   G          H+NQREA
Sbjct  418   DDHH--------SSSSSSNMASLNLDSRLVYLNLGATGSGQMGSRMDREDDVSHNNQREA  469

Query  1518  MTTRQNSGD-PPSMYHHSHEY  1577
             M    + G    SMYHHSHEY
Sbjct  470   MNRHGSQGGCDTSMYHHSHEY  490



>gb|KDP26222.1| hypothetical protein JCGZ_22468 [Jatropha curcas]
Length=493

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/485 (78%), Positives = 403/485 (83%), Gaps = 22/485 (5%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD P    PGS   ++ +  G 
Sbjct  19    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPSGLDPGSGSRMINSVGGG  78

Query  339   aSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAV  518
              S  GS   VIPVNSVGYEVFLL++QFLYSGQVSIVPQKHEPRPNC ERGCWHTHCTSAV
Sbjct  79    -SATGSRQNVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAV  137

Query  519   DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
             DLALDTL+AAR FGVEQLALLTQKQLA+MVEKASIEDVM+VLIAS KQEM QLWTTCSHL
Sbjct  138   DLALDTLAAARYFGVEQLALLTQKQLATMVEKASIEDVMKVLIASRKQEMHQLWTTCSHL  197

Query  699   VAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdl-------gaaadl  857
             VAKSGLPPEVLAKHLPIDVVAKIEELR KSSLAR SL+ HHHH H          AAADL
Sbjct  198   VAKSGLPPEVLAKHLPIDVVAKIEELRLKSSLARRSLMPHHHHHHHHHPHHHDLTAAADL  257

Query  858   EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADV  1037
             EDQK+RRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVE+CSREVVKALLELGAADV
Sbjct  258   EDQKVRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVESCSREVVKALLELGAADV  317

Query  1038  NYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGA  1217
             NYPAG AG+TPLH+AAEMVSPDMV+VLLDHHADPNVRT DGITPLDILRTLTSDFLFKGA
Sbjct  318   NYPAGPAGKTPLHVAAEMVSPDMVAVLLDHHADPNVRTVDGITPLDILRTLTSDFLFKGA  377

Query  1218  IPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAALAMSEEHHHRNI  1397
             +PGLAHIEPNKLRLCLELVQSAA+VISREEG  + N  SSS  IYP  ++     H  N 
Sbjct  378   VPGLAHIEPNKLRLCLELVQSAALVISREEG--SVNAGSSSNAIYPPPIS----DHENNS  431

Query  1398  PSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQR----EAMTTRQNSGDPPSMY-H  1562
              SSGG G   NLNLDSRLVYLNLGA   SGG G    R    E  +     G  P+MY H
Sbjct  432   TSSGGGG---NLNLDSRLVYLNLGATSVSGGSGQMGSRMEGDEDNSHNSQRGHDPTMYHH  488

Query  1563  HSHEY  1577
             HSH++
Sbjct  489   HSHDF  493



>ref|XP_011075394.1| PREDICTED: regulatory protein NPR5-like [Sesamum indicum]
Length=480

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/501 (79%), Positives = 417/501 (83%), Gaps = 36/501 (7%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T EDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD+  
Sbjct  2     TPEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDTTQ  61

Query  288   sdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPR  467
             S     RMG      G+ SPRG   QVIPVNSVGYEVFLLM+QFLYSGQVSIVPQKHEPR
Sbjct  62    SGLDPLRMG-----PGSGSPRGHSSQVIPVNSVGYEVFLLMLQFLYSGQVSIVPQKHEPR  116

Query  468   PNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLI  647
             PNC ERGCWHTHCTSAVDLALDTL+AARSFGVEQLALLTQKQLASMVEKASIEDVM+VLI
Sbjct  117   PNCGERGCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQLASMVEKASIEDVMKVLI  176

Query  648   ASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhh  827
             AS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR KSSLAR SL+ HHH 
Sbjct  177   ASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSLARRSLMPHHHP  236

Query  828   rhdlg-aaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVV  1004
              H    AAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVV
Sbjct  237   HHHDLGAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVV  296

Query  1005  KALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILR  1184
             KALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DGITPLD+LR
Sbjct  297   KALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGITPLDVLR  356

Query  1185  TLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAAL  1364
             TLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREEG     +  SSA IYP   
Sbjct  357   TLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEG---NASAPSSAAIYP---  410

Query  1365  AMSEEHH-------HRNIPSSGGSGNIVNLNLDSRLVYLNLGAV---ENSGGGGHHNQRE  1514
              M ++ H         NI ++GGS     LNLDSR+VYLNLGA    + S G G  +QRE
Sbjct  411   PMGDQDHGSSGSSGAGNI-AAGGS-----LNLDSRMVYLNLGAQIGGKLSEGEGSSSQRE  464

Query  1515  AMTTRQNSGDPPSMY-HHSHE  1574
              M           MY HHSH+
Sbjct  465   TMNRHD-------MYHHHSHD  478



>gb|KHG10935.1| Regulatory NPR5 -like protein [Gossypium arboreum]
Length=482

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/504 (77%), Positives = 413/504 (82%), Gaps = 34/504 (7%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS+ E+SLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC PD 
Sbjct  1     MSSFEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCSPDP  60

Query  282   pgsdspg-sRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKH  458
             P    P  SRM         A+  GS P VI V+SVGYEVFLL++QFLYSGQVSIVPQKH
Sbjct  61    PSGLDPVGSRMN------PTAAAAGSRPGVILVSSVGYEVFLLLLQFLYSGQVSIVPQKH  114

Query  459   EPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMR  638
             EPRPNC ER CWHTHCTSAVDLALDTLSAAR FGVEQLALLTQKQL+SMVEKASIEDVM+
Sbjct  115   EPRPNCSERACWHTHCTSAVDLALDTLSAARYFGVEQLALLTQKQLSSMVEKASIEDVMK  174

Query  639   VLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssl--l  812
             VLIAS KQ+M QLW+TCSHLVAKSGLPPEVLAKHLPIDVVAKIEE+R KSSLAR SL   
Sbjct  175   VLIASRKQDMHQLWSTCSHLVAKSGLPPEVLAKHLPIDVVAKIEEMRLKSSLARRSLIPH  234

Query  813   ahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCS  992
              H  H HDL  AADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCS
Sbjct  235   HHQQHHHDLATAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCS  294

Query  993   REVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPL  1172
             REVVK LLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPL
Sbjct  295   REVVKTLLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPL  354

Query  1173  DILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIY  1352
             DILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA+VISREEG     N  +S  IY
Sbjct  355   DILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVISREEG---NANPPTSTAIY  411

Query  1353  PAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGA---------VENSGGGGHHN  1505
             P    MS+EH+     SS    N+ NLNLDSRLVYLNLGA         +E      H++
Sbjct  412   P---PMSDEHN-----SSSSGSNLANLNLDSRLVYLNLGATGSTQMGSRMEGDDDSSHNS  463

Query  1506  QREAMTTRQNSGDPPSMYHHSHEY  1577
              REAM         P+MYHHSH++
Sbjct  464   HREAMNRHD-----PTMYHHSHDF  482



>ref|XP_009609217.1| PREDICTED: regulatory protein NPR5-like [Nicotiana tomentosiformis]
Length=475

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/496 (78%), Positives = 411/496 (83%), Gaps = 28/496 (6%)
 Frame = +3

Query  105   STVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC-----  269
             ST ED+LRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARS FFRKFFC     
Sbjct  3     STPEDNLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSHFFRKFFCGPDSP  62

Query  270   gpdspgsdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVP  449
                    D  GSRMG VG  +   SPRGS   VIPVNSVGYEVFLLM+QFLYSGQVSIVP
Sbjct  63    RSSPQQLDPTGSRMGPVGGVS---SPRGS-GSVIPVNSVGYEVFLLMLQFLYSGQVSIVP  118

Query  450   QKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIED  629
             QKHEPRPNC ERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLA MVEKASIED
Sbjct  119   QKHEPRPNCGERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLAIMVEKASIED  178

Query  630   VMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssl  809
             VMRVLIAS KQ+MQQLWTTCSHLVAKSGLPPE+LAKHLPIDVVAKIEELR KS+LAR SL
Sbjct  179   VMRVLIASRKQDMQQLWTTCSHLVAKSGLPPEILAKHLPIDVVAKIEELRLKSNLARRSL  238

Query  810   lahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENC  989
             + HHHH     AA   EDQKIRRM+RALDSSDVELVKLMVMGEGLNLDE++ALHYAVENC
Sbjct  239   MPHHHHHDLGSAAEL-EDQKIRRMKRALDSSDVELVKLMVMGEGLNLDESIALHYAVENC  297

Query  990   SREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITP  1169
             SREVVKALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DGITP
Sbjct  298   SREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTLDGITP  357

Query  1170  LDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVI  1349
             LDILRTLTSDFLFKGA+PG+ HIEPNKLRLCLELVQSAAMVISREEG  +AN + SS  I
Sbjct  358   LDILRTLTSDFLFKGAVPGINHIEPNKLRLCLELVQSAAMVISREEG--SANIDPSSTTI  415

Query  1350  YPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTR  1529
             YP  ++        +  S G  GN  N+N+DSR+VYLNLGA  N+              R
Sbjct  416   YPPNVSDDHT---SSTSSGGNIGN--NVNIDSRMVYLNLGAATNNS-----------QNR  459

Query  1530  QNSGDPPSMYHHSHEY  1577
              N  DP SMYHHSH+Y
Sbjct  460   HNGCDPSSMYHHSHDY  475



>ref|XP_002308905.1| ankyrin repeat family protein [Populus trichocarpa]
 gb|EEE92428.1| ankyrin repeat family protein [Populus trichocarpa]
Length=481

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/501 (78%), Positives = 426/501 (85%), Gaps = 32/501 (6%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T+EDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD P 
Sbjct  2     TLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPS  61

Query  288   sds-pgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEP  464
                  GSR+  VG      SP GS   VIPVNSVGYEVFLL++QFLYSGQVSIVPQKHEP
Sbjct  62    GLDPSGSRINTVG------SP-GSRSNVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEP  114

Query  465   RPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVL  644
             RPNC ERGCWHTHCTSAVDLALDTL+AAR FGVEQLA+LTQKQLA+MVEKASIEDVM+VL
Sbjct  115   RPNCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLAMLTQKQLANMVEKASIEDVMKVL  174

Query  645   IASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssll-ahh  821
             IAS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR KSS+AR SL+  HH
Sbjct  175   IASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSIARRSLMPHHH  234

Query  822   hhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREV  1001
             HH HDL +AADLEDQKIRRM+RALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREV
Sbjct  235   HHLHDLTSAADLEDQKIRRMKRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREV  294

Query  1002  VKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDIL  1181
             VKALLELGAA+VNY AG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPLDIL
Sbjct  295   VKALLELGAANVNYQAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDIL  354

Query  1182  RTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAA  1361
             RTLTSDFLFKGA+PGLAH+EPNKLRLCLELVQSAAMV+SREEG    N N++S +IYP  
Sbjct  355   RTLTSDFLFKGAVPGLAHMEPNKLRLCLELVQSAAMVLSREEG----NVNATSTLIYP--  408

Query  1362  LAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGA---------VENSGGGGHHNQRE  1514
              +MS+EH   N  SSG   N+ NLNLDSRLVYLNLGA         ++      H+NQR+
Sbjct  409   -SMSDEH---NTSSSG--SNLANLNLDSRLVYLNLGAAGSGQMGSRMDEEDDSNHNNQRD  462

Query  1515  AMTTRQNSGDPPSMYHHSHEY  1577
                  ++  DP   +HHSH++
Sbjct  463   HHAMSRH--DPTMYHHHSHDF  481



>ref|XP_002531503.1| aberrant large forked product, putative [Ricinus communis]
 gb|EEF30890.1| aberrant large forked product, putative [Ricinus communis]
Length=491

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/510 (77%), Positives = 419/510 (82%), Gaps = 40/510 (8%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T+EDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGP+ P 
Sbjct  2     TLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPEPPS  61

Query  288   sdspgsRMGLVgagagaaSP------------RGSIPQVIPVNSVGYEVFLLMMQFLYSG  431
                     GL  +G+    P            RG+   VIPVNSVGYEVFLL++QFLYSG
Sbjct  62    --------GLDPSGSRINHPGGGGGGSGGGVSRGN--NVIPVNSVGYEVFLLLLQFLYSG  111

Query  432   QVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVE  611
             QVSIVPQKHEPRPNC ERGCWHTHCTSAVDLALDTL+AAR FGVEQLALLTQKQLASMVE
Sbjct  112   QVSIVPQKHEPRPNCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLASMVE  171

Query  612   KASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKss  791
             KASIEDVM+VLIAS KQ+M QLWTTCSHL AKSGLPPEVLAKHLPIDVVAKIEELR KSS
Sbjct  172   KASIEDVMKVLIASRKQDMHQLWTTCSHLAAKSGLPPEVLAKHLPIDVVAKIEELRLKSS  231

Query  792   larssllahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALH  971
             LAR SL+ HHHH HDL  AADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALH
Sbjct  232   LARRSLMPHHHHHHDLTTAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALH  291

Query  972   YAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRT  1151
             YAVENCSREVVKALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT
Sbjct  292   YAVENCSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRT  351

Query  1152  ADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannn  1331
              DG+TPLDILRTLTSDFLFKGA+PGLAHIEPNKLRLCLELVQSAA+V+SREEG   + N 
Sbjct  352   VDGVTPLDILRTLTSDFLFKGAVPGLAHIEPNKLRLCLELVQSAALVLSREEG---SVNA  408

Query  1332  sssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSG--------  1487
              +S  IYP    MS+EH+     SS G  N+ NLNLDSRLVYLNLGA   SG        
Sbjct  409   PTSTAIYP---PMSDEHNS----SSSGGSNLANLNLDSRLVYLNLGATGCSGQMGSSRME  461

Query  1488  GGGHHNQREAMTTRQNSGDPPSMYHHSHEY  1577
             G   H+   +      S   P+MYHHSHE+
Sbjct  462   GDDDHSSHSSQQRDSMSRHDPTMYHHSHEF  491



>ref|XP_006491569.1| PREDICTED: regulatory protein NPR5-like isoform X1 [Citrus sinensis]
Length=506

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/495 (75%), Positives = 403/495 (81%), Gaps = 29/495 (6%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD P    P +   +     G 
Sbjct  19    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPSGLDPATASRI---NQGP  75

Query  339   aSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAV  518
              SP      VIPVNSVGYEVFLL++QFLYSGQVSIVPQKHEPRPNC ERGCWHTHCTSAV
Sbjct  76    PSPASRPTGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAV  135

Query  519   DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
             DLALDTL+AAR FGVEQLALLTQKQLA+MVEKASIEDVM+VLIAS KQ+M QLWTTCSHL
Sbjct  136   DLALDTLAAARYFGVEQLALLTQKQLANMVEKASIEDVMKVLIASRKQDMHQLWTTCSHL  195

Query  699   VAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrh----dlgaaadlEDQ  866
             VAKSGLPPEVLAKHLPI+VVAKIE+LRHKSSLAR SL++HHHH H        AADLEDQ
Sbjct  196   VAKSGLPPEVLAKHLPIEVVAKIEDLRHKSSLARRSLISHHHHHHHHDLSAATAADLEDQ  255

Query  867   KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYP  1046
             KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYP
Sbjct  256   KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYP  315

Query  1047  AGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPG  1226
             AG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPLDILRTLTSDFLFKGA+PG
Sbjct  316   AGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPG  375

Query  1227  LAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAALAMSEEHHHRNIPSS  1406
             L HIEPNKLRLCLELVQSAA+V+SREEG     ++S++ VIYP  ++   E  H N  SS
Sbjct  376   LTHIEPNKLRLCLELVQSAALVLSREEGILNEPSSSTATVIYPPPMSCCSEEVHNN--SS  433

Query  1407  GGSGNIVN--LNLD-SRLVYLNLGAVENSGGGGHHNQREAMTTRQNSGD-----------  1544
              GS  I N  LNLD SRLVYLNLGA   +G   HH+  +  ++R +  D           
Sbjct  434   SGSATINNNSLNLDSSRLVYLNLGA--GTGNSAHHHHHQMGSSRMDGDDDSSHQSQREAV  491

Query  1545  ---PPSMY-HHSHEY  1577
                 PS+Y HHS E+
Sbjct  492   NRHDPSIYHHHSQEF  506



>ref|XP_008240732.1| PREDICTED: regulatory protein NPR5 [Prunus mume]
Length=503

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/522 (74%), Positives = 419/522 (80%), Gaps = 49/522 (9%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS++E+SLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD 
Sbjct  1     MSSLEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDP  60

Query  282   pgsdspgsRMGLVgagagaaSPRGSIP------------QVIPVNSVGYEVFLLMMQFLY  425
             P         GL        SP G+              QVIPVNSVGYEVFLL++QFLY
Sbjct  61    PS--------GLDPISGSRMSPGGTSSSCHRAANSQQQQQVIPVNSVGYEVFLLLLQFLY  112

Query  426   SGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASM  605
             SGQVSIVPQKHEPRPNC ERGCWHTHCTSAVDLALDTL+AARSFGVEQLALLTQKQLASM
Sbjct  113   SGQVSIVPQKHEPRPNCGERGCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQLASM  172

Query  606   VEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHK  785
             VEKASI+DVM+VL+AS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR K
Sbjct  173   VEKASIDDVMKVLLASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLK  232

Query  786   sslarssllahhhhrhdlg---aaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE  956
             SSLAR S++ HHHH H      AAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLD+
Sbjct  233   SSLARRSMMPHHHHHHHHHDLGAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDD  292

Query  957   ALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHAD  1136
             ALALHYAVENCSREVVKALLELGAADVNYPAG AG+TPLHIA+EMVSPDMV+VLLDHHAD
Sbjct  293   ALALHYAVENCSREVVKALLELGAADVNYPAGPAGKTPLHIASEMVSPDMVAVLLDHHAD  352

Query  1137  PNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEG--  1310
             PNVRT DG+TPLD+LRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA+V+SREEG  
Sbjct  353   PNVRTVDGVTPLDVLRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGNN  412

Query  1311  -naaannnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSG  1487
                 A N+S+S  IYP    ++++HH     S   SGNI NLNLDSRLVYLNLGA +   
Sbjct  413   NANNAPNSSNSTAIYP---PINDDHHS----SGSNSGNIGNLNLDSRLVYLNLGATQM--  463

Query  1488  GGGHHNQREAMTTR------------QNSGDPPSMYHHSHEY  1577
               G  N                    Q   DP +MYHHSH+Y
Sbjct  464   --GSRNMDGHDHQDHDHHGSHSSHRAQGGCDPATMYHHSHDY  503



>ref|XP_007204386.1| hypothetical protein PRUPE_ppa004578mg [Prunus persica]
 gb|EMJ05585.1| hypothetical protein PRUPE_ppa004578mg [Prunus persica]
Length=502

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/503 (74%), Positives = 400/503 (80%), Gaps = 49/503 (10%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD P         GL       
Sbjct  19    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPS--------GLDPISGSR  70

Query  339   aSPRGSIP------------QVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRE  482
              SP G+              QVIPVNSVGYEVFLL++QFLYSGQVSIVPQKHEPRPNC E
Sbjct  71    MSPGGTSSSLHRGGNSQQQQQVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGE  130

Query  483   RGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQ  662
             RGCWHTHCTSAVDLALDTL+AARSFGVEQLALLTQKQLASMVEKASI+DVM+VL+AS KQ
Sbjct  131   RGCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQLASMVEKASIDDVMKVLLASRKQ  190

Query  663   EMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlg  842
             +M QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR KSSLAR S++ HHHH H   
Sbjct  191   DMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSLARRSMMPHHHHHHHHH  250

Query  843   ---aaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKAL  1013
                AAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKAL
Sbjct  251   DLGAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKAL  310

Query  1014  LELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT  1193
             LELGAADVNYPAG AG+TPLHIA+EMVSPDMV+VLLDHHADPNVRT DG+TPLD+LRTLT
Sbjct  311   LELGAADVNYPAGPAGKTPLHIASEMVSPDMVAVLLDHHADPNVRTVDGVTPLDVLRTLT  370

Query  1194  SDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEG---naaannnsssaVIYPAAL  1364
             SDFLFKGA+PGL HIEPNKLRLCLELVQSAA+V+SREEG      A N+S+S  IYP   
Sbjct  371   SDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGNNNANNAPNSSNSTAIYP---  427

Query  1365  AMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTR-----  1529
              ++++HH     S   SGNI NLNLDSRLVYLNLGA +     G  N             
Sbjct  428   PINDDHHS----SGSNSGNIGNLNLDSRLVYLNLGATQM----GSRNMDGHDHQDHDHHG  479

Query  1530  -------QNSGDPPSMYHHSHEY  1577
                    Q   DP +MYHHSH+Y
Sbjct  480   SHSSHRAQGGCDPATMYHHSHDY  502



>ref|XP_006421265.1| hypothetical protein CICLE_v10004795mg [Citrus clementina]
 gb|ESR34505.1| hypothetical protein CICLE_v10004795mg [Citrus clementina]
 gb|KDO50128.1| hypothetical protein CISIN_1g010590mg [Citrus sinensis]
Length=506

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/495 (75%), Positives = 400/495 (81%), Gaps = 29/495 (6%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD P    P +   +     G 
Sbjct  19    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPSGLDPATASRI---NQGP  75

Query  339   aSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAV  518
              SP      VIPVNSVGYEVFLL++QFLYSGQVSIVPQKHEPRPNC ERGCWHTHCTSAV
Sbjct  76    PSPASRPTGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAV  135

Query  519   DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
             DLALDTL+AAR FGVEQLALLTQKQLA+MVEKASIEDVM+VLIAS KQ+M QLWTTCSHL
Sbjct  136   DLALDTLAAARYFGVEQLALLTQKQLANMVEKASIEDVMKVLIASRKQDMHQLWTTCSHL  195

Query  699   VAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarss----llahhhhrhdlgaaadlEDQ  866
             VAKSGLPPEVLAKHLPI+VVAKIE+LRHKSSLAR S       HHHH     AAADLEDQ
Sbjct  196   VAKSGLPPEVLAKHLPIEVVAKIEDLRHKSSLARRSLISHHHHHHHHDLSAAAAADLEDQ  255

Query  867   KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYP  1046
             KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYP
Sbjct  256   KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYP  315

Query  1047  AGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPG  1226
             AG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPLDILRTLTSDFLFKGA+PG
Sbjct  316   AGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPG  375

Query  1227  LAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAALAMSEEHHHRNIPSS  1406
             L HIEPNKLRLCLELVQSAA+V+SREEG     ++S++ VIYP  ++   E  H N  SS
Sbjct  376   LTHIEPNKLRLCLELVQSAALVLSREEGILNEPSSSTATVIYPPPMSCCSEEVHNN--SS  433

Query  1407  GGSGNIVN--LNLD-SRLVYLNLGAVENSGGGGHHNQREAMTTRQNSGD-----------  1544
              GS  I N  LNLD SRLVYLNLGA   +G   HH+  +  ++R +  D           
Sbjct  434   SGSATINNNSLNLDSSRLVYLNLGA--GTGNSAHHHHHQMGSSRMDGDDDSSHQSQREAV  491

Query  1545  ---PPSMY-HHSHEY  1577
                 PS+Y HHS E+
Sbjct  492   NRHDPSIYHHHSQEF  506



>ref|XP_011027294.1| PREDICTED: regulatory protein NPR5 [Populus euphratica]
Length=481

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/500 (78%), Positives = 426/500 (85%), Gaps = 32/500 (6%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T+EDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD P 
Sbjct  2     TLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPS  61

Query  288   sds-pgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEP  464
                  GSR+  VG      SP GS   VIPVNSVGYEVFLL++QFLYSGQVSIVPQKHEP
Sbjct  62    GLDPSGSRINTVG------SP-GSRSNVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEP  114

Query  465   RPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVL  644
             RPNC ERGCWHTHCTSAVDLALDTL+AAR FGVEQLA+LTQKQLA+MVEKASI+DVM+VL
Sbjct  115   RPNCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLAMLTQKQLANMVEKASIDDVMKVL  174

Query  645   IASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssll-ahh  821
             IAS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR KSS+AR SL+  HH
Sbjct  175   IASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSIARRSLMPHHH  234

Query  822   hhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREV  1001
             HH HDL +AADLEDQKIRRM+RALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREV
Sbjct  235   HHLHDLTSAADLEDQKIRRMKRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREV  294

Query  1002  VKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDIL  1181
             VKALLELGAA+VNY AG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPLDIL
Sbjct  295   VKALLELGAANVNYQAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDIL  354

Query  1182  RTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAA  1361
             RTLTSDFLFKGA+PGLAH+EPNKLRLCLELVQSAAMV+SREEG    N N++S +IYP  
Sbjct  355   RTLTSDFLFKGAVPGLAHMEPNKLRLCLELVQSAAMVLSREEG----NVNATSTLIYP--  408

Query  1362  LAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGA---------VENSGGGGHHNQRE  1514
              +MS+EH+     SS GS N+ NLNLDSRLVYLNLGA         ++      H+NQR+
Sbjct  409   -SMSDEHN----TSSCGS-NLANLNLDSRLVYLNLGAAGSGQMGSRMDEDDDSSHNNQRD  462

Query  1515  AMTTRQNSGDPPSMYHHSHE  1574
                  ++  DP   +HHSH+
Sbjct  463   HHAMSRH--DPTMYHHHSHD  480



>ref|XP_009799339.1| PREDICTED: regulatory protein NPR5-like [Nicotiana sylvestris]
Length=481

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/500 (76%), Positives = 406/500 (81%), Gaps = 30/500 (6%)
 Frame = +3

Query  105   STVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC-----  269
             ST ED+LRSLSLDYLNLLINGQAFSDV FSVEGRLVHAHRCILAARS FFRKFFC     
Sbjct  3     STPEDNLRSLSLDYLNLLINGQAFSDVAFSVEGRLVHAHRCILAARSHFFRKFFCGPDSP  62

Query  270   gpdspgsdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVP  449
                    D  GSRMG VG  +           VIPVNSVGYEVFLLM+QFLYSGQVSIVP
Sbjct  63    RSGPQQLDPTGSRMGPVGGVSSPRG--SGSGSVIPVNSVGYEVFLLMLQFLYSGQVSIVP  120

Query  450   QKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIED  629
             QKHEPRPNC ERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLA MVEKASIED
Sbjct  121   QKHEPRPNCGERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLAIMVEKASIED  180

Query  630   VMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssl  809
             VMRVLIAS KQ+MQQLWTTCSHLVAKSGLPPE+LAKHLPIDVVAKIEELR KS+L R SL
Sbjct  181   VMRVLIASRKQDMQQLWTTCSHLVAKSGLPPEILAKHLPIDVVAKIEELRLKSNLTRRSL  240

Query  810   lahhhhrhdlg----aaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYA  977
             + HHH  H       +AA+LEDQK+RRMRRALDSSDVELVKLMVMGEGLNLDE++ALHYA
Sbjct  241   MPHHHGHHHHHHDLGSAAELEDQKVRRMRRALDSSDVELVKLMVMGEGLNLDESIALHYA  300

Query  978   VENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTAD  1157
             VENCSREVVKALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT D
Sbjct  301   VENCSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTLD  360

Query  1158  GITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnss  1337
             GITPLDILRTLTSDFLFKGA+PG+ HIEPNKLRLCLELVQSAAMVISREEG  +AN + S
Sbjct  361   GITPLDILRTLTSDFLFKGAVPGINHIEPNKLRLCLELVQSAAMVISREEG--SANIDPS  418

Query  1338  saVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREA  1517
             S  IYP  ++           S G  GN  NLN+DSR+VYLNLGA  N+           
Sbjct  419   STTIYPPNVSDDHTSSTS---SGGNIGN--NLNIDSRMVYLNLGAATNT-----------  462

Query  1518  MTTRQNSGDPPSMYHHSHEY  1577
                R N  DP SMYHHSH+Y
Sbjct  463   -QNRYNGCDPSSMYHHSHDY  481



>ref|XP_008392381.1| PREDICTED: regulatory protein NPR5-like [Malus domestica]
 ref|XP_009341949.1| PREDICTED: regulatory protein NPR5-like [Pyrus x bretschneideri]
 ref|XP_009349061.1| PREDICTED: regulatory protein NPR5-like [Pyrus x bretschneideri]
Length=498

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/505 (77%), Positives = 417/505 (83%), Gaps = 20/505 (4%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS++E+SLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD 
Sbjct  1     MSSLEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDP  60

Query  282   pgsdspg-sRMGLVgagagaaSPRGSIPQ---VIPVNSVGYEVFLLMMQFLYSGQVSIVP  449
             P    P  SRM   G  +      GS PQ   VIPVNSVGYEVFLL++QFLYSGQVSIVP
Sbjct  61    PLGLDPSGSRMSPGGTSSSYHRGSGSSPQQQQVIPVNSVGYEVFLLLLQFLYSGQVSIVP  120

Query  450   QKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIED  629
             QKHEPRPNC ERGCWHTHCTSAVDLALDTL+AARSFGVEQLALLTQKQLASMVEKASI+D
Sbjct  121   QKHEPRPNCGERGCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQLASMVEKASIDD  180

Query  630   VMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssl  809
             VM+VL+AS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPID+VAKIEELR KSS+AR S+
Sbjct  181   VMKVLLASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDIVAKIEELRLKSSIARRSM  240

Query  810   lahhhhrhdlg--aaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVE  983
             + HHHH H     AAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVE
Sbjct  241   MPHHHHHHHHDLGAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVE  300

Query  984   NCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGI  1163
             NCSREVVKALLELGAADVNYPAG AG+TPLHIA+EMVSPDMV+VLLDHHADPNVRT DG+
Sbjct  301   NCSREVVKALLELGAADVNYPAGPAGKTPLHIASEMVSPDMVAVLLDHHADPNVRTVDGV  360

Query  1164  TPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEG---naaannns  1334
             TPLD+LRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA+V+SREEG        N+S
Sbjct  361   TPLDVLRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGNSNANNNPNSS  420

Query  1335  ssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGG---GGHHN  1505
             +S  IYP               S     NI NLNLDSRLVYLNLGA    G     GH +
Sbjct  421   NSTAIYPPLSDDHHS-------SGSSGSNIGNLNLDSRLVYLNLGAAHQMGSRNMEGHDH  473

Query  1506  QREAMTTRQNSG-DPPSMYHHSHEY  1577
             Q      R  SG DP +MYHHSH+Y
Sbjct  474   QDHDHHHRAQSGCDPSTMYHHSHDY  498



>gb|AFK30388.1| BOP1 [Nicotiana tabacum]
Length=480

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/499 (76%), Positives = 405/499 (81%), Gaps = 29/499 (6%)
 Frame = +3

Query  105   STVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC-----  269
             ST ED+LRSLSLDYLNLLINGQAFSDV FSVEGRLVHAHRCILAARS FFRKFFC     
Sbjct  3     STPEDNLRSLSLDYLNLLINGQAFSDVAFSVEGRLVHAHRCILAARSHFFRKFFCGPDSP  62

Query  270   gpdspgsdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVP  449
                    D  GSRMG VG  +           VIPVNSVGYEVFLLM+QFLYSGQVSIVP
Sbjct  63    RSGPQQLDPTGSRMGPVGGVSSPRG--SGSGSVIPVNSVGYEVFLLMLQFLYSGQVSIVP  120

Query  450   QKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIED  629
             QKHEPRPNC ERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLA MVEKASIED
Sbjct  121   QKHEPRPNCGERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLAIMVEKASIED  180

Query  630   VMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssl  809
             VMRVLIAS KQ+MQQLWTTCSHLVAKSGLPPE+LAKHLPIDVVAKIEELR KS+L R SL
Sbjct  181   VMRVLIASRKQDMQQLWTTCSHLVAKSGLPPEILAKHLPIDVVAKIEELRLKSNLTRRSL  240

Query  810   lahhhhrhdlg---aaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAV  980
             + HHH  H      +AA+LEDQK+RRMRRALDSSDVELVKLMVMGEGLNLDE++ALHYAV
Sbjct  241   MPHHHGHHHHHDLGSAAELEDQKVRRMRRALDSSDVELVKLMVMGEGLNLDESIALHYAV  300

Query  981   ENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADG  1160
             ENCSREVVKALLE GAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG
Sbjct  301   ENCSREVVKALLEPGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTLDG  360

Query  1161  ITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsss  1340
             ITPLDILRTLTSDFLFKGA+PG+ HIEPNKLRLCLELVQSAAMVISREEG  +AN + SS
Sbjct  361   ITPLDILRTLTSDFLFKGAVPGINHIEPNKLRLCLELVQSAAMVISREEG--SANIDPSS  418

Query  1341  aVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAM  1520
               IYP  ++           S G  GN  NLN+DSR+VYLNLGA  N+            
Sbjct  419   TTIYPPNVSDDHTSSTS---SGGNIGN--NLNIDSRMVYLNLGAATNT------------  461

Query  1521  TTRQNSGDPPSMYHHSHEY  1577
               R N  DP SMYHHSH+Y
Sbjct  462   QNRYNGCDPSSMYHHSHDY  480



>ref|XP_008387416.1| PREDICTED: regulatory protein NPR5-like isoform X2 [Malus domestica]
Length=493

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/507 (77%), Positives = 417/507 (82%), Gaps = 29/507 (6%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS++E+SLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGP+ 
Sbjct  1     MSSLEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPEP  60

Query  282   pgsdspg-sRMGLVgagagaaSPRGSIPQ---VIPVNSVGYEVFLLMMQFLYSGQVSIVP  449
             P    P  SRM      +      GS  Q   VIPVNSVGYEVFLL++QFLYSGQVSIVP
Sbjct  61    PSGLDPSGSRMSPRRTSSSCYRGSGSSTQQQQVIPVNSVGYEVFLLLLQFLYSGQVSIVP  120

Query  450   QKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIED  629
             QKHEPRPNC ERGCWHTHCTSAVDLALDTL+AARSFGVEQLALLTQKQLASMVEKASI+D
Sbjct  121   QKHEPRPNCGERGCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQLASMVEKASIDD  180

Query  630   VMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssl  809
             VM+VL+AS KQ+MQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR KSS+AR S+
Sbjct  181   VMKVLLASRKQDMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSIARRSM  240

Query  810   lahhhhrhdlg---aaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAV  980
             + HHHH H      AAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAV
Sbjct  241   MPHHHHHHHDHDLGAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAV  300

Query  981   ENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADG  1160
             ENCSREVVKALLELGA DVNYPAG  G+TPLHIA+EMVSPDMV+VLLDHHADPNVRT DG
Sbjct  301   ENCSREVVKALLELGAGDVNYPAGPVGKTPLHIASEMVSPDMVAVLLDHHADPNVRTVDG  360

Query  1161  ITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEG--naaannns  1334
             +TPLD+LRTLTS+FLFKGA+PGL HIEPNKLRLCLELVQSAA+V+SREEG  NA   N+S
Sbjct  361   VTPLDVLRTLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGNNNANNPNSS  420

Query  1335  ssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSG-----GGGH  1499
             +S  IYP               S     NI NLNLDSRLVYLNLGA    G     G  H
Sbjct  421   NSTAIYPPISDDHHS-------SGSSGSNIGNLNLDSRLVYLNLGATHQMGSRNMEGHDH  473

Query  1500  HNQREAMTTRQNSG-DPPSMYHHSHEY  1577
             HN       R +SG DP +MYHHSH+Y
Sbjct  474   HN-------RVHSGCDPSTMYHHSHDY  493



>ref|XP_009784747.1| PREDICTED: regulatory protein NPR5-like [Nicotiana sylvestris]
Length=490

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/509 (76%), Positives = 420/509 (83%), Gaps = 39/509 (8%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T+EDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAH+CILAARSL FRKFFCGP+SPG
Sbjct  2     TLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHKCILAARSLVFRKFFCGPESPG  61

Query  288   --sdspgsRMGLVgagagaaSPRG-SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKH  458
                +   SRM      AG  SPRG S  QVIPVNSVGYEVFLLM+QFLYSGQVS+VPQKH
Sbjct  62    GGPEPLSSRMS----SAGVISPRGTSGLQVIPVNSVGYEVFLLMLQFLYSGQVSVVPQKH  117

Query  459   EPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMR  638
             EPRPNC ER CWHTHCTSAVDLALDTL+AARSFGVEQLALLTQKQL SMVEKASIEDVM+
Sbjct  118   EPRPNCGERSCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQLTSMVEKASIEDVMK  177

Query  639   VLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarss---l  809
             VLIAS KQ+M QLWTTCSHLVAKSGLP EVLAKHLPID+VAKIEELR KSSL R S    
Sbjct  178   VLIASRKQDMPQLWTTCSHLVAKSGLPAEVLAKHLPIDIVAKIEELRLKSSLVRRSLIPH  237

Query  810   lahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENC  989
               H HH+HDL  A++LEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE++ALHYAVENC
Sbjct  238   HHHQHHQHDLSTASELEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESIALHYAVENC  297

Query  990   SREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITP  1169
             SREVVKALLELGAA+VNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DGITP
Sbjct  298   SREVVKALLELGAANVNYPAGLAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGITP  357

Query  1170  LDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVI  1349
             LDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREE    ANN +S+AV 
Sbjct  358   LDILRTLTSDFLFKGAVPGLNHIEPNKLRLCLELVQSAAMVISREE--ENANNPTSTAVY  415

Query  1350  YPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAV------------ENSGGG  1493
              P    ++E+H      S+  S N+ NLNLDSR+VYLNLGA             E     
Sbjct  416   QP----INEDH------STSNSSNMGNLNLDSRMVYLNLGATSSAPPQMGCKMNEGDNDS  465

Query  1494  GHHNQREAMTTRQNSGDPPSMYHHS-HEY  1577
              H+N++     R +  DP SMYHHS HEY
Sbjct  466   SHNNKQ----NRHSGFDPSSMYHHSHHEY  490



>gb|AFK30390.1| BOP4 [Nicotiana tabacum]
Length=488

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/505 (76%), Positives = 417/505 (83%), Gaps = 38/505 (8%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T+EDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAH+CILAARSL FRKFFCGP+SPG
Sbjct  2     TLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHKCILAARSLVFRKFFCGPESPG  61

Query  288   --sdspgsRMGLVgagagaaSPRG-SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKH  458
                +   SRM      AG  SPRG S  QVIPVNSVGYEVFLLM+QFLYSGQVS+VPQKH
Sbjct  62    GGPEPLSSRMS----SAGVISPRGTSGLQVIPVNSVGYEVFLLMLQFLYSGQVSVVPQKH  117

Query  459   EPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMR  638
             EPRPNC ER CWHTHCTSAVDLALDTL+AARSFGVEQLALLTQKQL SMVEKASIEDVM+
Sbjct  118   EPRPNCGERSCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQLTSMVEKASIEDVMK  177

Query  639   VLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarss---l  809
             VLIAS KQ+M QLWTTCSHLVAKSGLP EVLAKHLPID+VAKIEELR KSSL R S    
Sbjct  178   VLIASRKQDMPQLWTTCSHLVAKSGLPAEVLAKHLPIDIVAKIEELRLKSSLVRRSLIPH  237

Query  810   lahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENC  989
               H HH+HDL  A++LEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE++ALHYAVENC
Sbjct  238   HHHQHHQHDLSTASELEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESIALHYAVENC  297

Query  990   SREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITP  1169
             SREVVKALLELGAA+VNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DGITP
Sbjct  298   SREVVKALLELGAANVNYPAGLAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGITP  357

Query  1170  LDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVI  1349
             LDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREE    ANN +S+AV 
Sbjct  358   LDILRTLTSDFLFKGAVPGLNHIEPNKLRLCLELVQSAAMVISREE--ENANNPTSTAVY  415

Query  1350  YPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAV------------ENSGGG  1493
              P    ++E+H      S+  S N+ NLNLDSR+VYLNLGA             E     
Sbjct  416   QP----INEDH------STSNSSNMGNLNLDSRMVYLNLGATSSAPPQMGCKMNEGDNDS  465

Query  1494  GHHNQREAMTTRQNSGDPPSMYHHS  1568
              H+N++     R +  DP SMYHHS
Sbjct  466   SHNNKQ----NRHSGFDPSSMYHHS  486



>ref|XP_009615711.1| PREDICTED: regulatory protein NPR5-like [Nicotiana tomentosiformis]
Length=488

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/504 (76%), Positives = 416/504 (83%), Gaps = 38/504 (8%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T+EDSL+SLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSL FRKFFCGP+SP 
Sbjct  2     TLEDSLKSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLVFRKFFCGPESPS  61

Query  288   --sdspgsRMGLVgagagaaSPRGSIP-QVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKH  458
                D   SRMG     AG  SPRG+   QVIPVNS+GYEVFLLM+QFLYSGQVS+VPQKH
Sbjct  62    GGPDPLSSRMG----SAGVISPRGTGGLQVIPVNSIGYEVFLLMLQFLYSGQVSVVPQKH  117

Query  459   EPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMR  638
             EPRPNC ER CWHTHCTSAVDLALDTL+AARSFGVEQLALLTQKQLASMVEK SIEDVM+
Sbjct  118   EPRPNCGERSCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQLASMVEKTSIEDVMK  177

Query  639   VLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarss---l  809
             VLIAS KQ+M QLWTTCSHLVAKSGLP EVLAKHLPIDVVAKIEELR KSSLAR S    
Sbjct  178   VLIASRKQDMPQLWTTCSHLVAKSGLPTEVLAKHLPIDVVAKIEELRLKSSLARRSLILH  237

Query  810   lahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENC  989
               H H +HDL AA++LEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE++ALHYAVENC
Sbjct  238   HHHQHQQHDLSAASELEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESIALHYAVENC  297

Query  990   SREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITP  1169
             SREVVKALLELGAA+VNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVR  DGITP
Sbjct  298   SREVVKALLELGAANVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRRMDGITP  357

Query  1170  LDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVI  1349
             LDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREE    ANN +S+AV 
Sbjct  358   LDILRTLTSDFLFKGAVPGLYHIEPNKLRLCLELVQSAAMVISREE--ETANNPTSTAVY  415

Query  1350  YPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAV------------ENSGGG  1493
              P    ++E+H   N+       N+ NLNLDSR+VYLNLGA             E     
Sbjct  416   QP----INEDHTTSNV------SNMGNLNLDSRMVYLNLGATSSAPHQMGCKMNEGDNDS  465

Query  1494  GHHNQREAMTTRQNSGDPPSMYHH  1565
              H+N++     R +S DP SMYHH
Sbjct  466   SHNNKQ----NRHSSFDPSSMYHH  485



>gb|AFK30389.1| BOP3 [Nicotiana tabacum]
Length=488

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/504 (76%), Positives = 415/504 (82%), Gaps = 38/504 (8%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T+EDSL+SLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSL FRKF CGP+SP 
Sbjct  2     TLEDSLKSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLVFRKFLCGPESPS  61

Query  288   --sdspgsRMGLVgagagaaSPRGSI-PQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKH  458
                D   SRMG     AG  SPRG+   QVIPVNS+GYEVFLLM+QFLYSGQVS+VPQKH
Sbjct  62    GGPDPLSSRMG----SAGVISPRGTGGSQVIPVNSIGYEVFLLMLQFLYSGQVSVVPQKH  117

Query  459   EPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMR  638
             EPRPNC ER CWHTHCTSAVDLALDTL+AARSFGVEQLALLTQKQLASMVEK SIEDVM+
Sbjct  118   EPRPNCGERSCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQLASMVEKTSIEDVMK  177

Query  639   VLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarss---l  809
             VLIAS KQ+M QLWTTCSHLVAKSGLP EVLAKHLPIDVVAKIEELR KSSLAR S    
Sbjct  178   VLIASRKQDMPQLWTTCSHLVAKSGLPTEVLAKHLPIDVVAKIEELRLKSSLARRSLILH  237

Query  810   lahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENC  989
               + H +HDL AA++LEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE++ALHYAVENC
Sbjct  238   HHYQHQQHDLSAASELEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESIALHYAVENC  297

Query  990   SREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITP  1169
             SREVVKALLELGAA+VNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVR  DGITP
Sbjct  298   SREVVKALLELGAANVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRRMDGITP  357

Query  1170  LDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVI  1349
             LDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREE    ANN +S+AV 
Sbjct  358   LDILRTLTSDFLFKGAVPGLYHIEPNKLRLCLELVQSAAMVISREE--ETANNPTSTAVY  415

Query  1350  YPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAV------------ENSGGG  1493
              P    ++E+H   N+       N+ NLNLDSR+VYLNLGA             E     
Sbjct  416   QP----INEDHTTSNV------SNMGNLNLDSRMVYLNLGATSSAPHQMGCKMNEGDNDS  465

Query  1494  GHHNQREAMTTRQNSGDPPSMYHH  1565
              H+N++     R +S DP SMYHH
Sbjct  466   SHNNKQ----NRHSSFDPSSMYHH  485



>ref|XP_004303610.1| PREDICTED: LOW QUALITY PROTEIN: regulatory protein NPR5-like 
[Fragaria vesca subsp. vesca]
Length=506

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/509 (76%), Positives = 427/509 (84%), Gaps = 20/509 (4%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS++EDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD 
Sbjct  1     MSSLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDP  60

Query  282   pgsdspgsRMGLVga-gagaaSPRG--SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQ  452
             P    P S  G   +  + + S RG  S  QVIPVNSVGYEVFLL++QFLYSGQVSIVPQ
Sbjct  61    PSGLDPVSSPGSCRSGTSSSTSQRGGMSSSQVIPVNSVGYEVFLLLLQFLYSGQVSIVPQ  120

Query  453   KHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDV  632
             KHEPRPNC ERGCWHTHCTSAVDLALDTL+AARSFGVEQLALLTQKQLASMVEK SI+DV
Sbjct  121   KHEPRPNCGERGCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQLASMVEKTSIDDV  180

Query  633   MRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssll  812
             M+VL+AS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR KSS+AR S++
Sbjct  181   MKVLLASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSIARRSMM  240

Query  813   ---ahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVE  983
                 HHHH HD+GAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVE
Sbjct  241   PHHHHHHHHHDMGAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVE  300

Query  984   NCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGI  1163
             +CSREVVKALLELGAADVNYPAG AG+TPLHIA+EMVSPDMV+VLLDHHADPNVRT DG+
Sbjct  301   SCSREVVKALLELGAADVNYPAGPAGKTPLHIASEMVSPDMVAVLLDHHADPNVRTVDGV  360

Query  1164  TPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssa  1343
             TPLD+LRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA+V+SREEGN  ANN++S++
Sbjct  361   TPLDVLRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGNNNANNSASNS  420

Query  1344  VIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAV-----ENSGGGGHHNQ  1508
                     MS+ H H +  S G +   ++LNLDSRLVYLNLGA      +N  G    + 
Sbjct  421   SNTAIYQPMSDHHDHHSSGSGGSN---ISLNLDSRLVYLNLGATGSSAPQNQMGSSRMDS  477

Query  1509  REAMTT------RQNSGDPPSMYHHSHEY  1577
              +          RQ   DP +MYHHSH++
Sbjct  478   EDHHQHHHHSHGRQGGCDPSTMYHHSHDF  506



>ref|XP_008443289.1| PREDICTED: regulatory protein NPR5 [Cucumis melo]
Length=486

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/496 (78%), Positives = 416/496 (84%), Gaps = 15/496 (3%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS +EDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG  +
Sbjct  1     MSHLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGTST  60

Query  282   pgsdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHE  461
                 S     GL   G+ + S   S  QVIPVNSVGYEVFLL++QFLYSGQVSIVPQK E
Sbjct  61    EAGASS----GLSPVGSPSPSTGSSSTQVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKQE  116

Query  462   PRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRV  641
             PRPNC +R CWHTHCTSAVDLAL TLSAARSFGVEQLALLTQKQLASMVEKASIEDVM+V
Sbjct  117   PRPNCGDRACWHTHCTSAVDLALHTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMKV  176

Query  642   LIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssll--a  815
             L+AS KQ+M QLW+TCSHLVAKSGLPPEVLAKHLPID+VAKIEELR KSSLAR SL+   
Sbjct  177   LLASRKQDMHQLWSTCSHLVAKSGLPPEVLAKHLPIDIVAKIEELRLKSSLARRSLMPHH  236

Query  816   hhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSR  995
             HHHH HDL  AADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSR
Sbjct  237   HHHHHHDLSVAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSR  296

Query  996   EVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLD  1175
             EVVKALLELGAADVNYPAG AG+TPLH+AAEMVSPDMV+VLLDHHADPNVRT DG+TPLD
Sbjct  297   EVVKALLELGAADVNYPAGPAGKTPLHMAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLD  356

Query  1176  ILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISR--EEGnaaannnsssaVI  1349
             ILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA+V+SR  E  NA AN N SS+ I
Sbjct  357   ILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEENANANANANVSSSPI  416

Query  1350  YPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTR  1529
             YP    MSE+H   +  ++    NI NLNLDSRLVYLNLGA    GG     + +     
Sbjct  417   YP---PMSEDHSSSSSNNN----NIGNLNLDSRLVYLNLGASGRMGGSRVDGEDDNRHGS  469

Query  1530  QNSGDPPSMYHHSHEY  1577
             Q  G  P+MYHHSH++
Sbjct  470   QGGGCIPTMYHHSHDF  485



>ref|XP_010525497.1| PREDICTED: regulatory protein NPR5-like isoform X2 [Tarenaya 
hassleriana]
Length=491

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/496 (77%), Positives = 410/496 (83%), Gaps = 27/496 (5%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             M ++E+SLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD 
Sbjct  1     MGSLEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDP  60

Query  282   pgsdspgsRMGLVgagagaaSPR--GSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQK  455
             P         GL  +G     P   G    VIPVNSVGYEVFLL++QFLYSGQVSIVPQK
Sbjct  61    PPGT------GLDPSGVTRPGPASPGRPAGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQK  114

Query  456   HEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVM  635
             HEPRPNC ERGCWHTHCTSAVDLALDTLSAAR FGVEQLALLTQKQLASMVEKASIEDVM
Sbjct  115   HEPRPNCGERGCWHTHCTSAVDLALDTLSAARYFGVEQLALLTQKQLASMVEKASIEDVM  174

Query  636   RVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarsslla  815
             +VLIAS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLP+DVV KIEELR KSS+AR S +A
Sbjct  175   KVLIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPVDVVTKIEELRLKSSMARRSQMA  234

Query  816   hhhhrhdl------gaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYA  977
             HHH  H          A DLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYA
Sbjct  235   HHHQHHPHHHHHDLSVAQDLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYA  294

Query  978   VENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTAD  1157
             VENCSREVVKALLELGAADVNYPAG AG+TPLH+AAEMVSPDMV+VLLDHHADPNVRT D
Sbjct  295   VENCSREVVKALLELGAADVNYPAGPAGKTPLHLAAEMVSPDMVAVLLDHHADPNVRTVD  354

Query  1158  GITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnss  1337
             GITPLDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA+VISREEGN   NNN +
Sbjct  355   GITPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVISREEGNNNNNNNDT  414

Query  1338  saVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSG--GGGHHNQR  1511
             S  IYP    M+EEH      +SGGS   +N NLDSRLVYLNLGA  NSG  G G  +  
Sbjct  415   SHAIYP---PMNEEH------TSGGSLGNLN-NLDSRLVYLNLGA-GNSGQMGSGRDHGE  463

Query  1512  EAMTTRQNSGDPPSMY  1559
             +  +++      PSMY
Sbjct  464   DHSSSQGRHHHDPSMY  479



>ref|XP_008387415.1| PREDICTED: regulatory protein NPR5-like isoform X1 [Malus domestica]
Length=503

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/517 (75%), Positives = 417/517 (81%), Gaps = 39/517 (8%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS++E+SLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGP+ 
Sbjct  1     MSSLEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPEP  60

Query  282   pgsdspg-sRMGLVgagagaaSPRGSIPQ---VIPVNSVGYEVFLLMMQFLYSGQVSIVP  449
             P    P  SRM      +      GS  Q   VIPVNSVGYEVFLL++QFLYSGQVSIVP
Sbjct  61    PSGLDPSGSRMSPRRTSSSCYRGSGSSTQQQQVIPVNSVGYEVFLLLLQFLYSGQVSIVP  120

Query  450   QKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQ----------KQLA  599
             QKHEPRPNC ERGCWHTHCTSAVDLALDTL+AARSFGVEQLALLTQ          KQLA
Sbjct  121   QKHEPRPNCGERGCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQTMSSYVLVLQKQLA  180

Query  600   SMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR  779
             SMVEKASI+DVM+VL+AS KQ+MQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR
Sbjct  181   SMVEKASIDDVMKVLLASRKQDMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR  240

Query  780   HKsslarssllahhhhrhdlg---aaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNL  950
              KSS+AR S++ HHHH H      AAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNL
Sbjct  241   LKSSIARRSMMPHHHHHHHDHDLGAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNL  300

Query  951   DEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHH  1130
             DEALALHYAVENCSREVVKALLELGA DVNYPAG  G+TPLHIA+EMVSPDMV+VLLDHH
Sbjct  301   DEALALHYAVENCSREVVKALLELGAGDVNYPAGPVGKTPLHIASEMVSPDMVAVLLDHH  360

Query  1131  ADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEG  1310
             ADPNVRT DG+TPLD+LRTLTS+FLFKGA+PGL HIEPNKLRLCLELVQSAA+V+SREEG
Sbjct  361   ADPNVRTVDGVTPLDVLRTLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEG  420

Query  1311  --naaannnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENS  1484
               NA   N+S+S  IYP               S     NI NLNLDSRLVYLNLGA    
Sbjct  421   NNNANNPNSSNSTAIYPPISDDHHS-------SGSSGSNIGNLNLDSRLVYLNLGATHQM  473

Query  1485  G-----GGGHHNQREAMTTRQNSG-DPPSMYHHSHEY  1577
             G     G  HHN       R +SG DP +MYHHSH+Y
Sbjct  474   GSRNMEGHDHHN-------RVHSGCDPSTMYHHSHDY  503



>gb|AGO64649.1| blade-on-petiole [Lupinus luteus]
Length=486

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/508 (76%), Positives = 413/508 (81%), Gaps = 46/508 (9%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             ++EDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG   P 
Sbjct  2     SLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGGSDPS  61

Query  288   sdspgsRMGLVgagagaaSPRGSIPQ------VIPVNSVGYEVFLLMMQFLYSGQVSIVP  449
             + S     GL+       +P GS P+      VIPVNSVGYEVFLL++QFLYSGQVSIVP
Sbjct  62    ASS-----GLIDQTGVRVNPSGS-PRSSNGVLVIPVNSVGYEVFLLLLQFLYSGQVSIVP  115

Query  450   QKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIED  629
             QKHE RPNC ERGCWHTHC+SAVDLALDTL+AAR FGVEQLALLTQKQLASMVEKASIED
Sbjct  116   QKHEARPNCGERGCWHTHCSSAVDLALDTLAAARYFGVEQLALLTQKQLASMVEKASIED  175

Query  630   VMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssl  809
             VM+VL+AS KQ+MQQLWTTCSHLVAKSGLPPEVLAKHLPI++VAKIEELR KSS+AR S+
Sbjct  176   VMKVLLASRKQDMQQLWTTCSHLVAKSGLPPEVLAKHLPIEIVAKIEELRLKSSIARRSM  235

Query  810   lahhhhrhdl---gaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAV  980
             + HHHH H      AAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAV
Sbjct  236   MPHHHHHHHPHDLNAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAV  295

Query  981   ENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADG  1160
             ENCSREV KALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT D 
Sbjct  296   ENCSREVAKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDN  355

Query  1161  ITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsss  1340
             +TPLDILRTLTSDFLFKGAIPGL HIEPNKLRLCLELVQSAA+V+SREEGNA  N  SS+
Sbjct  356   VTPLDILRTLTSDFLFKGAIPGLTHIEPNKLRLCLELVQSAALVLSREEGNANNNPPSST  415

Query  1341  aVIYPAALAMSEEHHH------RNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGG----  1490
                 P        +HH       +  SSG + NI NLNLDSRLVYLNLGA   SG     
Sbjct  416   TTTLPM-------YHHPMNDDHNSSSSSGNNHNIGNLNLDSRLVYLNLGATVGSGQMSDD  468

Query  1491  -GGHHNQREAMTTRQNSGDPPSMYHHSH  1571
              GG H            GD P+MYHHSH
Sbjct  469   HGGRH------------GD-PAMYHHSH  483



>ref|XP_010273271.1| PREDICTED: regulatory protein NPR5-like [Nelumbo nucifera]
Length=488

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/485 (76%), Positives = 397/485 (82%), Gaps = 27/485 (6%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspg-sRMGLVgagag  335
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD P       SRM    + + 
Sbjct  19    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPAGLDSVGSRMN---SASL  75

Query  336   aaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSA  515
             A SPRG   QVIPV+SVGYEVFLL++QFLYSGQVSIVPQKHEPRPNC ERGCWHTHCTSA
Sbjct  76    ATSPRGGNSQVIPVSSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSA  135

Query  516   VDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSH  695
             VDLALDTL+AAR FGVEQLALLTQKQLASMVEKASIEDVM+VLIAS KQ+M QLWTTCSH
Sbjct  136   VDLALDTLAAARYFGVEQLALLTQKQLASMVEKASIEDVMKVLIASRKQDMHQLWTTCSH  195

Query  696   LVAKSGLPPEVLAKHLPIDVVAKIEELRHKss--larssllahhhhrhdlgaaadlEDQK  869
             LVAKSGLPPEVLAKHLPIDVVAKIEELR KSS          HHHH HDLGAAADLEDQK
Sbjct  196   LVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSFHRRSLIPHHHHHHHHDLGAAADLEDQK  255

Query  870   IRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPA  1049
             IRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPA
Sbjct  256   IRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPA  315

Query  1050  GAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGL  1229
             G AG+TPLH+AAEMV PDMV+VLLDHHADPNVRT DG+TPLD+LR LTSDFLFKGA+PGL
Sbjct  316   GPAGKTPLHVAAEMVCPDMVAVLLDHHADPNVRTVDGVTPLDVLRQLTSDFLFKGAVPGL  375

Query  1230  AHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAALAMSEEHHHRNIPSSG  1409
             AH+EPNKLRLCLELVQSAA+V+SREEG+    +++    IYP               S+ 
Sbjct  376   AHVEPNKLRLCLELVQSAALVLSREEGSGNPPSSTP---IYPPMNNDLN--------SNN  424

Query  1410  GSGNIVNLNLDSRLVYLNLGAVENSGGG--------GHHNQREAMTTR-QNSGDPPSMYH  1562
              + N+V+L+LDSR+VYLNLGA      G        GH NQREAM      +G  PSMY 
Sbjct  425   SNNNMVSLSLDSRMVYLNLGAAAAGQLGCRMDGEDNGHSNQREAMNRHGSQAGCDPSMY-  483

Query  1563  HSHEY  1577
             HSH++
Sbjct  484   HSHDF  488



>ref|XP_010525496.1| PREDICTED: regulatory protein NPR5-like isoform X1 [Tarenaya 
hassleriana]
Length=491

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/496 (77%), Positives = 408/496 (82%), Gaps = 27/496 (5%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             M ++E+SLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD 
Sbjct  1     MGSLEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDP  60

Query  282   pgsdspgsRMGLVgagagaaSPR--GSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQK  455
             P         GL  +G     P   G    VIPVNSVGYEVFLL++QFLYSGQVSIVPQK
Sbjct  61    PPGT------GLDPSGVTRPGPASPGRPAGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQK  114

Query  456   HEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVM  635
             HEPRPNC ERGCWHTHCTSAVDLALDTLSAAR FGVEQLALLTQKQLASMVEKASIEDVM
Sbjct  115   HEPRPNCGERGCWHTHCTSAVDLALDTLSAARYFGVEQLALLTQKQLASMVEKASIEDVM  174

Query  636   RVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarsslla  815
             +VLIAS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLP+DVV KIEELR KSS+AR S +A
Sbjct  175   KVLIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPVDVVTKIEELRLKSSMARRSQMA  234

Query  816   hhhhrhdl------gaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYA  977
             HHH  H          A DLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYA
Sbjct  235   HHHQHHPHHHHHDLSVAQDLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYA  294

Query  978   VENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTAD  1157
             VENCSREVVKALLELGAADVNYPAG AG  PLH+AAEMVSPDMV+VLLDHHADPNVRT D
Sbjct  295   VENCSREVVKALLELGAADVNYPAGPAGEKPLHLAAEMVSPDMVAVLLDHHADPNVRTVD  354

Query  1158  GITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnss  1337
             GITPLDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA+VISREEGN   NNN +
Sbjct  355   GITPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVISREEGNNNNNNNDT  414

Query  1338  saVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSG--GGGHHNQR  1511
             S  IYP    M+EEH      +SGGS   +N NLDSRLVYLNLGA  NSG  G G  +  
Sbjct  415   SHAIYP---PMNEEH------TSGGSLGNLN-NLDSRLVYLNLGA-GNSGQMGSGRDHGE  463

Query  1512  EAMTTRQNSGDPPSMY  1559
             +  +++      PSMY
Sbjct  464   DHSSSQGRHHHDPSMY  479



>ref|XP_004136653.1| PREDICTED: regulatory protein NPR5-like [Cucumis sativus]
 ref|XP_004167704.1| PREDICTED: regulatory protein NPR5-like [Cucumis sativus]
 gb|KGN59470.1| hypothetical protein Csa_3G822220 [Cucumis sativus]
Length=487

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/499 (77%), Positives = 418/499 (84%), Gaps = 20/499 (4%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS +EDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG  +
Sbjct  1     MSHLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGTTT  60

Query  282   pgsdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHE  461
                 S     GL   G+ + S   S  QVIPVNSVGYEVFLL++QFLYSGQVSIVPQK E
Sbjct  61    EAGASS----GLSPVGSPSPSTGSSSTQVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKQE  116

Query  462   PRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRV  641
             PRPNC +R CWHTHCTSAVDLAL TLSAARSFGVEQLALLTQKQLASMVEKASIEDVM+V
Sbjct  117   PRPNCGDRACWHTHCTSAVDLALHTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMKV  176

Query  642   LIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssll--a  815
             L+AS KQ+M QLW+TCSHLVAKSGLPPEVLAKHLPID+VAKIEELR KSSLAR SL+   
Sbjct  177   LLASRKQDMHQLWSTCSHLVAKSGLPPEVLAKHLPIDIVAKIEELRIKSSLARRSLMPHH  236

Query  816   hhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSR  995
             HHHH HDL  AADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSR
Sbjct  237   HHHHHHDLSVAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSR  296

Query  996   EVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLD  1175
             EVVKALLELGAADVNYPAG AG+TPLH+AAEMVSPDMV+VLLDHHADPNVRT DG+TPLD
Sbjct  297   EVVKALLELGAADVNYPAGPAGKTPLHMAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLD  356

Query  1176  ILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaV--I  1349
             ILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA+V+SREE NA AN N + +   I
Sbjct  357   ILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEENANANANVNVSSSPI  416

Query  1350  YPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGG---GHHNQREAM  1520
             YP    MSE+H   +  ++    NI NLNLDSRLVYLNLGA    GG    G  + R   
Sbjct  417   YP---PMSEDHSSSSSNNN----NIGNLNLDSRLVYLNLGASGRMGGSRVDGEDDNRHG-  468

Query  1521  TTRQNSGDPPSMYHHSHEY  1577
              ++   G  P+MYHHSH++
Sbjct  469   -SQGGGGCIPTMYHHSHDF  486



>ref|XP_010277606.1| PREDICTED: regulatory protein NPR5-like [Nelumbo nucifera]
Length=491

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/488 (75%), Positives = 402/488 (82%), Gaps = 30/488 (6%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspg-sRMGLVgagag  335
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGP+ P    P  +RM    + + 
Sbjct  19    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPEPPAGIDPVGTRMN---SASL  75

Query  336   aaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSA  515
              +SPRG   QVIPVNSVGYEVFLL++QFLYSGQVS+VPQKHEPRPNC ERGCWHTHCTSA
Sbjct  76    CSSPRGGNSQVIPVNSVGYEVFLLLLQFLYSGQVSVVPQKHEPRPNCGERGCWHTHCTSA  135

Query  516   VDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSH  695
             VDLAL+TL+A+RSFGVEQLALLTQKQLASMVEKASIEDVM+VL+AS KQEM QLWTTCSH
Sbjct  136   VDLALETLAASRSFGVEQLALLTQKQLASMVEKASIEDVMKVLLASRKQEMHQLWTTCSH  195

Query  696   LVAKSGLPPEVLAKHLPIDVVAKIEELRHKss---larssllahhhhrhdlgaaadlEDQ  866
             LVAKSGLPPEVLAKHLPIDVVAKIEELR KSS    +      HHHH HDLGAAADLEDQ
Sbjct  196   LVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSLHRRSLMPHHHHHHHHHDLGAAADLEDQ  255

Query  867   KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYP  1046
             KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNY 
Sbjct  256   KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYQ  315

Query  1047  AGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPG  1226
             AG AG+TPLHIAAEMV PDMV+VLLDHHADPNVRT DG+TPLD+LR LTSDFLFKGA+PG
Sbjct  316   AGPAGKTPLHIAAEMVCPDMVAVLLDHHADPNVRTVDGVTPLDVLRQLTSDFLFKGAVPG  375

Query  1227  LAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAALAMSEEHHHRNIPSS  1406
             LAH+EPNKLRLCLELVQSAA+VISREEGN    +++    IYP               S+
Sbjct  376   LAHVEPNKLRLCLELVQSAALVISREEGNENPPSSTH---IYPPMSNDLN--------SN  424

Query  1407  GGSGNIVNLNLDSRLVYLNLGA---------VENSGGGGHHNQREAMTTRQNS--GDPPS  1553
               + N+VNL+LDSR+VYLNLGA         ++  G  GH+NQR+AM     S  G  PS
Sbjct  425   SSNNNMVNLSLDSRMVYLNLGAAAAAQLGCKMDGEGHNGHNNQRQAMNRHGGSQGGCDPS  484

Query  1554  MYHHSHEY  1577
             MY HSH+Y
Sbjct  485   MY-HSHDY  491



>ref|XP_007145550.1| hypothetical protein PHAVU_007G248000g [Phaseolus vulgaris]
 gb|ESW17544.1| hypothetical protein PHAVU_007G248000g [Phaseolus vulgaris]
Length=479

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/502 (76%), Positives = 413/502 (82%), Gaps = 36/502 (7%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             ++EDSLRSLSLDYLNLLINGQAFSDVTF VEGRLVHAHRCILAARSLFFRKFFCGPDSP 
Sbjct  2     SLEDSLRSLSLDYLNLLINGQAFSDVTFQVEGRLVHAHRCILAARSLFFRKFFCGPDSPP  61

Query  288   sdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPR  467
                    +    A   AA+     P VIPVNSVGYEVFLL++QFLYSGQVSIVPQKHE R
Sbjct  62    G------LDPAAASRAAAASGARPPGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEAR  115

Query  468   PNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLI  647
             PNC ERGCWHTHCTSAVDLALDTL+AAR FGVEQLALLTQKQLASMVEKASI+DVM+VLI
Sbjct  116   PNCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLASMVEKASIDDVMKVLI  175

Query  648   ASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahh-h  824
             AS KQEMQQLW+TCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR KSSLAR S+L     
Sbjct  176   ASRKQEMQQLWSTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSLARRSMLPLRHP  235

Query  825   hrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVV  1004
             H+H    AAD+EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVE+CSREVV
Sbjct  236   HQHPDLGAADMEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVESCSREVV  295

Query  1005  KALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILR  1184
             KALLELGAADVN+PAG AG+TPLH+AAEMVSP+MV+VLLDHHADPNVRT DG+TPLDILR
Sbjct  296   KALLELGAADVNFPAGPAGKTPLHVAAEMVSPEMVAVLLDHHADPNVRTVDGVTPLDILR  355

Query  1185  TLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEG---------naaannnss  1337
             TLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA+V+SREEG         N   NN+++
Sbjct  356   TLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEGNNNNHANNTNDNTNNSNT  415

Query  1338  saVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREA  1517
             S+ IYP    MSEEH      SS         NLDSRLVYLNLGA    G    +NQREA
Sbjct  416   SSAIYP---PMSEEH------SSS--------NLDSRLVYLNLGATPQIGDDD-NNQREA  457

Query  1518  MTTRQNSGD--PPSMYHHSHEY  1577
             M    + G    PSMYHHSH++
Sbjct  458   MNRHGSHGGGCDPSMYHHSHDF  479



>ref|XP_004237330.1| PREDICTED: regulatory protein NPR5-like [Solanum lycopersicum]
Length=466

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/474 (76%), Positives = 388/474 (82%), Gaps = 29/474 (6%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTF VEG LVHAHRC+LAARS FFRKFFCGP SP S     ++G V      
Sbjct  21    INGQAFSDVTFHVEGHLVHAHRCVLAARSQFFRKFFCGPSSPQSGP---QLGSVNGPRDT  77

Query  339   aSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAV  518
              SP  S+  VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNC ERGCWHTHCTSAV
Sbjct  78    GSPASSV--VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAV  135

Query  519   DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
             DLALDTLSAARSFGVEQLALLTQKQLA MVEKASIEDVMRVLIAS KQ+M QLWTTCSHL
Sbjct  136   DLALDTLSAARSFGVEQLALLTQKQLAIMVEKASIEDVMRVLIASRKQDMNQLWTTCSHL  195

Query  699   VAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRR  878
             VAKSGLPPE+LAKHLPIDVVAKIEELR KS+LAR SL+ HHHH  DL ++A+LEDQKIRR
Sbjct  196   VAKSGLPPEMLAKHLPIDVVAKIEELRLKSNLARRSLMPHHHHHLDLSSSAELEDQKIRR  255

Query  879   MRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAA  1058
             MRRALDSSDVELVKLMVMGEGLNLDE++ALHYAVENCSREVVKALLELGAADVN+PAG A
Sbjct  256   MRRALDSSDVELVKLMVMGEGLNLDESIALHYAVENCSREVVKALLELGAADVNFPAGPA  315

Query  1059  GRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHI  1238
             G+TPLHIAAEMVSPDMV+VLLDHHADPNVR  DGITPLDILRTLTSDFLFKG +PG  H+
Sbjct  316   GKTPLHIAAEMVSPDMVAVLLDHHADPNVRMLDGITPLDILRTLTSDFLFKGTVPGHVHV  375

Query  1239  EPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAALAMSEEHHHRNIPSSGGSG  1418
             EPNKLRLCLELVQSAAMVISREEG+A  + +S++  IYP    MS++H      S     
Sbjct  376   EPNKLRLCLELVQSAAMVISREEGSANIDLSSTN--IYPPN-NMSDDHTSSTSTSGTN--  430

Query  1419  NIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTRQNSGDPPSMYHH-SHEY  1577
                  N+DSR+VYLNL       GGG  N      T      P SMYHH SHEY
Sbjct  431   -----NIDSRMVYLNL-------GGGVTN------TSSTHDHPSSMYHHSSHEY  466



>ref|XP_003518145.1| PREDICTED: regulatory protein NPR5-like [Glycine max]
Length=476

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/484 (75%), Positives = 391/484 (81%), Gaps = 37/484 (8%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTF VEGRLVH HRCILAARSLFFRKFFCGPD P         GL  AGA  
Sbjct  19    INGQAFSDVTFQVEGRLVHGHRCILAARSLFFRKFFCGPDPPT--------GLDPAGASR  70

Query  339   aSPRGSI---PQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCT  509
             ++  G+    P VIPVNSVGYEVFLL++QFLYSGQVSIVPQKHE RPNC ERGCWHTHCT
Sbjct  71    SNDTGAAARPPGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEARPNCGERGCWHTHCT  130

Query  510   SAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTC  689
             SAVDLALDTL+AAR FGVEQLALLTQKQLASMVEKASI+DVM+VLIAS KQEMQQLW+TC
Sbjct  131   SAVDLALDTLAAARYFGVEQLALLTQKQLASMVEKASIDDVMKVLIASRKQEMQQLWSTC  190

Query  690   SHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQK  869
             SHLVAKSGLPPEVLAKHLPIDVVAKIEELR KSSLAR SLL  HH  H        EDQK
Sbjct  191   SHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSLARRSLLPGHHQHHHDLTPGM-EDQK  249

Query  870   IRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPA  1049
             I+RMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVN+PA
Sbjct  250   IQRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNFPA  309

Query  1050  GAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGL  1229
             G AG+TPLH+AAEMV P+MV+VLLDHHADPNVRT +G+TPLDILRTLTSDFLF+GA+PGL
Sbjct  310   GPAGKTPLHVAAEMVLPEMVAVLLDHHADPNVRTVEGVTPLDILRTLTSDFLFRGAVPGL  369

Query  1230  AHIEPNKLRLCLELVQSAAMVISREEG-----naaannnsssaVIYPAALAMSEEHHHRN  1394
              HIEPNKLRLCLELVQSAA+V+SREEG     +   N ++S+  IYP    MS E H   
Sbjct  370   THIEPNKLRLCLELVQSAALVLSREEGNNVNNDHNNNASASATAIYP---PMSSEDH---  423

Query  1395  IPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTRQNSG---DPPSMYHH  1565
               SSG        N DSRLVYLNLGA    G     +QREAM    + G   DPPSMYHH
Sbjct  424   --SSG--------NSDSRLVYLNLGATPPMGEDD-GSQREAMNRHGSQGGRCDPPSMYHH  472

Query  1566  SHEY  1577
             SH++
Sbjct  473   SHDF  476



>ref|XP_010672970.1| PREDICTED: regulatory protein NPR5-like [Beta vulgaris subsp. 
vulgaris]
Length=498

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/472 (75%), Positives = 392/472 (83%), Gaps = 19/472 (4%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG D PG   P   MG       A
Sbjct  19    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGSDQPGGLDPRV-MG------QA  71

Query  339   aSPR---GSIP-QVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHC  506
             +SPR   G +P QVIPVNSVGYEVF+L++Q+LYSGQVSI+PQKHEPRPNC ERGCWHTHC
Sbjct  72    SSPRAGGGPVPTQVIPVNSVGYEVFMLLLQYLYSGQVSIIPQKHEPRPNCGERGCWHTHC  131

Query  507   TSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTT  686
             TSAVDLALDTLSAARSFGVEQLALLTQKQL+SMVEKASIEDVM+VLIAS KQ+M QLWTT
Sbjct  132   TSAVDLALDTLSAARSFGVEQLALLTQKQLSSMVEKASIEDVMKVLIASRKQDMHQLWTT  191

Query  687   CSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlg------aa  848
             CSHLVAKSGLPPEVLAKHLPI+VVAKIEELR KSS+AR S L  HHH H           
Sbjct  192   CSHLVAKSGLPPEVLAKHLPIEVVAKIEELRLKSSIARRSSLIPHHHHHHHPHDLGLPTP  251

Query  849   adlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGA  1028
             AD ED KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGA
Sbjct  252   ADHEDHKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGA  311

Query  1029  ADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLF  1208
              DVNYPAG  G+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPLDILRTLTSDFLF
Sbjct  312   GDVNYPAGPTGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLF  371

Query  1209  KGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAA-LAMSEEHH  1385
             KGA+PGLAHIEPNKLRLCLELVQSAAMVISRE+ N   NNN+++     +  + M  +  
Sbjct  372   KGAVPGLAHIEPNKLRLCLELVQSAAMVISREDANDNNNNNNNNNTTSTSMYVPMGGDQE  431

Query  1386  HRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTRQNSG  1541
             H    S+  SGN+ N+ +DSR+VYLNLGAV ++  G   +  ++ T+++NS 
Sbjct  432   HTTS-STSSSGNVGNIGIDSRMVYLNLGAVGSASMGDQQHNEDSHTSQRNSA  482



>ref|XP_006364431.1| PREDICTED: regulatory protein NPR5-like [Solanum tuberosum]
Length=461

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/492 (76%), Positives = 399/492 (81%), Gaps = 34/492 (7%)
 Frame = +3

Query  105   STVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdsp  284
             S  EDSLRSLSLDYLNLLINGQAFSDVTF VEG LVHAHRC+LAARS FFRKFFCGP SP
Sbjct  3     SNPEDSLRSLSLDYLNLLINGQAFSDVTFHVEGHLVHAHRCVLAARSQFFRKFFCGPSSP  62

Query  285   gsdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEP  464
              S     ++G V       SP      VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEP
Sbjct  63    QSGP---QLGPVNGPRDTGSPASV---VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEP  116

Query  465   RPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVL  644
             RPNC ERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLA MVEKASIEDVMRVL
Sbjct  117   RPNCGERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLAIMVEKASIEDVMRVL  176

Query  645   IASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhh  824
             IAS KQ+M QLWTTCSHLVAKSGLPPE+LAKHLPIDVVAKIEELR KS+LAR SL+ HHH
Sbjct  177   IASRKQDMNQLWTTCSHLVAKSGLPPEMLAKHLPIDVVAKIEELRLKSNLARRSLMPHHH  236

Query  825   hrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVV  1004
             H  DL +AA+LEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE++ALHYAVENCSREVV
Sbjct  237   HHLDLSSAAELEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESIALHYAVENCSREVV  296

Query  1005  KALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILR  1184
             KALLELGAADVN+PAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVR  DGITPLDILR
Sbjct  297   KALLELGAADVNFPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRMLDGITPLDILR  356

Query  1185  TLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAAL  1364
             TLTSDFLFKG +PG  HIEPNKLRLCLELVQSAAMVI REEG+A  + +S++  IYP   
Sbjct  357   TLTSDFLFKGTVPGHVHIEPNKLRLCLELVQSAAMVILREEGSANIDLSSTN--IYPP--  412

Query  1365  AMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGA-VENSGGGGHHNQREAMTTRQNSG  1541
                      N+     S      N+DSR+VYLNLGA V N+    H              
Sbjct  413   --------NNMSDDHTSSTSSGTNIDSRMVYLNLGAGVTNTSTHDH--------------  450

Query  1542  DPPSMYHHSHEY  1577
              P SMYHHSHEY
Sbjct  451   -PSSMYHHSHEY  461



>ref|XP_006402903.1| hypothetical protein EUTSA_v10005948mg [Eutrema salsugineum]
 gb|ESQ44356.1| hypothetical protein EUTSA_v10005948mg [Eutrema salsugineum]
Length=469

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/492 (73%), Positives = 397/492 (81%), Gaps = 26/492 (5%)
 Frame = +3

Query  105   STVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdsp  284
             S++E++L+SLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG D  
Sbjct  3     SSIEETLKSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGSDPS  62

Query  285   gsdspgsRMGLVgagagaaSPRGSI-PQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHE  461
                    + G   A    +  R ++   VIPVNSVGYEVFLL++QFLYSGQVSIVP KHE
Sbjct  63    -------QTGAETAHQTGSGARAAVVGGVIPVNSVGYEVFLLLLQFLYSGQVSIVPHKHE  115

Query  462   PRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRV  641
             PR NC +RGCWHTHCT+AVDL+LD L+AAR FGVEQLALLTQK L SMVEKAS+EDVM+V
Sbjct  116   PRSNCGDRGCWHTHCTAAVDLSLDILAAARYFGVEQLALLTQKHLTSMVEKASVEDVMKV  175

Query  642   LIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahh  821
             LIAS KQ+M QLWTTCS+LVAKSGLP E+LAKHLPI++VAK+EELR KSS+   SL+ H 
Sbjct  176   LIASRKQDMHQLWTTCSYLVAKSGLPTEILAKHLPIELVAKVEELRLKSSMPLRSLMPHQ  235

Query  822   hhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREV  1001
             H           EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LAL YAVENCSREV
Sbjct  236   HDLTSALDL---EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALIYAVENCSREV  292

Query  1002  VKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDIL  1181
             VKALLELGAADVNYPAG  G+T LHIAAEMVSPDMV+VLLDHHADPNV+T DGITPLDIL
Sbjct  293   VKALLELGAADVNYPAGPTGKTALHIAAEMVSPDMVAVLLDHHADPNVQTVDGITPLDIL  352

Query  1182  RTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAA  1361
             RTLTSDFLFKGAIPGL HIEPNKLRLCLELVQSAA+VISREEG    +NN ++ VIYP  
Sbjct  353   RTLTSDFLFKGAIPGLTHIEPNKLRLCLELVQSAALVISREEG--NNSNNDNNTVIYP--  408

Query  1362  LAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTRQNSG  1541
               M +EH      S+GGS      +LDSRLVYLNLGA   + G GH NQRE M+   +  
Sbjct  409   -RMKDEH---TSGSNGGS------SLDSRLVYLNLGATNRNLGDGHSNQREGMSLHHHH-  457

Query  1542  DPPSMYHHSHEY  1577
             DP +MYHH H Y
Sbjct  458   DPSTMYHHHHHY  469



>emb|CDY06929.1| BnaA04g23860D [Brassica napus]
Length=487

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/500 (74%), Positives = 410/500 (82%), Gaps = 24/500 (5%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS++E+SLRS+SLD+LNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG D 
Sbjct  1     MSSLEESLRSMSLDFLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGTDQ  60

Query  282   pgsdspgsRMGLVgagagaaS--PRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQK  455
             P S    +R G V A     S  P G    VIPVNSVGYEVFLL++QFLYSGQVSIVPQK
Sbjct  61    PQSCIDPTRHGSVPASPTRGSQAPAG----VIPVNSVGYEVFLLLLQFLYSGQVSIVPQK  116

Query  456   HEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVM  635
             HEPRPNC ERGCWHTHC++AVDLALDTL+A+R FGVEQLALLTQKQLASMVEKASIEDVM
Sbjct  117   HEPRPNCGERGCWHTHCSAAVDLALDTLAASRYFGVEQLALLTQKQLASMVEKASIEDVM  176

Query  636   RVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarsslla  815
             +VLIAS KQ+MQQLW+TCSHLVAKSGLPPE+LAKHL IDVVAKIEE+R K+S++R SL+ 
Sbjct  177   KVLIASRKQDMQQLWSTCSHLVAKSGLPPEILAKHLTIDVVAKIEEIRLKTSISRRSLMP  236

Query  816   hhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSR  995
             H+HH     A    EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVE+CSR
Sbjct  237   HNHHHDLTVAQDL-EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVESCSR  295

Query  996   EVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLD  1175
             EVVKALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT  GITPLD
Sbjct  296   EVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVGGITPLD  355

Query  1176  ILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYP  1355
             ILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREEG    +NN+++    P
Sbjct  356   ILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEG--NNSNNNNNDYNNP  413

Query  1356  AALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGG------HHNQREA  1517
             +   M+EEH       + GS    N NLDSRLVYLNLGA     G G       ++QRE 
Sbjct  414   SYPQMNEEH-------NSGSSGGSNNNLDSRLVYLNLGAGTGQMGQGRDHGDDQNSQREG  466

Query  1518  MT--TRQNSGDPPSMYHHSH  1571
             M+     +  DP +MYH  H
Sbjct  467   MSRHNHHHHHDPSTMYHQHH  486



>ref|XP_002881770.1| hypothetical protein ARALYDRAFT_903451 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58029.1| hypothetical protein ARALYDRAFT_903451 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/502 (76%), Positives = 414/502 (82%), Gaps = 30/502 (6%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS++E+SLRSLSLD+LNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG DS
Sbjct  1     MSSLEESLRSLSLDFLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGTDS  60

Query  282   pgsds--pgsRMGLVgagagaaSP-RGSIPQ--VIPVNSVGYEVFLLMMQFLYSGQVSIV  446
             P   +    +R G V A     SP RGS     VIPVNSVGYEVFLL++QFLYSGQVSIV
Sbjct  61    PQPVTGIDPTRHGSVPA-----SPTRGSTAPAGVIPVNSVGYEVFLLLLQFLYSGQVSIV  115

Query  447   PQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIE  626
             PQKHEPRPNC ERGCWHTHC++AVDLALDTL+A+R FGVEQLALLTQKQLASMVEKASIE
Sbjct  116   PQKHEPRPNCGERGCWHTHCSAAVDLALDTLAASRYFGVEQLALLTQKQLASMVEKASIE  175

Query  627   DVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarss  806
             DVM+VLIAS KQ+M QLWTTCSHLVAKSGLPPE+LAKHLPIDVVAKIEELR KSS+AR S
Sbjct  176   DVMKVLIASRKQDMHQLWTTCSHLVAKSGLPPEILAKHLPIDVVAKIEELRLKSSIARRS  235

Query  807   llahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVEN  986
             L+ H+HH     A    EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVE+
Sbjct  236   LMPHNHHHDLSVAQDL-EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVES  294

Query  987   CSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGIT  1166
             CSREVVKALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT  GIT
Sbjct  295   CSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVGGIT  354

Query  1167  PLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaV  1346
             PLDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREEGN + N N+ +  
Sbjct  355   PLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEGNNSNNQNNDNNT  414

Query  1347  -IYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGG------HHN  1505
              IYP    M+EEH       + GS    N NLDSRLVYLNLGA     G G      H +
Sbjct  415   GIYP---HMNEEH-------NSGSSGGSNNNLDSRLVYLNLGAGTGQMGPGRDQGDDHIS  464

Query  1506  QREAMT--TRQNSGDPPSMYHH  1565
             QRE M+     +  DP +MYHH
Sbjct  465   QREGMSRHHHHHHQDPSTMYHH  486



>ref|XP_010508725.1| PREDICTED: regulatory protein NPR5 [Camelina sativa]
Length=490

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/498 (76%), Positives = 414/498 (83%), Gaps = 28/498 (6%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS++E+SLRSLSLD+LNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG DS
Sbjct  1     MSSLEESLRSLSLDFLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGNDS  60

Query  282   pgsdspg--sRMGLVgagagaaSP-RGSIPQ--VIPVNSVGYEVFLLMMQFLYSGQVSIV  446
             P + +    +R G V A     SP RGS     VIPVNSVGYEVFLL++QFLYSGQVSIV
Sbjct  61    PQAGTGIDPTRHGSVPA-----SPTRGSTAPAGVIPVNSVGYEVFLLLLQFLYSGQVSIV  115

Query  447   PQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIE  626
             PQKHEPRPNC ERGCWHTHC++AVDLALDTL+A+R FGVEQLALLTQKQLASMVEKASIE
Sbjct  116   PQKHEPRPNCGERGCWHTHCSAAVDLALDTLAASRYFGVEQLALLTQKQLASMVEKASIE  175

Query  627   DVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarss  806
             DVM+VLIAS KQ+M QLWTTCSHL AKSGLPPE+LAKHLPIDVVAKIEELR KSS+AR S
Sbjct  176   DVMKVLIASRKQDMHQLWTTCSHLAAKSGLPPEILAKHLPIDVVAKIEELRLKSSIARRS  235

Query  807   llahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVEN  986
             L+ H+HH     A    EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVE+
Sbjct  236   LMPHNHHHDLSVAQDL-EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVES  294

Query  987   CSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGIT  1166
             CSREVVKALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT  GIT
Sbjct  295   CSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVGGIT  354

Query  1167  PLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaV  1346
             PLDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREEGN + N+N+ +  
Sbjct  355   PLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEGNNSNNHNNDNNT  414

Query  1347  -IYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGG------HHN  1505
              +YP    M+EEH       + GS    N NLDSRLVYLNLGA     G G      H++
Sbjct  415   GMYP---HMNEEH-------NSGSSGGSNNNLDSRLVYLNLGAGTGQMGPGRDQGDDHNS  464

Query  1506  QREAMTTRQNSGDPPSMY  1559
             QRE M+   +  DP +MY
Sbjct  465   QREGMSRHHHHHDPSTMY  482



>ref|XP_006411403.1| hypothetical protein EUTSA_v10016568mg [Eutrema salsugineum]
 gb|ESQ52856.1| hypothetical protein EUTSA_v10016568mg [Eutrema salsugineum]
Length=492

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/497 (76%), Positives = 411/497 (83%), Gaps = 24/497 (5%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS++E+SLRSLSLD+LNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG D+
Sbjct  1     MSSLEESLRSLSLDFLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGTDT  60

Query  282   pgsdspg--sRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQK  455
             P S +    +R G V A     SP  S   VIPVNSVGYEVFLL++QFLYSGQVSIVPQK
Sbjct  61    PQSGTGIDPTRHGSVPASPTRGSPAPS--GVIPVNSVGYEVFLLLLQFLYSGQVSIVPQK  118

Query  456   HEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVM  635
             HEPRPNC ERGCWHTHC++AVDLALDTL+A+R FGVEQLALLTQKQLASMVEKASIEDVM
Sbjct  119   HEPRPNCGERGCWHTHCSAAVDLALDTLAASRYFGVEQLALLTQKQLASMVEKASIEDVM  178

Query  636   RVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarsslla  815
             +VLIAS KQ+M QLWTTCSHLVAKSGLPPE+LAKHL IDVVAKIEELR KSS+AR SL+ 
Sbjct  179   KVLIASRKQDMHQLWTTCSHLVAKSGLPPEILAKHLTIDVVAKIEELRLKSSIARRSLMP  238

Query  816   hhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSR  995
             HHHH     A    EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVE+CSR
Sbjct  239   HHHHHDLTVAQDL-EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVESCSR  297

Query  996   EVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLD  1175
             EVVKALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT  GITPLD
Sbjct  298   EVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVGGITPLD  357

Query  1176  ILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEG-naaannnsssaVIY  1352
             ILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREEG N+  NNN  +  IY
Sbjct  358   ILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEGNNSNNNNNDHNNTIY  417

Query  1353  PAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGA------VENSGGGGHHNQRE  1514
             P    M+EEH       + GS    N NLDSRLVYLNLGA      +    G  H++QRE
Sbjct  418   P---QMNEEH-------NSGSSGGSNNNLDSRLVYLNLGAGTGQMGLSRDQGDDHNSQRE  467

Query  1515  AMT--TRQNSGDPPSMY  1559
              M+     +  DP +MY
Sbjct  468   GMSRHHHHHHHDPSTMY  484



>ref|XP_010554791.1| PREDICTED: regulatory protein NPR5-like [Tarenaya hassleriana]
Length=486

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/463 (81%), Positives = 397/463 (86%), Gaps = 23/463 (5%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS++E+SLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD 
Sbjct  1     MSSLEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDP  60

Query  282   pgsdspgsRMGLVgagagaaSPRGSIPQ----VIPVNSVGYEVFLLMMQFLYSGQVSIVP  449
             P         G   +      P    P     VIPVNSVGYEVFLL++Q+LYSGQVSIVP
Sbjct  61    PSGT------GFDPSEMTRPGPGNVSPTRPAGVIPVNSVGYEVFLLLLQYLYSGQVSIVP  114

Query  450   QKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIED  629
             QKHEPRPNC ERGCWHTHCTSAVDLAL+TLSAAR FGVEQLALLTQKQLASMVEKASIED
Sbjct  115   QKHEPRPNCGERGCWHTHCTSAVDLALETLSAARYFGVEQLALLTQKQLASMVEKASIED  174

Query  630   VMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssl  809
             VMRVLIAS KQ+M QLWTTCSHLVAKSGLPPE+LAKHLPIDVVAKIEELR KSS+AR SL
Sbjct  175   VMRVLIASRKQDMHQLWTTCSHLVAKSGLPPEILAKHLPIDVVAKIEELRLKSSMARRSL  234

Query  810   l--ahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVE  983
             +   HHHH HDL  A DLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVE
Sbjct  235   MPHHHHHHHHDLSVAQDLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVE  294

Query  984   NCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGI  1163
             NCSREVVKALLELGAADVNYPAG AG+TPLH+AAEMV PDMV+VLLDHHADP VRT DGI
Sbjct  295   NCSREVVKALLELGAADVNYPAGPAGKTPLHVAAEMVCPDMVAVLLDHHADPIVRTVDGI  354

Query  1164  TPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssa  1343
             TPLDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREEGN+  NN++S A
Sbjct  355   TPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEGNSNNNNDNSPA  414

Query  1344  VIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGA  1472
             +  P    M+E+   R   SSGGS N    NLDSRLVYLNLGA
Sbjct  415   IFPP----MNED---RTSGSSGGSMN----NLDSRLVYLNLGA  446



>emb|CDY14765.1| BnaC04g47620D [Brassica napus]
Length=487

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/494 (75%), Positives = 408/494 (83%), Gaps = 23/494 (5%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS++E+SLRS+SLD+LNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG D 
Sbjct  1     MSSLEESLRSMSLDFLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGTDQ  60

Query  282   pgsdspgsRMGLVgagagaaS--PRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQK  455
             P S    +R G V       S  P G    VIPVNSVGYEVFLL++QFLYSGQVSIVPQK
Sbjct  61    PQSCIDPTRHGSVPGSPSRGSQAPAG----VIPVNSVGYEVFLLLLQFLYSGQVSIVPQK  116

Query  456   HEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVM  635
             HEPRPNC ERGCWHTHC++AVDLALDTL+A+R FGVEQLALLTQKQLASMVEKASIEDVM
Sbjct  117   HEPRPNCGERGCWHTHCSAAVDLALDTLAASRYFGVEQLALLTQKQLASMVEKASIEDVM  176

Query  636   RVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarsslla  815
             +VLIAS KQ+MQQLW+TCSHLVAKSGLPPE+LAKHL IDVVAKIEE+R K+S++R SL+ 
Sbjct  177   KVLIASRKQDMQQLWSTCSHLVAKSGLPPEILAKHLTIDVVAKIEEIRLKTSISRRSLMP  236

Query  816   hhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSR  995
             H+HH     A    EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVE+CSR
Sbjct  237   HNHHHDLTVAQDL-EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVESCSR  295

Query  996   EVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLD  1175
             EVVKALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT  GITPLD
Sbjct  296   EVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVGGITPLD  355

Query  1176  ILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYP  1355
             ILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREEG    +NN+++    P
Sbjct  356   ILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEG--NNSNNNNNDYNNP  413

Query  1356  AALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGG------HHNQREA  1517
             +   M+EEH       + GS    N NLDSRLVYLNLGA     G G       ++QRE 
Sbjct  414   SYPQMNEEH-------NSGSSGGSNNNLDSRLVYLNLGAGTGQMGQGRDHGDDQNSQREG  466

Query  1518  MTTRQNSGDPPSMY  1559
             M +R +  DP +MY
Sbjct  467   M-SRHHHHDPSTMY  479



>ref|XP_010036340.1| PREDICTED: regulatory protein NPR5-like [Eucalyptus grandis]
 ref|XP_010036341.1| PREDICTED: regulatory protein NPR5-like [Eucalyptus grandis]
 gb|KCW47870.1| hypothetical protein EUGRSUZ_K01614 [Eucalyptus grandis]
Length=489

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/513 (75%), Positives = 418/513 (81%), Gaps = 48/513 (9%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T EDSLRSLSLDYLNL+ING+AFSDVTF+VEGRLVHAHRCILAARSLFFRKFFCGPD P 
Sbjct  2     TPEDSLRSLSLDYLNLIINGEAFSDVTFTVEGRLVHAHRCILAARSLFFRKFFCGPDPPS  61

Query  288   sdspgsRMGLVgagagaaSPRGSIPQ--------------VIPVNSVGYEVFLLMMQFLY  425
                     GL+ A      PRG+ PQ              VIPVNSVGYEVFLL++QFLY
Sbjct  62    --------GLLDAAG---CPRGN-PQGAAHHPSRPPPPPGVIPVNSVGYEVFLLVLQFLY  109

Query  426   SGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASM  605
             SGQVSIVPQKHEPRPNC  RGCWHTHCTSAVDLALDTL+AARSFGVEQLALLTQKQLASM
Sbjct  110   SGQVSIVPQKHEPRPNCGNRGCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQLASM  169

Query  606   VEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHK  785
             VEKASIEDVM+VLIAS KQEM QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR K
Sbjct  170   VEKASIEDVMKVLIASRKQEMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLK  229

Query  786   sslarssllahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALA  965
             SS+AR S++ HHHH HDL  AA+LE+QKIRRMRRALDSSDVELVKLMVMGEGLNLD ALA
Sbjct  230   SSMARRSIMPHHHHPHDLSTAAELEEQKIRRMRRALDSSDVELVKLMVMGEGLNLDAALA  289

Query  966   LHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNV  1145
             LHYAVENCSREVVKALLELGAADVN+PAG +G+TPLH++AEMVSPDMV+VLLDHHADP V
Sbjct  290   LHYAVENCSREVVKALLELGAADVNHPAGPSGKTPLHLSAEMVSPDMVAVLLDHHADPTV  349

Query  1146  RTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEG---na  1316
             RTADGITPLD+LRTLTSDFLFKGA+PGLAHIEPNKLRLCLELVQSAA+VISREE    NA
Sbjct  350   RTADGITPLDVLRTLTSDFLFKGAVPGLAHIEPNKLRLCLELVQSAALVISREEAGNANA  409

Query  1317  aannnsssaVIYPAALAMSEEHHHRNIPSSGGSG-NIVNLNLDSRLVYLNLGA-----VE  1478
               N +SS+  IYP    M  + H     SSG SG N+ N+NLDSR VYLNLG      ++
Sbjct  410   NTNASSSTTTIYP---PMCGDDH-----SSGSSGNNMGNINLDSR-VYLNLGTQMGSRMD  460

Query  1479  NSGGGGHHNQREAMTTRQNSGDPPSMYHHSHEY  1577
                    +NQRE M    + G    +Y HSH++
Sbjct  461   EDDQSSRNNQRETMNLYGSQG----LYRHSHDF  489



>gb|KFK36987.1| hypothetical protein AALP_AA4G197800 [Arabis alpina]
Length=491

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/494 (76%), Positives = 410/494 (83%), Gaps = 19/494 (4%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS++E+SLRSLSLD+LNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG DS
Sbjct  1     MSSLEESLRSLSLDFLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGTDS  60

Query  282   pgsds--pgsRMGLVgag-agaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQ  452
             P S +    +R G V        S   +   VIPVNSVGYEVFLLM+QFLYSGQVSIVPQ
Sbjct  61    PQSGTGIDPTRHGSVPLSPTRGGSTGQTGGGVIPVNSVGYEVFLLMLQFLYSGQVSIVPQ  120

Query  453   KHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDV  632
             KHEPRPNC ERGCWHTHC++AVDLALDTL+A+R FGVEQLALLTQKQLASMVEKASIEDV
Sbjct  121   KHEPRPNCGERGCWHTHCSAAVDLALDTLAASRYFGVEQLALLTQKQLASMVEKASIEDV  180

Query  633   MRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssll  812
             M+VLIAS KQ+M QLWTTCSHLVAKSGLPPE+LAKH+P+DVVAKIEELR KSSLAR SL+
Sbjct  181   MKVLIASRKQDMHQLWTTCSHLVAKSGLPPEILAKHIPMDVVAKIEELRLKSSLARRSLM  240

Query  813   ahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCS  992
              H+HH     A    EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVE+CS
Sbjct  241   PHNHHHDLTVAQDL-EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVESCS  299

Query  993   REVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPL  1172
             REVVKALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT  GITPL
Sbjct  300   REVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVGGITPL  359

Query  1173  DILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIY  1352
             DILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREEGN + NNN  +  IY
Sbjct  360   DILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEGNNSNNNNDLNNAIY  419

Query  1353  PAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVE----NSGGGGHHNQREAM  1520
             P    M+EEH       + GS    N NLDSRLVYLNLGA +       G  H++QRE M
Sbjct  420   P---HMNEEH-------NSGSSGGSNNNLDSRLVYLNLGAGQMGPSRDQGDDHNSQREGM  469

Query  1521  TTR-QNSGDPPSMY  1559
             +    +  DP +MY
Sbjct  470   SRHPHHHHDPSTMY  483



>ref|XP_010543719.1| PREDICTED: regulatory protein NPR5 isoform X2 [Tarenaya hassleriana]
Length=479

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/488 (76%), Positives = 402/488 (82%), Gaps = 19/488 (4%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS+VEDSLRS+SLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD 
Sbjct  1     MSSVEDSLRSMSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDP  60

Query  282   pgsdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHE  461
             P  D      G+   G+G ASP  ++  VIPVNSVGYEVFLL++QFLYSGQVSIVPQKHE
Sbjct  61    PPLDPS----GMTRPGSGPASPTRTV-GVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHE  115

Query  462   PRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRV  641
             PRPNC ERGCWHTHCTSAVDLALDTLSAAR FGVEQLALLTQKQLASMVEKASIEDVM+V
Sbjct  116   PRPNCGERGCWHTHCTSAVDLALDTLSAARYFGVEQLALLTQKQLASMVEKASIEDVMKV  175

Query  642   LIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahh  821
             L+AS K +M QLW TCSHLVAKSGLPPEVLAKHLPIDVVAKIEE+R   + +        
Sbjct  176   LVASRKHDMHQLWVTCSHLVAKSGLPPEVLAKHLPIDVVAKIEEIR--LNSSMGRRSLMA  233

Query  822   hhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREV  1001
             +H HDL A  DLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVENCSREV
Sbjct  234   NHHHDLSATLDLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVENCSREV  293

Query  1002  VKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDIL  1181
             VKALLELGAA+VNYPAG AG+TPLH+AAEM  PDMV+VLLDHHA+PNVRT DGITPLDIL
Sbjct  294   VKALLELGAAEVNYPAGPAGKTPLHMAAEMGFPDMVAVLLDHHANPNVRTVDGITPLDIL  353

Query  1182  RTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAA  1361
             R LTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREEG     N      IYP  
Sbjct  354   RALTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEGKNNDTNPG----IYP--  407

Query  1362  LAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSG--GGGHHNQREAMTTRQN  1535
               M++EH   +   S G GN+V  +LDSRLVYLNLGA  NSG  G  H ++ +  +++  
Sbjct  408   -PMNDEHTSGSSGGSSGLGNLV--HLDSRLVYLNLGAA-NSGQVGSSHDHEEDHSSSQSR  463

Query  1536  SGDPPSMY  1559
                 PSMY
Sbjct  464   HHHDPSMY  471



>ref|XP_004514968.1| PREDICTED: regulatory protein NPR5-like [Cicer arietinum]
Length=490

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/484 (76%), Positives = 401/484 (83%), Gaps = 23/484 (5%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTF VEGRLVHAHRCILAARSLFFRKFFCGPD P    P       G  +  
Sbjct  19    INGQAFSDVTFQVEGRLVHAHRCILAARSLFFRKFFCGPDPPPGLDPTG-----GGSSRQ  73

Query  339   aSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAV  518
             ++PR   P VIPVNSVGYEVFLL++QFLYSGQVSIVPQKHEPRPNC ERGCWHTHC+SAV
Sbjct  74    SNPR---PGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCSSAV  130

Query  519   DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
             DLALDTL+AAR FGVEQLALLTQKQL S VEKASI+DVM+VLIAS KQEM QLWTTCSHL
Sbjct  131   DLALDTLAAARYFGVEQLALLTQKQLVSTVEKASIDDVMKVLIASRKQEMHQLWTTCSHL  190

Query  699   VAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaa-dlEDQKIR  875
             VAKSGLPPEVLAKHLPIDVVAKIEELR K+SLAR SL+  HHH H L     DLEDQKIR
Sbjct  191   VAKSGLPPEVLAKHLPIDVVAKIEELRLKTSLARRSLMPLHHHHHHLHHDLGDLEDQKIR  250

Query  876   RMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGA  1055
             RMRRALDSSDVELVKLMVMGEGLNLDEALALHY VENCSREVVKALLELGAADVNYPAG 
Sbjct  251   RMRRALDSSDVELVKLMVMGEGLNLDEALALHYGVENCSREVVKALLELGAADVNYPAGP  310

Query  1056  AGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAH  1235
             +G++PLH+AAEMVSP+MV+VLLDHHADP VRT DG+TPLDILRTLTSDFLFKGA+PGL H
Sbjct  311   SGKSPLHVAAEMVSPEMVAVLLDHHADPTVRTVDGVTPLDILRTLTSDFLFKGAVPGLTH  370

Query  1236  IEPNKLRLCLELVQSAAMVISREEGnaaannnsssaV--IYPAALAMSEEH---HHRNIP  1400
             IEPNKLRLCLELVQSAA+V+SREE NA  NNN+SS+   IYP    MSE+H      N  
Sbjct  371   IEPNKLRLCLELVQSAALVMSREENNANNNNNASSSAAPIYP---PMSEDHSSSSSGNNN  427

Query  1401  SSGGSGNIVNLNLDSRLVYLNLGAVE-----NSGGGGHHNQREAMTTRQNSGDPPSMYHH  1565
             ++  + NI NLNLDSRLVYLNLGA       +    GH++ REAM  RQ  G  P+MYHH
Sbjct  428   NNNNNNNIGNLNLDSRLVYLNLGAARMGGGGDDDDSGHNSHREAM-NRQGGGCDPTMYHH  486

Query  1566  SHEY  1577
             SH++
Sbjct  487   SHDF  490



>gb|EYU18655.1| hypothetical protein MIMGU_mgv11b023775mg [Erythranthe guttata]
Length=489

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/476 (79%), Positives = 399/476 (84%), Gaps = 23/476 (5%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T EDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD   
Sbjct  2     TTEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPQP  61

Query  288   sdspgsRMGLVgagagaaS----PRGSIPQ-VIPVNSVGYEVFLLMMQFLYSGQVSIVPQ  452
                P  RMG  G G G  +    PR    Q VIPVNSVGYEVFLLM+QFLYSGQVSIVPQ
Sbjct  62    GSDPL-RMGPGGVGGGGGASSSSPRQQQQQQVIPVNSVGYEVFLLMLQFLYSGQVSIVPQ  120

Query  453   KHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDV  632
             KHEPRPNC ER CWHTHCTSAVDLALDTL+AARSFGVEQLALLTQKQL+SMVEKASIEDV
Sbjct  121   KHEPRPNCGERACWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQLSSMVEKASIEDV  180

Query  633   MRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssll  812
             M+VLIAS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPI+VVAKIEELR KS+LAR SL+
Sbjct  181   MKVLIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIEVVAKIEELRLKSTLARRSLM  240

Query  813   ahhhhrhdlg------aaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHY  974
               HHH           AAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHY
Sbjct  241   PPHHHHSHHHHHDMGGAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHY  300

Query  975   AVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTA  1154
             AVENCSREVVKALLELGAADVNYPAG AG++PLH+AAEMVSPDMV+VLLDHHADPNVRT 
Sbjct  301   AVENCSREVVKALLELGAADVNYPAGPAGKSPLHVAAEMVSPDMVAVLLDHHADPNVRTV  360

Query  1155  DGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannns  1334
             DGITPLD+LRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREEG        
Sbjct  361   DGITPLDVLRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEG---NAGTP  417

Query  1335  ssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHH  1502
              SA IYP    M+++ H     ++   G   NLNLDSR+VYLNLGA    GGGG +
Sbjct  418   PSAAIYP---PMNDQDHGG---AAASIGAAGNLNLDSRMVYLNLGA--QMGGGGKN  465



>ref|XP_007162101.1| hypothetical protein PHAVU_001G124100g [Phaseolus vulgaris]
 gb|ESW34095.1| hypothetical protein PHAVU_001G124100g [Phaseolus vulgaris]
Length=475

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/497 (77%), Positives = 412/497 (83%), Gaps = 30/497 (6%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             ++EDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD P 
Sbjct  2     SLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPS  61

Query  288   sdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPR  467
                     GL  AG    S  G    VIPVNSVGYEVFLLM+QFLYSGQVSIVPQKHE R
Sbjct  62    --------GLDPAGPRLNSRSG----VIPVNSVGYEVFLLMLQFLYSGQVSIVPQKHEAR  109

Query  468   PNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLI  647
             PNC ERGCWHTHCTSAVDLALDTL+AAR FGVEQLALLTQKQLASMVEKASIEDVM+VL+
Sbjct  110   PNCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLASMVEKASIEDVMKVLL  169

Query  648   ASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhh  827
             AS KQ+MQQLW TCSHLVAKSGLPPEVLAKHLPID+VAKIEELR KSS+AR SL+ HHHH
Sbjct  170   ASRKQDMQQLWATCSHLVAKSGLPPEVLAKHLPIDIVAKIEELRIKSSMARRSLVPHHHH  229

Query  828   rhdlgaaadl--EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREV  1001
              H     A L  EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALAL YAVENCSREV
Sbjct  230   HHPHHHHAALDLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALPYAVENCSREV  289

Query  1002  VKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDIL  1181
             VKALLELGAADVNYP+G AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPLDIL
Sbjct  290   VKALLELGAADVNYPSGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDIL  349

Query  1182  RTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEG--naaannnsssaVIYP  1355
             RTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA+V+SREEG  N     ++S+A IYP
Sbjct  350   RTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVMSREEGNANNNNAPSNSAAPIYP  409

Query  1356  AALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVE--NSGGGGHHNQREAMTTR  1529
               +    E H+ +  S   + NI NLNLDSRLVYLNLGA    +S   G  ++REAM T 
Sbjct  410   PPM---NEDHNSSSSSGNNNNNIGNLNLDSRLVYLNLGATASMSSRLDGGEDEREAMNT-  465

Query  1530  QNSGDPPSMY-HHSHEY  1577
                    +MY HHSH++
Sbjct  466   -------TMYHHHSHDF  475



>ref|NP_181668.1| NPR1 like protein BOP2 [Arabidopsis thaliana]
 sp|Q9ZVC2.1|NPR5_ARATH RecName: Full=Regulatory protein NPR5; AltName: Full=BTB/POZ 
domain-containing protein NPR5; AltName: Full=Protein BLADE 
ON PETIOLE 2 [Arabidopsis thaliana]
 gb|AAC78536.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAU90063.1| At2g41370 [Arabidopsis thaliana]
 gb|AAX22759.1| BLADE-ON-PETIOLE2 [Arabidopsis thaliana]
 gb|AEC09966.1| NPR1 like protein BOP2 [Arabidopsis thaliana]
Length=491

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/497 (76%), Positives = 410/497 (82%), Gaps = 25/497 (5%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS +E+SLRSLSLD+LNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG DS
Sbjct  1     MSNLEESLRSLSLDFLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGTDS  60

Query  282   pgsdspgsRMGLVgagagaaSP-RGSIPQ--VIPVNSVGYEVFLLMMQFLYSGQVSIVPQ  452
             P   +    +     G+  ASP RGS     +IPVNSVGYEVFLL++QFLYSGQVSIVPQ
Sbjct  61    PQPVTG---IDPTQHGSVPASPTRGSTAPAGIIPVNSVGYEVFLLLLQFLYSGQVSIVPQ  117

Query  453   KHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDV  632
             KHEPRPNC ERGCWHTHC++AVDLALDTL+A+R FGVEQLALLTQKQLASMVEKASIEDV
Sbjct  118   KHEPRPNCGERGCWHTHCSAAVDLALDTLAASRYFGVEQLALLTQKQLASMVEKASIEDV  177

Query  633   MRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssll  812
             M+VLIAS KQ+M QLWTTCSHLVAKSGLPPE+LAKHLPIDVV KIEELR KSS+AR SL+
Sbjct  178   MKVLIASRKQDMHQLWTTCSHLVAKSGLPPEILAKHLPIDVVTKIEELRLKSSIARRSLM  237

Query  813   ahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCS  992
              H+HH     A    EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVE+CS
Sbjct  238   PHNHHHDLSVAQDL-EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVESCS  296

Query  993   REVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPL  1172
             REVVKALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT  GITPL
Sbjct  297   REVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVGGITPL  356

Query  1173  DILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaV-I  1349
             DILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREEGN + N N+ +   I
Sbjct  357   DILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEGNNSNNQNNDNNTGI  416

Query  1350  YPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGG------HHNQR  1511
             YP    M+EEH       + GS    N NLDSRLVYLNLGA     G G      H++QR
Sbjct  417   YP---HMNEEH-------NSGSSGGSNNNLDSRLVYLNLGAGTGQMGPGRDQGDDHNSQR  466

Query  1512  EAMTT-RQNSGDPPSMY  1559
             E M+    +  DP +MY
Sbjct  467   EGMSRHHHHHQDPSTMY  483



>ref|XP_004249233.1| PREDICTED: regulatory protein NPR5 [Solanum lycopersicum]
Length=488

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/499 (74%), Positives = 398/499 (80%), Gaps = 28/499 (6%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             M+T+EDSL++LSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSL FRKFFCGP+S
Sbjct  1     MNTLEDSLKTLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLVFRKFFCGPES  60

Query  282   pgsdspgsRMGLVgagagaaSPRGSIPQ----VIPVNSVGYEVFLLMMQFLYSGQVSIVP  449
             PG        G      G  SPR S       VIPVNSVGYEVFLLM+QFLYSGQVSIVP
Sbjct  61    PG--------GGPDPSVGFGSPRTSTTSSSQVVIPVNSVGYEVFLLMLQFLYSGQVSIVP  112

Query  450   QKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIED  629
             QKHEPRPNC ER CWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQL SMVEK SIED
Sbjct  113   QKHEPRPNCGERNCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLTSMVEKTSIED  172

Query  630   VMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssl  809
             VM+VL+AS KQ+M QLWTTCSHLVAKSGLPPE+LAKHLPIDVVAKIEE+R K+SLAR SL
Sbjct  173   VMKVLVASRKQDMPQLWTTCSHLVAKSGLPPEILAKHLPIDVVAKIEEIRLKTSLARRSL  232

Query  810   lahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENC  989
             ++HHH       +   EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE++ALHYAVENC
Sbjct  233   ISHHHQHDLSSTSEL-EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESIALHYAVENC  291

Query  990   SREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITP  1169
             SREVVKALLELGAA+VN+PAG AG+TPLHIA+EMVSPDMV+VLLDHHADPNVRT DGITP
Sbjct  292   SREVVKALLELGAANVNHPAGPAGKTPLHIASEMVSPDMVAVLLDHHADPNVRTMDGITP  351

Query  1170  LDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVI  1349
             LDIL+TLTSDFLFKGAIPGL HIEPNKLRLCLELVQSAAMVISREE     N  SS+A+ 
Sbjct  352   LDILQTLTSDFLFKGAIPGLTHIEPNKLRLCLELVQSAAMVISREE-ETTNNVPSSTAIF  410

Query  1350  YPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGA---------VENSGGGGHH  1502
              P     +E+H      ++   GN  NLNLDSR+VYLNLGA                  H
Sbjct  411   QPIN---NEDHGSSTSNTTNVGGN--NLNLDSRMVYLNLGAGTSIAQQIGCNRMTNQDDH  465

Query  1503  NQREAMTTRQNSGDPPSMY  1559
             +       R    DP SMY
Sbjct  466   DNSHNKQNRHGEFDPSSMY  484



>gb|AEM62768.1| BTB/POZ ankyrin repeat protein [Lotus japonicus]
Length=483

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/510 (75%), Positives = 415/510 (81%), Gaps = 48/510 (9%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             ++EDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD P 
Sbjct  2     SLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPP  61

Query  288   sdspgsRMGLVgagagaaSPRGSIPQ---VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKH  458
                     G          PR + P+   VIPVNSVGYEVFLLM+QFLYSGQVSIVPQKH
Sbjct  62    PSGNLDSPG---------GPRVNSPRPGGVIPVNSVGYEVFLLMLQFLYSGQVSIVPQKH  112

Query  459   EPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMR  638
             EPRPNC ER CWHTHCTSAVDLALDTL+AAR FGVEQLALLTQKQLASMVEKASIEDVM+
Sbjct  113   EPRPNCGERACWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLASMVEKASIEDVMK  172

Query  639   VLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarss----  806
             VL+AS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPID+VAKIEELR KS+LAR S    
Sbjct  173   VLLASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDIVAKIEELRLKSTLARRSLIPH  232

Query  807   --llahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAV  980
                  HHH  HD+GAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALAL YAV
Sbjct  233   HHHHHHHHGHHDMGAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALPYAV  292

Query  981   ENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADG  1160
             ENCSREVVKALLELGAADVNYP+G +G+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG
Sbjct  293   ENCSREVVKALLELGAADVNYPSGPSGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDG  352

Query  1161  ITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannn---  1331
             +TPLDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA+V+SREEGNA AN++   
Sbjct  353   VTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVMSREEGNANANSSNNN  412

Query  1332  ----sssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSG--GG  1493
                 S++  IYP    M+E+H          S +  NLNLDSRLVYLNLGA + SG    
Sbjct  413   NAPCSAATPIYP---PMNEDH--------NSSSSNANLNLDSRLVYLNLGAAQMSGDDDS  461

Query  1494  GHHNQREAMTTRQNSGDPPSMY--HHSHEY  1577
              H + REAM          +MY  HHSH+Y
Sbjct  462   SHGSHREAMNQ--------AMYHHHHSHDY  483



>gb|AET34790.1| BTB/POZ ankyrin repeat protein [Pisum sativum]
 gb|AET34791.1| BTB/POZ ankyrin repeat protein [Pisum sativum]
Length=483

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/505 (74%), Positives = 408/505 (81%), Gaps = 38/505 (8%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             ++EDSLRSLSLDYLNLLINGQAFSDV FSVEGRLVHAHRCILAARSLFFRKFFCGPD P 
Sbjct  2     SLEDSLRSLSLDYLNLLINGQAFSDVVFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPS  61

Query  288   sdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPR  467
                     GL  +G    S   S   VIPVNSVGYEVFLLM+QFLYSGQVSIVPQKHEPR
Sbjct  62    --------GLDPSGNRVNSSTRS--GVIPVNSVGYEVFLLMLQFLYSGQVSIVPQKHEPR  111

Query  468   PNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLI  647
             PNC +RGCWHTHCTSAVDLALDTLSAAR FGVEQLALLTQKQLASMVEKASIEDVM+VL+
Sbjct  112   PNCGDRGCWHTHCTSAVDLALDTLSAARYFGVEQLALLTQKQLASMVEKASIEDVMKVLL  171

Query  648   ASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarss-----ll  812
             AS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPID++AKIEELR KSSL+R S       
Sbjct  172   ASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDIIAKIEELRMKSSLSRRSLIPHHHH  231

Query  813   ahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCS  992
               HHH   L AAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALAL YAVE+CS
Sbjct  232   NPHHHHDHLTAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALPYAVESCS  291

Query  993   REVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPL  1172
             REVVKALLELGAADVN+PAG  G+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPL
Sbjct  292   REVVKALLELGAADVNFPAGPTGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPL  351

Query  1173  DILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIY  1352
             DILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA+V+SREEGN   N N+++    
Sbjct  352   DILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVMSREEGNNNNNANNNN----  407

Query  1353  PAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVE-------NSGGGGHH-NQ  1508
                 + +  + H ++     S +  N N+DSRLVYLNLGA         +SG   H+ NQ
Sbjct  408   -TGSSATNMYPHNHMNEEHHSHHNNNSNMDSRLVYLNLGANTQMSTSRLDSGDDDHNSNQ  466

Query  1509  REAMTTRQNSGDPPSMY--HHSHEY  1577
             REAM         PSMY  HHSH+Y
Sbjct  467   REAMN--------PSMYHHHHSHDY  483



>ref|XP_010505917.1| PREDICTED: regulatory protein NPR5-like [Camelina sativa]
Length=493

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/501 (75%), Positives = 414/501 (83%), Gaps = 31/501 (6%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS++E+SLRSLSLD+LNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG DS
Sbjct  1     MSSLEESLRSLSLDFLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGNDS  60

Query  282   pgsdspg--sRMGLVgagagaaSP-RGSIPQ--VIPVNSVGYEVFLLMMQFLYSGQVSIV  446
             P + +    +R G V A     SP RGS     VIPVNSVGYEVFLL++QFLYSGQVSIV
Sbjct  61    PQAGTGIDPTRHGSVPA-----SPTRGSTAPAGVIPVNSVGYEVFLLLLQFLYSGQVSIV  115

Query  447   PQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIE  626
             PQKHEPRPNC ERGCWHTHC++AVDLALDTL+A+R FGVEQL LLTQKQLASMVEKASIE
Sbjct  116   PQKHEPRPNCGERGCWHTHCSAAVDLALDTLAASRYFGVEQLVLLTQKQLASMVEKASIE  175

Query  627   DVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarss  806
             DVM+VLIAS KQ+M QLWTTCSHLVAKSGLPPE+LAKHLPIDVVAKIEELR KSS+AR S
Sbjct  176   DVMKVLIASRKQDMHQLWTTCSHLVAKSGLPPEILAKHLPIDVVAKIEELRLKSSIARRS  235

Query  807   llahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVEN  986
             L+ H+HH     A    EDQKIRRMRRALDSSDVELVKLMVMGEGL+LDE+LALHYAVE+
Sbjct  236   LMPHNHHHDLSVAQDL-EDQKIRRMRRALDSSDVELVKLMVMGEGLSLDESLALHYAVES  294

Query  987   CSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGIT  1166
             CSREVVKALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT  GIT
Sbjct  295   CSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVGGIT  354

Query  1167  PLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaV  1346
             PLDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREEGN + N+N+ +  
Sbjct  355   PLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEGNNSNNHNNDNNA  414

Query  1347  -IYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGG------HHN  1505
              IYP    M+EEH       + GS    N NLDSRLVYLNLGA     G G      H++
Sbjct  415   GIYP---HMNEEH-------NSGSSGGSNNNLDSRLVYLNLGAGTGQMGPGRDQGDDHNS  464

Query  1506  QREAMT---TRQNSGDPPSMY  1559
             QRE M+      +  DP +MY
Sbjct  465   QREGMSRHHHHHHHHDPSTMY  485



>ref|XP_006294095.1| hypothetical protein CARUB_v10023088mg [Capsella rubella]
 gb|EOA26993.1| hypothetical protein CARUB_v10023088mg [Capsella rubella]
Length=491

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/499 (75%), Positives = 412/499 (83%), Gaps = 29/499 (6%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS++E+SLRSLSLD+LNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG DS
Sbjct  1     MSSLEESLRSLSLDFLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGNDS  60

Query  282   pgsdspg--sRMGLVgagagaaSP-RGSIPQ--VIPVNSVGYEVFLLMMQFLYSGQVSIV  446
             P   +    +R G V A     SP RGS     VIPVNSVGYEVFLL++QFLYSGQVSIV
Sbjct  61    PQGVTGIDPTRHGSVPA-----SPTRGSTAPAGVIPVNSVGYEVFLLLLQFLYSGQVSIV  115

Query  447   PQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIE  626
             PQKHEPRPNC ERGCWHTHC++AVDLALDTL+A+R FGVEQLALLTQKQLASMVEKASIE
Sbjct  116   PQKHEPRPNCGERGCWHTHCSAAVDLALDTLAASRYFGVEQLALLTQKQLASMVEKASIE  175

Query  627   DVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarss  806
             DVM+VLIAS KQ+M QLWTTCSHLVAKSGLPPE+LAKHL IDVVAKIEELR KSS+AR S
Sbjct  176   DVMKVLIASRKQDMHQLWTTCSHLVAKSGLPPEILAKHLSIDVVAKIEELRLKSSIARRS  235

Query  807   llahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVEN  986
             L+ H+HH     A    EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVE+
Sbjct  236   LMPHNHHHDLSVAQDL-EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVES  294

Query  987   CSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGIT  1166
             CSREVVKALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT  GIT
Sbjct  295   CSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVGGIT  354

Query  1167  PLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaV  1346
             PLDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREEGN + N+N+ +  
Sbjct  355   PLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEGNNSNNHNNDNNN  414

Query  1347  -IYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGG------HHN  1505
              +YP    M+EEH+  +           N NLDSRLVYLNLGA     G G      H++
Sbjct  415   GMYP---HMNEEHNSGSS-------GGSNNNLDSRLVYLNLGAGTGQMGPGRDQGDDHNS  464

Query  1506  QREAMT-TRQNSGDPPSMY  1559
             QRE M+    +  DP +MY
Sbjct  465   QREGMSRHHHHHHDPSTMY  483



>ref|XP_010543641.1| PREDICTED: regulatory protein NPR5 isoform X1 [Tarenaya hassleriana]
Length=480

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/489 (75%), Positives = 402/489 (82%), Gaps = 20/489 (4%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS+VEDSLRS+SLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD 
Sbjct  1     MSSVEDSLRSMSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDP  60

Query  282   pgsdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHE  461
             P  D      G+   G+G ASP  ++  VIPVNSVGYEVFLL++QFLYSGQVSIVPQKHE
Sbjct  61    PPLDPS----GMTRPGSGPASPTRTV-GVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHE  115

Query  462   PRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRV  641
             PRPNC ERGCWHTHCTSAVDLALDTLSAAR FGVEQLALLTQKQLASMVEKASIEDVM+V
Sbjct  116   PRPNCGERGCWHTHCTSAVDLALDTLSAARYFGVEQLALLTQKQLASMVEKASIEDVMKV  175

Query  642   LIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahh  821
             L+AS K +M QLW TCSHLVAKSGLPPEVLAKHLPIDVVAKIEE+R   + +        
Sbjct  176   LVASRKHDMHQLWVTCSHLVAKSGLPPEVLAKHLPIDVVAKIEEIR--LNSSMGRRSLMA  233

Query  822   hhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREV  1001
             +H HDL A  DLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVENCSREV
Sbjct  234   NHHHDLSATLDLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVENCSREV  293

Query  1002  VKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTAD-GITPLDI  1178
             VKALLELGAA+VNYPAG AG+TPLH+AAEM  PDMV+VLLDHHA+PNVRT D GITPLDI
Sbjct  294   VKALLELGAAEVNYPAGPAGKTPLHMAAEMGFPDMVAVLLDHHANPNVRTVDGGITPLDI  353

Query  1179  LRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPA  1358
             LR LTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREEG     N      IYP 
Sbjct  354   LRALTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEGKNNDTNPG----IYP-  408

Query  1359  ALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSG--GGGHHNQREAMTTRQ  1532
                M++EH   +   S G GN+V  +LDSRLVYLNLGA  NSG  G  H ++ +  +++ 
Sbjct  409   --PMNDEHTSGSSGGSSGLGNLV--HLDSRLVYLNLGAA-NSGQVGSSHDHEEDHSSSQS  463

Query  1533  NSGDPPSMY  1559
                  PSMY
Sbjct  464   RHHHDPSMY  472



>ref|XP_004249234.1| PREDICTED: regulatory protein NPR5-like [Solanum lycopersicum]
Length=494

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/507 (73%), Positives = 405/507 (80%), Gaps = 34/507 (7%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             M+T+EDSL++LSLDYLNLLINGQAFSDVTFSVEGRL+HAHRCILAARSLFFRKFFCGP+S
Sbjct  1     MNTLEDSLKTLSLDYLNLLINGQAFSDVTFSVEGRLIHAHRCILAARSLFFRKFFCGPES  60

Query  282   pgsdspgsRMG-LVgagagaaSPRGSIP---QVIPVNSVGYEVFLLMMQFLYSGQVSIVP  449
                  P  R+G        A+SPRG+      VIPVN+VGYEVFLLM+QFLYSGQVSIVP
Sbjct  61    ASVSGP--RLGPFGVGAGLASSPRGTTSCSQVVIPVNTVGYEVFLLMLQFLYSGQVSIVP  118

Query  450   QKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIED  629
             QKHEPRPNC ER CWHTHCTSAVDLALDTLSAARSFGVEQLALLTQK L SMVEKASIED
Sbjct  119   QKHEPRPNCGERNCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKHLISMVEKASIED  178

Query  630   VMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarss-  806
             VM+VLIAS KQ+M QLWTTCSHLVAKSGLPPE+LAKHLPIDVVAKIE+LR KSS++R S 
Sbjct  179   VMKVLIASRKQDMHQLWTTCSHLVAKSGLPPEILAKHLPIDVVAKIEDLRLKSSISRRSL  238

Query  807   ---llahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYA  977
                   +H H+H + +  +LEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYA
Sbjct  239   IPHHHHNHQHQHQMSSNIELEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYA  298

Query  978   VENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTAD  1157
             VENCSREVVKALLELGAADVNY AG + ++PLH+AAEMVSPDMV+VLLDHHADPN +T D
Sbjct  299   VENCSREVVKALLELGAADVNYQAGPSCKSPLHLAAEMVSPDMVAVLLDHHADPNTQTVD  358

Query  1158  GITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnss  1337
             GITPLDILRTLTSDFLFKGAIPGL HIEPNKLRLCLELVQSAAMVISREEG A  N +S 
Sbjct  359   GITPLDILRTLTSDFLFKGAIPGLTHIEPNKLRLCLELVQSAAMVISREEGEANNNQSSE  418

Query  1338  saVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREA  1517
             +   +     + E+H      SS  S    NLNLDSR+VYLNLGA        HH+Q   
Sbjct  419   NMYTH-----IREDH------SSSTSSGNNNLNLDSRMVYLNLGA----NVANHHHQMAC  463

Query  1518  MTTRQNSGD---------PPSMYHHSH  1571
                  N  D         P +MYHH H
Sbjct  464   KMNNNNDHDCSSSHNNQNPSTMYHHHH  490



>gb|AET34792.1| BTB/POZ ankyrin repeat protein [Pisum sativum]
Length=483

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/505 (74%), Positives = 407/505 (81%), Gaps = 38/505 (8%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             ++EDSLRSLSLDYLNLLINGQAFSDV FSVEGRLVHAHRCILAARSLFFRKFFCGPD P 
Sbjct  2     SLEDSLRSLSLDYLNLLINGQAFSDVVFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPS  61

Query  288   sdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPR  467
                     GL  +G    S   S   VIPVNSVGYEVFLLM+QFLYSGQVSIVPQKHEPR
Sbjct  62    --------GLDPSGNRVNSSTRS--GVIPVNSVGYEVFLLMLQFLYSGQVSIVPQKHEPR  111

Query  468   PNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLI  647
             PNC +RGCWHTHCTSAVDLALDTLSAAR FGVEQLALLTQKQLASMVEKASIEDVM+VL+
Sbjct  112   PNCGDRGCWHTHCTSAVDLALDTLSAARYFGVEQLALLTQKQLASMVEKASIEDVMKVLL  171

Query  648   ASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarss-----ll  812
             AS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPID++AKIEELR KSSL+R S       
Sbjct  172   ASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDIIAKIEELRMKSSLSRRSLIPHHHH  231

Query  813   ahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCS  992
               HHH   L AAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALAL YAVE+CS
Sbjct  232   NPHHHHDHLTAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALPYAVESCS  291

Query  993   REVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPL  1172
             REVVKALLELGAADVN+PAG  G+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPL
Sbjct  292   REVVKALLELGAADVNFPAGPTGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPL  351

Query  1173  DILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIY  1352
             DILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQ AA+V+SREEGN   N N+++    
Sbjct  352   DILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQFAALVMSREEGNNNNNANNNN----  407

Query  1353  PAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVE-------NSGGGGHH-NQ  1508
                 + +  + H ++     S +  N N+DSRLVYLNLGA         +SG   H+ NQ
Sbjct  408   -TGSSATNMYPHNHMNEEHHSHHNNNSNMDSRLVYLNLGANTQMSTSRLDSGDDDHNSNQ  466

Query  1509  REAMTTRQNSGDPPSMY--HHSHEY  1577
             REAM         PSMY  HHSH+Y
Sbjct  467   REAMN--------PSMYHHHHSHDY  483



>ref|XP_010102740.1| Regulatory protein [Morus notabilis]
 gb|EXB93992.1| Regulatory protein [Morus notabilis]
Length=501

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/528 (72%), Positives = 413/528 (78%), Gaps = 63/528 (12%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS++E+S+RSLSLDYLNLLINGQAFSDVTF+VEGRLVHAHRCILAARSLFFRKFFCGPD 
Sbjct  1     MSSLEESMRSLSLDYLNLLINGQAFSDVTFNVEGRLVHAHRCILAARSLFFRKFFCGPDP  60

Query  282   pgsdspgsRMGLVgagagaaSPR----GSIPQ-------VIPVNSVGYEVFLLMMQFLYS  428
             P         GL      ++ PR    GS          VIPVNSVGYEVFLL++QFLYS
Sbjct  61    PSG-------GLDPVSPSSSGPRPMGSGSSAAGRPGNSAVIPVNSVGYEVFLLLLQFLYS  113

Query  429   GQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMV  608
             GQVSIVPQKHEPRPNC ERGCWHTHCTSAVDLALDTL+AARSFGVEQLA+LTQKQLASMV
Sbjct  114   GQVSIVPQKHEPRPNCGERGCWHTHCTSAVDLALDTLAAARSFGVEQLAMLTQKQLASMV  173

Query  609   EKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKs  788
             EKASIEDVM+VL+AS KQ+MQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR KS
Sbjct  174   EKASIEDVMKVLLASRKQDMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKS  233

Query  789   slarssllahhhhrhdlg--------aaadlEDQKIRRMRRALDSSDVELVKLMVMGEGL  944
             SLAR SLL HHH  H           AAADLEDQKIRRMRRALDSSDVELVKLMVMGEGL
Sbjct  234   SLARRSLLPHHHGHHHHHHHHHHDLGAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGL  293

Query  945   NLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLD  1124
             NLDEALALHYAVENCSREVVKALLELGAADVNYPAG AG+TPLH+A+EMVSPDMV+VLLD
Sbjct  294   NLDEALALHYAVENCSREVVKALLELGAADVNYPAGPAGKTPLHVASEMVSPDMVAVLLD  353

Query  1125  HHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISRE  1304
             HHADPNVRT DG+TPLD+LRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA+V+SRE
Sbjct  354   HHADPNVRTVDGVTPLDVLRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSRE  413

Query  1305  E-------GnaaannnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLN  1463
             E            N+N+S  VIYP    M+EE            GNI     DSRLVYLN
Sbjct  414   EGNNNTNANCGNTNSNASPTVIYP---PMNEE------------GNI-----DSRLVYLN  453

Query  1464  LGAVENSGG---------GGHHNQREAMTTRQNSGDPPSMY-HHSHEY  1577
             LGA +  G              ++      + + G  P+MY HHSH++
Sbjct  454   LGATQMGGSRMDGDDDSSHSSGHRDHHHHHQHHQGMNPAMYHHHSHDF  501



>gb|KEH41446.1| BTB/POZ ankyrin repeat protein [Medicago truncatula]
Length=492

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/485 (75%), Positives = 398/485 (82%), Gaps = 23/485 (5%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTF VEGRLVHAHRCILAARSLFFRKFFCGPD P         GL   G G+
Sbjct  19    INGQAFSDVTFQVEGRLVHAHRCILAARSLFFRKFFCGPDPPS--------GLDPIGGGS  70

Query  339   aSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAV  518
             +      P VIPVNSVGYEVFLL++QFLYSGQVSIVPQKHEPRPNC ERGCWHTHCTSAV
Sbjct  71    SRQPTVRPGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAV  130

Query  519   DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
             DLALDTL+AAR FGVEQLALLTQKQL SMVEKASI+DVM+VLIAS KQEM QLWTTCSHL
Sbjct  131   DLALDTLAAARYFGVEQLALLTQKQLVSMVEKASIDDVMKVLIASRKQEMPQLWTTCSHL  190

Query  699   VAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaa--dlEDQKI  872
             VAKSGLPPE+LAKHL IDVVAKIEELR KSSLAR SL+  HHH H        DLEDQKI
Sbjct  191   VAKSGLPPEILAKHLSIDVVAKIEELRLKSSLARRSLMPLHHHHHHHHHHDFGDLEDQKI  250

Query  873   RRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAG  1052
             RRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAG
Sbjct  251   RRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAG  310

Query  1053  AAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLA  1232
              AG+T LH+AAEMVSP+MV+VLLDHHADP VRT DG+TPLDILRTLTSDFLFKGA+PGL 
Sbjct  311   PAGKTSLHVAAEMVSPEMVAVLLDHHADPTVRTVDGVTPLDILRTLTSDFLFKGAVPGLN  370

Query  1233  HIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaV------IYPAALAMSEEH-HHR  1391
             HIEPNKLRLCLELVQSAA+V+SREE NA+ NNN+++        +YP    MSE+H    
Sbjct  371   HIEPNKLRLCLELVQSAALVLSREENNASNNNNNNNNASSSAAPVYP---PMSEDHSSSS  427

Query  1392  NIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGH-HNQ--REAMTTRQNSGDPPSMYH  1562
             +  ++  + +I NLNLDSRLVYLNLGA +  G   + HN   REAM  +   G  PSMYH
Sbjct  428   SGNNNNNNNSIGNLNLDSRLVYLNLGATQMGGDDDNRHNNSHREAMNRQGGHGCDPSMYH  487

Query  1563  HSHEY  1577
             HSH++
Sbjct  488   HSHDF  492



>ref|XP_009627132.1| PREDICTED: regulatory protein NPR5-like isoform X2 [Nicotiana 
tomentosiformis]
Length=487

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/499 (74%), Positives = 412/499 (83%), Gaps = 22/499 (4%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T EDSLR+LS DYLNLLINGQAFSDVTFSVEGRLVHAH+CILAARSLFFRKFFCGP+SPG
Sbjct  2     TPEDSLRTLSSDYLNLLINGQAFSDVTFSVEGRLVHAHKCILAARSLFFRKFFCGPESPG  61

Query  288   ----sdspgsRMGLVgagagaaSPRG-SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQ  452
                         GL        SPRG S  QVIPVN+VGYEVFLLM+QFLYSGQVSIVPQ
Sbjct  62    GGCGPRISPFSGGLTS------SPRGTSGSQVIPVNTVGYEVFLLMLQFLYSGQVSIVPQ  115

Query  453   KHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDV  632
             KHEPRPNC ER CWHTHCTSAVDLALDTL+AARSFGVEQLALLTQKQL SMVEKASIEDV
Sbjct  116   KHEPRPNCGERSCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQLTSMVEKASIEDV  175

Query  633   MRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssll  812
             M+VLIAS KQ+M QLWT+CSHLVAKSGLPPE+L KHLPIDVVAKIE+LR KSS++R+  L
Sbjct  176   MKVLIASRKQDMHQLWTSCSHLVAKSGLPPEILVKHLPIDVVAKIEDLRLKSSISRTRSL  235

Query  813   ahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCS  992
               HHH H++ +  +LED KIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVENCS
Sbjct  236   IPHHHHHEIPSTIELEDHKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVENCS  295

Query  993   REVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPL  1172
             REVVKALLELGAADVNY AG  G++ LH+AAEMVSPDMV+VLLDHHADPNV+T DGITPL
Sbjct  296   REVVKALLELGAADVNYQAGPNGKSSLHLAAEMVSPDMVAVLLDHHADPNVQTMDGITPL  355

Query  1173  DILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIY  1352
             DILRTLTSDFLFKGAIPGL HIEPNKLRLCLELVQSAAMVISREEG A  N +S +  IY
Sbjct  356   DILRTLTSDFLFKGAIPGLTHIEPNKLRLCLELVQSAAMVISREEGEANNNPSSDN--IY  413

Query  1353  PAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQ--REAMTT  1526
             P  +   E+H   +  +S G+ N+ NLN+DSR+VYLNLGA  +       N+  +   ++
Sbjct  414   PPHV--REDH---SSSTSSGNNNLGNLNVDSRMVYLNLGAAPHHQMACKMNEGDQHDCSS  468

Query  1527  RQNSGDPPSMY--HHSHEY  1577
               N+ +P SMY  HHSHEY
Sbjct  469   SHNTQNPASMYHHHHSHEY  487



>gb|AET34786.1| BTB/POZ ankyrin repeat protein [Medicago truncatula]
 gb|AET34788.1| BTB/POZ ankyrin repeat protein [Medicago truncatula]
Length=483

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/513 (73%), Positives = 406/513 (79%), Gaps = 54/513 (11%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             ++EDSLRSLSLDYLNLLINGQAFSDV FSVEGRLVHAHRCILAARSLFFRKFFCGPD P 
Sbjct  2     SLEDSLRSLSLDYLNLLINGQAFSDVVFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPS  61

Query  288   sdspgsRMGLVgagagaaSPRGSIPQ-VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEP  464
                       +       +P GS    VIPVNSVGYEVFLLM+QFLYSGQVSIVPQKHEP
Sbjct  62    G---------LDPSGNRVNPSGSARSGVIPVNSVGYEVFLLMLQFLYSGQVSIVPQKHEP  112

Query  465   RPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVL  644
             RPNC +RGCWHTHCTSAVDLALDTL+AAR FGVEQLALLTQKQLASMVEKASIEDVM+VL
Sbjct  113   RPNCGDRGCWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLASMVEKASIEDVMKVL  172

Query  645   IASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhh  824
             +AS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPID++AKIEELR K+SL+R SL+ HHH
Sbjct  173   LASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDIIAKIEELRIKTSLSRRSLMPHHH  232

Query  825   hrhdl---gaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSR  995
             H H      AAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALAL YAVENCSR
Sbjct  233   HPHHHDHLTAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALPYAVENCSR  292

Query  996   EVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLD  1175
             EVVKALLELGAADVN+PAG  G+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPLD
Sbjct  293   EVVKALLELGAADVNFPAGPTGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLD  352

Query  1176  ILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEG-------naaannns  1334
             ILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA+V+SREEG       N      S
Sbjct  353   ILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVMSREEGNNNNSNNNNNNATAS  412

Query  1335  ssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQRE  1514
             S+  +YP    M+E+H H        S N  N N+DSRLVYLNLGA             +
Sbjct  413   SATNMYPHH-NMNEDHRH--------SHN--NNNMDSRLVYLNLGA-----------NTQ  450

Query  1515  AMTTRQNSGDPP---------SMYH---HSHEY  1577
               T+R +SGD           SMYH   H H+Y
Sbjct  451   MSTSRMDSGDDDNTHREAINNSMYHHHSHGHDY  483



>ref|XP_006351282.1| PREDICTED: regulatory protein NPR5-like [Solanum tuberosum]
Length=487

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/504 (73%), Positives = 399/504 (79%), Gaps = 41/504 (8%)
 Frame = +3

Query  105   STVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdsp  284
             ST+EDSL++LSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSL FRKFFCGP+SP
Sbjct  3     STLEDSLKTLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLVFRKFFCGPESP  62

Query  285   gsdspgsRMGLVgagagaaSPRGSIPQ----VIPVNSVGYEVFLLMMQFLYSGQVSIVPQ  452
             G        G     AG  SPR S       VIPVNSVGYEVFLLM+QFLYSGQVSIVPQ
Sbjct  63    G--------GGSDPSAGFGSPRTSTTSSSQVVIPVNSVGYEVFLLMLQFLYSGQVSIVPQ  114

Query  453   KHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDV  632
             KHEPRPNC ER CWHTHCTSAVDLALD LSAARSFGVEQLALLTQKQL  MVEK SIEDV
Sbjct  115   KHEPRPNCGERSCWHTHCTSAVDLALDILSAARSFGVEQLALLTQKQLTGMVEKTSIEDV  174

Query  633   MRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssll  812
             M+VLIAS KQ+M QLWTTCSHLVAKSGLPPE+LAKHLPIDVVAKIEE+R K+SLAR SL+
Sbjct  175   MKVLIASRKQDMPQLWTTCSHLVAKSGLPPEILAKHLPIDVVAKIEEIRLKTSLARRSLI  234

Query  813   ahhhhrhdlgaaadl-EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENC  989
             +HHHH     + A   EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE++ALHYAVENC
Sbjct  235   SHHHHHQHDLSTASELEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESIALHYAVENC  294

Query  990   SREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITP  1169
             SREVVK LLELGAA+VN+PAG AG+TPLHIA+EMVSPDMV+VLLDHHADPNVRT DGITP
Sbjct  295   SREVVKTLLELGAANVNHPAGPAGKTPLHIASEMVSPDMVAVLLDHHADPNVRTMDGITP  354

Query  1170  LDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVI  1349
             LDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREE N            
Sbjct  355   LDILRTLTSDFLFKGAVPGLNHIEPNKLRLCLELVQSAAMVISREEENTNN---------  405

Query  1350  YPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGA--------------VENSG  1487
              P++ A+ +  ++ +  SS  +    NLNLDSR+VYLNLGA               E+  
Sbjct  406   VPSSTAIFQPINNEDHGSSATNVGSNNLNLDSRMVYLNLGAGTSISQQMGCNRMTNEDDH  465

Query  1488  GGGHHNQREAMTTRQNSGDPPSMY  1559
                H+ Q      R +  DP SMY
Sbjct  466   ANSHNKQ-----NRHSGFDPSSMY  484



>gb|AAO22795.1| unknown protein [Arabidopsis thaliana]
Length=491

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/497 (75%), Positives = 409/497 (82%), Gaps = 25/497 (5%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS +E+SLRSLSLD+LNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG DS
Sbjct  1     MSNLEESLRSLSLDFLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGTDS  60

Query  282   pgsdspgsRMGLVgagagaaSP-RGSIPQ--VIPVNSVGYEVFLLMMQFLYSGQVSIVPQ  452
             P   +    +     G+  ASP RGS     +IPVNSVGYEVFLL++QFLYSGQVSIVPQ
Sbjct  61    PQPVTG---IDPTQHGSVPASPTRGSTAPAGIIPVNSVGYEVFLLLLQFLYSGQVSIVPQ  117

Query  453   KHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDV  632
             KHEPRPNC ERGCWHTHC++AVDLALDTL+A+R FGVEQLALLTQKQLASMVEKASIEDV
Sbjct  118   KHEPRPNCGERGCWHTHCSAAVDLALDTLAASRYFGVEQLALLTQKQLASMVEKASIEDV  177

Query  633   MRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssll  812
             M+VLIAS KQ+M QLWTTCSHLVAKSGLPPE+LAKHLPIDVV KIEELR KSS+AR SL+
Sbjct  178   MKVLIASRKQDMHQLWTTCSHLVAKSGLPPEILAKHLPIDVVTKIEELRLKSSIARRSLM  237

Query  813   ahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCS  992
              H+HH     A    EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVE+CS
Sbjct  238   PHNHHHDLSVAQDL-EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVESCS  296

Query  993   REVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPL  1172
             REVVKALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT  GITPL
Sbjct  297   REVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVGGITPL  356

Query  1173  DILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaV-I  1349
             DILRTLTSDFLFKGA+PGL HIEPNKLRL LELVQSAAMVISREEGN + N N+ +   I
Sbjct  357   DILRTLTSDFLFKGAVPGLTHIEPNKLRLRLELVQSAAMVISREEGNNSNNQNNDNNTGI  416

Query  1350  YPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGG------HHNQR  1511
             YP    M+EEH       + GS    N NLDSRLVYLNLGA     G G      H++QR
Sbjct  417   YP---HMNEEH-------NSGSSGGSNNNLDSRLVYLNLGAGTGQMGPGRDQGDDHNSQR  466

Query  1512  EAMTT-RQNSGDPPSMY  1559
             E M+    +  DP +MY
Sbjct  467   EGMSRHHHHHQDPSTMY  483



>ref|XP_006491570.1| PREDICTED: regulatory protein NPR5-like isoform X2 [Citrus sinensis]
Length=448

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/477 (74%), Positives = 375/477 (79%), Gaps = 51/477 (11%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD P    P +   +     G 
Sbjct  19    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPSGLDPATASRI---NQGP  75

Query  339   aSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAV  518
              SP      VIPVNSVGYEVFLL++QFLYSGQVSIVPQKHEPRPNC ERGCWHTHCTSAV
Sbjct  76    PSPASRPTGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAV  135

Query  519   DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
             DLALDTL+AAR FGVEQLALLTQKQLA+MVEKASIEDVM+VLIAS KQ+M QLWTTCSHL
Sbjct  136   DLALDTLAAARYFGVEQLALLTQKQLANMVEKASIEDVMKVLIASRKQDMHQLWTTCSHL  195

Query  699   VAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrh----dlgaaadlEDQ  866
             VAKSGLPPEVLAKHLPI+VVAKIE+LRHKSSLAR SL++HHHH H        AADLEDQ
Sbjct  196   VAKSGLPPEVLAKHLPIEVVAKIEDLRHKSSLARRSLISHHHHHHHHDLSAATAADLEDQ  255

Query  867   KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYP  1046
             KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYP
Sbjct  256   KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYP  315

Query  1047  AGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPG  1226
             AG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPLDILRTLTSDFLFKGA+PG
Sbjct  316   AGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPG  375

Query  1227  LAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAALAMSEEHHHRNIPSS  1406
             L HIEPNKLRLCLELVQSAA+V+SREEGN                   S  HHH  + SS
Sbjct  376   LTHIEPNKLRLCLELVQSAALVLSREEGN-------------------SAHHHHHQMGSS  416

Query  1407  GGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTRQNSGDPPSMYHHSHEY  1577
                G+                         H +QREA+    N  DP   +HHS E+
Sbjct  417   RMDGD---------------------DDSSHQSQREAV----NRHDPSIYHHHSQEF  448



>ref|XP_006351262.1| PREDICTED: regulatory protein NPR5-like [Solanum tuberosum]
Length=490

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/505 (73%), Positives = 410/505 (81%), Gaps = 31/505 (6%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T EDSLR+LSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGP+S  
Sbjct  2     TPEDSLRTLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPESSS  61

Query  288   sdspgsRMG-LVgagagaaSPRG--SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKH  458
                P  R+G        A+SPRG  S  QVIPVN+VGYEVFLLM+QFLYSGQVSIVPQKH
Sbjct  62    VSGP--RLGPFGAGAGLASSPRGTTSCSQVIPVNTVGYEVFLLMLQFLYSGQVSIVPQKH  119

Query  459   EPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMR  638
             EPRPNC ER CWHTHCT+AVDLALDTL+AARSFGVEQLALLTQK L SMVEKASIEDVM+
Sbjct  120   EPRPNCGERSCWHTHCTAAVDLALDTLTAARSFGVEQLALLTQKHLISMVEKASIEDVMK  179

Query  639   VLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssll-a  815
             VLIAS KQ+M QLWTTCSHL+AKSGLPPE+L KHLPIDVVAKIE+LR KSS++R SL+  
Sbjct  180   VLIASRKQDMHQLWTTCSHLIAKSGLPPEILTKHLPIDVVAKIEDLRLKSSISRRSLIPH  239

Query  816   hhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSR  995
             HHHH H + +  +LEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVENCSR
Sbjct  240   HHHHHHQMSSNIELEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVENCSR  299

Query  996   EVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLD  1175
             EVVKALLELGAA+VNY AG + ++PLH+AAEMVSPDMV+VLLDHHADPN++T DGITPLD
Sbjct  300   EVVKALLELGAAEVNYQAGPSCKSPLHLAAEMVSPDMVAVLLDHHADPNIQTVDGITPLD  359

Query  1176  ILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYP  1355
             ILRTLTSDFLFKGAIPGL HIEPNKLRLCLELVQSAAMVISREEG A  N +S +   + 
Sbjct  360   ILRTLTSDFLFKGAIPGLTHIEPNKLRLCLELVQSAAMVISREEGEANNNQSSENMYTH-  418

Query  1356  AALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTRQ-  1532
                 + E+H      SS  S    NLNLDSR+VYLNLGA   +    HH     M   + 
Sbjct  419   ----VREDH------SSSTSSGNNNLNLDSRMVYLNLGA---NVATTHHQMACKMNNNEG  465

Query  1533  --------NSGDPPSMY--HHSHEY  1577
                     N+ +P +MY  HHSHEY
Sbjct  466   DHDCSRSHNNQNPSTMYHHHHSHEY  490



>ref|XP_009141987.1| PREDICTED: regulatory protein NPR5-like [Brassica rapa]
Length=487

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/500 (73%), Positives = 404/500 (81%), Gaps = 24/500 (5%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS++E+SLRS+SLD+LNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG D 
Sbjct  1     MSSLEESLRSMSLDFLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGTDQ  60

Query  282   pgsdspgsRMGLVgagagaaS--PRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQK  455
             P S    +R G V A     S  P G    VIP NSVGYEVFLL++QFLYSGQVSIVPQK
Sbjct  61    PQSCIDPTRHGSVPASPTRGSQAPAG----VIPANSVGYEVFLLLLQFLYSGQVSIVPQK  116

Query  456   HEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVM  635
             HEPRPNC ERGCWHTHC++AVDLALDTL+A+R FGVEQLALLTQKQLASMVEKASIEDVM
Sbjct  117   HEPRPNCGERGCWHTHCSAAVDLALDTLAASRYFGVEQLALLTQKQLASMVEKASIEDVM  176

Query  636   RVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarsslla  815
             +VLIAS KQ+MQQLW+TCSHLVAKSGLPPE+LAKHL IDVVAKIEE+R K+S++R SL+ 
Sbjct  177   KVLIASRKQDMQQLWSTCSHLVAKSGLPPEILAKHLTIDVVAKIEEIRLKTSISRRSLMP  236

Query  816   hhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSR  995
             H+HH     A    EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVE+CSR
Sbjct  237   HNHHHDLTVAQDL-EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVESCSR  295

Query  996   EVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLD  1175
             EVVK LLELGAADVN P   AG+TPLHIAAEMVSPDMV+V LDHHADPNVRT  GITPLD
Sbjct  296   EVVKVLLELGAADVNSPVCPAGKTPLHIAAEMVSPDMVAVFLDHHADPNVRTVGGITPLD  355

Query  1176  ILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYP  1355
             ILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREEG    +NN+++    P
Sbjct  356   ILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEG--NNSNNNNNDYNNP  413

Query  1356  AALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGG------HHNQREA  1517
             +   M+EEH       + GS    N NLDSRLVYLNLGA     G G       ++QRE 
Sbjct  414   SYPQMNEEH-------NSGSSGGSNNNLDSRLVYLNLGAGTGQMGQGRDHGDDQNSQREG  466

Query  1518  MT--TRQNSGDPPSMYHHSH  1571
             M+     +  DP +MYH  H
Sbjct  467   MSRHNHHHHHDPSTMYHQHH  486



>ref|XP_009627133.1| PREDICTED: regulatory protein NPR5-like isoform X3 [Nicotiana 
tomentosiformis]
Length=478

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/498 (75%), Positives = 412/498 (83%), Gaps = 29/498 (6%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T EDSLR+LS DYLNLLINGQAFSDVTFSVEGRLVHAH+CILAARSLFFRKFFCGP+SPG
Sbjct  2     TPEDSLRTLSSDYLNLLINGQAFSDVTFSVEGRLVHAHKCILAARSLFFRKFFCGPESPG  61

Query  288   ----sdspgsRMGLVgagagaaSPRG-SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQ  452
                         GL        SPRG S  QVIPVN+VGYEVFLLM+QFLYSGQVSIVPQ
Sbjct  62    GGCGPRISPFSGGLTS------SPRGTSGSQVIPVNTVGYEVFLLMLQFLYSGQVSIVPQ  115

Query  453   KHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQ-KQLASMVEKASIED  629
             KHEPRPNC ER CWHTHCTSAVDLALDTL+AARSFGVEQLALLTQ KQL SMVEKASIED
Sbjct  116   KHEPRPNCGERSCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQQKQLTSMVEKASIED  175

Query  630   VMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssl  809
             VM+VLIAS KQ+M QLWT+CSHLVAKSGLPPE+L KHLPIDVVAKIE+LR KSS++R+  
Sbjct  176   VMKVLIASRKQDMHQLWTSCSHLVAKSGLPPEILVKHLPIDVVAKIEDLRLKSSISRTRS  235

Query  810   lahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENC  989
             L  HHH H++ +  +LED KIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVENC
Sbjct  236   LIPHHHHHEIPSTIELEDHKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVENC  295

Query  990   SREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITP  1169
             SREVVKALLELGAADVNY AG  G++ LH+AAEMVSPDMV+VLLDHHADPNV+T DGITP
Sbjct  296   SREVVKALLELGAADVNYQAGPNGKSSLHLAAEMVSPDMVAVLLDHHADPNVQTMDGITP  355

Query  1170  LDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVI  1349
             LDILRTLTSDFLFKGAIPGL HIEPNKLRLCLELVQSAAMVISREEG A  N +S +  I
Sbjct  356   LDILRTLTSDFLFKGAIPGLTHIEPNKLRLCLELVQSAAMVISREEGEANNNPSSDN--I  413

Query  1350  YPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTR  1529
             YP  +   E+H   +  +S G+ N+ NLN+DSR+VYLNLGA         H+Q +  ++ 
Sbjct  414   YPPHV--REDH---SSSTSSGNNNLGNLNVDSRMVYLNLGAAP-------HHQHDC-SSS  460

Query  1530  QNSGDPPSMY--HHSHEY  1577
              N+ +P SMY  HHSHEY
Sbjct  461   HNTQNPASMYHHHHSHEY  478



>ref|XP_002876399.1| hypothetical protein ARALYDRAFT_324222 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52658.1| hypothetical protein ARALYDRAFT_324222 [Arabidopsis lyrata subsp. 
lyrata]
Length=468

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/486 (72%), Positives = 387/486 (80%), Gaps = 29/486 (6%)
 Frame = +3

Query  105   STVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdsp  284
             ST E+SL+S+SLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC  D  
Sbjct  3     STFEESLKSMSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCESDPS  62

Query  285   gsdspgsRMGLVgagagaaSPRGS-IPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHE  461
                    + G   A    +  R + +  VIPVNSVGYEVFLL++QFLYSGQVSIVP KHE
Sbjct  63    -------QTGAEQANQTGSGARAAAVGGVIPVNSVGYEVFLLLLQFLYSGQVSIVPHKHE  115

Query  462   PRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRV  641
             PR NC +RGCWHTHCT+AVDL+LD L+AAR FGVEQLALLTQK L SMVEKAS+EDVM+V
Sbjct  116   PRSNCGDRGCWHTHCTAAVDLSLDILAAARYFGVEQLALLTQKHLTSMVEKASVEDVMKV  175

Query  642   LIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahh  821
             LIAS KQ+M QLWTTCS+L+AKSGLP E+LAKHLPI++VAK+EELR KSS+   SL+ HH
Sbjct  176   LIASRKQDMHQLWTTCSYLIAKSGLPQEILAKHLPIELVAKVEELRLKSSMPLRSLMPHH  235

Query  822   hhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREV  1001
             H           EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LAL YAVENCSREV
Sbjct  236   HDLTSSLDL---EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALIYAVENCSREV  292

Query  1002  VKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDIL  1181
             VKALLELGAADVNYPAG  G+T LHIAAEMVSPDMV+VLLDHHADPNV+T DGITPLDIL
Sbjct  293   VKALLELGAADVNYPAGPTGKTALHIAAEMVSPDMVAVLLDHHADPNVQTVDGITPLDIL  352

Query  1182  RTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAA  1361
             RTLTSDFLFKGAIPGL HIEPNKLRLCLELVQSAA+VISREEG     +N ++A+IYP  
Sbjct  353   RTLTSDFLFKGAIPGLTHIEPNKLRLCLELVQSAALVISREEG--NNTSNDNNAMIYP--  408

Query  1362  LAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTRQNSG  1541
               M +EH      +SG S       LDSRLVYLNLGA     G  + NQRE M    +  
Sbjct  409   -RMKDEH------TSGSS-------LDSRLVYLNLGATNRDLGDENSNQREGMNLHHHHH  454

Query  1542  DPPSMY  1559
             DP +MY
Sbjct  455   DPSTMY  460



>ref|XP_009627131.1| PREDICTED: regulatory protein NPR5-like isoform X1 [Nicotiana 
tomentosiformis]
Length=488

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/500 (74%), Positives = 412/500 (82%), Gaps = 23/500 (5%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T EDSLR+LS DYLNLLINGQAFSDVTFSVEGRLVHAH+CILAARSLFFRKFFCGP+SPG
Sbjct  2     TPEDSLRTLSSDYLNLLINGQAFSDVTFSVEGRLVHAHKCILAARSLFFRKFFCGPESPG  61

Query  288   ----sdspgsRMGLVgagagaaSPRG-SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQ  452
                         GL        SPRG S  QVIPVN+VGYEVFLLM+QFLYSGQVSIVPQ
Sbjct  62    GGCGPRISPFSGGLTS------SPRGTSGSQVIPVNTVGYEVFLLMLQFLYSGQVSIVPQ  115

Query  453   KHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQ-KQLASMVEKASIED  629
             KHEPRPNC ER CWHTHCTSAVDLALDTL+AARSFGVEQLALLTQ KQL SMVEKASIED
Sbjct  116   KHEPRPNCGERSCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQQKQLTSMVEKASIED  175

Query  630   VMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssl  809
             VM+VLIAS KQ+M QLWT+CSHLVAKSGLPPE+L KHLPIDVVAKIE+LR KSS++R+  
Sbjct  176   VMKVLIASRKQDMHQLWTSCSHLVAKSGLPPEILVKHLPIDVVAKIEDLRLKSSISRTRS  235

Query  810   lahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENC  989
             L  HHH H++ +  +LED KIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVENC
Sbjct  236   LIPHHHHHEIPSTIELEDHKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVENC  295

Query  990   SREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITP  1169
             SREVVKALLELGAADVNY AG  G++ LH+AAEMVSPDMV+VLLDHHADPNV+T DGITP
Sbjct  296   SREVVKALLELGAADVNYQAGPNGKSSLHLAAEMVSPDMVAVLLDHHADPNVQTMDGITP  355

Query  1170  LDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVI  1349
             LDILRTLTSDFLFKGAIPGL HIEPNKLRLCLELVQSAAMVISREEG A  N +S +  I
Sbjct  356   LDILRTLTSDFLFKGAIPGLTHIEPNKLRLCLELVQSAAMVISREEGEANNNPSSDN--I  413

Query  1350  YPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQ--REAMT  1523
             YP  +   E+H   +  +S G+ N+ NLN+DSR+VYLNLGA  +       N+  +   +
Sbjct  414   YPPHV--REDH---SSSTSSGNNNLGNLNVDSRMVYLNLGAAPHHQMACKMNEGDQHDCS  468

Query  1524  TRQNSGDPPSMY--HHSHEY  1577
             +  N+ +P SMY  HHSHEY
Sbjct  469   SSHNTQNPASMYHHHHSHEY  488



>ref|XP_003521136.1| PREDICTED: regulatory protein NPR5-like [Glycine max]
Length=487

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/490 (76%), Positives = 398/490 (81%), Gaps = 40/490 (8%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD+P         GL       
Sbjct  19    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDAP--------CGL-----DP  65

Query  339   aSPRG---SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCT  509
             A PRG   S   VIPVNSVGYEVFLLM+QFLYSGQVSIVPQKHE RPNC ERGCWHTHCT
Sbjct  66    AGPRGVNSSRSGVIPVNSVGYEVFLLMLQFLYSGQVSIVPQKHEARPNCGERGCWHTHCT  125

Query  510   SAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTC  689
             SAVDLALDTL+AAR FGVE LALLTQKQLASMVEKASIEDVM+VL+AS KQ+MQQLW TC
Sbjct  126   SAVDLALDTLAAARYFGVEPLALLTQKQLASMVEKASIEDVMKVLLASRKQDMQQLWATC  185

Query  690   SHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadl----  857
             SHLVAKSGLPPEVLAKHLPID+VAKIEELR KSSLAR SL+  HHH H            
Sbjct  186   SHLVAKSGLPPEVLAKHLPIDIVAKIEELRLKSSLARRSLVPSHHHHHHHPHHHAAAALD  245

Query  858   -EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAAD  1034
              EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALAL YAVENCSREVVKALLELGAAD
Sbjct  246   LEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALPYAVENCSREVVKALLELGAAD  305

Query  1035  VNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKG  1214
             VNYP+G AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPLDILRTLTSDFLFKG
Sbjct  306   VNYPSGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKG  365

Query  1215  AIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaan------nnsssaVIYPAALAMSE  1376
             A+PGL HIEPNKLRLCLELVQSAA+V+SREEGN A N      ++SS+A IYP    M+E
Sbjct  366   AVPGLTHIEPNKLRLCLELVQSAALVMSREEGNNANNNNNGPHSSSSAAPIYPP--PMNE  423

Query  1377  EH-HHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVE--NSGGGGHHNQREAMTTRQNSGDP  1547
             +H ++ N  SS G+ NI NLNLDSRLVYLNLGA    +S      ++REAM   QN    
Sbjct  424   DHNNNNNSSSSSGNNNIGNLNLDSRLVYLNLGATASMSSRLDNAEDEREAMN--QN----  477

Query  1548  PSMYHHSHEY  1577
               MYHH H +
Sbjct  478   --MYHHHHSH  485



>ref|XP_010056313.1| PREDICTED: regulatory protein NPR5 [Eucalyptus grandis]
 gb|KCW90074.1| hypothetical protein EUGRSUZ_A02268 [Eucalyptus grandis]
Length=488

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/500 (74%), Positives = 404/500 (81%), Gaps = 32/500 (6%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             ++EDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG +SPG
Sbjct  2     SIEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGSESPG  61

Query  288   sdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPR  467
               S              +  R +   VIPV+SVGYEVFLL++QFLYSGQVSIVPQKHEPR
Sbjct  62    GPSSDPSS--------GSGSRAARAAVIPVSSVGYEVFLLLLQFLYSGQVSIVPQKHEPR  113

Query  468   PNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLI  647
             P+C ERGCWHTHCTSAVDLALDTL+AARSFGVEQLALLTQKQLASMV+KASIEDVM+VLI
Sbjct  114   PDCGERGCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQLASMVQKASIEDVMKVLI  173

Query  648   ASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhh  827
             AS K EMQ LWTTCSHLVAKSGLPPEVLAKHLPIDVV KIEELR KSSLAR SL+ H H 
Sbjct  174   ASRKHEMQPLWTTCSHLVAKSGLPPEVLAKHLPIDVVTKIEELRLKSSLARQSLMPHPHA  233

Query  828   rh------dlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENC  989
              H         A ADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLD+ALALHYAVENC
Sbjct  234   HHPGHHDLVAAAGADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDDALALHYAVENC  293

Query  990   SREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITP  1169
             SREVVKALLELGAA+VN PAG AG+TPLH+AAEMVSPDMV+VLLDHHADPNVRT DG+TP
Sbjct  294   SREVVKALLELGAANVNCPAGPAGKTPLHVAAEMVSPDMVAVLLDHHADPNVRTVDGVTP  353

Query  1170  LDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVI  1349
             LD+LR LTSDFLFKGA+PGLAHIEPNKLRLCLELVQSAA+VISREEGNA A+++S++++ 
Sbjct  354   LDVLRALTSDFLFKGAVPGLAHIEPNKLRLCLELVQSAALVISREEGNANASSHSNNSIY  413

Query  1350  YPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTR  1529
              P               S    GN+ N+N+DSR+VYLNLGA +   G G     EA T R
Sbjct  414   NPPMSEGHS--------SGSSGGNMSNVNVDSRMVYLNLGAAQM--GSGVDCGEEAETGR  463

Query  1530  QNSG--------DPPSMYHH  1565
                         DP S+YHH
Sbjct  464   HRQRQRTQQVGCDPSSLYHH  483



>ref|XP_003625012.1| BOP/NPR1/NIM1-like regulatory protein [Medicago truncatula]
 gb|ABD28327.1| BTB/POZ [Medicago truncatula]
 gb|AES81230.1| BTB/POZ ankyrin repeat protein [Medicago truncatula]
 gb|AET34787.1| BTB/POZ ankyrin repeat protein [Medicago truncatula]
 gb|AET34789.1| BTB/POZ ankyrin repeat protein [Medicago truncatula]
Length=482

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/512 (73%), Positives = 403/512 (79%), Gaps = 53/512 (10%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             ++EDSLRSLSLDYLNLLINGQAFSDV FSVEGRLVHAHRCILAARSLFFRKFFCGPD P 
Sbjct  2     SLEDSLRSLSLDYLNLLINGQAFSDVVFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPS  61

Query  288   sdspgsRMGLVgagagaaSPRGSIPQ-VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEP  464
                       +       +P GS    VIPVNSVGYEVFLLM+QFLYSGQVSIVPQKHEP
Sbjct  62    G---------LDPSGNRVNPSGSARSGVIPVNSVGYEVFLLMLQFLYSGQVSIVPQKHEP  112

Query  465   RPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVL  644
             RPNC +RGCWHTHCTSAVDLALDTL+AAR FGVEQLALLTQKQLASMVEKASIEDVM+VL
Sbjct  113   RPNCGDRGCWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLASMVEKASIEDVMKVL  172

Query  645   IASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhh  824
             +AS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPID++AKIEELR K+SL+R SL+ HHH
Sbjct  173   LASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDIIAKIEELRIKTSLSRRSLMPHHH  232

Query  825   hrhdl---gaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSR  995
             H H      AAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALAL YAVENCSR
Sbjct  233   HPHHHDHLTAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALPYAVENCSR  292

Query  996   EVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLD  1175
             EVVKALLELGAADVN+PAG  G+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPLD
Sbjct  293   EVVKALLELGAADVNFPAGPTGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLD  352

Query  1176  ILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEG------naaannnss  1337
             ILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA+V+SREEG      N      SS
Sbjct  353   ILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVMSREEGNNNNSNNNNNATASS  412

Query  1338  saVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREA  1517
             +  +YP        HH+ N        +  N N+DSRLVYLNLGA             + 
Sbjct  413   ATNMYP--------HHNMN---EDHHHSHNNNNMDSRLVYLNLGA-----------NTQM  450

Query  1518  MTTRQNSGDPP---------SMYH---HSHEY  1577
              T+R +SGD           SMYH   H H+Y
Sbjct  451   STSRMDSGDDDNTHREAINNSMYHHHSHGHDY  482



>emb|CDY23854.1| BnaC04g01830D [Brassica napus]
Length=481

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/498 (74%), Positives = 405/498 (81%), Gaps = 26/498 (5%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS++E+SLRSLSLDYLNLLINGQAFSDVTFSV+GRLVHAHRCILAARSLFFRKFFCG DS
Sbjct  1     MSSLEESLRSLSLDYLNLLINGQAFSDVTFSVDGRLVHAHRCILAARSLFFRKFFCGTDS  60

Query  282   pg--sdspgsRMGLVgagagaaSPRGSIPQ--VIPVNSVGYEVFLLMMQFLYSGQVSIVP  449
             P   +    +R G V       S RGS     VIPVNSVGYEVFLL++QFLYSGQVSIVP
Sbjct  61    PQPGTGIDPTRHGSVPVS----STRGSQAPAGVIPVNSVGYEVFLLLLQFLYSGQVSIVP  116

Query  450   QKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIED  629
             QKHEP PNC ERGCWH HC++AVDLALDTL+A+R FGVEQLALLTQKQL SMVEKA+IED
Sbjct  117   QKHEPTPNCGERGCWHIHCSAAVDLALDTLAASRYFGVEQLALLTQKQLVSMVEKAAIED  176

Query  630   VMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssl  809
             VM+VLIAS KQ+M QLWTTCSHLVAKSGLPPE+LAKHL IDVVAKIEE+R K S+AR SL
Sbjct  177   VMKVLIASRKQDMHQLWTTCSHLVAKSGLPPEILAKHLTIDVVAKIEEIRLKYSIARRSL  236

Query  810   lahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENC  989
             + HHHH     A    EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVE+C
Sbjct  237   MPHHHHHDLTAAQDL-EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVESC  295

Query  990   SREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITP  1169
             SREVVKALLELGA+DVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT  GITP
Sbjct  296   SREVVKALLELGASDVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVGGITP  355

Query  1170  LDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVI  1349
             LDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREEG   +NNN  +  I
Sbjct  356   LDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEG-NNSNNNDHNNAI  414

Query  1350  YPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVE----NSGGGGHHNQREA  1517
             YP    M++E        + GS    N NLDSR VYLNLGA +       G  H++QRE 
Sbjct  415   YP---QMNDE-------RNSGSSGGSNNNLDSRFVYLNLGAGQIGPGRDHGDDHNSQREG  464

Query  1518  MTTRQNSGDPPSMYHHSH  1571
             M+   +  DP +MYH  H
Sbjct  465   MSRHHH--DPSTMYHQHH  480



>ref|XP_011033136.1| PREDICTED: regulatory protein NPR5-like isoform X1 [Populus euphratica]
 ref|XP_011013844.1| PREDICTED: regulatory protein NPR5-like [Populus euphratica]
 ref|XP_011013845.1| PREDICTED: regulatory protein NPR5-like [Populus euphratica]
 ref|XP_011016127.1| PREDICTED: regulatory protein NPR5-like [Populus euphratica]
Length=443

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/428 (84%), Positives = 383/428 (89%), Gaps = 15/428 (4%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T+EDSLR+LSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRK+FCGPD P 
Sbjct  2     TLEDSLRTLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKYFCGPDPPS  61

Query  288   sdspg-sRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEP  464
                P  SR+ LVG      SP GS   VIPVNSVGYEVFLL++QFLYSGQVSIVPQKHEP
Sbjct  62    GLDPSGSRINLVG------SP-GSRSNVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEP  114

Query  465   RPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVL  644
             RPNC ERGCWHTHCTSAVDLALDTL+AAR FGVEQLA+LTQKQLASMV+KASIEDVM+VL
Sbjct  115   RPNCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLAMLTQKQLASMVDKASIEDVMKVL  174

Query  645   IASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssll-ahh  821
             IAS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR KSS+AR SL+  HH
Sbjct  175   IASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSIARRSLMPHHH  234

Query  822   hhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREV  1001
             HH HDL AAADLEDQKIR M+RALDSSDVELVKLMVMGEGLNL+EALALHYAVENCSREV
Sbjct  235   HHLHDLTAAADLEDQKIRGMKRALDSSDVELVKLMVMGEGLNLNEALALHYAVENCSREV  294

Query  1002  VKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDIL  1181
             VKALLELGAADVNYPAG AG+TPLHIAAEMVSPDMVSVLLDHHADPNVRT DGITPLDIL
Sbjct  295   VKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVSVLLDHHADPNVRTVDGITPLDIL  354

Query  1182  RTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAA  1361
             RTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA V+SREEG+  A  ++    IYP  
Sbjct  355   RTLTSDFLFKGAVPGLVHIEPNKLRLCLELVQSAASVLSREEGSVNATTSNP---IYP--  409

Query  1362  LAMSEEHH  1385
               MS+EH+
Sbjct  410   -PMSDEHN  416



>ref|XP_010427578.1| PREDICTED: regulatory protein NPR6 [Camelina sativa]
 ref|XP_010427579.1| PREDICTED: regulatory protein NPR6 [Camelina sativa]
Length=468

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/486 (71%), Positives = 388/486 (80%), Gaps = 29/486 (6%)
 Frame = +3

Query  105   STVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdsp  284
             ST E+SL+S+SLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC  D+ 
Sbjct  3     STFEESLKSMSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCESDAS  62

Query  285   gsdspgsRMGLVgagagaaSPRGS-IPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHE  461
                    + G   A    +  R + +  VIPVNSVGYEVFLL++QFLYSGQVSIVP KHE
Sbjct  63    -------QTGAEPANQTGSGARAAAVGGVIPVNSVGYEVFLLLLQFLYSGQVSIVPHKHE  115

Query  462   PRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRV  641
             PR NC +RGCWHTHCT+AVDL+LD L+AAR FGVEQLALLTQK L SMVEKAS+EDVM+V
Sbjct  116   PRSNCGDRGCWHTHCTAAVDLSLDILAAARYFGVEQLALLTQKHLTSMVEKASVEDVMKV  175

Query  642   LIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahh  821
             LIAS KQ+M QLWTTCS+L+AKSGLP E+LAKHLP+++VAK+EELR KSS+   SL+ HH
Sbjct  176   LIASRKQDMHQLWTTCSYLIAKSGLPQEILAKHLPVELVAKVEELRLKSSMPLRSLMPHH  235

Query  822   hhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREV  1001
             H           ED KIRRMRRALDSSDVELVKLMVMGEGLNLDE+LAL YAVENCSREV
Sbjct  236   HDLTSAIDL---EDHKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALIYAVENCSREV  292

Query  1002  VKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDIL  1181
             VKALLELGAADVNYP G  G+T LHIAAEMVSPDMV+VLLDHHADPNV+T DGITPLDIL
Sbjct  293   VKALLELGAADVNYPTGPTGKTALHIAAEMVSPDMVAVLLDHHADPNVQTVDGITPLDIL  352

Query  1182  RTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAA  1361
             RTLTSDFLFKGAIPGL HIEPNKLRLCLELVQSAA+VISRE+G    N+N +++VIYP  
Sbjct  353   RTLTSDFLFKGAIPGLTHIEPNKLRLCLELVQSAALVISREDG--NNNSNDNNSVIYP--  408

Query  1362  LAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTRQNSG  1541
               M +EH      +SG S       LDSRLVYLNLGA     G  + NQRE M+   N  
Sbjct  409   -RMKDEH------TSGSS-------LDSRLVYLNLGATTRDLGDDNSNQREGMSLHHNHH  454

Query  1542  DPPSMY  1559
             DP +MY
Sbjct  455   DPSTMY  460



>ref|NP_001276282.1| regulatory protein NPR5-like [Glycine max]
 gb|AET34796.1| BTB/POZ ankyrin repeat protein [Glycine max]
 gb|AET34797.1| BTB/POZ ankyrin repeat protein [Glycine max]
Length=488

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/491 (73%), Positives = 390/491 (79%), Gaps = 39/491 (8%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD P         GL       
Sbjct  19    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPS--------GL-----DP  65

Query  339   aSPRGSIPQ----VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHC  506
               PRG        VIPVNSVGYEVFLLM+QFLYSGQVSIVPQKHE RPNC ERGCWHTHC
Sbjct  66    TGPRGVNSSRSGGVIPVNSVGYEVFLLMLQFLYSGQVSIVPQKHEARPNCGERGCWHTHC  125

Query  507   TSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTT  686
             TSAVDLALDTL+AAR FGVEQLALLTQKQLASMVEKASIEDVM+VL+AS KQ+MQQLW T
Sbjct  126   TSAVDLALDTLAAARYFGVEQLALLTQKQLASMVEKASIEDVMKVLLASRKQDMQQLWAT  185

Query  687   CSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadl---  857
             CSHLVAKSGLPPEVLAKHLPID+VAKIEELR KSSLAR SL+  HHH H           
Sbjct  186   CSHLVAKSGLPPEVLAKHLPIDIVAKIEELRLKSSLARRSLVPSHHHHHHHHHHHAAAAL  245

Query  858   --EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAA  1031
               EDQKIRRMRRALDSSDVELVKLM+MGEGLNLDEALAL YAVENCSREVVKALLELGAA
Sbjct  246   DLEDQKIRRMRRALDSSDVELVKLMLMGEGLNLDEALALPYAVENCSREVVKALLELGAA  305

Query  1032  DVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFK  1211
             DVNYP+G AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPLDILRTLTSDFLFK
Sbjct  306   DVNYPSGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFK  365

Query  1212  GAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaV-----IYPAALAMSE  1376
             GA+PGL HIEPNKLRLCLELVQSAA+V+SRE+GN A NNN+++       IYP  +    
Sbjct  366   GAVPGLTHIEPNKLRLCLELVQSAALVMSREDGNNANNNNNNATNNSAAPIYPPPMNEDH  425

Query  1377  EHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVE--NSGGGGHHNQREAMTTRQNSGDPP  1550
              ++  +   +  + NI NLNLDSRLVYLNLGA    +S      ++REAM          
Sbjct  426   NNNSSSSSGNNNNNNIGNLNLDSRLVYLNLGATASMSSRLDNAEDEREAMNQ--------  477

Query  1551  SMY--HHSHEY  1577
             +MY  HHSH+Y
Sbjct  478   TMYHHHHSHDY  488



>ref|NP_191272.1| protein BLADE ON PETIOLE 1 [Arabidopsis thaliana]
 sp|Q9M1I7.1|NPR6_ARATH RecName: Full=Regulatory protein NPR6; AltName: Full=BTB/POZ 
domain-containing protein NPR6; AltName: Full=Protein BLADE-ON-PETIOLE 
1 [Arabidopsis thaliana]
 emb|CAB72183.1| putative protein [Arabidopsis thaliana]
 gb|AAY78777.1| ankyrin repeat family protein [Arabidopsis thaliana]
 gb|ABH04470.1| At3g57130 [Arabidopsis thaliana]
 dbj|BAH30493.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE79617.1| protein BLADE ON PETIOLE 1 [Arabidopsis thaliana]
Length=467

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/468 (72%), Positives = 370/468 (79%), Gaps = 29/468 (6%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC  D         + G   A    
Sbjct  21    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCESDPS-------QPGAEPANQTG  73

Query  339   aSPRGS-IPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSA  515
             +  R + +  VIPVNSVGYEVFLL++QFLYSGQVSIVP KHEPR NC +RGCWHTHCT+A
Sbjct  74    SGARAAAVGGVIPVNSVGYEVFLLLLQFLYSGQVSIVPHKHEPRSNCGDRGCWHTHCTAA  133

Query  516   VDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSH  695
             VDL+LD L+AAR FGVEQLALLTQK L SMVEKASIEDVM+VLIAS KQ+M QLWTTCS+
Sbjct  134   VDLSLDILAAARYFGVEQLALLTQKHLTSMVEKASIEDVMKVLIASRKQDMHQLWTTCSY  193

Query  696   LVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIR  875
             L+AKSGLP E+LAKHLPI++VAKIEELR KSS+   SL+ HHH           EDQKIR
Sbjct  194   LIAKSGLPQEILAKHLPIELVAKIEELRLKSSMPLRSLMPHHHDLTSTLDL---EDQKIR  250

Query  876   RMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGA  1055
             RMRRALDSSDVELVKLMVMGEGLNLDE+LAL YAVENCSREVVKALLELGAADVNYPAG 
Sbjct  251   RMRRALDSSDVELVKLMVMGEGLNLDESLALIYAVENCSREVVKALLELGAADVNYPAGP  310

Query  1056  AGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAH  1235
              G+T LHIAAEMVSPDMV+VLLDHHADPNV+T DGITPLDILRTLTSDFLFKGAIPGL H
Sbjct  311   TGKTALHIAAEMVSPDMVAVLLDHHADPNVQTVDGITPLDILRTLTSDFLFKGAIPGLTH  370

Query  1236  IEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAALAMSEEHHHRNIPSSGGS  1415
             IEPNKLRLCLELVQSAA+VISREEG    N+N ++ +IYP    M +EH      +SG S
Sbjct  371   IEPNKLRLCLELVQSAALVISREEG--NNNSNDNNTMIYP---RMKDEH------TSGSS  419

Query  1416  GNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTRQNSGDPPSMY  1559
                    LDSRLVYLNLGA     G  + NQRE M    +  DP +MY
Sbjct  420   -------LDSRLVYLNLGATNRDIGDDNSNQREGMNLHHHHHDPSTMY  460



>ref|XP_009775137.1| PREDICTED: regulatory protein NPR5-like isoform X2 [Nicotiana 
sylvestris]
Length=481

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/493 (75%), Positives = 408/493 (83%), Gaps = 31/493 (6%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T EDSLR+LSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGP+SP 
Sbjct  2     TPEDSLRTLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPESPV  61

Query  288   sd----spgsRMGLVgagagaaSPRG-SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQ  452
                         GLV       SPRG S  QVIPVN+VGYEVFLLM+QFLYSGQVSIVPQ
Sbjct  62    GSCGPRISPFSGGLVP------SPRGTSGSQVIPVNTVGYEVFLLMLQFLYSGQVSIVPQ  115

Query  453   KHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDV  632
             KHEPRPNC ER CWHTHCTSAVDLALDTL+AARSFGVEQLALLTQKQLASMVEKASIEDV
Sbjct  116   KHEPRPNCGERSCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQLASMVEKASIEDV  175

Query  633   MRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssl-  809
             M+VL+AS KQ+M QLWTTCSHLVAKSGLPPE+LAKH+PIDVVAKIE+LR KSS++R+   
Sbjct  176   MKVLVASRKQDMHQLWTTCSHLVAKSGLPPEILAKHIPIDVVAKIEDLRLKSSISRTRSL  235

Query  810   ---lahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAV  980
                  H HH H++ +  +LEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAV
Sbjct  236   IPHHHHLHHHHEIPSTIELEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAV  295

Query  981   ENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADG  1160
             ENCSREVVKALLELGAADVNY AG  G++PLH+AAEMVSPDMV+VLLDHHADPNV+T D 
Sbjct  296   ENCSREVVKALLELGAADVNYQAGPNGKSPLHLAAEMVSPDMVAVLLDHHADPNVQTMDR  355

Query  1161  ITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsss  1340
             ITPLDILRTLTSDFLFKGAIPGL HIEPNKLRLCLELVQSAAMV SREEG   ANNN SS
Sbjct  356   ITPLDILRTLTSDFLFKGAIPGLTHIEPNKLRLCLELVQSAAMVFSREEG--EANNNPSS  413

Query  1341  aVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAM  1520
               IYP    + E+H      +S G+ N+ NLN+DSR+VYLNLGA         H+Q +  
Sbjct  414   DTIYP---HVREDHSSS---TSSGNNNLGNLNVDSRMVYLNLGAAP-------HHQHDC-  459

Query  1521  TTRQNSGDPPSMY  1559
             ++  N+ +P SMY
Sbjct  460   SSSHNNQNPASMY  472



>gb|KFK34952.1| hypothetical protein AALP_AA5G215400 [Arabis alpina]
Length=470

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/487 (72%), Positives = 389/487 (80%), Gaps = 26/487 (5%)
 Frame = +3

Query  99    SMSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpd  278
             S +T E+SL+S+SLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG D
Sbjct  2     SNTTFEESLKSMSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGSD  61

Query  279   spgsdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKH  458
                ++             G+ +   S+  VIPVNSVGYEVFLL++QFLYSGQVSIVP KH
Sbjct  62    PSQTEPSSQ--------TGSGARASSVGGVIPVNSVGYEVFLLLLQFLYSGQVSIVPHKH  113

Query  459   EPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMR  638
             EPR NC +RGCWHTHCT+AVDL+LD L+AAR FG+EQL LLTQK L SMVEKASIEDVM+
Sbjct  114   EPRSNCGDRGCWHTHCTAAVDLSLDILAAARYFGIEQLVLLTQKHLTSMVEKASIEDVMK  173

Query  639   VLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllah  818
             VLIAS KQ M QLWTTCS+L+AKSGLPPE+LAKHLP+++VAK+EELR KSS+   SL+ H
Sbjct  174   VLIASRKQNMHQLWTTCSYLIAKSGLPPEILAKHLPLELVAKVEELRLKSSMPLRSLMPH  233

Query  819   hhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSRE  998
             HH           EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LAL YAVENCSRE
Sbjct  234   HHDLTSALDL---EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALVYAVENCSRE  290

Query  999   VVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDI  1178
             VVKALLELGAADVNYPAG  G+T LHIAAEMVSPDMV+VLLDHHADPNV+T DGITPLDI
Sbjct  291   VVKALLELGAADVNYPAGPTGKTALHIAAEMVSPDMVAVLLDHHADPNVQTVDGITPLDI  350

Query  1179  LRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPA  1358
             LRTLTSDFLFKGAIPGL HIEPNKLRLCLELVQSAA+VISREE     NN  ++ +IYP 
Sbjct  351   LRTLTSDFLFKGAIPGLTHIEPNKLRLCLELVQSAALVISREE--GNNNNGDNNTLIYP-  407

Query  1359  ALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTRQNS  1538
                M +EH      S GGS      NLDSRLVYLNLGA     G  H+NQRE M+   + 
Sbjct  408   --RMKDEH---TSGSDGGS------NLDSRLVYLNLGATNRDHGDDHNNQREGMSLHHHH  456

Query  1539  GDPPSMY  1559
              DP +M+
Sbjct  457   -DPSTMF  462



>ref|XP_011033137.1| PREDICTED: regulatory protein NPR5-like isoform X2 [Populus euphratica]
Length=443

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/428 (84%), Positives = 382/428 (89%), Gaps = 15/428 (4%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T+EDSLR+LSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCI AARSLFFRK+FCGPD P 
Sbjct  2     TLEDSLRTLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCIFAARSLFFRKYFCGPDPPS  61

Query  288   sdspg-sRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEP  464
                P  SR+ LVG      SP GS   VIPVNSVGYEVFLL++QFLYSGQVSIVPQKHEP
Sbjct  62    GLDPSGSRINLVG------SP-GSRSNVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEP  114

Query  465   RPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVL  644
             RPNC ERGCWHTHCTSAVDLALDTL+AAR FGVEQLA+LTQKQLASMV+KASIEDVM+VL
Sbjct  115   RPNCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLAMLTQKQLASMVDKASIEDVMKVL  174

Query  645   IASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssll-ahh  821
             IAS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR KSS+AR SL+  HH
Sbjct  175   IASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSIARRSLMPHHH  234

Query  822   hhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREV  1001
             HH HDL AAADLEDQKIR M+RALDSSDVELVKLMVMGEGLNL+EALALHYAVENCSREV
Sbjct  235   HHLHDLTAAADLEDQKIRGMKRALDSSDVELVKLMVMGEGLNLNEALALHYAVENCSREV  294

Query  1002  VKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDIL  1181
             VKALLELGAADVNYPAG AG+TPLHIAAEMVSPDMVSVLLDHHADPNVRT DGITPLDIL
Sbjct  295   VKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVSVLLDHHADPNVRTVDGITPLDIL  354

Query  1182  RTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAA  1361
             RTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA V+SREEG+  A  ++    IYP  
Sbjct  355   RTLTSDFLFKGAVPGLVHIEPNKLRLCLELVQSAASVLSREEGSVNATTSNP---IYP--  409

Query  1362  LAMSEEHH  1385
               MS+EH+
Sbjct  410   -PMSDEHN  416



>ref|XP_002323261.1| ankyrin repeat family protein [Populus trichocarpa]
 gb|EEF05022.1| ankyrin repeat family protein [Populus trichocarpa]
Length=443

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/428 (84%), Positives = 382/428 (89%), Gaps = 15/428 (4%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T+EDSLR+LSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRK+FCGPD P 
Sbjct  2     TLEDSLRTLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKYFCGPDPPS  61

Query  288   sdspg-sRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEP  464
                P  SR+ LVG      SP GS   VIPVNSVGYEVFLL++QFLYSGQVSIVPQKHEP
Sbjct  62    GLDPSGSRINLVG------SP-GSRSNVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEP  114

Query  465   RPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVL  644
             RPNC  RGCWHTHCTSAVDLALDTL+AAR FGVEQLA+LTQKQLASMV+ ASI+DVM+VL
Sbjct  115   RPNCGVRGCWHTHCTSAVDLALDTLAAARYFGVEQLAMLTQKQLASMVDNASIDDVMKVL  174

Query  645   IASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssll-ahh  821
             IAS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR KSS+AR SL+  HH
Sbjct  175   IASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSIARRSLMPHHH  234

Query  822   hhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREV  1001
             HH HDL AAADLEDQKIRRM+RALDSSDVELVKLMVMGEGLNL+EALALHYAVENCSREV
Sbjct  235   HHLHDLTAAADLEDQKIRRMKRALDSSDVELVKLMVMGEGLNLNEALALHYAVENCSREV  294

Query  1002  VKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDIL  1181
             VKALLELGAADVNYPAG AG+TPLHIAAEMVSPDMVSVLLDHHADPNVRT DGITPLDIL
Sbjct  295   VKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVSVLLDHHADPNVRTVDGITPLDIL  354

Query  1182  RTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAA  1361
             RTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA V+SREEG+  A  ++    IYP  
Sbjct  355   RTLTSDFLFKGAVPGLVHIEPNKLRLCLELVQSAASVLSREEGSVNATTSNP---IYP--  409

Query  1362  LAMSEEHH  1385
               MS+EH+
Sbjct  410   -PMSDEHN  416



>ref|XP_004150250.1| PREDICTED: regulatory protein NPR5-like [Cucumis sativus]
 ref|XP_004162071.1| PREDICTED: regulatory protein NPR5-like [Cucumis sativus]
 gb|KGN54003.1| hypothetical protein Csa_4G256430 [Cucumis sativus]
Length=490

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/505 (73%), Positives = 408/505 (81%), Gaps = 31/505 (6%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T EDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG  S  
Sbjct  2     TFEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGSSSDS  61

Query  288   sds-----pgsRMGLVgagagaaSPRGSIPQ--VIPVNSVGYEVFLLMMQFLYSGQVSIV  446
             + S              +   + +   S+P   VIPVNSVGYEVFLL++QFLYSGQVSI+
Sbjct  62    NSSPGPVFDSRSPSGSNSRGSSGANSTSLPPQGVIPVNSVGYEVFLLLLQFLYSGQVSIL  121

Query  447   PQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIE  626
             PQKHEPRPNC ERGCWHTHC+SAVDLAL+TL+AARSFGVEQLALLTQKQL SMVEKASIE
Sbjct  122   PQKHEPRPNCGERGCWHTHCSSAVDLALETLAAARSFGVEQLALLTQKQLVSMVEKASIE  181

Query  627   DVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarss  806
             DVM+VLIAS KQ+M QLWTTCSHLVAKSGLP EVLAKH+P+DVVAKIEELR KSSLAR S
Sbjct  182   DVMKVLIASRKQDMHQLWTTCSHLVAKSGLPTEVLAKHIPLDVVAKIEELRLKSSLARRS  241

Query  807   lla----hhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHY  974
              L     HHHH   L AAADLE+QKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHY
Sbjct  242   SLMPHHHHHHHHLQLSAAADLEEQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHY  301

Query  975   AVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTA  1154
             AVENC+REVVKALLELGAADVNYPAG AG+TPLHIA+EMVS DMV+VLLDHHADP +RT 
Sbjct  302   AVENCTREVVKALLELGAADVNYPAGPAGKTPLHIASEMVSADMVAVLLDHHADPTIRTV  361

Query  1155  DGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannns  1334
             DG+TPLDILRTLTSDFLFKGA+PG+ HIEPNKLRLCLELVQSAA+VISRE+GN   NN +
Sbjct  362   DGVTPLDILRTLTSDFLFKGAVPGMTHIEPNKLRLCLELVQSAALVISREQGNNNNNNGN  421

Query  1335  ssaV----IYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHH  1502
             ++A     IYP    MSE+H          S N  NLNLD+RLVYLNLGA   S   G  
Sbjct  422   NNASSSNPIYP---PMSEDH--------SSSSNGSNLNLDTRLVYLNLGANSGSAQMGAD  470

Query  1503  NQREAMTTRQNSGDPPSMYHHSHEY  1577
                      ++ G+ P+MYHHSH++
Sbjct  471   G-----ADHRHGGNDPTMYHHSHDF  490



>ref|XP_004493408.1| PREDICTED: regulatory protein NPR5-like [Cicer arietinum]
Length=482

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/468 (75%), Positives = 381/468 (81%), Gaps = 28/468 (6%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDV FSVEGRLVHAHRCILAARS+FFRKFFCGP+        S    V +    
Sbjct  19    INGQAFSDVVFSVEGRLVHAHRCILAARSMFFRKFFCGPEPASGVLDPSSGNRVNSVGST  78

Query  339   aSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAV  518
              S       VIPVNSVGYEVFLLM+QFLYSGQV IVPQKHE RPNC ER CWHTHCTSAV
Sbjct  79    RS------GVIPVNSVGYEVFLLMLQFLYSGQVCIVPQKHEARPNCGERACWHTHCTSAV  132

Query  519   DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
             DLALDTLSAAR FGVEQLALLTQKQLA+MVEKASIEDVM+VL+AS KQ+MQQLW+TCSHL
Sbjct  133   DLALDTLSAARYFGVEQLALLTQKQLANMVEKASIEDVMKVLLASRKQDMQQLWSTCSHL  192

Query  699   VAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrh-dlgaaadlEDQKIR  875
             VAKSGLPPEVLAKHLPID++AKIEELR KSSL+R SL AHH     DL AAADLEDQKIR
Sbjct  193   VAKSGLPPEVLAKHLPIDIIAKIEELRMKSSLSRRSLNAHHRRHPHDLTAAADLEDQKIR  252

Query  876   RMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGA  1055
             RMRRALDSSDVELVKLMVMGEGLNLDEALAL YAVENCSREVVKALLELGAADVN+PAG 
Sbjct  253   RMRRALDSSDVELVKLMVMGEGLNLDEALALPYAVENCSREVVKALLELGAADVNFPAGP  312

Query  1056  AGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAH  1235
              G+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPLDILRTLTSDFLFKGA+PGL H
Sbjct  313   TGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLTH  372

Query  1236  IEPNKLRLCLELVQSAAMVISREEG----naaannnsssaVIYPAALAMSEEHHHRNIPS  1403
             IEPNKLRLCLELVQSAA+V+SRE+G    N     +SS   +YP    M+E+H H     
Sbjct  373   IEPNKLRLCLELVQSAALVMSREDGNNNANNNNATSSSGTTMYP---HMNEDHSHN----  425

Query  1404  SGGSGNIVNLNLDSRLVYLNLGAVE-----NSG--GGGHHNQREAMTT  1526
                +    NLNLDSRLVYLNLGA +     +SG     H++QREA+ +
Sbjct  426   ---NNINNNLNLDSRLVYLNLGANQISSRMDSGDDDNNHNSQREAINS  470



>ref|XP_009775136.1| PREDICTED: regulatory protein NPR5-like isoform X1 [Nicotiana 
sylvestris]
Length=482

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/494 (75%), Positives = 408/494 (83%), Gaps = 32/494 (6%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             T EDSLR+LSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGP+SP 
Sbjct  2     TPEDSLRTLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPESPV  61

Query  288   sd----spgsRMGLVgagagaaSPRG-SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQ  452
                         GLV       SPRG S  QVIPVN+VGYEVFLLM+QFLYSGQVSIVPQ
Sbjct  62    GSCGPRISPFSGGLVP------SPRGTSGSQVIPVNTVGYEVFLLMLQFLYSGQVSIVPQ  115

Query  453   KHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQ-KQLASMVEKASIED  629
             KHEPRPNC ER CWHTHCTSAVDLALDTL+AARSFGVEQLALLTQ KQLASMVEKASIED
Sbjct  116   KHEPRPNCGERSCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQQKQLASMVEKASIED  175

Query  630   VMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssl  809
             VM+VL+AS KQ+M QLWTTCSHLVAKSGLPPE+LAKH+PIDVVAKIE+LR KSS++R+  
Sbjct  176   VMKVLVASRKQDMHQLWTTCSHLVAKSGLPPEILAKHIPIDVVAKIEDLRLKSSISRTRS  235

Query  810   ----lahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYA  977
                   H HH H++ +  +LEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYA
Sbjct  236   LIPHHHHLHHHHEIPSTIELEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYA  295

Query  978   VENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTAD  1157
             VENCSREVVKALLELGAADVNY AG  G++PLH+AAEMVSPDMV+VLLDHHADPNV+T D
Sbjct  296   VENCSREVVKALLELGAADVNYQAGPNGKSPLHLAAEMVSPDMVAVLLDHHADPNVQTMD  355

Query  1158  GITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnss  1337
              ITPLDILRTLTSDFLFKGAIPGL HIEPNKLRLCLELVQSAAMV SREEG   ANNN S
Sbjct  356   RITPLDILRTLTSDFLFKGAIPGLTHIEPNKLRLCLELVQSAAMVFSREEG--EANNNPS  413

Query  1338  saVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREA  1517
             S  IYP    + E+H      +S G+ N+ NLN+DSR+VYLNLGA         H+Q + 
Sbjct  414   SDTIYP---HVREDHSSS---TSSGNNNLGNLNVDSRMVYLNLGAAP-------HHQHDC  460

Query  1518  MTTRQNSGDPPSMY  1559
              ++  N+ +P SMY
Sbjct  461   -SSSHNNQNPASMY  473



>ref|XP_010504634.1| PREDICTED: regulatory protein NPR6-like [Camelina sativa]
Length=469

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/485 (70%), Positives = 387/485 (80%), Gaps = 26/485 (5%)
 Frame = +3

Query  105   STVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdsp  284
             ST E+SL+S+SLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC  D+ 
Sbjct  3     STFEESLKSMSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCETDAS  62

Query  285   gsdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEP  464
              +              G+ +   ++  VIPVNSVGYEVFLL++QFLYSGQVSIVP KHEP
Sbjct  63    QTGEAEP-----ANQTGSGARAAAVGGVIPVNSVGYEVFLLLLQFLYSGQVSIVPHKHEP  117

Query  465   RPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVL  644
             R NC +RGCWHTHCT+AVDL+LD L+AAR FGVEQLALLTQK L S+VEKAS+EDVM+VL
Sbjct  118   RSNCGDRGCWHTHCTAAVDLSLDILAAARYFGVEQLALLTQKHLTSIVEKASVEDVMKVL  177

Query  645   IASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhh  824
             IAS KQ+MQQLWTTCS+L+AKSG+P E+LAKHLP++++AK+EELR KSS+   SL+ HHH
Sbjct  178   IASRKQDMQQLWTTCSYLIAKSGIPQEILAKHLPMELIAKVEELRLKSSMPIRSLMPHHH  237

Query  825   hrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVV  1004
                        ED KIRRM+RALDSSD+ELVKLMVMGEGLNLDE+LAL YAVENCSREVV
Sbjct  238   DLTSAIDL---EDHKIRRMKRALDSSDIELVKLMVMGEGLNLDESLALIYAVENCSREVV  294

Query  1005  KALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILR  1184
             KALLELGAADVNYP G  G+T LHIAAEMVSPDMV+VLLDHHADPNV+T DGITPLDILR
Sbjct  295   KALLELGAADVNYPTGPTGKTALHIAAEMVSPDMVAVLLDHHADPNVQTVDGITPLDILR  354

Query  1185  TLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAAL  1364
             TLTSDFLFKGAIPGL HIEPNKLRLCLELVQSAA+VISREEG    N+N ++ VIYP   
Sbjct  355   TLTSDFLFKGAIPGLTHIEPNKLRLCLELVQSAALVISREEG--NNNSNDNNTVIYP---  409

Query  1365  AMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTRQNSGD  1544
              M +EH      +SG S       LDSRLVYLNLGA     G  + NQR+ M+   +  D
Sbjct  410   RMKDEH------TSGSS-------LDSRLVYLNLGATNRDLGNDNSNQRDGMSLHHHHHD  456

Query  1545  PPSMY  1559
             P +MY
Sbjct  457   PSTMY  461



>ref|XP_009142739.1| PREDICTED: regulatory protein NPR5 [Brassica rapa]
Length=484

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/494 (75%), Positives = 401/494 (81%), Gaps = 26/494 (5%)
 Frame = +3

Query  102   MSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpds  281
             MS++E+SLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG DS
Sbjct  1     MSSLEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGTDS  60

Query  282   pg--sdspgsRMGLVgagagaaS--PRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVP  449
             P   +    +R G V A     S  P G    VIPVNSVGY VFLL++QFLYSGQVSIVP
Sbjct  61    PQPGTGIDPTRHGSVPASPTRGSQAPAG----VIPVNSVGYAVFLLLLQFLYSGQVSIVP  116

Query  450   QKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIED  629
             QKHEPRPNC ERGCWHTHC++A DLALDTL+ +R FGVEQLALLT KQL SMVEKASIED
Sbjct  117   QKHEPRPNCGERGCWHTHCSAAFDLALDTLAPSRYFGVEQLALLTHKQLVSMVEKASIED  176

Query  630   VMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssl  809
             VM+VLIAS KQ+M  LWTTCSHLVAKSGLPPE+LAKHL IDVVAKIEELR KSS+AR SL
Sbjct  177   VMKVLIASRKQDMHHLWTTCSHLVAKSGLPPEILAKHLTIDVVAKIEELRLKSSIARRSL  236

Query  810   lahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENC  989
             + HHHH     A    EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+LALHYAVE+C
Sbjct  237   MPHHHHHDLTVAQDL-EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALHYAVESC  295

Query  990   SREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITP  1169
             SREVVKALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT  GITP
Sbjct  296   SREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVGGITP  355

Query  1170  LDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVI  1349
             LDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREEG   +NNN  +  I
Sbjct  356   LDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEG-NNSNNNDHNNAI  414

Query  1350  YPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVE----NSGGGGHHNQREA  1517
             YP    M++E        + GS    N NLDSR VYLNLGA +       G  H++QRE 
Sbjct  415   YP---QMNDER-------NSGSSGGSNNNLDSRFVYLNLGAGQMGPGRDHGDDHNSQREG  464

Query  1518  MTTRQNSGDPPSMY  1559
             M+   +  DP +MY
Sbjct  465   MSRHHH--DPSTMY  476



>ref|XP_006292732.1| hypothetical protein CARUB_v10018976mg [Capsella rubella]
 gb|EOA25630.1| hypothetical protein CARUB_v10018976mg [Capsella rubella]
Length=468

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/488 (71%), Positives = 386/488 (79%), Gaps = 30/488 (6%)
 Frame = +3

Query  99    SMSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpd  278
             S S+ E+SL+S+SLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC  D
Sbjct  2     SSSSFEESLKSMSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCESD  61

Query  279   spgsdspgsRMGLVgagagaaSPRGS-IPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQK  455
                      + G   A    +  R + +  VIPVNSVGYEVFLL++QFLYSGQVSIVP K
Sbjct  62    PS-------QTGAEPASQTGSGARAAAVGGVIPVNSVGYEVFLLLLQFLYSGQVSIVPHK  114

Query  456   HEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVM  635
             HEPR NC +RGCWHTHCT+AVDL+LD L+AAR FGVEQLALLTQK L SMVEKAS+EDVM
Sbjct  115   HEPRSNCGDRGCWHTHCTAAVDLSLDILAAARYFGVEQLALLTQKHLTSMVEKASVEDVM  174

Query  636   RVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarsslla  815
             +VLIAS KQ+M QLWTTCS+L+AKSGLP E+LAKHLP+++VAK+EELR KSS+   SL+ 
Sbjct  175   KVLIASRKQDMHQLWTTCSYLIAKSGLPQEILAKHLPMELVAKVEELRLKSSMPLRSLMP  234

Query  816   hhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSR  995
             HHH           ED KIRRMRRALDSSDVELVKLMVMGEGLNLDE+LAL YAVENCSR
Sbjct  235   HHHDLTSALDI---EDHKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALIYAVENCSR  291

Query  996   EVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLD  1175
             EVVKALLELGAADVNYP G  G+T LHIAAEMVSPDMV+VLLDHHADPNV+T DGITPLD
Sbjct  292   EVVKALLELGAADVNYPTGPTGKTALHIAAEMVSPDMVAVLLDHHADPNVQTVDGITPLD  351

Query  1176  ILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYP  1355
             ILRTLTSDFLFKGAIPGL HIEPNKLRLCLELVQSAA+VISREEG    N+N ++ VIYP
Sbjct  352   ILRTLTSDFLFKGAIPGLTHIEPNKLRLCLELVQSAALVISREEG--NNNSNDNNTVIYP  409

Query  1356  AALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTRQN  1535
                 M +EH      +SG S       LDSRLVYLNLGA     G    NQRE M+   +
Sbjct  410   ---RMKDEH------TSGSS-------LDSRLVYLNLGATTRDLGDDSSNQREGMSMHHH  453

Query  1536  SGDPPSMY  1559
               DP +MY
Sbjct  454   H-DPSTMY  460



>ref|XP_010516320.1| PREDICTED: regulatory protein NPR6-like [Camelina sativa]
Length=468

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/486 (71%), Positives = 385/486 (79%), Gaps = 29/486 (6%)
 Frame = +3

Query  105   STVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdsp  284
             ST E+SL+S+SLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC  D+ 
Sbjct  3     STFEESLKSMSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCESDAS  62

Query  285   gsdspgsRMGLVgagagaaSPRGS-IPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHE  461
                    + G   A    +  R + +  VIPVNSVGYEVFLL++QFLYSGQVSIVP KHE
Sbjct  63    -------QTGAEPANQTGSGARAAAVGGVIPVNSVGYEVFLLLLQFLYSGQVSIVPHKHE  115

Query  462   PRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRV  641
             PR NC +RGCWHTHCT+AVDL+LD L+AAR FGVEQLALLTQK L SMVEKAS+EDVM+V
Sbjct  116   PRSNCGDRGCWHTHCTAAVDLSLDILAAARYFGVEQLALLTQKHLTSMVEKASVEDVMKV  175

Query  642   LIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahh  821
             LIAS KQ+M QLWTTCS+L+AKSGLP E+LAKHLP+++VAK+EELR KSS+   SL+ HH
Sbjct  176   LIASRKQDMHQLWTTCSYLIAKSGLPQEILAKHLPMELVAKVEELRLKSSMPLRSLMPHH  235

Query  822   hhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREV  1001
             H           ED KIRRMRRALDSSDVELVKLMVMGEGLNL+E+LAL YAVENCSREV
Sbjct  236   HDLTSAIDL---EDHKIRRMRRALDSSDVELVKLMVMGEGLNLNESLALIYAVENCSREV  292

Query  1002  VKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDIL  1181
             VKALLELGAADVNYP G  G+T LHIAAEMVSPDMV+VLLDHHADPNV+T DGITPLDIL
Sbjct  293   VKALLELGAADVNYPTGPTGKTALHIAAEMVSPDMVAVLLDHHADPNVQTVDGITPLDIL  352

Query  1182  RTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAA  1361
             RTLTSDFLFKGAIPGL H EPNKLRLCLELVQSAA+VISREEG    N+N ++ VIYP  
Sbjct  353   RTLTSDFLFKGAIPGLTHFEPNKLRLCLELVQSAALVISREEG--NNNSNDNNTVIYP--  408

Query  1362  LAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTRQNSG  1541
               M +EH      +SG S       LDSRLVYLNLGA        + NQR+ M+   +  
Sbjct  409   -RMKDEH------TSGSS-------LDSRLVYLNLGATNRDLRDDNSNQRDGMSLHHHHH  454

Query  1542  DPPSMY  1559
             DP +MY
Sbjct  455   DPSTMY  460



>ref|XP_009384381.1| PREDICTED: regulatory protein NPR6-like [Musa acuminata subsp. 
malaccensis]
Length=502

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/455 (73%), Positives = 362/455 (80%), Gaps = 17/455 (4%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsd-spgsRMGLVgagag  335
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG +                    
Sbjct  17    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGAEPSSPPGLLLLHHHHHHQHHS  76

Query  336   aaSPRGSIPQ--------VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGC  491
               SP G   Q        VIPVNSV YEVFLLM+QF+YSGQVS+VPQKHEPRPNC +RGC
Sbjct  77    PRSPTGGASQCLSSSPGSVIPVNSVSYEVFLLMLQFMYSGQVSLVPQKHEPRPNCSDRGC  136

Query  492   WHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQ  671
             WHTHCT+AVDLALDTL+A+RSFGVEQLALLTQKQLASMVEKASIEDVM+VL+AS KQEM 
Sbjct  137   WHTHCTAAVDLALDTLTASRSFGVEQLALLTQKQLASMVEKASIEDVMKVLMASRKQEMH  196

Query  672   QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaa  851
             QLWTTCSHLVAKSGLPPEVLAKHLPIDV+AKIEELR KSSLAR S + HHH     G + 
Sbjct  197   QLWTTCSHLVAKSGLPPEVLAKHLPIDVMAKIEELRLKSSLARRSFIPHHHALEVAGPST  256

Query  852   dlEDQ-KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGA  1028
             +L+D  KIRRMRRALDSSDVELVKLMVMGEGLNLD+ALALHYAVENCSREVVKALLELGA
Sbjct  257   ELDDHHKIRRMRRALDSSDVELVKLMVMGEGLNLDDALALHYAVENCSREVVKALLELGA  316

Query  1029  ADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLF  1208
             ADVN  AG AG+TPLH+AAEMV PDMV+VLLDHHADPNVRT DG+TPLDILR LTSDFLF
Sbjct  317   ADVNCRAGPAGKTPLHVAAEMVCPDMVAVLLDHHADPNVRTFDGVTPLDILRNLTSDFLF  376

Query  1209  KGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnss--saVIYPAALAMSEEH  1382
             KGA+PGL HIEPNKLRLCLELVQSAA+V+SREE  +      S   + IYP     S   
Sbjct  377   KGAVPGLTHIEPNKLRLCLELVQSAALVMSREEAKSGGGGAGSHPHSAIYPPMHPDSTSC  436

Query  1383  HHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSG  1487
                N      +G++VNL+LDSR+VYLNLG     G
Sbjct  437   TPNN-----SNGSMVNLSLDSRMVYLNLGMAARLG  466



>ref|XP_010938612.1| PREDICTED: regulatory protein NPR5-like [Elaeis guineensis]
Length=509

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/398 (81%), Positives = 343/398 (86%), Gaps = 14/398 (4%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGL-------  317
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD P          L       
Sbjct  17    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPSPGLLLLHQDLHPHHHQS  76

Query  318   --VgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGC  491
                 +GA  +SPRG    VIPVNSVGYEVFLL++QFLYSGQVSIVPQKHEPRPNC ERGC
Sbjct  77    PRSPSGASTSSPRGGGAAVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCSERGC  136

Query  492   WHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQ  671
             WHTHCT+AVDLALDTL+AARSFGVEQLALLTQKQLASMVEKASIEDVM+VL+AS KQ+MQ
Sbjct  137   WHTHCTAAVDLALDTLAAARSFGVEQLALLTQKQLASMVEKASIEDVMKVLMASRKQDMQ  196

Query  672   QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllah---hhhrhdlg  842
             QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR K+SLAR S               
Sbjct  197   QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKTSLARRSSFMAHHPLDIAAAGP  256

Query  843   aaadlED--QKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALL  1016
             ++A+LED   KIRRMRRAL+SSDVELVKLMVMGEGLNLD+ALALHYAVENCSREVVKALL
Sbjct  257   SSAELEDHHHKIRRMRRALESSDVELVKLMVMGEGLNLDDALALHYAVENCSREVVKALL  316

Query  1017  ELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTS  1196
             ELGAADVN PAG AG+TPLHIAAEMV PDMV+VLLDHHADPN+RT DG+TPLDILRTLTS
Sbjct  317   ELGAADVNCPAGPAGKTPLHIAAEMVCPDMVAVLLDHHADPNIRTVDGVTPLDILRTLTS  376

Query  1197  DFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEG  1310
             DFLFKGA+PGL+HIEPNKLRLCLELVQSAAMV+SREE 
Sbjct  377   DFLFKGAVPGLSHIEPNKLRLCLELVQSAAMVMSREEA  414



>ref|XP_009399975.1| PREDICTED: regulatory protein NPR6-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009399976.1| PREDICTED: regulatory protein NPR6-like [Musa acuminata subsp. 
malaccensis]
Length=490

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/464 (72%), Positives = 367/464 (79%), Gaps = 44/464 (9%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFR+FFCG D P         GL+      
Sbjct  17    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRRFFCGTDPPSP-------GLLS-----  64

Query  339   aSPRGSIPQ-------VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWH  497
              SPRG           VIPVNSV YEVFLLM+QFLYSGQVS+VPQKHEPRP+C ERGCWH
Sbjct  65    -SPRGGAASPGAAGGAVIPVNSVSYEVFLLMLQFLYSGQVSVVPQKHEPRPSCGERGCWH  123

Query  498   THCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQL  677
             THCT+AVDLALDTL+AARSFGV+QL  +T+KQLASM EKASIEDVM+VL+AS +Q+MQQL
Sbjct  124   THCTAAVDLALDTLTAARSFGVKQLEQITEKQLASMAEKASIEDVMKVLMASRQQDMQQL  183

Query  678   WTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhh-hrhdlgaaad  854
             WTTCSHLVAKSGLP EVLAKHLPIDVVA+IEELR KSSLAR S    HH      G++AD
Sbjct  184   WTTCSHLVAKSGLPAEVLAKHLPIDVVARIEELRLKSSLARRSSFVAHHHQIDVSGSSAD  243

Query  855   lEDQ--KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGA  1028
             LED   KIRRMRRALDSSDVELVKLMVMGEGLNLD+ALALHYAVENCSREVVKALLELGA
Sbjct  244   LEDHHHKIRRMRRALDSSDVELVKLMVMGEGLNLDDALALHYAVENCSREVVKALLELGA  303

Query  1029  ADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLF  1208
             ADVN PAG  G+TPLHIAAEMV PDMV+VLLDHHADPNVRT DG+TPLDILRTLTSDFLF
Sbjct  304   ADVNSPAGPTGKTPLHIAAEMVCPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLF  363

Query  1209  KGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGn----aaannnsssaVIYPAALAMSE  1376
             KGA+PGL+HIEPNKLRLCLELVQSAA+VISREE N         ++ +  IYP       
Sbjct  364   KGAVPGLSHIEPNKLRLCLELVQSAALVISREEANCGGGTGGAGSNPTTAIYP-------  416

Query  1377  EHHHRNIPSSGG------SGNIVNLNLDSRLVYLNLGAVENSGG  1490
                 R  P +G       +  +VNL+LDSR+VYLNLG     GG
Sbjct  417   ----RMNPGTGACDASSSTSGMVNLSLDSRMVYLNLGMAAQFGG  456



>ref|XP_009401048.1| PREDICTED: regulatory protein NPR6-like [Musa acuminata subsp. 
malaccensis]
Length=505

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/462 (69%), Positives = 360/462 (78%), Gaps = 28/462 (6%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRC+LAARSLFFRKFFCG +            L+      
Sbjct  17    INGQAFSDVTFSVEGRLVHAHRCVLAARSLFFRKFFCGAEPSSPSGL-----LLLNPHDR  71

Query  339   aSPRG------------------SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEP  464
              SPR                   +   VIPVN V YEVFLLM+QF+YSGQV +VPQKHEP
Sbjct  72    HSPRSPTGGASMSSSSSPRGSACTAGSVIPVNYVSYEVFLLMLQFMYSGQVPLVPQKHEP  131

Query  465   RPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVL  644
             RP+C +RGCWHTHCT+AVDL LDTL+AARSFG+EQLALLTQKQLASMVEKA+IEDVM+VL
Sbjct  132   RPSCSDRGCWHTHCTAAVDLTLDTLAAARSFGIEQLALLTQKQLASMVEKATIEDVMKVL  191

Query  645   IASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhh  824
             IAS KQ+M QLW TCSHLVAKSG+PPEVLAKHLPID+VAKIEELR KSSL   S + HHH
Sbjct  192   IASRKQDMNQLWITCSHLVAKSGIPPEVLAKHLPIDIVAKIEELRLKSSLTGRSFITHHH  251

Query  825   hrhdlgaaadlEDQ-KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREV  1001
                  GA+ +LED  KIRRMRRALDSSDVELVKLMVMGEGLNLD+ALALHYAVENC+REV
Sbjct  252   SLEAAGASTELEDHHKIRRMRRALDSSDVELVKLMVMGEGLNLDDALALHYAVENCTREV  311

Query  1002  VKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDIL  1181
             VKALLELGA DVN+ AG AG+TPLHIAA+MV PDMV+VLLDHHADPN+RT DG+TPLDIL
Sbjct  312   VKALLELGATDVNFRAGPAGKTPLHIAAKMVCPDMVAVLLDHHADPNIRTFDGVTPLDIL  371

Query  1182  RTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAA  1361
             R LTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA+V+SRE+  +    N   + IYP  
Sbjct  372   RNLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVMSREDAKSGGGGNHPHSAIYPPM  431

Query  1362  LAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSG  1487
                  +       ++  S ++VNL+LDSR+VYLNLG  E  G
Sbjct  432   ----NQQESNTCNANHTSSSMVNLSLDSRMVYLNLGMAERLG  469



>ref|XP_011078926.1| PREDICTED: LOW QUALITY PROTEIN: regulatory protein NPR5-like 
[Sesamum indicum]
Length=452

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/385 (86%), Positives = 348/385 (90%), Gaps = 8/385 (2%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFR FFCGPDS  S     RMG      G 
Sbjct  19    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRNFFCGPDSQSSGLDPLRMG-----PGT  73

Query  339   aSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAV  518
              SPRG I QVIPVNSVGYEVFLL++QFLYSG VSIVPQKHEPR NC ERGCWHTHC+SAV
Sbjct  74    GSPRGPITQVIPVNSVGYEVFLLLLQFLYSGHVSIVPQKHEPRSNCGERGCWHTHCSSAV  133

Query  519   DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
             DLALD L+AARSFGVEQLALLTQKQL SMVEKASI+DVM+VLIAS KQE+ QLWTTCSHL
Sbjct  134   DLALDXLAAARSFGVEQLALLTQKQLESMVEKASIQDVMKVLIASRKQELHQLWTTCSHL  193

Query  699   VAKSGLPPEVLAKHLPIDVVAKIEELRHKssla-rssllahhhhrhdlgaaadlEDQKIR  875
             VAKSGLPPE+LAKHLP+DVVA+IEELR KSSLA RS L  HHHH H LGAAADLE+QKIR
Sbjct  194   VAKSGLPPEILAKHLPVDVVARIEELRLKSSLAHRSLLPPHHHHHHHLGAAADLEEQKIR  253

Query  876   RMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPA--  1049
             RMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPA  
Sbjct  254   RMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGP  313

Query  1050  GAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGL  1229
             G AG+TPLHIAAEMVSPDMV+VLLDHHADPN RT DGITPLD+LRTLTSDFLFKGA+PGL
Sbjct  314   GPAGKTPLHIAAEMVSPDMVAVLLDHHADPNCRTVDGITPLDVLRTLTSDFLFKGAVPGL  373

Query  1230  AHIEPNKLRLCLELVQSAAMVISRE  1304
             AHIEPNKLRLCLELVQSAAMVISRE
Sbjct  374   AHIEPNKLRLCLELVQSAAMVISRE  398



>ref|XP_010909412.1| PREDICTED: regulatory protein NPR6-like isoform X1 [Elaeis guineensis]
 ref|XP_010909414.1| PREDICTED: regulatory protein NPR6-like isoform X1 [Elaeis guineensis]
Length=520

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/477 (71%), Positives = 368/477 (77%), Gaps = 42/477 (9%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD P                  
Sbjct  17    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPSPGLLLLHH-QDLHPHHH  75

Query  339   aSPRGSI----------------------PQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQ  452
              SPR                         P VIPVNSVGYEVFLL++QFLYSGQVS+VPQ
Sbjct  76    QSPRSPSGASASSPRGGASPSSAAAAGVGPVVIPVNSVGYEVFLLLLQFLYSGQVSLVPQ  135

Query  453   KHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDV  632
             KHEPRPNC ERGCWHTHCT+AVDLALDTL+AARSFGVEQLALLTQKQLASMVEKASIEDV
Sbjct  136   KHEPRPNCGERGCWHTHCTAAVDLALDTLAAARSFGVEQLALLTQKQLASMVEKASIEDV  195

Query  633   MRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssl-  809
             M+VL+AS KQ+M QLWTTCSHLVAKSGLP EVLAKHLPIDVVAKIEELR KSSLAR S  
Sbjct  196   MKVLLASRKQDMHQLWTTCSHLVAKSGLPAEVLAKHLPIDVVAKIEELRLKSSLARRSSF  255

Query  810   ---------lahhhhrhdlgaaadlED--QKIRRMRRALDSSDVELVKLMVMGEGLNLDE  956
                                 AAA+LED   KIRRMRRALDSSDVELVKLMVMGEGLNLD+
Sbjct  256   MAHHHPLDLATAGAGPSSSSAAAELEDHHNKIRRMRRALDSSDVELVKLMVMGEGLNLDD  315

Query  957   ALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHAD  1136
             ALALHYAVENCSREVVKALLELGAADVN PAG AG+TPLHIAAEMV PDMV+VLLDHHAD
Sbjct  316   ALALHYAVENCSREVVKALLELGAADVNCPAGPAGKTPLHIAAEMVCPDMVAVLLDHHAD  375

Query  1137  PNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGna  1316
             PN+RT DG+TPLDILRTLTSDFLFKGA+PGL+HIEPNKLRLCLELVQSAA+V+SREE   
Sbjct  376   PNIRTVDGVTPLDILRTLTSDFLFKGAVPGLSHIEPNKLRLCLELVQSAALVMSREEA--  433

Query  1317  aannnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSG  1487
                 +  +A IYP    M+ E  + N  +S  S ++VNL+LDSR+VYLNLG     G
Sbjct  434   TNCGSGGTAAIYP---PMNPEPSNCN--ASSASSSMVNLSLDSRMVYLNLGMAAQLG  485



>gb|ABE11621.1| ankyrin-repeat protein [Oryza sativa Japonica Group]
 gb|ABE11622.1| ankyrin-repeat protein [Oryza sativa Japonica Group]
 gb|EAY77221.1| hypothetical protein OsI_05192 [Oryza sativa Indica Group]
 gb|AEF30414.1| putative NPR1-like protein 4 [Oryza sativa Japonica Group]
Length=506

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/468 (70%), Positives = 362/468 (77%), Gaps = 41/468 (9%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG  +  + +P   + L       
Sbjct  17    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGAAADQAAAPPGALLL-----DH  71

Query  339   aSPRGSIPQ-----------------------VIPVNSVGYEVFLLMMQFLYSGQVSIVP  449
              SPR                            VIPV+SV YEVFLL++QFLYSGQVS+VP
Sbjct  72    LSPRSPSGGASASSPRGAGGSAAAAAAATPGAVIPVSSVSYEVFLLLLQFLYSGQVSLVP  131

Query  450   QKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIED  629
             QK EPRP C ERGCWHTHC +AVDLALDTL+AARSFGVE+LALLTQKQLA MVEKASIED
Sbjct  132   QKGEPRPGCGERGCWHTHCAAAVDLALDTLAAARSFGVEELALLTQKQLAGMVEKASIED  191

Query  630   VMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssl  809
             VM+VL+AS KQ++ QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKI+ELR KS   RS  
Sbjct  192   VMKVLMASRKQDLHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIDELRLKSMSRRSPF  251

Query  810   lahhhhrh--------dlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALA  965
             L+HHHH             AA   +  KIRRMRRALDSSDVELVKLMVMGEGLNLD+ALA
Sbjct  252   LSHHHHHPHAAAAGIEASSAAELDDHHKIRRMRRALDSSDVELVKLMVMGEGLNLDDALA  311

Query  966   LHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNV  1145
             LHYAVENCSREVVKALLELGAADVN+PAG AG+TPLH+AAEMV PDMV+VLLDHHADPNV
Sbjct  312   LHYAVENCSREVVKALLELGAADVNHPAGPAGKTPLHVAAEMVCPDMVAVLLDHHADPNV  371

Query  1146  RTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaan  1325
             RT DG+TPLDILRTLTSDFLFKGA+PGLAHIEPNKLRLCLELVQSAAMV+SRE+   AA 
Sbjct  372   RTVDGVTPLDILRTLTSDFLFKGAVPGLAHIEPNKLRLCLELVQSAAMVMSREDAQTAAV  431

Query  1326  nnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLG  1469
             N +      P        ++     +SG S ++VNL+LD+R+VYLNLG
Sbjct  432   NAAPIYGESPGGGGGGGVYN-----ASGTSSSMVNLSLDNRMVYLNLG  474



>ref|XP_009116421.1| PREDICTED: regulatory protein NPR6 [Brassica rapa]
 gb|ACU32462.1| NPR1 protein [Brassica rapa subsp. pekinensis]
Length=462

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/485 (69%), Positives = 382/485 (79%), Gaps = 39/485 (8%)
 Frame = +3

Query  105   STVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdsp  284
             S++E+SL+S+SLDYLNLLINGQAFSDVTF+VEGRLVHAHRCILAARSLFFRKFFCG D  
Sbjct  10    SSIEESLKSMSLDYLNLLINGQAFSDVTFNVEGRLVHAHRCILAARSLFFRKFFCGSDPS  69

Query  285   gsdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEP  464
              +D             G+ +    +  VIPVNSVGYEVFLL++QFLYSGQVS+VP KHEP
Sbjct  70    QTDPANQ--------TGSGARAAVVGGVIPVNSVGYEVFLLLLQFLYSGQVSMVPHKHEP  121

Query  465   RPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVL  644
             R NC +RGCWHTHCT+AVDL+LD L+AAR FGVEQLALLTQKQL SMVEKASIEDVM+VL
Sbjct  122   RSNCGDRGCWHTHCTAAVDLSLDILAAARYFGVEQLALLTQKQLTSMVEKASIEDVMKVL  181

Query  645   IASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhh  824
             IAS K +M QLWTTCS+LVAKSGLP E+LAKHLPI++VAK+E+LR KSS+   SL+ H H
Sbjct  182   IASRKHDMHQLWTTCSYLVAKSGLPTEILAKHLPIELVAKVEDLRLKSSMPLRSLMPHQH  241

Query  825   hrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVV  1004
                        EDQKIRRMRRALDS+DVELVKLMVMGEGLNLDE+LAL YAVENCSREVV
Sbjct  242   DLTSALDL---EDQKIRRMRRALDSADVELVKLMVMGEGLNLDESLALVYAVENCSREVV  298

Query  1005  KALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILR  1184
             KALLELGA DVNYPAG   +T LHIA+EMVSPDMV+VLLDHHADPNV+T DGITPLDILR
Sbjct  299   KALLELGAIDVNYPAGPTRKTALHIASEMVSPDMVAVLLDHHADPNVQTVDGITPLDILR  358

Query  1185  TLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAAL  1364
             TLTSDFLFKG +PGL H+EPNKLRLCLELVQSAA+V+SREEG     NN ++ V+YP   
Sbjct  359   TLTSDFLFKGTVPGLTHVEPNKLRLCLELVQSAALVMSREEG----INNDNNTVMYP---  411

Query  1365  AMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTRQNSGD  1544
              + +EH       SG S       LDSRLVYLNL       GG H NQ E M+   +  +
Sbjct  412   RLKDEH------MSGSS-------LDSRLVYLNL-------GGEHGNQMEGMSLHHHH-E  450

Query  1545  PPSMY  1559
             PP+MY
Sbjct  451   PPTMY  455



>emb|CDY06130.1| BnaA09g36500D [Brassica napus]
Length=462

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/485 (69%), Positives = 382/485 (79%), Gaps = 39/485 (8%)
 Frame = +3

Query  105   STVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdsp  284
             S++E+SL+S+SLDYLNLLINGQAFSDVTF+VEGRL+HAHRCILAARSLFFRKFFCG D  
Sbjct  10    SSIEESLKSMSLDYLNLLINGQAFSDVTFNVEGRLIHAHRCILAARSLFFRKFFCGSDPS  69

Query  285   gsdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEP  464
              +D             G+ +    +  VIPVNSVGYEVFLL++QFLYSGQVS+VP KHEP
Sbjct  70    QTDPANQ--------TGSGARAAVVGGVIPVNSVGYEVFLLLLQFLYSGQVSMVPHKHEP  121

Query  465   RPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVL  644
             R NC +RGCWHTHCT+AVDL+LD L+AAR FGVEQLALLTQKQL SMVEKASIEDVM+VL
Sbjct  122   RSNCGDRGCWHTHCTAAVDLSLDILAAARYFGVEQLALLTQKQLTSMVEKASIEDVMKVL  181

Query  645   IASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhh  824
             IAS K +M QLWTTCS+LVAKSGLP E+LAKHLPI++VAK+E+LR KSS+   SL+ H H
Sbjct  182   IASRKHDMHQLWTTCSYLVAKSGLPTEILAKHLPIELVAKVEDLRLKSSIPLRSLMPHQH  241

Query  825   hrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVV  1004
                        EDQKIRRMRRALDS+DVELVKLMVMGEGLNLDE+LAL YAVENCSREVV
Sbjct  242   DLTSALDL---EDQKIRRMRRALDSADVELVKLMVMGEGLNLDESLALVYAVENCSREVV  298

Query  1005  KALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILR  1184
             KALLELGA DVNYPAG   +T LHIA+EMVSPDMV+VLLDHHADPNV+T DGITPLDILR
Sbjct  299   KALLELGAIDVNYPAGPTRKTALHIASEMVSPDMVAVLLDHHADPNVQTVDGITPLDILR  358

Query  1185  TLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAAL  1364
             TLTSDFLFKG +PGL H+EPNKLRLCLELVQSAA+V+SREEG     N+ ++ V+YP   
Sbjct  359   TLTSDFLFKGTVPGLTHVEPNKLRLCLELVQSAALVMSREEG----INSDNNTVMYP---  411

Query  1365  AMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTRQNSGD  1544
              + +EH       SG S       LDSRLVYLNL       GG H NQ E M+   +  +
Sbjct  412   RLKDEH------MSGSS-------LDSRLVYLNL-------GGEHGNQMEGMSLHHHH-E  450

Query  1545  PPSMY  1559
             PP+MY
Sbjct  451   PPTMY  455



>ref|XP_008800205.1| PREDICTED: regulatory protein NPR5-like [Phoenix dactylifera]
Length=524

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/408 (77%), Positives = 336/408 (82%), Gaps = 24/408 (6%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC------------gpdspgsdspg  302
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC              D       G
Sbjct  17    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPSPGLLLLHQDLHPHHHHG  76

Query  303   sRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRE  482
              R     + +       + P VIPVNSVGYEVFLL++QFLYSGQVSIVPQKHEPRPNC E
Sbjct  77    PRSPSGASASSPRGASAAGPVVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCSE  136

Query  483   RGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQ  662
             RGCWHT CT+AVDLALDTL+AARSFGVEQLALLTQKQLASMVEKASIEDVM+VL+AS KQ
Sbjct  137   RGCWHTSCTAAVDLALDTLAAARSFGVEQLALLTQKQLASMVEKASIEDVMKVLMASRKQ  196

Query  663   EMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllah--------  818
             +M QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELR K+SLAR S            
Sbjct  197   DMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKTSLARRSSFMSHHPLDIAV  256

Query  819   --hhhrhdlgaaadlEDQ--KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVEN  986
                       AAA+LEDQ  KIRRMRRALDSSDVELVKLMVMGEGLNLD+ALALHYAVEN
Sbjct  257   AGVGPSSAAAAAAELEDQHHKIRRMRRALDSSDVELVKLMVMGEGLNLDDALALHYAVEN  316

Query  987   CSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGIT  1166
             CSREVVKALLELGAADVN PAG AG+TPLHIAAEMV PDMV+VLLDHHADPN+RT DG+T
Sbjct  317   CSREVVKALLELGAADVNCPAGPAGKTPLHIAAEMVCPDMVAVLLDHHADPNIRTVDGVT  376

Query  1167  PLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEG  1310
             PLDILRTLTSDFLFKGA+PGL+HIEPNKLRLCLELVQSAAMV+SREE 
Sbjct  377   PLDILRTLTSDFLFKGAVPGLSHIEPNKLRLCLELVQSAAMVMSREEA  424



>ref|XP_006646676.1| PREDICTED: regulatory protein NPR5-like [Oryza brachyantha]
Length=462

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/444 (72%), Positives = 350/444 (79%), Gaps = 40/444 (9%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFF                        
Sbjct  17    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFF------------------------  52

Query  339   aSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAV  518
              SP      VIPV+SV YEVFLL++QFLYSGQVS+VPQK EPRP C ERGCWHTHC +AV
Sbjct  53    -SPGA----VIPVSSVSYEVFLLLLQFLYSGQVSLVPQKGEPRPGCGERGCWHTHCAAAV  107

Query  519   DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
             DLALDTL+AARSFGVE+LALLTQKQLA MVEKASIEDVM+VL+AS KQ++ QLWTTCSHL
Sbjct  108   DLALDTLAAARSFGVEELALLTQKQLAGMVEKASIEDVMKVLMASRKQDLHQLWTTCSHL  167

Query  699   VAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarsslla----hhhhrhdlgaaadlEDQ  866
             VAKSGLPPEVLAKHLPIDVVAKI+ELR KS   RS  L+    HH    +   A   +  
Sbjct  168   VAKSGLPPEVLAKHLPIDVVAKIDELRLKSMSRRSPFLSHHHPHHPAGIEAPTAELDDHH  227

Query  867   KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYP  1046
             KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVN+P
Sbjct  228   KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNHP  287

Query  1047  AGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPG  1226
             AG AG+TPLH+AAEMV PDMV+VLLDHHADPNVRT DG+TPLDILRTLTSDFLFKGA+PG
Sbjct  288   AGPAGKTPLHVAAEMVCPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPG  347

Query  1227  LAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAALAMSEEHHHRNIP--  1400
             LAHIEPNKLRLCLELVQSAAMV+SRE+   A N       IY  + A             
Sbjct  348   LAHIEPNKLRLCLELVQSAAMVMSREDAQTAVNAAP----IYGESPAGGGGSPPGGGGVY  403

Query  1401  -SSGGSGNIVNLNLDSRLVYLNLG  1469
              +SG + ++VNL+LD+R+VYLNLG
Sbjct  404   NASGTNSSMVNLSLDNRMVYLNLG  427



>ref|XP_009391550.1| PREDICTED: regulatory protein NPR5 [Musa acuminata subsp. malaccensis]
Length=490

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/452 (74%), Positives = 368/452 (81%), Gaps = 20/452 (4%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFR+FFCG + P      S  G      GA
Sbjct  17    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRRFFCGTEPPPPGLLSSPRG------GA  70

Query  339   aSPRGS-IPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSA  515
             ASP  +    VIPVNS+ YEVFLLM+QFLYSGQVS++PQKHEPRPNC ERGCWHTHCT+A
Sbjct  71    ASPGATGAGVVIPVNSISYEVFLLMLQFLYSGQVSVMPQKHEPRPNCGERGCWHTHCTAA  130

Query  516   VDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSH  695
             VDLALDTL+AARSFGV+QL  +T+KQLAS+VEKASIEDVM+VL+AS +Q+MQQLW TCSH
Sbjct  131   VDLALDTLTAARSFGVKQLEQITEKQLASVVEKASIEDVMKVLMASRQQDMQQLWATCSH  190

Query  696   LVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllah--hhhrhdlgaaadlEDQ-  866
             LVAKSGLP EVLAKHLPIDVVA+IEELR KSSL R S       H     G AADLED  
Sbjct  191   LVAKSGLPAEVLAKHLPIDVVARIEELRLKSSLVRRSSFVGHHPHQIDVGGPAADLEDHH  250

Query  867   -KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNY  1043
              KIRRMRRALDSSDVELVKLMVMGEGLNLD+A ALHYAVENCSREVVKALLELGAADVN 
Sbjct  251   HKIRRMRRALDSSDVELVKLMVMGEGLNLDDAFALHYAVENCSREVVKALLELGAADVNC  310

Query  1044  PAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIP  1223
             PAG  G+TPLHIAAEMV PDMV+VLLDHHADPNVRT DG+TPLDILRTLTSDFLFKGA+P
Sbjct  311   PAGPTGKTPLHIAAEMVCPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVP  370

Query  1224  GLAHIEPNKLRLCLELVQSAAMVISREEGn----aaannnsssaVIYPAALAMSEEHHHR  1391
             GL+HIEPNKLRLCLELVQSAA+V+SREE N         NS S+VIYP    M+ E    
Sbjct  371   GLSHIEPNKLRLCLELVQSAALVMSREEANCGGGTGGAGNSPSSVIYP---RMNPEIGAC  427

Query  1392  NIPSSGGSGNIVNLNLDSRLVYLNLGAVENSG  1487
             N  ++  S ++VNL+LDSR+VYLNLG     G
Sbjct  428   N--TNSSSSSMVNLSLDSRMVYLNLGMAAQFG  457



>gb|EPS72362.1| hypothetical protein M569_02396, partial [Genlisea aurea]
Length=394

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/384 (78%), Positives = 324/384 (84%), Gaps = 25/384 (7%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLV+AHRCILAARSL+FRKFF                     +  
Sbjct  18    INGQAFSDVTFSVEGRLVNAHRCILAARSLYFRKFF--------------------SSTE  57

Query  339   aSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAV  518
              SPR     VIPVNSVGYEVFLL++QFLYSGQVSIVPQKHEPR NC ERGCWHTHC+SAV
Sbjct  58    GSPRSG--GVIPVNSVGYEVFLLVLQFLYSGQVSIVPQKHEPRANCGERGCWHTHCSSAV  115

Query  519   DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
             DLALDTLSAARSFGVEQL  +TQKQLASMVEK SIEDVM+VLIAS KQEM QLWTTCSHL
Sbjct  116   DLALDTLSAARSFGVEQLVYITQKQLASMVEKVSIEDVMKVLIASRKQEMPQLWTTCSHL  175

Query  699   VAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRR  878
             VAKSGLPPE+LAKHLPI+VVAKIEELR KS++A ++    HH    +      EDQKIRR
Sbjct  176   VAKSGLPPEILAKHLPIEVVAKIEELRLKSTIAMAAAGPRHHQSSAMAEL---EDQKIRR  232

Query  879   MRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAA  1058
             MRRALDSSDVELVKLMVMGEGLNLD++LALHYAVENCSREVVK+LLELGAADVN+ AG  
Sbjct  233   MRRALDSSDVELVKLMVMGEGLNLDDSLALHYAVENCSREVVKSLLELGAADVNFAAGPV  292

Query  1059  GRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHI  1238
             G+TPLHIAAEMV PDMV+VLLDHHADP VRTA+G+TPLDILR+LTSDFLFKGA+P L HI
Sbjct  293   GKTPLHIAAEMVCPDMVAVLLDHHADPTVRTAEGVTPLDILRSLTSDFLFKGAVPWLTHI  352

Query  1239  EPNKLRLCLELVQSAAMVISREEG  1310
             EPNKLRLCLELVQSAAMVISREE 
Sbjct  353   EPNKLRLCLELVQSAAMVISREEA  376



>ref|XP_004971245.1| PREDICTED: regulatory protein NPR5-like [Setaria italica]
Length=509

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/480 (68%), Positives = 376/480 (78%), Gaps = 33/480 (7%)
 Frame = +3

Query  111   VEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgs  290
             +ED+L+SLS+DYLNLLINGQAFSDVTF+VEGRLVHAHRCILAARSLFFRKFFCG  +   
Sbjct  1     MEDTLKSLSMDYLNLLINGQAFSDVTFNVEGRLVHAHRCILAARSLFFRKFFCGGAAADQ  60

Query  291   dspgsRMGLVgagagaaSPRGSIPQ--------------------VIPVNSVGYEVFLLM  410
              +  +            SPR                         VIPVNSV YEVF+L+
Sbjct  61    AAAAAAP-PGALLLDHLSPRSPSGASASSPRGAGVSAAAAAAPGAVIPVNSVSYEVFMLL  119

Query  411   MQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQK  590
             +QFLYSGQVS+VPQK EPRP C ERGCWHTHC +AVDLALDTL+AARSFGVE+LALLTQK
Sbjct  120   LQFLYSGQVSLVPQKGEPRPGCGERGCWHTHCAAAVDLALDTLAAARSFGVEELALLTQK  179

Query  591   QLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIE  770
             QLA MVEKASIEDVM+VL+AS KQ++ QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKI+
Sbjct  180   QLAGMVEKASIEDVMKVLMASRKQDLHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKID  239

Query  771   ELRHKsslarss------llahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVM  932
             ELR K+S++R S         H        A    +  KIRRMRRALDSSDVELVKLMVM
Sbjct  240   ELRLKTSMSRRSPFLAHHHPHHAAGIEASSAGELDDHHKIRRMRRALDSSDVELVKLMVM  299

Query  933   GEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVS  1112
             GEGLNLDEALALHYAVENCSREVVKALLELGAADVN+PAG AG+TPLH+AAEMV PDMV+
Sbjct  300   GEGLNLDEALALHYAVENCSREVVKALLELGAADVNHPAGPAGKTPLHVAAEMVCPDMVA  359

Query  1113  VLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMV  1292
             VLLDHHADPNVRT +G+TPLDILRTLTSDFLFKGA+PGLAHIEPNKLRLCLELVQSAAMV
Sbjct  360   VLLDHHADPNVRTVEGVTPLDILRTLTSDFLFKGAVPGLAHIEPNKLRLCLELVQSAAMV  419

Query  1293  ISREEGnaaannnsssaVI-YPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLG  1469
             +SRE+ + A    +++ +   P+  A    ++     +SG + ++VNL+LD+R+VYLNLG
Sbjct  420   MSREDAHTATAAVNAAPMYGEPSGGAGGAVYN-----ASGTNSSMVNLSLDNRMVYLNLG  474



>emb|CDX72067.1| BnaC08g28070D [Brassica napus]
Length=463

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/485 (69%), Positives = 380/485 (78%), Gaps = 39/485 (8%)
 Frame = +3

Query  105   STVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdsp  284
             S++E+SL+S+SLDYLNLLINGQ FSDVTF+VEGRLVHAHRCILAARSLFFRKFFCG D  
Sbjct  10    SSIEESLKSMSLDYLNLLINGQTFSDVTFNVEGRLVHAHRCILAARSLFFRKFFCGSDPS  69

Query  285   gsdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEP  464
              +D             G+ +    +  VIPVNSVGYEVFLL++QFLYSGQVS+VP KHEP
Sbjct  70    QTDPANQ--------TGSGARAAVVGGVIPVNSVGYEVFLLLLQFLYSGQVSMVPHKHEP  121

Query  465   RPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVL  644
             R NC +RGCWHTHCT+AVDL+LD L+AAR FGVEQLALLTQKQL SMVEKASIEDVM+VL
Sbjct  122   RSNCGDRGCWHTHCTAAVDLSLDILAAARYFGVEQLALLTQKQLTSMVEKASIEDVMKVL  181

Query  645   IASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhh  824
             IAS K +M QLWTTCS+LVAKSGLP E+LAKHLPI++VAK+E+LR KSS+   SL+ H H
Sbjct  182   IASRKHDMHQLWTTCSYLVAKSGLPTEILAKHLPIELVAKVEDLRLKSSMPLRSLMPHQH  241

Query  825   hrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVV  1004
                        EDQKIRRMRRAL S+DVELVKLMVMGEGLNLDE+LAL YAVENCSREVV
Sbjct  242   DLTSALDL---EDQKIRRMRRALHSADVELVKLMVMGEGLNLDESLALVYAVENCSREVV  298

Query  1005  KALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILR  1184
             KALLELGA DVNYPAG   +T LHIAAEMVSPDMV+VLLDHHADPNV+T DGITPLDILR
Sbjct  299   KALLELGAIDVNYPAGPTRKTALHIAAEMVSPDMVAVLLDHHADPNVQTVDGITPLDILR  358

Query  1185  TLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAAL  1364
             TLTSDFLFKG +PGL H+EPNKLRLCLELVQSAA+V+SREEG     NN ++ V+YP   
Sbjct  359   TLTSDFLFKGTVPGLTHVEPNKLRLCLELVQSAALVMSREEG----INNDNNTVMYP---  411

Query  1365  AMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTRQNSGD  1544
              + +EH       SG S       LDSRLVYLNL       GG H NQ E M+   +  +
Sbjct  412   RLKDEH------MSGSS-------LDSRLVYLNL-------GGEHGNQMEGMSLHHHH-E  450

Query  1545  PPSMY  1559
             PP+MY
Sbjct  451   PPTMY  455



>ref|XP_008798547.1| PREDICTED: LOW QUALITY PROTEIN: regulatory protein NPR5-like 
[Phoenix dactylifera]
Length=525

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/479 (70%), Positives = 362/479 (76%), Gaps = 41/479 (9%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRK-FFCgpdspgsdspgsRMGLVgagag  335
             INGQ+FSDVTFSVEGRLVHAHRCILAARSLFFRK F                 L      
Sbjct  17    INGQSFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPSPGLLLLHHQDLHSHHHH  76

Query  336   aaSPRGSIPQ----------------------VIPVNSVGYEVFLLMMQFLYSGQVSIVP  449
               SPR                           VIPVNSVGYEVFLL++QFLYSGQVS+VP
Sbjct  77    HQSPRSPSGASASSPRGGASPGSAAAGGAGPVVIPVNSVGYEVFLLLLQFLYSGQVSLVP  136

Query  450   QKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIED  629
             QKHEPRPNC ERGCWHTHCT+AVDLALDTL+AARSFGVEQLALLTQKQLASMVEKASIED
Sbjct  137   QKHEPRPNCGERGCWHTHCTAAVDLALDTLAAARSFGVEQLALLTQKQLASMVEKASIED  196

Query  630   VMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssl  809
             VM+VL+AS KQ+M QLWTTCSHLVAKSGLP EVLAKHLPIDVVAKIEELR KSSLAR S 
Sbjct  197   VMKVLMASRKQDMHQLWTTCSHLVAKSGLPAEVLAKHLPIDVVAKIEELRLKSSLARRSS  256

Query  810   ---------lahhhhrhdlgaaadlEDQ--KIRRMRRALDSSDVELVKLMVMGEGLNLDE  956
                      +A         AAA+LED   KIRRMRRALDSSDVELVKLMVMGEGLNLD+
Sbjct  257   FMAHHHPLDIAAAGAGPSSSAAAELEDHHHKIRRMRRALDSSDVELVKLMVMGEGLNLDD  316

Query  957   ALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHAD  1136
             ALALHYAVENCSREVVKALLELGAADVN PA  AG+TPLHIAAEMV PDMV+VLLDHHAD
Sbjct  317   ALALHYAVENCSREVVKALLELGAADVNCPARPAGKTPLHIAAEMVCPDMVAVLLDHHAD  376

Query  1137  PNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGna  1316
             PN+RT DG+TPLDILRTLTSDFLFKGA+PGL+HIEPNKLRLCLELVQSAA+V+SREE   
Sbjct  377   PNIRTVDGVTPLDILRTLTSDFLFKGAVPGLSHIEPNKLRLCLELVQSAALVMSREEAAN  436

Query  1317  aannnsssaV--IYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSG  1487
               +   S     IYP    M+ E  + N  +S  S ++VNL+LDSR+VYLNLG     G
Sbjct  437   CGSGGGSHPTTDIYP---PMNPEPSNCN--ASSASNSMVNLSLDSRMVYLNLGIAAQLG  490



>ref|NP_001140651.1| hypothetical protein [Zea mays]
 gb|ACF84271.1| unknown [Zea mays]
 gb|AFW83977.1| hypothetical protein ZEAMMB73_767493 [Zea mays]
 gb|AIB05285.1| TRAF transcription factor, partial [Zea mays]
Length=490

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/472 (70%), Positives = 371/472 (79%), Gaps = 30/472 (6%)
 Frame = +3

Query  111   VEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgs  290
             +ED+L+SLS+DYLNLLINGQAFSDVTF+VEGRLVHAHRCILAARSLFFRKFFCG +   +
Sbjct  1     MEDTLKSLSMDYLNLLINGQAFSDVTFNVEGRLVHAHRCILAARSLFFRKFFCGAEQAAA  60

Query  291   dspgsRMGLVgagagaaSPRG-SIPQ----------VIPVNSVGYEVFLLMMQFLYSGQV  437
                     L+       SP G S P+          VIPVNSV YEVFLL++QFLYSGQV
Sbjct  61    GPG----ALLLDHLSPRSPSGTSSPRGASAAAPGAAVIPVNSVSYEVFLLLLQFLYSGQV  116

Query  438   SIVPQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKA  617
             S+VPQK EPRP C ER CWHTHC +AVDLALDTL+AARSFGVE+LALLTQKQLA MVEKA
Sbjct  117   SLVPQKGEPRPGCGERACWHTHCAAAVDLALDTLAAARSFGVEELALLTQKQLAGMVEKA  176

Query  618   SIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKssla  797
             SIEDVM+VL+AS KQ++ QLWTTCSHLVAKSGLPPEVLAKHLP+DVV+KI+ELR KSSL+
Sbjct  177   SIEDVMKVLMASRKQDLHQLWTTCSHLVAKSGLPPEVLAKHLPMDVVSKIDELRLKSSLS  236

Query  798   rssllah-------hhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE  956
             R S                   AA   +  KIRRMRRALDSSDVELVKLMVMGEGLNLDE
Sbjct  237   RRSPFLAHHHHPAPGGGMEASSAADIDDHHKIRRMRRALDSSDVELVKLMVMGEGLNLDE  296

Query  957   ALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHAD  1136
             ALALHYAVENCSREVVKALLELGAADVN+ AG AG+TPLH+AAEMV PDMV+VLLDHHAD
Sbjct  297   ALALHYAVENCSREVVKALLELGAADVNHTAGPAGKTPLHVAAEMVCPDMVAVLLDHHAD  356

Query  1137  PNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGna  1316
             PNVRT +G+TPLDILRTLTSD LFKGA+PGLAHIEPNKLRLCLELVQSAAMV+SRE+ + 
Sbjct  357   PNVRTVEGVTPLDILRTLTSDLLFKGAVPGLAHIEPNKLRLCLELVQSAAMVMSREDAHT  416

Query  1317  aannnsssaVIYPAALAMSEEHHHRNIPSSG-GSGNIVNLNLDSRLVYLNLG  1469
             A N         P     S         +SG  S ++VNLNLD+R+VYLNLG
Sbjct  417   AVNAA-------PMYGEPSGGGGCGVYSASGTSSTSLVNLNLDNRMVYLNLG  461



>ref|XP_009386839.1| PREDICTED: regulatory protein NPR5 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=484

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/481 (69%), Positives = 365/481 (76%), Gaps = 33/481 (7%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFR FFCG DSP        +     G G 
Sbjct  17    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRSFFCGTDSPPPGL----LSSPRGGGGG  72

Query  339   aSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAV  518
             ASP  S   V+PVNSV YEVFLLM+QFLYSGQVS+VPQKHEPRPNC +RGCWHTHC +AV
Sbjct  73    ASPGASGGAVVPVNSVSYEVFLLMLQFLYSGQVSVVPQKHEPRPNCGDRGCWHTHCAAAV  132

Query  519   DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
             DLALDTL+AARSFGV+QL  +T+KQLASMVEKASIEDVM+VL+AS +Q+MQQLW TCSHL
Sbjct  133   DLALDTLAAARSFGVKQLEQITEKQLASMVEKASIEDVMKVLMASRQQDMQQLWATCSHL  192

Query  699   VAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhh--hrhdlgaaadlEDQ--  866
             VAKSGLP EVLAKHLPIDVVA+IEELR KSS AR       H       G AADLED   
Sbjct  193   VAKSGLPAEVLAKHLPIDVVARIEELRLKSSFARRPSFVARHPHQIDVAGPAADLEDHHH  252

Query  867   KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYP  1046
             KIRRMRRALDSSDVELVKLMVMGEGLNLD+ALALHYAVENC+REVVKALLELGAADVN P
Sbjct  253   KIRRMRRALDSSDVELVKLMVMGEGLNLDDALALHYAVENCTREVVKALLELGAADVNCP  312

Query  1047  AGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPG  1226
             AG  G+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPL+ILRTLTSDFLFKGA+PG
Sbjct  313   AGPTGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLEILRTLTSDFLFKGAVPG  372

Query  1227  LAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsss----aVIYPAALAMSEEHHHRN  1394
             L+HIEPNKLRLCLELVQSAA+V+SREE N+   N  +     A IYP           R 
Sbjct  373   LSHIEPNKLRLCLELVQSAALVMSREEANSGGGNGGAGNSPRAAIYP-----------RM  421

Query  1395  IPSSGGSGNIVNLNLDSRLVYLNLGAVE------NSGGGGHHNQREAMTTRQNSGDPPSM  1556
              P         +L+LDSR+VYLNLG         N GGG                 P S+
Sbjct  422   NPEIAA----CSLSLDSRMVYLNLGMAAQFGSKMNDGGGDESLSSRPQGGGGGGVGPSSI  477

Query  1557  Y  1559
             Y
Sbjct  478   Y  478



>ref|XP_009386610.1| PREDICTED: regulatory protein NPR5-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009386611.1| PREDICTED: regulatory protein NPR5-like [Musa acuminata subsp. 
malaccensis]
Length=490

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/462 (69%), Positives = 361/462 (78%), Gaps = 25/462 (5%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGR VHAHRCILAARSLFFR+FFCG D P         GL+ +    
Sbjct  17    INGQAFSDVTFSVEGRFVHAHRCILAARSLFFRRFFCGTDPPSP-------GLLSSPRRV  69

Query  339   aSPRGSIP---QVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCT  509
             A+  G+      VIPVNSV YEVFLL++QFLYSGQ S+VPQKH+PR  C ER CWHTHCT
Sbjct  70    AASPGTAGGGGTVIPVNSVSYEVFLLILQFLYSGQASVVPQKHQPRSGCGERSCWHTHCT  129

Query  510   SAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTC  689
             +AVDLALDTL+AARSFG++QL  + +KQLA MVEKASI+DVM+VL+AS +Q++QQLWTTC
Sbjct  130   AAVDLALDTLAAARSFGIKQLEQIIEKQLAVMVEKASIDDVMKVLVASRQQDLQQLWTTC  189

Query  690   SHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlED--  863
             SHLVAKSGLP EVLAKHLPIDVVA+IEELR KSSL R S    HHH   +  A    D  
Sbjct  190   SHLVAKSGLPAEVLAKHLPIDVVARIEELRFKSSLVRRSSFVAHHHHQQVDVAGSSADID  249

Query  864   ---QKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAAD  1034
                 KIRRMRRALDSSDVELVKLMVMGEGLNLD+ALALHYAVENCSREVVKALLELGAAD
Sbjct  250   DHHHKIRRMRRALDSSDVELVKLMVMGEGLNLDDALALHYAVENCSREVVKALLELGAAD  309

Query  1035  VNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKG  1214
             VN PAG +GRTPLH+AAEMV PDMV+VLLDHHADPNVRT DG+TP+DILRTLTS+FLFKG
Sbjct  310   VNRPAGPSGRTPLHVAAEMVCPDMVAVLLDHHADPNVRTVDGVTPIDILRTLTSEFLFKG  369

Query  1215  AIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAALAMSEEHHHRN  1394
             A+P L+HIEPNKLRLCLELVQSAA+V++REE N     ++ S  ++P    MS E    N
Sbjct  370   AVPALSHIEPNKLRLCLELVQSAALVMTREEANNCGAESNPSTSLFP---QMSPEAGSCN  426

Query  1395  IPSSGGSGNIVNLNLDSRLVYLNLGAVENSG-----GGGHHN  1505
                S  S  +++L+ DSR+VYLNLG  E  G     GGG  N
Sbjct  427   ASCSRSS--MIDLSPDSRMVYLNLGMAEQFGCKMNDGGGDEN  466



>ref|XP_009414176.1| PREDICTED: regulatory protein NPR5-like [Musa acuminata subsp. 
malaccensis]
Length=466

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/481 (66%), Positives = 363/481 (75%), Gaps = 42/481 (9%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRC+LAARSLFFR+FFCG D                    
Sbjct  19    INGQAFSDVTFSVEGRLVHAHRCVLAARSLFFRRFFCGSDPSSQR---------------  63

Query  339   aSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAV  518
               P G+   VIPVNSV YEVFLL++QFLYSGQ ++VPQKHE RP C ERGCWHTHCT+AV
Sbjct  64    -RPGGA--AVIPVNSVTYEVFLLILQFLYSGQTAVVPQKHELRPGCGERGCWHTHCTAAV  120

Query  519   DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
             DLALDTL+AARSFGV+QL  +T+KQL SMVEKASIEDVMRVL+A+ +Q+MQQLWTTCS L
Sbjct  121   DLALDTLAAARSFGVKQLEQITEKQLGSMVEKASIEDVMRVLMAAWQQDMQQLWTTCSLL  180

Query  699   VAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllah----hhhrhdlgaaadlED-  863
             VAKSGLP E+LAKHLP DVVA+IEELR +SSLAR           H      ++AD+ED 
Sbjct  181   VAKSGLPAELLAKHLPFDVVARIEELRLRSSLARRPSFLACHHYTHPIDVAISSADIEDH  240

Query  864   -QKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVN  1040
              QKIRRMRRALDSSDVELVKLMVMGEGLNLD+ALALHYAVENCSREVVKALLELGAADVN
Sbjct  241   HQKIRRMRRALDSSDVELVKLMVMGEGLNLDDALALHYAVENCSREVVKALLELGAADVN  300

Query  1041  YPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAI  1220
              PAGAAG+TPLHIAAEMV PDMV+VLLDHHADPN+RT +G+ PLDILRT+TSDFLFKG +
Sbjct  301   CPAGAAGKTPLHIAAEMVCPDMVAVLLDHHADPNIRTTEGVAPLDILRTMTSDFLFKGTL  360

Query  1221  PGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAALAMSEEHHHRNIP  1400
             PGL+H+EPNKLRLCLELVQSAA+V+SR++        + S  IYP     +E       P
Sbjct  361   PGLSHVEPNKLRLCLELVQSAALVMSRDDA-NYGAGTNPSTAIYPR--TNTETGACNATP  417

Query  1401  SSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTRQNSGD--PPSMYHHSHE  1574
             S   S +++NL+LDSR+VYLNLG  E  G               N GD   PS  + SH 
Sbjct  418   S---SSSMINLSLDSRMVYLNLGMAEQFG----------CKMDDNGGDESSPSSLYPSHG  464

Query  1575  Y  1577
             +
Sbjct  465   F  465



>emb|CDY30971.1| BnaC04g24530D [Brassica napus]
Length=455

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/489 (67%), Positives = 366/489 (75%), Gaps = 40/489 (8%)
 Frame = +3

Query  105   STVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdsp  284
             S+VE+SL++LSLD LNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFF     P
Sbjct  3     SSVEESLKTLSLDSLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFICGYDP  62

Query  285   gsdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEP  464
                   S   L G+   AA   G    VIPVNSVGYEVFLL++QFLYSGQVS+VP KHEP
Sbjct  63    SQTGVESANNLTGSVIRAAEMGG----VIPVNSVGYEVFLLLLQFLYSGQVSLVPHKHEP  118

Query  465   RPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVL  644
             R NC + GCWHTHCT+AVDL+LD L+AA  FGVEQLALLTQK L SMVE ASIEDVM+VL
Sbjct  119   RSNCGDSGCWHTHCTAAVDLSLDILAAAHYFGVEQLALLTQKHLTSMVENASIEDVMKVL  178

Query  645   IASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhh  824
             IAS K +M QLWTTCS+L+ KSGL  E+LAKHLPI++VAK+E+LRHKSS+     L    
Sbjct  179   IASRKHDMHQLWTTCSYLLTKSGLSTEILAKHLPIELVAKVEDLRHKSSMPHQHDLTSAL  238

Query  825   hrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVV  1004
                        +DQKIRRMRRALDSSDVELVKLMVMGEGLN+DE+LAL YAVENCSREVV
Sbjct  239   DL---------DDQKIRRMRRALDSSDVELVKLMVMGEGLNIDESLALIYAVENCSREVV  289

Query  1005  KALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILR  1184
             KALLE+GA DVN+      +T LHIAAEMVSPDMV+VLLDHHADPNV+T DGITPLDILR
Sbjct  290   KALLEIGATDVNFQVAPTRKTALHIAAEMVSPDMVAVLLDHHADPNVQTVDGITPLDILR  349

Query  1185  TLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAAL  1364
             TLTS+FLFKG I GL HIEPNKLRLCLEL+QSAA+VISREEGN   NN            
Sbjct  350   TLTSNFLFKGTIHGLTHIEPNKLRLCLELIQSAALVISREEGNNNDNN------------  397

Query  1365  AMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTTRQNSGD  1544
              M E+H      +SG        NLDSRLVYLNLGA     G  H +Q E M+   +  D
Sbjct  398   -MKEDH------TSGS-------NLDSRLVYLNLGATSRDLGDEHGHQTEGMSLHHHH-D  442

Query  1545  PPSMYHHSH  1571
             P +MYH+ H
Sbjct  443   PSTMYHYHH  451



>dbj|BAJ86934.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91942.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=513

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/475 (67%), Positives = 354/475 (75%), Gaps = 50/475 (11%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG  +  + +  +           
Sbjct  17    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGAAADQAAAAAAAGSPGAVLMDH  76

Query  339   aSPRGSIPQ-----------------------VIPVNSVGYEVFLLMMQFLYSGQVSIVP  449
              SPR                            VIPVNSV YEVFLL++QFLYSGQVS+VP
Sbjct  77    LSPRSPSGASASSPRGAGGSGSASAAAMAPGAVIPVNSVSYEVFLLVLQFLYSGQVSLVP  136

Query  450   QKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIED  629
             QK EPRP C ERGCWHTHC +AVDLALDTL+ ARSFGVE+LALLTQKQLA MVEKASIED
Sbjct  137   QKGEPRPGCGERGCWHTHCAAAVDLALDTLTVARSFGVEELALLTQKQLAGMVEKASIED  196

Query  630   VMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssl  809
             VM+VL+AS KQ++ QLW TCSHLVAKSGLPPEVLAKHLP+DVVAKI++LR KSS++R S 
Sbjct  197   VMKVLMASRKQDLHQLWNTCSHLVAKSGLPPEVLAKHLPLDVVAKIDDLRLKSSMSRRSP  256

Query  810   lahhh----------hrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEA  959
                HH             D  AA   +  KIRRMRRALDSSDVELVKLMVMGEGLNLDEA
Sbjct  257   FLAHHQQHQQHHHQGSVIDASAAELDDHNKIRRMRRALDSSDVELVKLMVMGEGLNLDEA  316

Query  960   LALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADP  1139
             LALHYAVENCSREVVKALLELGAADVN+PAG AG+TPLH+AAEMV PDMV+VLLDHHADP
Sbjct  317   LALHYAVENCSREVVKALLELGAADVNHPAGPAGKTPLHVAAEMVCPDMVAVLLDHHADP  376

Query  1140  NVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaa  1319
             NVRT DG+TPLDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMV+SRE+    
Sbjct  377   NVRTVDGVTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVMSREDAAGN  436

Query  1320  annnsssaVIYPAALAMSEEHH-----HRNIPSSGGSGNIVNLNLDSRLVYLNLG  1469
                         A + M  +HH           +GG+   +NL+LD+R+VYLNLG
Sbjct  437   ------------AMVPMYSDHHPGAGGGGVYSGTGGTSTSMNLSLDNRMVYLNLG  479



>ref|XP_003565065.1| PREDICTED: regulatory protein NPR5-like [Brachypodium distachyon]
Length=517

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/479 (67%), Positives = 363/479 (76%), Gaps = 55/479 (11%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagag-  335
             INGQAFSDV+FSVEGRLVHAHRCILAARSLFFRKFFCG     S        L       
Sbjct  17    INGQAFSDVSFSVEGRLVHAHRCILAARSLFFRKFFCGQQQQASADQPLMDHLSPRSPSG  76

Query  336   --aaSPRGSIPQ----------VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCR  479
               A+SPRG              VIPV+SV YEVFLL++QFLYSGQVS+VPQK EPRP C 
Sbjct  77    AGASSPRGGSTAAAAAAAGPGAVIPVSSVSYEVFLLLLQFLYSGQVSLVPQKGEPRPGCG  136

Query  480   ERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGK  659
             ERGCWHTHC +AVDLALDTL+AARSFGVE+LALLTQKQLA MVEKASIEDVM+VL+AS K
Sbjct  137   ERGCWHTHCAAAVDLALDTLAAARSFGVEELALLTQKQLAGMVEKASIEDVMKVLMASRK  196

Query  660   QEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdl  839
             Q++ QLWTTCSHLVAKSGLPPEVLAKHLP+D+VAKI++LR KSS++R S     HH    
Sbjct  197   QDLHQLWTTCSHLVAKSGLPPEVLAKHLPLDMVAKIDDLRLKSSMSRRSSPFLAHHHGHH  256

Query  840   gaaadlED---------------QKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHY  974
                   +                 KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHY
Sbjct  257   DTQQQQQQPSSDQQQQHLLDDAHHKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHY  316

Query  975   AVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRT-  1151
             AVENCSREVVKALLELGAADVN+PAG AG+TPLH+AAEMV PDMV+VLLDHHADPNVRT 
Sbjct  317   AVENCSREVVKALLELGAADVNHPAGPAGKTPLHVAAEMVCPDMVAVLLDHHADPNVRTL  376

Query  1152  ADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannn  1331
             ADG+TPLDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMV+SRE+ N+     
Sbjct  377   ADGVTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVMSREDNNSNN---  433

Query  1332  sssaVIYPAALAMS---EEHHHRNIPSSGGSG----------NIVNLNLDSRLVYLNLG  1469
                    PAA++M+   ++H H++    GG+             +NL+LD+R+VYLNLG
Sbjct  434   -------PAAVSMAYGGDQHQHQH---PGGAAVYGGGSGVTSTGMNLSLDNRMVYLNLG  482



>ref|XP_008808778.1| PREDICTED: regulatory protein NPR6-like [Phoenix dactylifera]
Length=512

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/499 (64%), Positives = 373/499 (75%), Gaps = 32/499 (6%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpd-------spgsdspgsRMGL  317
             INGQAFSDV FSV+GRLVHAHRC+LAARSLFFR+ FCGPD             P      
Sbjct  19    INGQAFSDVAFSVDGRLVHAHRCVLAARSLFFRRLFCGPDPPPGLHLLDPHRHPLHHHHS  78

Query  318   VgagagaaSPRGSIPQ--VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGC  491
               +  G AS RG +    VIP+NSVGYE FLL++QFLYSGQVS+VP KHEPRP+C ERGC
Sbjct  79    PRSPTGQASGRGGVSAGVVIPLNSVGYEAFLLLLQFLYSGQVSVVPPKHEPRPDCSERGC  138

Query  492   WHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQ  671
             WHTHCTSA+DLALDTLSAARSFG+EQLAL+TQKQL SMVEKASI+DVM+VL+AS KQ+M 
Sbjct  139   WHTHCTSAIDLALDTLSAARSFGIEQLALITQKQLESMVEKASIKDVMKVLMASHKQDMH  198

Query  672   QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssl---lahhhhrhdlg  842
             QLWTTCSHL+A SGLPPEVL KHLP+D+VAKIEELR K              HH+   + 
Sbjct  199   QLWTTCSHLIADSGLPPEVLGKHLPMDIVAKIEELRLKPGRPTFLTHHPNPTHHYLTAVP  258

Query  843   aaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLEL  1022
                  +  KIRRMRRALDSSD+ELVKLMVMGEGL+LD+ALALHYAV+NCSREVVKALLEL
Sbjct  259   TMGPDDHHKIRRMRRALDSSDIELVKLMVMGEGLDLDDALALHYAVQNCSREVVKALLEL  318

Query  1023  GAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDF  1202
             GAADVN PAG AG+TPLHIAAEMV+PDMV+VLLDHHADPNVRT DG+TPLDILR LTSDF
Sbjct  319   GAADVNCPAGPAGKTPLHIAAEMVNPDMVAVLLDHHADPNVRTVDGVTPLDILRNLTSDF  378

Query  1203  LFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREE---------GnaaannnsssaVIYP  1355
             LFKGA+PGL+HIEPNKLRLCLELVQSAAMVISREE         G A+  N+ + A+  P
Sbjct  379   LFKGAVPGLSHIEPNKLRLCLELVQSAAMVISREEEAAAAAAAGGGASGGNDPNPAIYQP  438

Query  1356  AALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLG--AVENSGGGGHHNQREAMTTR  1529
              +     + +  N  SS     +V+L+LDSR+VYLNLG  A  + G      ++ +  +R
Sbjct  439   MSTTEGSDCNANNTDSS-----MVSLSLDSRMVYLNLGMAAAAHLGCKIDDGRQGSNGSR  493

Query  1530  QNSGD---PPSMYHHSHEY  1577
                G    P SM+ H H++
Sbjct  494   SQGGSGIGPSSMFSH-HDF  511



>ref|XP_010922182.1| PREDICTED: regulatory protein NPR6-like [Elaeis guineensis]
Length=515

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/493 (64%), Positives = 366/493 (74%), Gaps = 24/493 (5%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsd-spgsRMGLVgagag  335
             INGQAFSDV FSV+GRLVHAHRC+LAARSLFFR+ FCGPD P            +     
Sbjct  19    INGQAFSDVAFSVDGRLVHAHRCVLAARSLFFRRLFCGPDPPPGLHLLDPHRHPLHHHHS  78

Query  336   aaSPRG--------SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGC  491
               SP G        S   VIP+NSVGYE FLL++QFLYSGQVSIVP KHEPRP+C ERGC
Sbjct  79    PRSPTGPASGRVGVSAGVVIPLNSVGYEAFLLLLQFLYSGQVSIVPPKHEPRPDCSERGC  138

Query  492   WHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQ  671
             WHTHCTSA+DLALDTLSAARSFG+EQLAL+TQKQL SMVEKASI+DVM+VL+AS KQ+M 
Sbjct  139   WHTHCTSAIDLALDTLSAARSFGIEQLALITQKQLESMVEKASIKDVMKVLMASHKQDMH  198

Query  672   QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKs---slarssllahhhhrhdlg  842
             QLWTTCSHL+A SGLPPEVL KHLP+D+VAKIEELR K    +         HH+   + 
Sbjct  199   QLWTTCSHLIADSGLPPEVLGKHLPMDIVAKIEELRLKPGRPTFLTHHPHPTHHYLPAVP  258

Query  843   aaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLEL  1022
                  +  KIRRMRRALDSSD+ELVKLMVMGEGL+LD+ALALHYAV+NCSREVVKALLEL
Sbjct  259   TMGPDDHHKIRRMRRALDSSDIELVKLMVMGEGLDLDDALALHYAVQNCSREVVKALLEL  318

Query  1023  GAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDF  1202
             GAADVN PAG AG+TPLHIAAEMV+PDMV+VLLDHHADPNVRT DG+TPLDILR LTSDF
Sbjct  319   GAADVNCPAGPAGKTPLHIAAEMVNPDMVAVLLDHHADPNVRTVDGVTPLDILRNLTSDF  378

Query  1203  LFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIY-------PAA  1361
             LFKGA+PGL+HIEPNKLRLCLELVQSAAMVISREE  AAA   +++           PA 
Sbjct  379   LFKGAVPGLSHIEPNKLRLCLELVQSAAMVISREEEAAAAAAAAAAGGGASGGSNPNPAI  438

Query  1362  LAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLG--AVENSGGGGHHNQREAMTTRQN  1535
                       +  ++    ++V+L+LDSR+VYLNLG  A  + G      ++ +  +R  
Sbjct  439   YQPMSTAEGSDCNANSTDSSMVSLSLDSRMVYLNLGMAAAAHLGCKIDDGRQGSNGSRSQ  498

Query  1536  SGD---PPSMYHH  1565
              G    P SM+ H
Sbjct  499   GGSGIGPSSMFSH  511



>emb|CDM86436.1| unnamed protein product [Triticum aestivum]
Length=514

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/477 (66%), Positives = 354/477 (74%), Gaps = 52/477 (11%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG  +  + +  +           
Sbjct  17    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGAAADQAAAAAAAGSPGAVLMDH  76

Query  339   aSPRGSIPQ-------------------------VIPVNSVGYEVFLLMMQFLYSGQVSI  443
              SPR                              VIPVNSV YEVFLL++QFLYSGQVS+
Sbjct  77    LSPRSPSGASASSPRGAGGSGSGSASAAAMAPGAVIPVNSVSYEVFLLLLQFLYSGQVSL  136

Query  444   VPQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASI  623
             VPQK EPRP C ERGCWHTHC +AVDLALDTL+ ARSFGVE+LA+LTQKQLA MVEKASI
Sbjct  137   VPQKGEPRPGCGERGCWHTHCPAAVDLALDTLAVARSFGVEELAVLTQKQLAGMVEKASI  196

Query  624   EDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslars  803
             EDVM+VL+AS KQ++ QLW TCSHLVAKSGLPPEVLAKHLP+DVVAKI++LR KSS++R 
Sbjct  197   EDVMKVLMASRKQDLHQLWNTCSHLVAKSGLPPEVLAKHLPLDVVAKIDDLRLKSSMSRR  256

Query  804   sllahhh----------hrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLD  953
             S    HH             +  AA   +  KIRRMRRALDSSDVELVKLMVMGEGLNLD
Sbjct  257   SPFLAHHQQHQQHHHQGSVIEASAAELDDHNKIRRMRRALDSSDVELVKLMVMGEGLNLD  316

Query  954   EALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHA  1133
             EALALHYAVENCSREVVKALLELGAADVN+PAG AG+TPLH+AAEMV PDMV+VLLDHHA
Sbjct  317   EALALHYAVENCSREVVKALLELGAADVNHPAGPAGKTPLHVAAEMVCPDMVAVLLDHHA  376

Query  1134  DPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGn  1313
             DPNVRT DG+TPLDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMV+SRE+  
Sbjct  377   DPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVMSREDAA  436

Query  1314  aaannnsssaVIYPAALAMSEEHH-----HRNIPSSGGSGNIVNLNLDSRLVYLNLG  1469
                           A + M  +HH           +GG+   +NL+LD+R+VYLNLG
Sbjct  437   GN------------APVPMYSDHHPGAGGGGVYSGTGGASTSMNLSLDNRMVYLNLG  481



>ref|XP_009386840.1| PREDICTED: regulatory protein NPR5 isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=483

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/481 (69%), Positives = 364/481 (76%), Gaps = 34/481 (7%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFR FFCG DSP        +     G G 
Sbjct  17    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRSFFCGTDSPPPGL----LSSPRGGGGG  72

Query  339   aSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAV  518
             ASP  S   V+PVNSV YEVFLLM+QFLYSGQVS+VPQKHEPRPNC +RGCWHTHC +AV
Sbjct  73    ASPGASGGAVVPVNSVSYEVFLLMLQFLYSGQVSVVPQKHEPRPNCGDRGCWHTHCAAAV  132

Query  519   DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
             DLALDTL+AARSFGV+QL  +T+ QLASMVEKASIEDVM+VL+AS +Q+MQQLW TCSHL
Sbjct  133   DLALDTLAAARSFGVKQLEQITE-QLASMVEKASIEDVMKVLMASRQQDMQQLWATCSHL  191

Query  699   VAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhh--hrhdlgaaadlEDQ--  866
             VAKSGLP EVLAKHLPIDVVA+IEELR KSS AR       H       G AADLED   
Sbjct  192   VAKSGLPAEVLAKHLPIDVVARIEELRLKSSFARRPSFVARHPHQIDVAGPAADLEDHHH  251

Query  867   KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYP  1046
             KIRRMRRALDSSDVELVKLMVMGEGLNLD+ALALHYAVENC+REVVKALLELGAADVN P
Sbjct  252   KIRRMRRALDSSDVELVKLMVMGEGLNLDDALALHYAVENCTREVVKALLELGAADVNCP  311

Query  1047  AGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPG  1226
             AG  G+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPL+ILRTLTSDFLFKGA+PG
Sbjct  312   AGPTGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLEILRTLTSDFLFKGAVPG  371

Query  1227  LAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsss----aVIYPAALAMSEEHHHRN  1394
             L+HIEPNKLRLCLELVQSAA+V+SREE N+   N  +     A IYP           R 
Sbjct  372   LSHIEPNKLRLCLELVQSAALVMSREEANSGGGNGGAGNSPRAAIYP-----------RM  420

Query  1395  IPSSGGSGNIVNLNLDSRLVYLNLGAVE------NSGGGGHHNQREAMTTRQNSGDPPSM  1556
              P         +L+LDSR+VYLNLG         N GGG                 P S+
Sbjct  421   NPEIAA----CSLSLDSRMVYLNLGMAAQFGSKMNDGGGDESLSSRPQGGGGGGVGPSSI  476

Query  1557  Y  1559
             Y
Sbjct  477   Y  477



>ref|XP_009104042.1| PREDICTED: regulatory protein NPR6-like isoform X1 [Brassica 
rapa]
Length=462

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/468 (68%), Positives = 356/468 (76%), Gaps = 32/468 (7%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFF G D P + +  +    V      
Sbjct  18    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFYGSDLPQTGTSSASGARV------  71

Query  339   aSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAV  518
                  S+  V+PVNSV YEVFLL++QFLYSGQVS+VP KHE R NC +RGCWHT CT+AV
Sbjct  72    ----ASVGGVVPVNSVSYEVFLLLLQFLYSGQVSLVPHKHESRSNCGDRGCWHTQCTAAV  127

Query  519   DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
             DL+LD L+AAR FGVEQLALLTQK L SMVEKASIEDVM+VLIAS KQ+M QLWTTCS+L
Sbjct  128   DLSLDILAAARYFGVEQLALLTQKHLTSMVEKASIEDVMKVLIASRKQDMHQLWTTCSYL  187

Query  699   VAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRR  878
             V+KSGLP E+LAKHLPI+++ K+EELR KSS+   SL+ H H ++        EDQKI+R
Sbjct  188   VSKSGLPTEILAKHLPIELLGKVEELRLKSSIPLRSLMPHQHDQNSALNL---EDQKIKR  244

Query  879   MRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAA  1058
             MRRALDSSD ELVKLMVMGEGLNLDE+LAL YAVENCSREVVKALLELGAADVN+PAG  
Sbjct  245   MRRALDSSDFELVKLMVMGEGLNLDESLALFYAVENCSREVVKALLELGAADVNHPAGPT  304

Query  1059  GRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHI  1238
              +T LHIAAEMVSPDMV+VLLDHHADP V+T DGITPLDILRTLTSDFLFKG I GL HI
Sbjct  305   RKTALHIAAEMVSPDMVAVLLDHHADPTVQTVDGITPLDILRTLTSDFLFKGTIHGLTHI  364

Query  1239  EPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAALAMSEEHHHRNIPSSGGSG  1418
             EPNKLRLCLELVQSAAMVISREEG    NNN ++ VIYP           ++    G S 
Sbjct  365   EPNKLRLCLELVQSAAMVISREEG--NNNNNVNNTVIYPRM---------KDKRVKGSS-  412

Query  1419  NIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTT-RQNSGDPPSMY  1559
                   LDSRLVYLN GA     G  H NQ E  +    +  DP +MY
Sbjct  413   ------LDSRLVYLNRGATNPDFGDEHGNQTEETSLHHHHYHDPSTMY  454



>ref|XP_009386838.1| PREDICTED: regulatory protein NPR6 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=493

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/490 (68%), Positives = 365/490 (74%), Gaps = 42/490 (9%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFR FFCG DSP        +     G G 
Sbjct  17    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRSFFCGTDSPPPGL----LSSPRGGGGG  72

Query  339   aSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAV  518
             ASP  S   V+PVNSV YEVFLLM+QFLYSGQVS+VPQKHEPRPNC +RGCWHTHC +AV
Sbjct  73    ASPGASGGAVVPVNSVSYEVFLLMLQFLYSGQVSVVPQKHEPRPNCGDRGCWHTHCAAAV  132

Query  519   DLALDTLSAARSFGVEQLALLT---------QKQLASMVEKASIEDVMRVLIASGKQEMQ  671
             DLALDTL+AARSFGV+QL  +T         QKQLASMVEKASIEDVM+VL+AS +Q+MQ
Sbjct  133   DLALDTLAAARSFGVKQLEQITESLSFGGWVQKQLASMVEKASIEDVMKVLMASRQQDMQ  192

Query  672   QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhh--hrhdlga  845
             QLW TCSHLVAKSGLP EVLAKHLPIDVVA+IEELR KSS AR       H       G 
Sbjct  193   QLWATCSHLVAKSGLPAEVLAKHLPIDVVARIEELRLKSSFARRPSFVARHPHQIDVAGP  252

Query  846   aadlEDQ--KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLE  1019
             AADLED   KIRRMRRALDSSDVELVKLMVMGEGLNLD+ALALHYAVENC+REVVKALLE
Sbjct  253   AADLEDHHHKIRRMRRALDSSDVELVKLMVMGEGLNLDDALALHYAVENCTREVVKALLE  312

Query  1020  LGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSD  1199
             LGAADVN PAG  G+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPL+ILRTLTSD
Sbjct  313   LGAADVNCPAGPTGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLEILRTLTSD  372

Query  1200  FLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsss----aVIYPAALA  1367
             FLFKGA+PGL+HIEPNKLRLCLELVQSAA+V+SREE N+   N  +     A IYP    
Sbjct  373   FLFKGAVPGLSHIEPNKLRLCLELVQSAALVMSREEANSGGGNGGAGNSPRAAIYP----  428

Query  1368  MSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVE------NSGGGGHHNQREAMTTR  1529
                    R  P         +L+LDSR+VYLNLG         N GGG            
Sbjct  429   -------RMNPEIAA----CSLSLDSRMVYLNLGMAAQFGSKMNDGGGDESLSSRPQGGG  477

Query  1530  QNSGDPPSMY  1559
                  P S+Y
Sbjct  478   GGGVGPSSIY  487



>gb|EPS73625.1| hypothetical protein M569_01131, partial [Genlisea aurea]
Length=392

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/391 (73%), Positives = 316/391 (81%), Gaps = 27/391 (7%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARS FFRKFF                        
Sbjct  18    INGQAFSDVTFSVEGRLVHAHRCILAARSPFFRKFF--------------------SGSD  57

Query  339   aSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAV  518
             A P  +   V+PVNSVGYEVFLL++QFLYSGQVSIVP KHEPRP+C ERGCWHTHC+SAV
Sbjct  58    APPPVAGQVVVPVNSVGYEVFLLLLQFLYSGQVSIVPHKHEPRPDCGERGCWHTHCSSAV  117

Query  519   DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
             DLALDTLSAARSFGVEQLALLTQKQL  MVEKA IEDVM+VL+AS  QE+ QLW TCSH+
Sbjct  118   DLALDTLSAARSFGVEQLALLTQKQLGMMVEKACIEDVMKVLMASRNQELSQLWNTCSHV  177

Query  699   VAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadl-------  857
             VAKSG+PPE+L KHLPI+VVA+IEELR K++++               +           
Sbjct  178   VAKSGVPPELLTKHLPIEVVARIEELRLKTTISGGGGGGGGGGGGGACSLVQQHDHHINL  237

Query  858   EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADV  1037
             EDQKIRRMRRAL++SDVELVKLMVMGEGLNLDE LALHYAVENC+REVVKALLE+GAADV
Sbjct  238   EDQKIRRMRRALEASDVELVKLMVMGEGLNLDETLALHYAVENCTREVVKALLEIGAADV  297

Query  1038  NYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGA  1217
             N PAG +G+TPLH+AAEMVSPDMV+VLLDHHADPN RT DG+TPLD+LRTLTSDFLFKGA
Sbjct  298   NLPAGPSGKTPLHLAAEMVSPDMVAVLLDHHADPNSRTVDGVTPLDVLRTLTSDFLFKGA  357

Query  1218  IPGLAHIEPNKLRLCLELVQSAAMVISREEG  1310
             +PGL H+EPNKLRLCLELVQSAA VISREEG
Sbjct  358   VPGLYHVEPNKLRLCLELVQSAAAVISREEG  388



>emb|CDX67678.1| BnaA07g17180D [Brassica napus]
Length=462

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/468 (67%), Positives = 353/468 (75%), Gaps = 32/468 (7%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFS+EGRLVHAHRCILAARSLFFRKFF G D P + +  +    V      
Sbjct  18    INGQAFSDVTFSLEGRLVHAHRCILAARSLFFRKFFYGSDPPQTVTSSASGARV------  71

Query  339   aSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAV  518
                  S+  V+PVNSV YEVFLL++QFLYSGQVS+VP KHE R NC +RGCWHT CT+AV
Sbjct  72    ----ASVGGVVPVNSVSYEVFLLLLQFLYSGQVSLVPHKHESRSNCGDRGCWHTQCTAAV  127

Query  519   DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
             DL+LD L+AAR FGVEQLALLTQK L SMVEKASIEDVM+VLIAS KQ+M QLWTTCS+L
Sbjct  128   DLSLDILAAARYFGVEQLALLTQKHLTSMVEKASIEDVMKVLIASRKQDMHQLWTTCSYL  187

Query  699   VAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRR  878
             VAKSG P E+LAKHLPI+++ K+EELR KSS+   SL+ H   ++        EDQKI+R
Sbjct  188   VAKSGFPTEILAKHLPIELLGKVEELRLKSSIPLRSLMPHQQDQNSALNL---EDQKIKR  244

Query  879   MRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAA  1058
             MRRALDSSD ELVKLMVMGEGLNLDE+LAL YAVENCSREVVKALLELGAADVN+PAG  
Sbjct  245   MRRALDSSDFELVKLMVMGEGLNLDESLALFYAVENCSREVVKALLELGAADVNHPAGPT  304

Query  1059  GRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHI  1238
              +T LHIAAEMVSPDMV+VLLDHHADP V+T DGITPLDILRTLTSDFLFKG I GL HI
Sbjct  305   RKTALHIAAEMVSPDMVAVLLDHHADPTVQTVDGITPLDILRTLTSDFLFKGTIHGLTHI  364

Query  1239  EPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAALAMSEEHHHRNIPSSGGSG  1418
             EPNKLRLCLELVQSAAMVISREEG    NNN ++ VIYP           ++  + G S 
Sbjct  365   EPNKLRLCLELVQSAAMVISREEG--NNNNNVNNTVIYPRM---------KDKRTKGSS-  412

Query  1419  NIVNLNLDSRLVYLNLGAVENSGGGGHHNQREAMTT-RQNSGDPPSMY  1559
                   LDSRLVYLN GA     G  H  Q E       +  DP +MY
Sbjct  413   ------LDSRLVYLNRGATNPDFGDEHGIQTEETGLHHHHYHDPSTMY  454



>gb|EMT28620.1| Regulatory protein NPR1 [Aegilops tauschii]
Length=523

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/486 (65%), Positives = 354/486 (73%), Gaps = 61/486 (13%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG  +  + +  +           
Sbjct  17    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGAAADQAAAAAAAGSPGAVLMDH  76

Query  339   aSPRGSIPQ-------------------------VIPVNSVGYEVFLLMMQFLYSGQVSI  443
              SPR                              VIPVNSV YEVFLL++QFLYSGQVS+
Sbjct  77    LSPRSPSGASASSPRGAGGSGSGSASAAAMAPGAVIPVNSVSYEVFLLLLQFLYSGQVSL  136

Query  444   VPQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASI  623
             VPQK EPRP C ERGCWHTHC +AVDLALDTL+ ARSFGVE+LA+LTQKQLA MVEKASI
Sbjct  137   VPQKGEPRPGCGERGCWHTHCAAAVDLALDTLAVARSFGVEELAVLTQKQLAGMVEKASI  196

Query  624   EDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslars  803
             EDVM+VL+AS KQ++ QLW TCSHLVAKSGLPPEVLAKHLP+DVVAKI++LR KSS++R 
Sbjct  197   EDVMKVLMASRKQDLHQLWNTCSHLVAKSGLPPEVLAKHLPLDVVAKIDDLRLKSSMSRR  256

Query  804   sllahhh----------hrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLD  953
             S    HH             +  AA   +  KIRRMRRALDSSDVELVKLMVMGEGLNLD
Sbjct  257   SPFLAHHQQHQQHHHQGSVIEASAAELDDHNKIRRMRRALDSSDVELVKLMVMGEGLNLD  316

Query  954   EALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEM---------VSPDM  1106
             EALALHYAVENCSREVVKALLELGAADVN+PAG AG+TPLH+AAEM         V PDM
Sbjct  317   EALALHYAVENCSREVVKALLELGAADVNHPAGPAGKTPLHVAAEMTPRHVAAEMVCPDM  376

Query  1107  VSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAA  1286
             V+VLLDHHADPNVRT DG+TPLDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA
Sbjct  377   VAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAA  436

Query  1287  MVISREEGnaaannnsssaVIYPAALAMSEEHH-----HRNIPSSGGSGNIVNLNLDSRL  1451
             MV+SRE+                A + M  +HH           +GG+   +NL+LD+R+
Sbjct  437   MVMSREDAAGN------------APVPMYSDHHPGAGGGGVYSGTGGASTSMNLSLDNRM  484

Query  1452  VYLNLG  1469
             VYLNLG
Sbjct  485   VYLNLG  490



>emb|CBI30078.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/387 (80%), Positives = 326/387 (84%), Gaps = 23/387 (6%)
 Frame = +3

Query  417   FLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQL  596
             FLYSGQVSIVPQKHEPRPNC ERGCWHTHCTSAVDLALDTL+AARSFGVEQLALLTQKQL
Sbjct  36    FLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAVDLALDTLAAARSFGVEQLALLTQKQL  95

Query  597   ASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEEL  776
             ASMVEKASIEDVM+VLIAS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEEL
Sbjct  96    ASMVEKASIEDVMKVLIASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEEL  155

Query  777   RHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE  956
             R KSSLAR SL+ HHHH  D+GAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE
Sbjct  156   RLKSSLARRSLMPHHHHHQDIGAAADLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE  215

Query  957   ALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHAD  1136
             ALALHYAVENCSREVVKALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHAD
Sbjct  216   ALALHYAVENCSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHAD  275

Query  1137  PNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGna  1316
             PNVRT DG+TPLD+LRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAA+V+SREEG  
Sbjct  276   PNVRTVDGVTPLDVLRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVLSREEG--  333

Query  1317  aannnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGG  1496
              + N  SS  IYP               SS  S N+ +LNLDSRLVYLNLGA   +  G 
Sbjct  334   -SANAPSSTTIYPPMSDDHH--------SSSSSSNMASLNLDSRLVYLNLGATAMNRHGS  384

Query  1497  HHNQREAMTTRQNSGDPPSMYHHSHEY  1577
                           G   SMYHHSHEY
Sbjct  385   ------------QGGCDTSMYHHSHEY  399



>ref|XP_010931998.1| PREDICTED: regulatory protein NPR5-like [Elaeis guineensis]
Length=508

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/500 (63%), Positives = 367/500 (73%), Gaps = 45/500 (9%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLV------  320
             INGQAFSDV FSV+GRL+HAHRC+LAARSLFFR+ FCGPD P         GL       
Sbjct  19    INGQAFSDVAFSVDGRLIHAHRCVLAARSLFFRRLFCGPDPPP--------GLTLLDPHR  70

Query  321   ---gagagaaSPRG-SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERG  488
                       SP G ++  VIP+NSVGYE FLL++QFLYSGQVS++P K  PRP+C ERG
Sbjct  71    HHHQHQLSPRSPSGPALGTVIPLNSVGYEAFLLLLQFLYSGQVSVMPNK--PRPDCSERG  128

Query  489   CWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEM  668
             C HTHCTSA+DLALDTL+ ARSFGV++LAL+TQKQL SMVEKASI+DVM+VL+AS KQ+M
Sbjct  129   CSHTHCTSAIDLALDTLATARSFGVQELALITQKQLESMVEKASIKDVMKVLMASHKQDM  188

Query  669   QQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHK----sslarssllahhhhrhd  836
              QLWTT SHL+A SGLPPEVL+KHLPID+VAKIEELR K    S L   S   HH+    
Sbjct  189   HQLWTTSSHLIADSGLPPEVLSKHLPIDIVAKIEELRLKPGRHSFLTHHSHPTHHYFPAA  248

Query  837   lgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALL  1016
                A   +  KI RMRRALDSSD++L+KLMVMGEGL+L+ ALA+HYAV+NCSREVVKALL
Sbjct  249   SPTAGPDDHHKIHRMRRALDSSDIDLLKLMVMGEGLDLNNALAVHYAVQNCSREVVKALL  308

Query  1017  ELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTS  1196
             ELGAADVN PAG AG+TPLHIAAEMV+PDMVSVLLDHHADPNVRT DG+TPLDILR LTS
Sbjct  309   ELGAADVNCPAGPAGKTPLHIAAEMVNPDMVSVLLDHHADPNVRTIDGVTPLDILRNLTS  368

Query  1197  DFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREE------------Gnaaannnsss  1340
             DFLFKGA+PGL+HIEPN+LRLCLELVQSAAMV+SREE            G  A+  ++ +
Sbjct  369   DFLFKGAVPGLSHIEPNRLRLCLELVQSAAMVLSREEEAAAAATAASATGGGASGGSNLN  428

Query  1341  aVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGG---GHHNQR  1511
               IY    +MS E    N  S+  S ++ +L+LDSR+VYLNLG    S  G   G   Q 
Sbjct  429   TAIYQ---SMSTEGSDCNTASNTDS-SMASLSLDSRMVYLNLGMAAASHLGCNIGDGRQG  484

Query  1512  EAMTTRQNSGD--PPSMYHH  1565
                +  Q  G+  P SM+ H
Sbjct  485   SNGSRSQGGGEIGPSSMFTH  504



>gb|AHF20179.1| NPR1-like protein, partial [Musa acuminata AAA Group]
Length=428

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/375 (74%), Positives = 317/375 (85%), Gaps = 5/375 (1%)
 Frame = +3

Query  366   VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDTLSA  545
             VIPVN V YEVFLLM+QF+YSGQV +VPQKHEPRP+C +RGCWHTHCT+AVDLALDTL+A
Sbjct  22    VIPVNYVSYEVFLLMLQFMYSGQVPLVPQKHEPRPSCSDRGCWHTHCTAAVDLALDTLAA  81

Query  546   ARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPE  725
             ARSFG+EQLALLTQKQLASMVEKA+IEDVM+VLIAS KQ+M QLW TCSHLVAKSG+PPE
Sbjct  82    ARSFGIEQLALLTQKQLASMVEKATIEDVMKVLIASRKQDMNQLWITCSHLVAKSGIPPE  141

Query  726   VLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQ-KIRRMRRALDSS  902
             VLAKHLPID+VAKIEELR KSSL   S + HHH     GA+ +LED  KIRRMRRAL+SS
Sbjct  142   VLAKHLPIDIVAKIEELRLKSSLTGRSFITHHHSLEAAGASTELEDHHKIRRMRRALESS  201

Query  903   DVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIA  1082
             DVELVKLMVMGEGLNLD+ALALHYAVENC+REVVKALLELGA DVN+ AG AG+TPLHIA
Sbjct  202   DVELVKLMVMGEGLNLDDALALHYAVENCTREVVKALLELGATDVNFRAGPAGKTPLHIA  261

Query  1083  AEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLC  1262
             A+MV PDMV+VLLDHHADPN+RT DG+TPLDILR LTSDFLFKGA+PGL HIEPNKLRLC
Sbjct  262   AKMVCPDMVAVLLDHHADPNIRTFDGVTPLDILRNLTSDFLFKGAVPGLTHIEPNKLRLC  321

Query  1263  LELVQSAAMVISREEGnaaannnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLD  1442
             LELVQSAA+V+SRE+  +    N   ++IYP       +       ++  S ++VNL+LD
Sbjct  322   LELVQSAALVMSREDAKSGGGGNHPHSIIYPPM----NQQESNTCNANHTSSSMVNLSLD  377

Query  1443  SRLVYLNLGAVENSG  1487
             SR+VYLNLG  E  G
Sbjct  378   SRMVYLNLGMAERLG  392



>ref|XP_006605205.1| PREDICTED: regulatory protein NPR5-like [Glycine max]
Length=433

 Score =   527 bits (1358),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 290/357 (81%), Positives = 302/357 (85%), Gaps = 22/357 (6%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPD P         GL       
Sbjct  19    INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPS--------GL-----DP  65

Query  339   aSPRGSIPQ----VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHC  506
               PRG        VIPVNSVGYEVFLLM+QFLYSGQVSIVPQKHE RPNC ERGCWHTHC
Sbjct  66    TGPRGVNSSRSGGVIPVNSVGYEVFLLMLQFLYSGQVSIVPQKHEARPNCGERGCWHTHC  125

Query  507   TSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTT  686
             TSAVDLALDTL+AAR FGVEQLALLTQKQLASMVEKASIEDVM+VL+AS KQ+MQQLW T
Sbjct  126   TSAVDLALDTLAAARYFGVEQLALLTQKQLASMVEKASIEDVMKVLLASRKQDMQQLWAT  185

Query  687   CSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadl---  857
             CSHLVAKSGLPPEVLAKHLPID+VAKIEELR KSSLAR SL+  HHH H           
Sbjct  186   CSHLVAKSGLPPEVLAKHLPIDIVAKIEELRLKSSLARRSLVPSHHHHHHHHHHHAAAAL  245

Query  858   --EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAA  1031
               EDQKIRRMRRALDSSDVELVKLM+MGEGLNLDEALAL YAVENCSREVVKALLELGAA
Sbjct  246   DLEDQKIRRMRRALDSSDVELVKLMLMGEGLNLDEALALPYAVENCSREVVKALLELGAA  305

Query  1032  DVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDF  1202
             DVNYP+G AG+TPLHIAAEMVSPDMV+VLLDHHADPNVRT DG+TPLDILRTLT  F
Sbjct  306   DVNYPSGPAGKTPLHIAAEMVSPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTLGF  362



>ref|XP_010931584.1| PREDICTED: LOW QUALITY PROTEIN: regulatory protein NPR6-like 
[Elaeis guineensis]
Length=492

 Score =   515 bits (1326),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 281/459 (61%), Positives = 339/459 (74%), Gaps = 25/459 (5%)
 Frame = +3

Query  162   NGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg-sdspgsRMGLVgagaga  338
             NGQAFSDV FSV+GRLVHAHRC+LAAR+LFF + FC PD P   +               
Sbjct  20    NGQAFSDVAFSVDGRLVHAHRCVLAARNLFFHRLFCSPDPPPGINLLDLNRHDHHHQLSP  79

Query  339   aSPRG--------SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCW  494
              SP G        +   VIP+NSVGYE FLL++QFLYSGQV++VP K+EPRP+C +RGC 
Sbjct  80    RSPSGPATGRVGVNAEMVIPLNSVGYEAFLLLLQFLYSGQVTVVPPKNEPRPDCSDRGCG  139

Query  495   HTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQ  674
             HTHCTSA+DLAL+T++ AR+FG ++LAL+TQKQL S++EKASI+DVM+VL AS  Q+M Q
Sbjct  140   HTHCTSAIDLALNTIATARAFGAQELALITQKQLESIMEKASIKDVMKVLTASHNQDMHQ  199

Query  675   LWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKs---slarssllahhhhrhdlga  845
             LWTTCSHL+A SGLPPEVL KHLPI++VA IEELR K    SL        HH+      
Sbjct  200   LWTTCSHLIADSGLPPEVLGKHLPIEIVATIEELRLKPGRHSLLTHHSHPTHHYFPAASP  259

Query  846   aadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELG  1025
             A   +  KI RMRRALDSSD++LVKLMVMG+GL+LD ALA+HYAV+NCSREVVKALLE G
Sbjct  260   AGRDDHLKIHRMRRALDSSDIDLVKLMVMGDGLDLDNALAIHYAVQNCSREVVKALLEFG  319

Query  1026  AADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFL  1205
             AADVN  AG  G+TPLHIAAEMV+PDMVSVLLDHHADPNVRT DG++PLD LR LTSDFL
Sbjct  320   AADVNRQAGPVGKTPLHIAAEMVNPDMVSVLLDHHADPNVRTIDGVSPLDKLRNLTSDFL  379

Query  1206  FKGAIPGLAHIEPNKLRLCLELVQSAAMVISREE-----------GnaaannnsssaVIY  1352
             FKGA+PGL+HIEPNKLRLCLELVQSAA+VISRE+               A+  S+     
Sbjct  380   FKGAVPGLSHIEPNKLRLCLELVQSAALVISREQEAAAAATTASATGGGASGGSNLNTAI  439

Query  1353  PAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLG  1469
               ++  +EE+   N  S+    ++V+L+L+SR VYLNLG
Sbjct  440   HQSIXSTEENDCNN--STDTDSSMVSLSLNSRAVYLNLG  476



>gb|EAZ14831.1| hypothetical protein OsJ_04757 [Oryza sativa Japonica Group]
Length=419

 Score =   505 bits (1301),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 270/359 (75%), Positives = 299/359 (83%), Gaps = 13/359 (4%)
 Frame = +3

Query  417   FLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQL  596
             FLYSGQVS+VPQK EPRP C ERGCWHTHC +AVDLALDTL+AARSFGVE+LALLTQKQL
Sbjct  34    FLYSGQVSLVPQKGEPRPGCGERGCWHTHCAAAVDLALDTLAAARSFGVEELALLTQKQL  93

Query  597   ASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEEL  776
             A MVEKASIEDVM+VL+AS KQ++ QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKI+EL
Sbjct  94    AGMVEKASIEDVMKVLMASRKQDLHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIDEL  153

Query  777   RHKsslarssllahhhhr--------hdlgaaadlEDQKIRRMRRALDSSDVELVKLMVM  932
             R KS   RS  L+HHHH             AA   +  KIRRMRRALDSSDVELVKLMVM
Sbjct  154   RLKSMSRRSPFLSHHHHHPHAAAAGIEASSAAELDDHHKIRRMRRALDSSDVELVKLMVM  213

Query  933   GEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVS  1112
             GEGLNLD+ALALHYAVENCSREVVKALLELGAADVN+PAG AG+TPLH+AAEMV PDMV+
Sbjct  214   GEGLNLDDALALHYAVENCSREVVKALLELGAADVNHPAGPAGKTPLHVAAEMVCPDMVA  273

Query  1113  VLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMV  1292
             VLLDHHADPNVRT DG+TPLDILRTLTSDFLFKGA+PGLAHIEPNKLRLCLELVQSAAMV
Sbjct  274   VLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLAHIEPNKLRLCLELVQSAAMV  333

Query  1293  ISREEGnaaannnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLG  1469
             +SRE+   AA N +      P        ++     +SG S ++VNL+LD+R+VYLNLG
Sbjct  334   MSREDAQTAAVNAAPIYGESPGGGGGGGVYN-----ASGTSSSMVNLSLDNRMVYLNLG  387



>gb|ABA95778.1| ankyrin repeat family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=494

 Score =   504 bits (1299),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 281/490 (57%), Positives = 338/490 (69%), Gaps = 43/490 (9%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGL-------  317
             INGQAFSDV FSVEGRLVHAHRC+LAARSLFFRK FCG D      P     L       
Sbjct  19    INGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPNHQPPPPPPPPLNWPTAGG  78

Query  318   --------VgagagaaSPRGSIPQ-VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRP  470
                        GAG      + P+ VIPV+S+ YEV +L++QFLYSGQ S+   K  P P
Sbjct  79    GGGGSGGGGRGGAGGGGGAPATPELVIPVSSIRYEVLVLVLQFLYSGQASVAAPKSGPLP  138

Query  471   NCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIA  650
              C  RGCWHT C +AVDLALDTL+AARSFGVEQLALL QKQL SMV++AS++DVM+VL+A
Sbjct  139   GCGARGCWHTRCGAAVDLALDTLAAARSFGVEQLALLVQKQLESMVKEASVDDVMKVLMA  198

Query  651   SGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhr  830
             S K EMQ+LW TCSHLVA+SGL  ++LAKHLPIDVVAKIEE+R KS LA ++        
Sbjct  199   SRKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEIRAKSPLAAAAAPRSPFLT  258

Query  831   -----hdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSR  995
                   +  ++A   D KIRRMRRALD++D+ELVKLMVMGEGL+LD+ALA+HYAV++C+R
Sbjct  259   HHYLPMNPASSAADRDNKIRRMRRALDAADIELVKLMVMGEGLDLDDALAVHYAVQHCNR  318

Query  996   EVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLD  1175
             +VVKALLELGAADVN  AG  G+T LH+AAEMVSPDMVSVLLDHHADPN RT DG+TPLD
Sbjct  319   DVVKALLELGAADVNSRAGPTGKTALHLAAEMVSPDMVSVLLDHHADPNSRTLDGVTPLD  378

Query  1176  ILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYP  1355
             +LR+LTS+FLFKGA+PGL HIEPNKLRLCLELVQSA MV +R++G              P
Sbjct  379   VLRSLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMVTTRDDGA-------------P  425

Query  1356  AALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVY--LNLGAVENSGGGGHHNQREAMTTR  1529
                  +      N P S    ++V+L ++S L+Y    + A   +G G   N        
Sbjct  426   VTGGEAGGSDGGNFPRSDADDSLVSLTMNSTLMYQGQEMAAAVAAGEGRKSNN-------  478

Query  1530  QNSGDPPSMY  1559
                  PP+MY
Sbjct  479   GRGSPPPAMY  488



>gb|EAZ17398.1| hypothetical protein OsJ_32922 [Oryza sativa Japonica Group]
Length=493

 Score =   503 bits (1294),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 279/489 (57%), Positives = 336/489 (69%), Gaps = 42/489 (9%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC--------------gpdspgsds  296
             INGQAFSDV FSVEGRLVHAHRC+LAARSLFFRK FC                       
Sbjct  19    INGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPNHQPPPPPPPLNWPMAGGG  78

Query  297   pgsRMGLVgagagaaSPRGSIPQ-VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPN  473
              G   G    GAG      + P+ VIPV+S+ YEV +L++QFLYSGQ S+   K  P P 
Sbjct  79    GGGSGGGGRGGAGGGGGAPATPELVIPVSSIRYEVLVLVLQFLYSGQASVAAPKSGPLPG  138

Query  474   CRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIAS  653
             C  RGCWHT C +AVDLALDTL+AARSFGVEQLALL QKQL SMV++AS++DVM+VL+AS
Sbjct  139   CGARGCWHTRCGAAVDLALDTLAAARSFGVEQLALLVQKQLESMVKEASVDDVMKVLMAS  198

Query  654   GKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhr-  830
              K EMQ+LW TCSHLVA+SGL  ++LAKHLPIDVVAKIEE+R KS LA ++         
Sbjct  199   RKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEIRAKSPLAAAAAPRSPFLTH  258

Query  831   ----hdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSRE  998
                  +  ++A   D KIRRMRRALD++D+ELVKLMVMGEGL+LD+ALA+HYAV++C+R+
Sbjct  259   HYLPMNPASSAADRDNKIRRMRRALDAADIELVKLMVMGEGLDLDDALAVHYAVQHCNRD  318

Query  999   VVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDI  1178
             VVKALLELGAADVN  AG  G+T LH+AAEMVSPDMVSVLLDHHADPN RT DG+TPLD+
Sbjct  319   VVKALLELGAADVNSRAGPTGKTALHLAAEMVSPDMVSVLLDHHADPNSRTLDGVTPLDV  378

Query  1179  LRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPA  1358
             LR+LTS+FLFKGA+PGL HIEPNKLRLCLELVQSA MV +R++G              P 
Sbjct  379   LRSLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMVTTRDDGA-------------PV  425

Query  1359  ALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVY--LNLGAVENSGGGGHHNQREAMTTRQ  1532
                 +      N P S    ++V+L ++S L+Y    + A   +G G   N         
Sbjct  426   TGGEAGGSDGGNFPRSDADDSLVSLTMNSTLMYQGQEMAAAVAAGEGRKSNN-------G  478

Query  1533  NSGDPPSMY  1559
                 PP+MY
Sbjct  479   RGSPPPAMY  487



>ref|NP_001065717.1| Os11g0141900 [Oryza sativa Japonica Group]
 gb|ABA91437.1| ankyrin repeat family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27562.1| Os11g0141900 [Oryza sativa Japonica Group]
 gb|AEF30415.1| putative NPR1-like protein 5 [Oryza sativa Japonica Group]
Length=494

 Score =   500 bits (1288),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 279/489 (57%), Positives = 335/489 (69%), Gaps = 41/489 (8%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC--------------gpdspgsds  296
             INGQAFSDV FSVEGRLVHAHRC+LAARSLFFRK FC                       
Sbjct  19    INGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPNHQPPPPPPPLNWPMAGGG  78

Query  297   pgsRMGLVgagagaaSPRGSIPQ-VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPN  473
              G   G    GAG      + P+ VIPV+S+ YEV +L++QFLYSGQ S+   K  P P 
Sbjct  79    GGGSGGGGRGGAGGGGGAPATPELVIPVSSIRYEVLVLVLQFLYSGQASVAAPKSGPLPG  138

Query  474   CRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIAS  653
             C  RGCWHT C +AVDLALDTL+AARSFGVEQLALL QKQL SMV++AS++DVM+VL+AS
Sbjct  139   CGARGCWHTRCGAAVDLALDTLAAARSFGVEQLALLVQKQLESMVKEASVDDVMKVLMAS  198

Query  654   GKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhr-  830
              K EMQ+LW TCSHLVA+SGL  ++LAKHLPIDVVAKIEE+R KS LA  +         
Sbjct  199   RKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEIRAKSPLAAVAAPRSPFLTH  258

Query  831   ----hdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSRE  998
                  +  ++A   D KIRRMRRALD++D+ELVKLMVMGEGL+LD+ALA+HYAV++C+R+
Sbjct  259   HYLPMNPASSAADRDNKIRRMRRALDAADIELVKLMVMGEGLDLDDALAVHYAVQHCNRD  318

Query  999   VVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDI  1178
             VVKALLELGAADVN  AG  G+T LH+AAEMVSPDMVSVLLDHHADPN RT DG+TPLD+
Sbjct  319   VVKALLELGAADVNSRAGPTGKTALHLAAEMVSPDMVSVLLDHHADPNSRTLDGVTPLDV  378

Query  1179  LRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPA  1358
             LR+LTS+FLFKGA+PGL HIEPNKLRLCLELVQSA MV +R++G                
Sbjct  379   LRSLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMVTTRDDGAPVTGG----------  428

Query  1359  ALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLN--LGAVENSGGGGHHNQREAMTTRQ  1532
               A +      N P S    ++V+L ++S L+Y    + A   +G G   N         
Sbjct  429   --AEAGGSDGGNFPRSDADDSLVSLTMNSTLMYQGQEMAAAVAAGEGRKSNN-------G  479

Query  1533  NSGDPPSMY  1559
                 PP+MY
Sbjct  480   RGSPPPAMY  488



>ref|XP_004977500.1| PREDICTED: regulatory protein NPR5-like [Setaria italica]
Length=475

 Score =   499 bits (1286),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 270/438 (62%), Positives = 323/438 (74%), Gaps = 20/438 (5%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDV FSVEGRLVHAHRC+LAARSLFFRK FCG D      P           GA
Sbjct  19    INGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPNHQPPPPPP---ALGSPGA  75

Query  339   aSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAV  518
              +   +   VIPV+S+ YEV +L++QFLYSGQ S+   K  P P C  RGCWHT C +AV
Sbjct  76    RAAGAAPELVIPVSSIRYEVLVLVLQFLYSGQASVAAPKSGPLPGCGARGCWHTRCGAAV  135

Query  519   DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
             DLALDTL+AARSFGVEQLALL QKQL SMV++AS++DVM+VL+AS K EMQ+LW TCSHL
Sbjct  136   DLALDTLAAARSFGVEQLALLVQKQLESMVKEASVDDVMKVLMASRKFEMQELWATCSHL  195

Query  699   VAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhr-----hdlgaaadlED  863
             VA+SGL  ++LAKHLPIDVVAKIEE+R KS +A ++              +  ++A   D
Sbjct  196   VARSGLSADLLAKHLPIDVVAKIEEIRAKSPVAAANAPRSPFLTHHYLPINAPSSAADRD  255

Query  864   QKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNY  1043
              KIRRMRRALD++D+ELVKLMVMGEGL+LD+ALA+HYAV++C+R+VVKALLELGAADVN 
Sbjct  256   HKIRRMRRALDAADIELVKLMVMGEGLDLDDALAVHYAVQHCNRDVVKALLELGAADVNS  315

Query  1044  PAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIP  1223
              AG  G+T LH+AAEMVSPDMVSVLLDHHADPN RT DG+TPLD+LR LTS+FLFKGA+P
Sbjct  316   RAGPTGKTALHLAAEMVSPDMVSVLLDHHADPNARTLDGVTPLDVLRGLTSEFLFKGAVP  375

Query  1224  GLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAALAMSEEHHHRNIPS  1403
             GL HIEPNKLRLCLELVQSA MV +R+E               P A   +      N P 
Sbjct  376   GLTHIEPNKLRLCLELVQSAVMVTTRDE------------GGAPGAGGEAGGSDGGNFPR  423

Query  1404  SGGSGNIVNLNLDSRLVY  1457
             S    ++V+L ++S L+Y
Sbjct  424   SDADDSLVSLTMNSTLMY  441



>gb|EAY79901.1| hypothetical protein OsI_35064 [Oryza sativa Indica Group]
Length=494

 Score =   500 bits (1287),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 279/489 (57%), Positives = 337/489 (69%), Gaps = 41/489 (8%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC--------------gpdspgsds  296
             INGQAFSDV FSVEGRLVHAHRC+LAARSLFFRK FC                       
Sbjct  19    INGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPNHQPPPPPPPLNWPMAGGG  78

Query  297   pgsRMGLVgagagaaSPRGSIPQ-VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPN  473
              G   G    GAG      + P+ VIPV+S+ YEV +L++QFLYSGQ S+   K  P P 
Sbjct  79    GGGSGGGGRGGAGGGGGAPATPELVIPVSSIRYEVLVLVLQFLYSGQASVAAPKSGPLPG  138

Query  474   CRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIAS  653
             C  RGCWHT C +AVDLALDTL+AARSFGVEQLALL QKQL SMV++AS++DVM+VL+AS
Sbjct  139   CGARGCWHTRCGAAVDLALDTLAAARSFGVEQLALLVQKQLESMVKEASVDDVMKVLMAS  198

Query  654   GKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhr-  830
              K EMQ+LW TCSHLVA+SGL  ++LAKHLPIDVVAKIEE+R KS LA ++         
Sbjct  199   RKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEIRAKSPLAAAAAPRSPFLTH  258

Query  831   ----hdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSRE  998
                  +  ++A   D KIRRMRRALD++D+ELVKLMVMGEGL+LD+ALA+HYAV++C+R+
Sbjct  259   HYLPMNPASSAADRDNKIRRMRRALDAADIELVKLMVMGEGLDLDDALAVHYAVQHCNRD  318

Query  999   VVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDI  1178
             VVKALLELGAADVN  AG  G+T LH+AAEMVSPDMVSVLLDHHADPN RT DG+TPLD+
Sbjct  319   VVKALLELGAADVNSRAGPTGKTALHLAAEMVSPDMVSVLLDHHADPNSRTLDGVTPLDV  378

Query  1179  LRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPA  1358
             LR+LTS+FLFKGA+PGL HIEPNKLRLCLELVQSA MV +R++G                
Sbjct  379   LRSLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMVTTRDDGAPVTGG----------  428

Query  1359  ALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLN--LGAVENSGGGGHHNQREAMTTRQ  1532
               A +      N P S    ++V+L ++S L+Y +  + A   +G G   N         
Sbjct  429   --AEAGGSDGGNFPRSDADDSLVSLTMNSTLMYQSQEMAAAVAAGEGRKSNN-------G  479

Query  1533  NSGDPPSMY  1559
                 PP+MY
Sbjct  480   RGSPPPAMY  488



>gb|EAY79893.1| hypothetical protein OsI_35056 [Oryza sativa Indica Group]
Length=649

 Score =   504 bits (1298),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 279/489 (57%), Positives = 336/489 (69%), Gaps = 42/489 (9%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC--------------gpdspgsds  296
             INGQAFSDV FSVEGRLVHAHRC+LAARSLFFRK FC                       
Sbjct  175   INGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPNHQPPPPPPPLNWPTAGGG  234

Query  297   pgsRMGLVgagagaaSPRGSIPQ-VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPN  473
              G   G    GAG      + P+ VIPV+S+ YEV +L++QFLYSGQ S+   K  P P 
Sbjct  235   GGGSGGGGRGGAGGGGGAPATPELVIPVSSIRYEVLVLVLQFLYSGQASVAAPKSGPLPG  294

Query  474   CRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIAS  653
             C  RGCWHT C +AVDLALDTL+AARSFGVEQLALL QKQL SMV++AS++DVM+VL+AS
Sbjct  295   CGARGCWHTRCGAAVDLALDTLAAARSFGVEQLALLVQKQLESMVKEASVDDVMKVLMAS  354

Query  654   GKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhr-  830
              K EMQ+LW TCSHLVA+SGL  ++LAKHLPIDVVAKIEE+R KS LA ++         
Sbjct  355   RKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEIRAKSPLAAAAAPRSPFLTH  414

Query  831   ----hdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSRE  998
                  +  ++A   D KIRRMRRALD++D+ELVKLMVMGEGL+LD+ALA+HYAV++C+R+
Sbjct  415   HYLPMNPASSAADRDNKIRRMRRALDAADIELVKLMVMGEGLDLDDALAVHYAVQHCNRD  474

Query  999   VVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDI  1178
             VVKALLELGAADVN  AG  G+T LH+AAEMVSPDMVSVLLDHHADPN RT DG+TPLD+
Sbjct  475   VVKALLELGAADVNSRAGPTGKTALHLAAEMVSPDMVSVLLDHHADPNSRTLDGVTPLDV  534

Query  1179  LRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPA  1358
             LR+LTS+FLFKGA+PGL HIEPNKLRLCLELVQSA MV +R++G              P 
Sbjct  535   LRSLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMVTTRDDGA-------------PV  581

Query  1359  ALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLN--LGAVENSGGGGHHNQREAMTTRQ  1532
                 +      N P S    ++V+L ++S L+Y    + A   +G G   N         
Sbjct  582   TGGEAGGSDGGNFPRSDADDSLVSLTMNSTLMYQGQEMAAAVAAGEGRKSNN-------G  634

Query  1533  NSGDPPSMY  1559
                 PP+MY
Sbjct  635   RGSPPPAMY  643



>ref|XP_002442682.1| hypothetical protein SORBIDRAFT_08g001180 [Sorghum bicolor]
 gb|EES16520.1| hypothetical protein SORBIDRAFT_08g001180 [Sorghum bicolor]
Length=480

 Score =   498 bits (1282),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 269/443 (61%), Positives = 317/443 (72%), Gaps = 30/443 (7%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDV FSVEGRLVHAHRC+LAARSLFFRK FCG D      P         G G 
Sbjct  19    INGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPNHPPPPPPPPQPPTGGGGG  78

Query  339   aSPRGSIPQ-VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSA  515
                    P  VIPV+S+ YEV +L++QFLYSGQ S+   K  P P C  RGCWHT C +A
Sbjct  79    ----ARTPDLVIPVSSIRYEVLVLVLQFLYSGQASVAAPKSGPLPGCGARGCWHTRCGAA  134

Query  516   VDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSH  695
             VDLALDTL+AARSFGVEQLALL QKQL SMV++AS++DVM+VL+AS K EMQ+LW TCSH
Sbjct  135   VDLALDTLAAARSFGVEQLALLVQKQLESMVKEASVDDVMKVLMASRKFEMQELWATCSH  194

Query  696   LVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhr---------hdlgaa  848
             LVA+SGL  ++LAKHLPIDVVAKIEE+R KS    +   A               +  ++
Sbjct  195   LVARSGLSADLLAKHLPIDVVAKIEEIRAKSPAGAAVSSATTPRSPFLTHHYLPINAASS  254

Query  849   adlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGA  1028
             A   D KIRRMRRALD++D+ELVKLMVMGEGL+LD+ALA+HYAV++C R+VVKALLELGA
Sbjct  255   AADRDHKIRRMRRALDAADIELVKLMVMGEGLDLDDALAVHYAVQHCGRDVVKALLELGA  314

Query  1029  ADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLF  1208
             ADVN  AG  G+T LH+AAEMVSPDMVSVLLDHHADP+ RT DG+TPLD+LR LTS+FLF
Sbjct  315   ADVNSRAGPTGKTALHLAAEMVSPDMVSVLLDHHADPSARTLDGVTPLDVLRGLTSEFLF  374

Query  1209  KGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAALAMSEEHHH  1388
             KGA+PGL HIEPNKLRLCLELVQSA MV +R+E                 A         
Sbjct  375   KGAVPGLTHIEPNKLRLCLELVQSAVMVTTRDE----------------GAGDAGGSDGG  418

Query  1389  RNIPSSGGSGNIVNLNLDSRLVY  1457
              N P S    ++V+L ++S L+Y
Sbjct  419   GNFPRSDADDSLVSLTMNSTLMY  441



>emb|CBX24422.1| hypothetical_protein [Oryza glaberrima]
Length=502

 Score =   494 bits (1271),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 278/498 (56%), Positives = 335/498 (67%), Gaps = 51/498 (10%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC--------------gpdspgsds  296
             INGQAFSDV FSVEGRLVHAHRC+LAARSLFFRK FC                       
Sbjct  19    INGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPNHQPPPPPPPLNWPTAGGG  78

Query  297   pgsRMGLVgagagaaSPRGSIPQ-VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPN  473
              G   G    GAG      + P+ VIPV+S+ YEV +L++QFLYSGQ S+   K  P P 
Sbjct  79    GGGSGGGGRGGAGGGGGAPATPELVIPVSSIRYEVLVLVLQFLYSGQASVAAPKSGPLPG  138

Query  474   CRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLT---------QKQLASMVEKASIE  626
             C  RGCWHT C +AVDLALDTL+AARSFGVEQLALL          QKQL  MV++AS++
Sbjct  139   CGARGCWHTRCGAAVDLALDTLAAARSFGVEQLALLVQVAQCNVLMQKQLEGMVKEASVD  198

Query  627   DVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarss  806
             DVM+VL+AS K EMQ+LW TCSHLVA+SGL  ++LAKHLPIDVVAKIEE+R KS LA ++
Sbjct  199   DVMKVLMASRKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEIRAKSPLAAAA  258

Query  807   llahhhhr-----hdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALH  971
                           +  ++A   D KIRRMRRALD++D+ELVKLMVMGEGL+LD+ALA+H
Sbjct  259   APRSPFLTHHYLPMNPASSAADRDNKIRRMRRALDAADIELVKLMVMGEGLDLDDALAVH  318

Query  972   YAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRT  1151
             YAV++C+R+VVKALLELGAADVN  AG  G+T LH+AAEMVSPDMVSVLLDHHADPN RT
Sbjct  319   YAVQHCNRDVVKALLELGAADVNSRAGPTGKTALHLAAEMVSPDMVSVLLDHHADPNSRT  378

Query  1152  ADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannn  1331
              DG+TPLD+LR+LTS+FLFKGA+PGL HIEPNKLRLCLELVQSA MV +R++G       
Sbjct  379   LDGVTPLDVLRSLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMVTTRDDGA------  432

Query  1332  sssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVY--LNLGAVENSGGGGHHN  1505
                    P     +      N P S    ++V+L ++S L+Y    + A   +G G   N
Sbjct  433   -------PVTGGEAGGSDGGNFPRSDADDSLVSLTMNSTLMYQGQEMAAAVAAGEGRKSN  485

Query  1506  QREAMTTRQNSGDPPSMY  1559
                          PP+MY
Sbjct  486   NGRG-------SPPPAMY  496



>dbj|BAJ90297.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=491

 Score =   492 bits (1267),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 262/398 (66%), Positives = 306/398 (77%), Gaps = 17/398 (4%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC--------gpdspgsdspgsRMG  314
             INGQAFSDV FSVEGRLVHAHRC+LAARSLFFRK FC         P      + G   G
Sbjct  19    INGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPSHQPPPPPLNWPTAGGGSG  78

Query  315   LVgagagaaSPRGSIPQ-VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGC  491
               G   G +    + P+ VIPV+S+ YEV +L++QFLYSGQ S+   K  P P C  RGC
Sbjct  79    GGGGSRGGSGGAPATPELVIPVSSIRYEVLVLVLQFLYSGQASVAAPKSGPLPGCGARGC  138

Query  492   WHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQ  671
             WHT C +AVDLALDTL+AARSFGVEQLALL QKQL SMV++AS++DVM+VL+AS K EMQ
Sbjct  139   WHTRCGAAVDLALDTLAAARSFGVEQLALLVQKQLESMVKEASVDDVMKVLMASRKFEMQ  198

Query  672   QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhd-----  836
             +LW TCSHLVA+SGL  ++LAKHLPIDVVAKIEE+R KS LA     A            
Sbjct  199   ELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEIRAKSPLAGGGASAPRSPFLTHHYLP  258

Query  837   ---lgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVK  1007
                  ++A   D KIRRMRRALD++D+ELVKLMVMGEGL+LD+ALA+HYAV++C+R+VVK
Sbjct  259   INNGPSSAADRDHKIRRMRRALDAADIELVKLMVMGEGLDLDDALAVHYAVQHCNRDVVK  318

Query  1008  ALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRT  1187
             ALLELGAADVN  AG  G+TPLH+AAE+VSPDMVSVLLDHHADPN RT DG+TPLD+LR 
Sbjct  319   ALLELGAADVNSRAGPTGKTPLHLAAELVSPDMVSVLLDHHADPNARTLDGVTPLDVLRG  378

Query  1188  LTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISR  1301
             LTS+FLFKGA+PGL HIEPNKLRLCLELVQSA MV +R
Sbjct  379   LTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMVTTR  416



>emb|CBX25371.1| hypothetical_protein [Oryza brachyantha]
Length=493

 Score =   492 bits (1266),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 270/454 (59%), Positives = 324/454 (71%), Gaps = 35/454 (8%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC----------------gpdspgs  290
             INGQAFSDV FSVEGRLVHAHRC+LAARSLFFRK FC                 P + G 
Sbjct  19    INGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPNHQPPPPPPPLNWPTTAGG  78

Query  291   dspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRP  470
                G   G  G G G      +   VIPV+S+ YEV +L++QFLYSGQ S+   K  P P
Sbjct  79    GPAGGGRGGAGGGGGGGGAPATPELVIPVSSIRYEVLVLVLQFLYSGQASVAAPKSGPLP  138

Query  471   NCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIA  650
              C  RGCWHT C +AVDLALDTL+AARSFGVEQLALL  KQL SMV++AS++DVM+VL+A
Sbjct  139   GCGARGCWHTRCGAAVDLALDTLAAARSFGVEQLALL--KQLESMVKEASVDDVMKVLMA  196

Query  651   SGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhr  830
             S K EMQ+LW TCSHLVA+SGL  ++LAKHLPIDVVAKIEE+R KS L  ++        
Sbjct  197   SRKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEIRSKSPLTAAATPRSPFLT  256

Query  831   -----hdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSR  995
                   +  ++A   D KIRRMRRALD++D+ELVKLMVMGEGL+LD+ALA+HYAV++C+R
Sbjct  257   HHYLPINAASSAADRDNKIRRMRRALDAADIELVKLMVMGEGLDLDDALAVHYAVQHCNR  316

Query  996   EVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLD  1175
             +VVKALLELGAADVN  AG  G+T LH+AAEMVSPDMVSVLLDHHADPN RT DG+TPLD
Sbjct  317   DVVKALLELGAADVNSRAGPTGKTALHLAAEMVSPDMVSVLLDHHADPNARTLDGVTPLD  376

Query  1176  ILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYP  1355
             +LR+LTS+FLFKGA+PGL HIEPNKLRLCLELVQSA MV +R++G               
Sbjct  377   VLRSLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMVTTRDDGAPV------------  424

Query  1356  AALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVY  1457
             A    +      N P S    ++V+L ++S L+Y
Sbjct  425   AGAGEAGGSDGGNFPRSDADDSLVSLTMNSTLMY  458



>ref|XP_008662362.1| PREDICTED: regulatory protein NPR6-like [Zea mays]
 gb|AFW55826.1| hypothetical protein ZEAMMB73_056831 [Zea mays]
 gb|AIB04714.1| TRAF transcription factor, partial [Zea mays]
Length=624

 Score =   495 bits (1274),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 283/464 (61%), Positives = 337/464 (73%), Gaps = 26/464 (6%)
 Frame = +3

Query  78    TFGLCVGSMSTVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFR  257
             T+G     MS+ EDSL+SLSLDYLNLLINGQAFSDV FSVEGRLVHAHRC+LAARSLFFR
Sbjct  142   TYGTAHEIMSS-EDSLKSLSLDYLNLLINGQAFSDVAFSVEGRLVHAHRCVLAARSLFFR  200

Query  258   KFFCgpdspgsdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQV  437
             K FCG D      P        A             VIPV+S+ YEV +L++QFLYSGQ 
Sbjct  201   KLFCGLDPNHPPPPPGARAAAAAAPEL---------VIPVSSIRYEVLVLVLQFLYSGQA  251

Query  438   SIVPQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKA  617
             S+   K  P P C  RGCWHT C +AVDLALDTL+AARSFGVEQLALL QKQL SMV++A
Sbjct  252   SVAAPKSGPLPGCGARGCWHTRCGAAVDLALDTLAAARSFGVEQLALLVQKQLESMVKEA  311

Query  618   SIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKssla  797
             S++DVM+VL+AS K EMQ+LW TCSHLVA+SGL  ++LAKHLPIDVVAKIEE+R KS + 
Sbjct  312   SVDDVMKVLMASRKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEIRAKSPVP  371

Query  798   rssllahhhh----rhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALA  965
               +  +          +  ++A   D KIRRMRRALD++D+ELVKLMVMGEGL+LD+ALA
Sbjct  372   AGAPRSPFLTHHYLPINAASSAADRDHKIRRMRRALDAADIELVKLMVMGEGLDLDDALA  431

Query  966   LHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNV  1145
             +HYAV++C R+VVKALLELGAADVN  AG  G+T LH+AAEMVSPDMVSVLLDHHADP+ 
Sbjct  432   VHYAVQHCGRDVVKALLELGAADVNSRAGPTGKTALHLAAEMVSPDMVSVLLDHHADPSA  491

Query  1146  RTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaan  1325
             RT DG+TPLD+LR LTS+FLFKGA+PGL HIEPNKLRLCLELVQSA MV +R+       
Sbjct  492   RTLDGVTPLDVLRGLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMVTTRD-------  544

Query  1326  nnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVY  1457
                            S+     N P S    ++V+L ++S L+Y
Sbjct  545   -----VDAAGDDAGGSDGGGGGNFPRSDADDSLVSLTMNSTLMY  583



>gb|EMT02606.1| Regulatory protein NPR1 [Aegilops tauschii]
Length=505

 Score =   483 bits (1242),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 263/410 (64%), Positives = 307/410 (75%), Gaps = 29/410 (7%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC----------gpdspgsdspgsR  308
             INGQAFSDV FSVEGRLVHAHRC+LAARSLFFRK FC           P +  +   GS 
Sbjct  19    INGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPSHQPPPPPLNWPNAGGGSG  78

Query  309   MGLVgagagaaSPRGSIPQ-VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRER  485
              G  G   G +    + P+ VIPV+S+ YEV +L++QFLYSGQ S+   K  P P C  R
Sbjct  79    GGGGGGSRGGSGGAPATPELVIPVSSIRYEVLVLVLQFLYSGQASVAAPKSGPLPGCGAR  138

Query  486   GCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQ----------KQLASMVEKASIEDVM  635
             GCWHT C +AVDLALDTL+AARSFGVEQLALL Q          KQL SMV++AS++DVM
Sbjct  139   GCWHTRCGAAVDLALDTLAAARSFGVEQLALLVQIIIWENLSMQKQLESMVKEASVDDVM  198

Query  636   RVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarsslla  815
             +VL+AS K EMQ+LW TCSHLVA+SGL  ++LAKHLPIDVVAKIEE+R KS LA      
Sbjct  199   KVLMASRKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEIRAKSPLAGGGASQ  258

Query  816   hhhhrhd--------lgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALH  971
                              ++A   D KIRRMRRALD++D+ELVKLMVMGEGL+LD+ALA+H
Sbjct  259   PRSPFLTHHYLPINNGPSSAADRDHKIRRMRRALDAADIELVKLMVMGEGLDLDDALAVH  318

Query  972   YAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRT  1151
             YAV++C+R+VVKALLELGAADVN  AG  G+TPLH+AAEMVSPDMVSVLLDHHADPN RT
Sbjct  319   YAVQHCNRDVVKALLELGAADVNSRAGPTGKTPLHLAAEMVSPDMVSVLLDHHADPNART  378

Query  1152  ADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISR  1301
              DG+TPLD+LR LTS+FLFKGA+PGL HIEPNKLRLCLELVQSA MV +R
Sbjct  379   LDGVTPLDVLRGLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMVTTR  428



>ref|XP_003578950.1| PREDICTED: regulatory protein NPR6-like [Brachypodium distachyon]
Length=503

 Score =   482 bits (1241),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 260/405 (64%), Positives = 300/405 (74%), Gaps = 27/405 (7%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGL-------  317
             INGQAFSDV FSVEGRLVHAHRC+LAARSLFFRK FCG D      P   +         
Sbjct  19    INGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPAHQPPPPPPLNWPNTASSA  78

Query  318   ----VgagagaaSPRGSIPQ-VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRE  482
                  G   G     G+ P+ VIPV+S+ YEV +L++QFLYSGQ S+   K  P P C  
Sbjct  79    AGAGGGGSRGGGGAPGAAPELVIPVSSIRYEVLVLVLQFLYSGQASVAAPKSGPLPGCGA  138

Query  483   RGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQ  662
             RGCWHT C +AVDLALDTL+AARSFGVEQLALL QKQL SMV++AS++DVM+VL+AS K 
Sbjct  139   RGCWHTRCGAAVDLALDTLAAARSFGVEQLALLVQKQLESMVKEASVDDVMKVLMASRKF  198

Query  663   EMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrh---  833
             EMQ+LW TCSHLVA+SGL  ++LAKHLPIDVVAKIEE+R KS    S L +         
Sbjct  199   EMQELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEIRSKSPPIISGLSSSSPTAAGPR  258

Query  834   -----------dlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAV  980
                                 D KIRRMRRALD++D+ELVKLMVMGEGL+LD++LA+HYAV
Sbjct  259   SPFQLTHSYLPMTTPNPADRDHKIRRMRRALDAADIELVKLMVMGEGLDLDDSLAVHYAV  318

Query  981   ENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTAD-  1157
              +C+R+VVKALLELGAADVN  AG  G+TPLH+AAEMVSPDMVSVLLDHHADPN RT D 
Sbjct  319   SHCNRDVVKALLELGAADVNSRAGPTGKTPLHLAAEMVSPDMVSVLLDHHADPNARTLDA  378

Query  1158  GITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMV  1292
             G+TPLD+LR LTS+FLFKGA+PGL HIEPNKLRLCLELVQSA MV
Sbjct  379   GVTPLDVLRGLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMV  423



>ref|XP_002450246.1| hypothetical protein SORBIDRAFT_05g002500 [Sorghum bicolor]
 gb|EES09234.1| hypothetical protein SORBIDRAFT_05g002500 [Sorghum bicolor]
Length=484

 Score =   477 bits (1227),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 259/392 (66%), Positives = 306/392 (78%), Gaps = 19/392 (5%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDV FSVEGRLVHAHRC+LAARSLFFRK FCG D                  G+
Sbjct  19    INGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPNHQP--------PPPPPGS  70

Query  339   aSPRGSIPQ-VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSA  515
             ++ R + P  VIPV+S+ YEV +L++QFLYSGQ S+   K  P P C  RGCWHT C +A
Sbjct  71    SAGRAAPPDLVIPVSSIRYEVLVLVLQFLYSGQASVAAPKSGPLPGCGARGCWHTRCGAA  130

Query  516   VDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSH  695
             VDLALDTL+AARSFGVEQLALL QKQL +MV++AS++DVM+VL+AS K EMQ+LW TCSH
Sbjct  131   VDLALDTLAAARSFGVEQLALLVQKQLEAMVKEASVDDVMKVLMASRKFEMQELWATCSH  190

Query  696   LVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrh----------dlga  845
             LVA+SGL  ++LAKHLPIDVVAKIEE+R KS    S   +    R           +  +
Sbjct  191   LVARSGLSADLLAKHLPIDVVAKIEEIRAKSPAVVSPAGSGGGPRSPFLTHHYLPINAAS  250

Query  846   aadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELG  1025
             +A   D +IRRMRRALD++D+ELVKLMVMGEGL+LD+ALA+HYAV++C R+VVKALLELG
Sbjct  251   SAADRDHRIRRMRRALDAADIELVKLMVMGEGLDLDDALAVHYAVQHCGRDVVKALLELG  310

Query  1026  AADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFL  1205
             AADVN  AG AG+T LH+AAEMVSPDMVSVLLDHHADPN RT DG+TPLD+LR+LTS+FL
Sbjct  311   AADVNSRAGPAGKTALHLAAEMVSPDMVSVLLDHHADPNARTLDGVTPLDVLRSLTSEFL  370

Query  1206  FKGAIPGLAHIEPNKLRLCLELVQSAAMVISR  1301
             FKGA+PGL HIEPNKLRLCLELVQSA MV +R
Sbjct  371   FKGAVPGLTHIEPNKLRLCLELVQSAVMVATR  402



>ref|XP_006843393.1| hypothetical protein AMTR_s00053p00115370 [Amborella trichopoda]
 gb|ERN05068.1| hypothetical protein AMTR_s00053p00115370 [Amborella trichopoda]
Length=444

 Score =   474 bits (1220),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 271/462 (59%), Positives = 320/462 (69%), Gaps = 57/462 (12%)
 Frame = +3

Query  108   TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
             ++EDS++ LSLDYLNLLINGQAFSDVTFSVEGR +HAH+CILAARS FFR+FFC  +   
Sbjct  2     SLEDSMKVLSLDYLNLLINGQAFSDVTFSVEGRHIHAHKCILAARSSFFRRFFCDQNQNQ  61

Query  288   sdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPR  467
             + +      L      +     S+ QV     VGYEVFLL++QFLYSGQVSI PQKHE R
Sbjct  62    NTAQNPNQALSPITTSSPPHHSSVVQV---TVVGYEVFLLLLQFLYSGQVSITPQKHEAR  118

Query  468   PNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLI  647
             PNC ER CWHTHC+SA+DLALDTL+AA  FGV+QL+LLTQ  LAS+V+KASIEDVMRVL+
Sbjct  119   PNCPERSCWHTHCSSAIDLALDTLAAAHFFGVDQLSLLTQAHLASIVDKASIEDVMRVLL  178

Query  648   AS--GKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahh  821
             A    K  M  LW+TCS LVA+SGLP +VLAKHLP D+   I ++R              
Sbjct  179   ACSHNKPLMHPLWSTCSRLVAQSGLPLDVLAKHLPPDLAQHILDMR-------------L  225

Query  822   hhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREV  1001
                     A  +ED K+RRM+RALDSSDVELVKLMVMGEGLNLD+ALALHYAV  CSREV
Sbjct  226   ESNSANARAHVVEDHKVRRMQRALDSSDVELVKLMVMGEGLNLDDALALHYAVARCSREV  285

Query  1002  VKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDIL  1181
             VKALLELGAADVN+ AG AGRTPLHIAAEMVSPDMV+VLLDHHADPN R+A G TP D+L
Sbjct  286   VKALLELGAADVNHAAGPAGRTPLHIAAEMVSPDMVAVLLDHHADPNARSASGATPFDVL  345

Query  1182  RTLTSDFLFKGAIPGLA-------HIEPNKLRLCLELVQSAAMVISREEGnaaannnsss  1340
             ++L SDFLFKG  P ++       HIE NKLRLCLEL+QSAA+VISR             
Sbjct  346   QSLASDFLFKG--PNVSSPTAPAPHIEHNKLRLCLELLQSAALVISR-------------  390

Query  1341  aVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNL  1466
                                  + G       ++DSR+++LN+
Sbjct  391   -----------------GCDGAEGCSPTPPQDIDSRMLFLNI  415



>ref|XP_008669884.1| PREDICTED: regulatory protein NPR5-like [Zea mays]
 tpg|DAA39222.1| TPA: hypothetical protein ZEAMMB73_394788 [Zea mays]
 gb|AIB05916.1| TRAF transcription factor, partial [Zea mays]
Length=473

 Score =   463 bits (1192),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 251/399 (63%), Positives = 301/399 (75%), Gaps = 26/399 (7%)
 Frame = +3

Query  159   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
             INGQAFSDV FSVEGRLVHAHRC+LAARSLFFRK FCG D                  G+
Sbjct  19    INGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPNYQPP--------TPTLGS  70

Query  339   aSPRGSIPQ-VIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSA  515
             +S     P+ VIPV+S+ YEV +L++QFLYSGQ S+   K  P P C  RGCWHT C +A
Sbjct  71    SSSGARAPELVIPVSSIRYEVLVLVLQFLYSGQASVAAPKSGPLPGCGARGCWHTSCGAA  130

Query  516   VDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSH  695
             VDLALDTL+AARSFGVEQLALL QKQL +M ++AS++DVM+VL+AS K EMQ+LW TCSH
Sbjct  131   VDLALDTLAAARSFGVEQLALLVQKQLEAMAKEASVDDVMKVLMASRKFEMQELWATCSH  190

Query  696   LVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarsslla-----------------hhh  824
             LVA+SGL  ++LAKHLPIDVVAKIEE+R  ++ +    ++                  + 
Sbjct  191   LVARSGLSADLLAKHLPIDVVAKIEEIRAAANKSPVCAVSGGGGPRSPFLLTHHYLPVNG  250

Query  825   hrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVV  1004
                   A+    D ++RRMRRALD++D+ELVKLMVMGEGL+LD ALA+HYAV++C R+VV
Sbjct  251   ASASASASEAERDHRVRRMRRALDAADIELVKLMVMGEGLDLDAALAVHYAVQHCGRDVV  310

Query  1005  KALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILR  1184
             KALLELGAADVN  AG AG+T LH+AAEMVSPDMVSVLLDHHADP+ RT DG+TPLD+LR
Sbjct  311   KALLELGAADVNSRAGPAGKTALHLAAEMVSPDMVSVLLDHHADPSARTLDGVTPLDVLR  370

Query  1185  TLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISR  1301
              LTS+FLF+GA+PGL HIEPNKLRLCLELVQSA MV +R
Sbjct  371   GLTSEFLFRGAVPGLTHIEPNKLRLCLELVQSAVMVTTR  409



>gb|EMS68804.1| Regulatory protein NPR5 [Triticum urartu]
Length=413

 Score =   419 bits (1076),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 213/303 (70%), Positives = 246/303 (81%), Gaps = 8/303 (3%)
 Frame = +3

Query  417   FLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQL  596
             FLYSGQ S+   K  P P C  RGCWHT C +AVDLALDTL+AARSFGVEQLALL QKQL
Sbjct  36    FLYSGQASVAAPKSGPLPGCGARGCWHTRCGAAVDLALDTLAAARSFGVEQLALLVQKQL  95

Query  597   ASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEEL  776
              SMV++AS++DVM+VL+AS K EMQ+LW TCSHLVA+SGL  ++LAKHLPIDVVAKIEE+
Sbjct  96    ESMVKEASVDDVMKVLMASRKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEI  155

Query  777   RHKsslarssllahhhhrhd--------lgaaadlEDQKIRRMRRALDSSDVELVKLMVM  932
             R KS LA     A                 ++A   D KIRRMRRALD++D+ELVKLMVM
Sbjct  156   RAKSPLAGGGASAPRSPFLTHHYLPINNGPSSAADRDHKIRRMRRALDAADIELVKLMVM  215

Query  933   GEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVS  1112
             GEGL+LD+ALA+HYAV++C+R+VVKALLELGAADVN  AG  G+TPLH+AAEMVSPDMVS
Sbjct  216   GEGLDLDDALAVHYAVQHCNRDVVKALLELGAADVNSRAGPTGKTPLHLAAEMVSPDMVS  275

Query  1113  VLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMV  1292
             VLLDHHADPN RT DG+TPLD+LR LTS+FLFKGA+PGL HIEPNKLRLCLELVQSA MV
Sbjct  276   VLLDHHADPNARTLDGVTPLDVLRGLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMV  335

Query  1293  ISR  1301
              +R
Sbjct  336   TTR  338



>ref|XP_008457939.1| PREDICTED: regulatory protein NPR5-like, partial [Cucumis melo]
Length=327

 Score =   406 bits (1043),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 247/339 (73%), Positives = 270/339 (80%), Gaps = 24/339 (7%)
 Frame = +3

Query  585   QKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAK  764
             QKQL SMVEKASIEDVM+VLIAS KQ+M QLWTTCSHLVAKSGLP EVLAKH+P+DVVAK
Sbjct  5     QKQLVSMVEKASIEDVMKVLIASRKQDMHQLWTTCSHLVAKSGLPTEVLAKHIPLDVVAK  64

Query  765   IEELRHKsslarsslla----hhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVM  932
             IEELR KSSLAR S L     HHHH   L  AADLE+QKIRRMRRALDSSDVELVKLMVM
Sbjct  65    IEELRLKSSLARRSSLMPHHHHHHHHLQLSTAADLEEQKIRRMRRALDSSDVELVKLMVM  124

Query  933   GEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVS  1112
             GEGLNLDEALALHYAVENC+REVVKALLELGAADVNYPAG AG+TPLHIA+EMVS DMV+
Sbjct  125   GEGLNLDEALALHYAVENCTREVVKALLELGAADVNYPAGPAGKTPLHIASEMVSADMVA  184

Query  1113  VLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMV  1292
             VLLDHHADP +RT DG+TPLDILRTLTSDFLFKGA+PG+ HIEPNKLRLCLELVQSAA+V
Sbjct  185   VLLDHHADPTIRTVDGVTPLDILRTLTSDFLFKGAVPGMTHIEPNKLRLCLELVQSAALV  244

Query  1293  ISREE----GnaaannnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYL  1460
             ISRE+     N   NN SSS  IYP    MSE+H          S N  NLNLD+RLVYL
Sbjct  245   ISREQGNNNNNNGNNNPSSSNPIYP---PMSEDH--------SSSSNGSNLNLDTRLVYL  293

Query  1461  NLGAVENSGGGGHHNQREAMTTRQNSGDPPSMYHHSHEY  1577
             NLGA   S   G           ++ G+ P+MYHHSH++
Sbjct  294   NLGANSGSAQMGADG-----ADHRHGGNDPTMYHHSHDF  327



>emb|CDX79940.1| BnaA05g02160D [Brassica napus]
Length=317

 Score =   401 bits (1030),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 240/323 (74%), Positives = 261/323 (81%), Gaps = 18/323 (6%)
 Frame = +3

Query  603   MVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRH  782
             MVEKASIEDVM+VLIAS KQ+M QLWTTCSHLVAKSGLPPE+LAKHL IDVVAKIEELR 
Sbjct  1     MVEKASIEDVMKVLIASRKQDMHQLWTTCSHLVAKSGLPPEILAKHLTIDVVAKIEELRL  60

Query  783   KsslarssllahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEAL  962
             KSS+AR SL+ HHHH     A    EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+L
Sbjct  61    KSSIARRSLMPHHHHHDLTVAQDL-EDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESL  119

Query  963   ALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPN  1142
             ALHYAVE+CSREVVKALLELGAADVNYPAG AG+TPLHIAAEMVSPDMV+VLLDHHADPN
Sbjct  120   ALHYAVESCSREVVKALLELGAADVNYPAGPAGKTPLHIAAEMVSPDMVAVLLDHHADPN  179

Query  1143  VRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaa  1322
             VRT  GITPLDILRTLTSDFLFKGA+PGL HIEPNKLRLCLELVQSAAMVISREEG   +
Sbjct  180   VRTVGGITPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAAMVISREEG-NNS  238

Query  1323  nnnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVE----NSGG  1490
             NNN  +  IYP    M++E        + GS    N NLDSR VYLNLGA +       G
Sbjct  239   NNNDHNNAIYP---QMNDE-------RNSGSSGGSNNNLDSRFVYLNLGAGQMGPGRDHG  288

Query  1491  GGHHNQREAMTTRQNSGDPPSMY  1559
               H++QRE M+   +  DP +MY
Sbjct  289   DDHNSQREGMSRHHH--DPSTMY  309



>gb|EAY77216.1| hypothetical protein OsI_05187 [Oryza sativa Indica Group]
Length=344

 Score =   400 bits (1029),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 222/309 (72%), Positives = 249/309 (81%), Gaps = 13/309 (4%)
 Frame = +3

Query  567   QLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLP  746
             +L  +  KQLA MVEKASIEDVM+VL+AS KQ++ QLWTTCSHLVAKSGLPPEVLAKHLP
Sbjct  9     RLVTVVAKQLAGMVEKASIEDVMKVLMASRKQDLHQLWTTCSHLVAKSGLPPEVLAKHLP  68

Query  747   IDVVAKIEELRHKsslarssllahhhhrh--------dlgaaadlEDQKIRRMRRALDSS  902
             IDVVAKI+ELR KS   RS  L+HHHH             AA   +  KIRRMRRALDSS
Sbjct  69    IDVVAKIDELRLKSMSRRSPFLSHHHHHPHAAAAGIEASSAAELDDHHKIRRMRRALDSS  128

Query  903   DVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIA  1082
             DVELVKLMVMGEGLNLD+ALALHYAVENCSREVVKALLELGAADVN+PAG AG+TPLH+A
Sbjct  129   DVELVKLMVMGEGLNLDDALALHYAVENCSREVVKALLELGAADVNHPAGPAGKTPLHVA  188

Query  1083  AEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLC  1262
             AEMV PDMV+VLLDHHADPNVRT DG+TPLDILRTLTSDFLFKGA+PGLAHIEPNKLRLC
Sbjct  189   AEMVCPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLAHIEPNKLRLC  248

Query  1263  LELVQSAAMVISREEGnaaannnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLD  1442
             LELVQSAAMV+SRE+   AA N +      P        ++     +SG S ++VNL+LD
Sbjct  249   LELVQSAAMVMSREDAQTAAVNAAPIYGESPGGGGGGGVYN-----ASGTSSSMVNLSLD  303

Query  1443  SRLVYLNLG  1469
             +R+VYLNLG
Sbjct  304   NRMVYLNLG  312



>ref|NP_001045396.1| Os01g0948900 [Oryza sativa Japonica Group]
 dbj|BAF07310.1| Os01g0948900 [Oryza sativa Japonica Group]
Length=337

 Score =   399 bits (1026),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 222/303 (73%), Positives = 247/303 (82%), Gaps = 13/303 (4%)
 Frame = +3

Query  585   QKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAK  764
             QKQLA MVEKASIEDVM+VL+AS KQ++ QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAK
Sbjct  8     QKQLAGMVEKASIEDVMKVLMASRKQDLHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAK  67

Query  765   IEELRHKsslarssllahhhhr--------hdlgaaadlEDQKIRRMRRALDSSDVELVK  920
             I+ELR KS   RS  L+HHHH             AA   +  KIRRMRRALDSSDVELVK
Sbjct  68    IDELRLKSMSRRSPFLSHHHHHPHAAAAGIEASSAAELDDHHKIRRMRRALDSSDVELVK  127

Query  921   LMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSP  1100
             LMVMGEGLNLD+ALALHYAVENCSREVVKALLELGAADVN+PAG AG+TPLH+AAEMV P
Sbjct  128   LMVMGEGLNLDDALALHYAVENCSREVVKALLELGAADVNHPAGPAGKTPLHVAAEMVCP  187

Query  1101  DMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQS  1280
             DMV+VLLDHHADPNVRT DG+TPLDILRTLTSDFLFKGA+PGLAHIEPNKLRLCLELVQS
Sbjct  188   DMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLAHIEPNKLRLCLELVQS  247

Query  1281  AAMVISREEGnaaannnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYL  1460
             AAMV+SRE+   AA N +      P        ++     +SG S ++VNL+LD+R+VYL
Sbjct  248   AAMVMSREDAQTAAVNAAPIYGESPGGGGGGGVYN-----ASGTSSSMVNLSLDNRMVYL  302

Query  1461  NLG  1469
             NLG
Sbjct  303   NLG  305



>dbj|BAD87216.1| non-inducible immunity 1-like [Oryza sativa Japonica Group]
Length=324

 Score =   390 bits (1003),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 217/297 (73%), Positives = 242/297 (81%), Gaps = 13/297 (4%)
 Frame = +3

Query  603   MVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRH  782
             MVEKASIEDVM+VL+AS KQ++ QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKI+ELR 
Sbjct  1     MVEKASIEDVMKVLMASRKQDLHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIDELRL  60

Query  783   Ksslarssllahhhhr--------hdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGE  938
             KS   RS  L+HHHH             AA   +  KIRRMRRALDSSDVELVKLMVMGE
Sbjct  61    KSMSRRSPFLSHHHHHPHAAAAGIEASSAAELDDHHKIRRMRRALDSSDVELVKLMVMGE  120

Query  939   GLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVL  1118
             GLNLD+ALALHYAVENCSREVVKALLELGAADVN+PAG AG+TPLH+AAEMV PDMV+VL
Sbjct  121   GLNLDDALALHYAVENCSREVVKALLELGAADVNHPAGPAGKTPLHVAAEMVCPDMVAVL  180

Query  1119  LDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVIS  1298
             LDHHADPNVRT DG+TPLDILRTLTSDFLFKGA+PGLAHIEPNKLRLCLELVQSAAMV+S
Sbjct  181   LDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLAHIEPNKLRLCLELVQSAAMVMS  240

Query  1299  REEGnaaannnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLG  1469
             RE+   AA N +      P        ++     +SG S ++VNL+LD+R+VYLNLG
Sbjct  241   REDAQTAAVNAAPIYGESPGGGGGGGVYN-----ASGTSSSMVNLSLDNRMVYLNLG  292



>ref|XP_008674530.1| PREDICTED: regulatory protein NPR5-like [Zea mays]
 ref|XP_008674531.1| PREDICTED: regulatory protein NPR5-like [Zea mays]
 tpg|DAA55831.1| TPA: hypothetical protein ZEAMMB73_949056 [Zea mays]
 tpg|DAA55832.1| TPA: hypothetical protein ZEAMMB73_949056 [Zea mays]
Length=326

 Score =   388 bits (996),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 218/306 (71%), Positives = 240/306 (78%), Gaps = 32/306 (10%)
 Frame = +3

Query  603   MVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRH  782
             MVEKASIEDVM+VL+AS KQ++ QLWTTCSHLVAKSGLPPEVL KHLPIDVVAKI ELR 
Sbjct  1     MVEKASIEDVMKVLMASRKQDLHQLWTTCSHLVAKSGLPPEVLDKHLPIDVVAKIVELRL  60

Query  783   Ksslarssllahhhh---------rhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMG  935
             KSS++R S    HHH              AA   E  KIRRMRRALDSSDVELVKLMVMG
Sbjct  61    KSSMSRRSPFLAHHHPHHHPAAGGMEASSAADIDEHHKIRRMRRALDSSDVELVKLMVMG  120

Query  936   EGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSV  1115
             EGLNLDEALALHYAVENCSREVVKALLELGAADVN+PAG AG+TPLH+AAEMV PDMV+V
Sbjct  121   EGLNLDEALALHYAVENCSREVVKALLELGAADVNHPAGPAGKTPLHVAAEMVCPDMVAV  180

Query  1116  LLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVI  1295
             LLDHHADPNVRT +G+TPLDILRTLTSDFLFKGA+PGLAH+EPNKLRLCLELVQSAAMV+
Sbjct  181   LLDHHADPNVRTVEGVTPLDILRTLTSDFLFKGAVPGLAHVEPNKLRLCLELVQSAAMVM  240

Query  1296  SREEGnaaannnsssaVIYPAALAMSEEHHHRNIPSSGG--------SGNIVNLNLDSRL  1451
             SRE+             + PAA  M  E      PS GG        S ++VNL+LD+R+
Sbjct  241   SREDA---------HTAVNPAAAPMYGE------PSGGGAVYSASGTSSSMVNLSLDNRM  285

Query  1452  VYLNLG  1469
             VYLNLG
Sbjct  286   VYLNLG  291



>ref|XP_010909415.1| PREDICTED: regulatory protein NPR5-like isoform X2 [Elaeis guineensis]
Length=455

 Score =   389 bits (999),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 229/316 (72%), Positives = 252/316 (80%), Gaps = 19/316 (6%)
 Frame = +3

Query  576   LLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDV  755
             L+  KQLASMVEKASIEDVM+VL+AS KQ+M QLWTTCSHLVAKSGLP EVLAKHLPIDV
Sbjct  112   LVVSKQLASMVEKASIEDVMKVLLASRKQDMHQLWTTCSHLVAKSGLPAEVLAKHLPIDV  171

Query  756   VAKIEELRHKsslarssl----------lahhhhrhdlgaaadlED--QKIRRMRRALDS  899
             VAKIEELR KSSLAR S                      AAA+LED   KIRRMRRALDS
Sbjct  172   VAKIEELRLKSSLARRSSFMAHHHPLDLATAGAGPSSSSAAAELEDHHNKIRRMRRALDS  231

Query  900   SDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHI  1079
             SDVELVKLMVMGEGLNLD+ALALHYAVENCSREVVKALLELGAADVN PAG AG+TPLHI
Sbjct  232   SDVELVKLMVMGEGLNLDDALALHYAVENCSREVVKALLELGAADVNCPAGPAGKTPLHI  291

Query  1080  AAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRL  1259
             AAEMV PDMV+VLLDHHADPN+RT DG+TPLDILRTLTSDFLFKGA+PGL+HIEPNKLRL
Sbjct  292   AAEMVCPDMVAVLLDHHADPNIRTVDGVTPLDILRTLTSDFLFKGAVPGLSHIEPNKLRL  351

Query  1260  CLELVQSAAMVISREEGnaaannnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNL  1439
             CLELVQSAA+V+SREE       +  +A IYP    M+ E  + N  +S  S ++VNL+L
Sbjct  352   CLELVQSAALVMSREEA--TNCGSGGTAAIYP---PMNPEPSNCN--ASSASSSMVNLSL  404

Query  1440  DSRLVYLNLGAVENSG  1487
             DSR+VYLNLG     G
Sbjct  405   DSRMVYLNLGMAAQLG  420



>ref|XP_002459094.1| hypothetical protein SORBIDRAFT_03g045730 [Sorghum bicolor]
 gb|EES04214.1| hypothetical protein SORBIDRAFT_03g045730 [Sorghum bicolor]
Length=325

 Score =   384 bits (985),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 213/297 (72%), Positives = 240/297 (81%), Gaps = 15/297 (5%)
 Frame = +3

Query  603   MVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRH  782
             MVEKASIEDVM+VL+AS KQ++ QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKI+ELR 
Sbjct  1     MVEKASIEDVMKVLMASRKQDLHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIDELRL  60

Query  783   Ksslarssllah--------hhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGE  938
             KSSL+R S                    AA   +  KIRRMRRALDSSDVELVKLMVMGE
Sbjct  61    KSSLSRRSPFLAHHHPYHPAAGGMEASSAADIDDHHKIRRMRRALDSSDVELVKLMVMGE  120

Query  939   GLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVL  1118
             GLNLDEALALHYAVENCSREVVKALLELGAADVN+PAG AG+TPLH+AAEMV PDMV+VL
Sbjct  121   GLNLDEALALHYAVENCSREVVKALLELGAADVNHPAGPAGKTPLHVAAEMVCPDMVAVL  180

Query  1119  LDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVIS  1298
             LDHHADPNVRT +G+TPLDILRTLTSDFLFKGA+PGLAHIEPNKLRLCLELVQSAAMV+S
Sbjct  181   LDHHADPNVRTVEGVTPLDILRTLTSDFLFKGAVPGLAHIEPNKLRLCLELVQSAAMVMS  240

Query  1299  REEGnaaannnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLG  1469
             RE+ + AA   +++ +         E        +SG S ++VNL+LD+R+VYLNLG
Sbjct  241   REDAHTAAAAVNAAPMY-------GEPSGGTVYNASGTSSSMVNLSLDNRMVYLNLG  290



>ref|XP_002986952.1| hypothetical protein SELMODRAFT_125007 [Selaginella moellendorffii]
 gb|EFJ12034.1| hypothetical protein SELMODRAFT_125007 [Selaginella moellendorffii]
Length=435

 Score =   384 bits (986),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 207/378 (55%), Positives = 265/378 (70%), Gaps = 38/378 (10%)
 Frame = +3

Query  162   NGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaa  341
             NGQAFSDVTF+VEGR V+AH+C+LAARS FFR  FC  ++                    
Sbjct  20    NGQAFSDVTFTVEGRPVYAHKCVLAARSQFFRMIFCSSEASQDIP---------------  64

Query  342   SPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPN-CRERGCWHTHCTSAV  518
                G  P  IPV  VGY+VF+LM+QFLYSGQ+S+VP    P P  C+E  CWH +C SAV
Sbjct  65    ---GRPP--IPVGIVGYDVFMLMLQFLYSGQLSLVP----PHPTGCKEGACWHVYCRSAV  115

Query  519   DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
             D AL+ L AA+ F +EQL++L Q++LA + EKASIEDVMR+L A+ KQ++  LW+ CS L
Sbjct  116   DFALEALHAAQVFSIEQLSILVQRELAGIAEKASIEDVMRILAAARKQDLLHLWSVCSKL  175

Query  699   VAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRR  878
             VAKSGL  EVL KHLP +VVA++E +R K             +  +  ++  L+DQ+ RR
Sbjct  176   VAKSGLSSEVLRKHLPGEVVAEVEAIRQK-----------CGYGFEAHSSDALDDQRTRR  224

Query  879   MRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAA  1058
             M++ALDSSDVELV+LMVMGEGL+LD+ LA+HYAV NCSR+VVK LLELGAA+VN P G  
Sbjct  225   MQKALDSSDVELVRLMVMGEGLDLDKTLAIHYAVANCSRKVVKNLLELGAANVNMP-GPD  283

Query  1059  GRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHI  1238
             GRTPLHIA E+  P+M++VLLDHHADP+  T  G T L+IL+ L S+ L  GA+ G+   
Sbjct  284   GRTPLHIAGELADPEMIAVLLDHHADPHSTTPTGATALNILQNLASEALAVGALTGVT-A  342

Query  1239  EPNKLRLCLELVQSAAMV  1292
             + NKLRLCL+L++SAA V
Sbjct  343   DHNKLRLCLDLLESAAAV  360



>ref|XP_002977926.1| hypothetical protein SELMODRAFT_107813 [Selaginella moellendorffii]
 gb|EFJ21264.1| hypothetical protein SELMODRAFT_107813 [Selaginella moellendorffii]
Length=435

 Score =   384 bits (985),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 207/378 (55%), Positives = 265/378 (70%), Gaps = 38/378 (10%)
 Frame = +3

Query  162   NGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaa  341
             NGQAFSDVTF+VEGR V+AH+C+LAARS FFR  FC  ++                    
Sbjct  20    NGQAFSDVTFTVEGRPVYAHKCVLAARSQFFRMIFCSSEASQDIP---------------  64

Query  342   SPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPN-CRERGCWHTHCTSAV  518
                G  P  IPV  VGY+VF+LM+QFLYSGQ+S+VP    P P  C+E  CWH +C SAV
Sbjct  65    ---GRPP--IPVGIVGYDVFMLMLQFLYSGQLSLVP----PHPTGCKEGACWHVYCRSAV  115

Query  519   DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
             D AL+ L AA+ F +EQL++L Q++LA + EKASIEDVMR+L A+ KQ++  LW+ CS L
Sbjct  116   DFALEALHAAQVFSIEQLSILVQRELAGIAEKASIEDVMRILAAARKQDLLHLWSVCSKL  175

Query  699   VAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRR  878
             VAKSGL  EVL KHLP +VVA++E +R K             +  +  ++  L+DQ+ RR
Sbjct  176   VAKSGLSSEVLRKHLPGEVVAEVEAIRQK-----------CGYGFEAHSSDALDDQRTRR  224

Query  879   MRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAA  1058
             M++ALDSSDVELV+LMVMGEGL+LD+ LA+HYAV NCSR+VVK LLELGAA+VN P G  
Sbjct  225   MQKALDSSDVELVRLMVMGEGLDLDKTLAIHYAVANCSRKVVKNLLELGAANVNMP-GPD  283

Query  1059  GRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHI  1238
             GRTPLHIA E+  P+M++VLLDHHADP+  T  G T L+IL+ L S+ L  GA+ G+   
Sbjct  284   GRTPLHIAGELADPEMIAVLLDHHADPHSTTPTGATALNILQNLASEALAVGALTGVT-A  342

Query  1239  EPNKLRLCLELVQSAAMV  1292
             + NKLRLCL+L++SAA V
Sbjct  343   DHNKLRLCLDLLESAAAV  360



>ref|XP_009104044.1| PREDICTED: regulatory protein NPR6-like isoform X2 [Brassica 
rapa]
Length=394

 Score =   382 bits (981),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 223/341 (65%), Positives = 251/341 (74%), Gaps = 22/341 (6%)
 Frame = +3

Query  540   SAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLP  719
             S AR   V  +  +  K L SMVEKASIEDVM+VLIAS KQ+M QLWTTCS+LV+KSGLP
Sbjct  67    SGARVASVGGVVPVNSKHLTSMVEKASIEDVMKVLIASRKQDMHQLWTTCSYLVSKSGLP  126

Query  720   PEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRALDS  899
              E+LAKHLPI+++ K+EELR KSS+   SL+ H H ++        EDQKI+RMRRALDS
Sbjct  127   TEILAKHLPIELLGKVEELRLKSSIPLRSLMPHQHDQNSALNL---EDQKIKRMRRALDS  183

Query  900   SDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHI  1079
             SD ELVKLMVMGEGLNLDE+LAL YAVENCSREVVKALLELGAADVN+PAG   +T LHI
Sbjct  184   SDFELVKLMVMGEGLNLDESLALFYAVENCSREVVKALLELGAADVNHPAGPTRKTALHI  243

Query  1080  AAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRL  1259
             AAEMVSPDMV+VLLDHHADP V+T DGITPLDILRTLTSDFLFKG I GL HIEPNKLRL
Sbjct  244   AAEMVSPDMVAVLLDHHADPTVQTVDGITPLDILRTLTSDFLFKGTIHGLTHIEPNKLRL  303

Query  1260  CLELVQSAAMVISREEGnaaannnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNL  1439
             CLELVQSAAMVISREEG    NNN ++ VIYP           ++    G S       L
Sbjct  304   CLELVQSAAMVISREEG--NNNNNVNNTVIYPRM---------KDKRVKGSS-------L  345

Query  1440  DSRLVYLNLGAVENSGGGGHHNQREAMTT-RQNSGDPPSMY  1559
             DSRLVYLN GA     G  H NQ E  +    +  DP +MY
Sbjct  346   DSRLVYLNRGATNPDFGDEHGNQTEETSLHHHHYHDPSTMY  386


 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/36 (100%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  159  INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFF  266
            INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFF
Sbjct  18   INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFF  53



>ref|XP_009139335.1| PREDICTED: regulatory protein NPR6-like [Brassica rapa]
Length=291

 Score =   377 bits (969),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 212/323 (66%), Positives = 237/323 (73%), Gaps = 36/323 (11%)
 Frame = +3

Query  603   MVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRH  782
             MVEKASIEDVM+VLIAS K +M QLWTTCS+L+ KSGLP E+LAKHLPI++VAK+E+LR 
Sbjct  1     MVEKASIEDVMKVLIASRKHDMHQLWTTCSYLLTKSGLPTEILAKHLPIELVAKVEDLRL  60

Query  783   KsslarssllahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEAL  962
             KSS+     L               +DQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+L
Sbjct  61    KSSMPHQHDLTSALDL---------DDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESL  111

Query  963   ALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPN  1142
             AL YAVENCSREVVKALLE+GA DVN+  G   +T LHIAAEMVSPDMV+VLLDHHADPN
Sbjct  112   ALVYAVENCSREVVKALLEIGATDVNFQVGPTRKTALHIAAEMVSPDMVAVLLDHHADPN  171

Query  1143  VRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaa  1322
             V+T DGITPLDILRTLTS+FLFKG I GL H EPNKLRLCLELVQSAA+VISREEGN   
Sbjct  172   VQTVDGITPLDILRTLTSNFLFKGTIHGLTHTEPNKLRLCLELVQSAALVISREEGNNND  231

Query  1323  nnnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHH  1502
             NN             M EEH      +SG S       LDSRLVYLNLGA     G GH 
Sbjct  232   NN-------------MKEEH------TSGSS-------LDSRLVYLNLGATNRDLGDGHG  265

Query  1503  NQREAMTTRQNSGDPPSMYHHSH  1571
             +Q E M+   +  DP +MYH+ H
Sbjct  266   HQMEGMSLHHHH-DPSTMYHYHH  287



>emb|CDX76040.1| BnaA04g03040D [Brassica napus]
Length=291

 Score =   377 bits (967),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 211/323 (65%), Positives = 237/323 (73%), Gaps = 36/323 (11%)
 Frame = +3

Query  603   MVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRH  782
             MVEKASIEDVM+VLIAS K +M QLWTTCS+L+ KSGLP E+LAKHLPI++VAK+E+LR 
Sbjct  1     MVEKASIEDVMKVLIASRKHDMHQLWTTCSYLLTKSGLPTEILAKHLPIELVAKVEDLRL  60

Query  783   KsslarssllahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEAL  962
             KSS+     L               +DQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+L
Sbjct  61    KSSMPHQHDLTSALDL---------DDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESL  111

Query  963   ALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPN  1142
             AL YAVENCSREVVKALLE+GA DVN+  G   +T LHIAAEMVSPDMV+VLLDHHADPN
Sbjct  112   ALVYAVENCSREVVKALLEIGATDVNFQVGPTRKTALHIAAEMVSPDMVAVLLDHHADPN  171

Query  1143  VRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaa  1322
             V+T DGITPLDILRTLTS+FLFKG I GL H EPNKLRLCLELVQSAA+VISREEGN   
Sbjct  172   VQTVDGITPLDILRTLTSNFLFKGTIHGLTHTEPNKLRLCLELVQSAALVISREEGNNND  231

Query  1323  nnnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHH  1502
             NN             M E+H      +SG S       LDSRLVYLNLGA     G GH 
Sbjct  232   NN-------------MKEDH------TSGSS-------LDSRLVYLNLGATNRDLGDGHG  265

Query  1503  NQREAMTTRQNSGDPPSMYHHSH  1571
             +Q E M+   +  DP +MYH+ H
Sbjct  266   HQMEGMSLHHHH-DPSTMYHYHH  287



>emb|CDY35774.1| BnaC02g38200D [Brassica napus]
Length=291

 Score =   375 bits (964),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 210/323 (65%), Positives = 236/323 (73%), Gaps = 36/323 (11%)
 Frame = +3

Query  603   MVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRH  782
             MVE ASIEDVM+VLIAS K +M QLWTTCS+L+ KSGLP E+LAKHLPI++VAK+E+LRH
Sbjct  1     MVENASIEDVMKVLIASRKHDMHQLWTTCSYLLTKSGLPTEILAKHLPIELVAKVEDLRH  60

Query  783   KsslarssllahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEAL  962
             KSS+     L               +DQKIRRMRRALDSSDVELVKLMVMGEGLNLDE+L
Sbjct  61    KSSMPHQHDLTSALDL---------DDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESL  111

Query  963   ALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPN  1142
             AL YAVENCSREVVKALLE+GA DVN+  G   +T LHIAAEMVSPDMV+VLL HHADPN
Sbjct  112   ALVYAVENCSREVVKALLEIGATDVNFQVGPTRKTALHIAAEMVSPDMVAVLLHHHADPN  171

Query  1143  VRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaa  1322
             V+T DGITPLDILRTLTS+FLFKG I GL H EPNKLRLCLELVQSAA+VISREEGN   
Sbjct  172   VQTVDGITPLDILRTLTSNFLFKGTIHGLTHTEPNKLRLCLELVQSAALVISREEGNNND  231

Query  1323  nnnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENSGGGGHH  1502
             NN             M E+H      +SG S       LDSRLVYLNLGA     G GH 
Sbjct  232   NN-------------MKEDH------TSGSS-------LDSRLVYLNLGATNRDLGDGHG  265

Query  1503  NQREAMTTRQNSGDPPSMYHHSH  1571
             +Q E M+   +  DP +MYH+ H
Sbjct  266   HQMEGMSLHHHH-DPSTMYHYHH  287



>ref|XP_002961253.1| hypothetical protein SELMODRAFT_74877 [Selaginella moellendorffii]
 gb|EFJ38792.1| hypothetical protein SELMODRAFT_74877 [Selaginella moellendorffii]
Length=396

 Score =   349 bits (895),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 188/407 (46%), Positives = 267/407 (66%), Gaps = 45/407 (11%)
 Frame = +3

Query  162   NGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaa  341
             NGQAFSDV F+++GR V+AH+C+LAARS FFR                          + 
Sbjct  22    NGQAFSDVAFAIDGRHVYAHKCVLAARSRFFRMVL----------------------TSN  59

Query  342   SPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVD  521
              P  + P V+PV++VG++ F+L ++FLYSGQ+ ++P   +P   C+E  CWH+ C +AVD
Sbjct  60    GPTQA-PLVMPVSAVGHDAFMLTLRFLYSGQLCLLPSNSQPDRGCKESSCWHSQCRAAVD  118

Query  522   LALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLV  701
              AL+ L AA+ FG+++L++L QK+LA+M EKASIED MR+L+ + KQ++ QLW+ CS L+
Sbjct  119   FALEALHAAQMFGIDELSVLVQKELAAMAEKASIEDAMRILVTARKQDLLQLWSVCSKLI  178

Query  702   AKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRM  881
             AKSGL  E L KH+P+++ A+IE +RHK           +++      +  L++Q+ RRM
Sbjct  179   AKSGLSTEALEKHVPVEIAAEIEAIRHK---------CGYYNASRADCSDSLDEQRTRRM  229

Query  882   RRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAG  1061
             ++ALDSSDVELVKL+VM EGL+LD+  ALHYAV +CSR+VV  LL+LGAADVN      G
Sbjct  230   QKALDSSDVELVKLLVMEEGLSLDKTFALHYAVAHCSRKVVSILLQLGAADVN-AVDVEG  288

Query  1062  RTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKG---AIPGLA  1232
             RTPLHIA E+  P+M++VLLDHHA P+VR+  G T LD++++     +F+    A  G A
Sbjct  289   RTPLHIAGELADPEMIAVLLDHHASPHVRSPAGTTALDMVQS----HVFQALTLASEGGA  344

Query  1233  HIEPNKLRLCLELVQSAAMVISRE-----EGnaaannnsssaVIYPA  1358
               + +KL+LCLEL+Q+A  V S+E     EGN        +   YPA
Sbjct  345   PADHSKLKLCLELLQTAEPVSSQERIVQDEGNCLLMAPERNNDFYPA  391



>ref|XP_002969487.1| hypothetical protein SELMODRAFT_91240 [Selaginella moellendorffii]
 gb|EFJ29575.1| hypothetical protein SELMODRAFT_91240 [Selaginella moellendorffii]
Length=396

 Score =   347 bits (890),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 181/384 (47%), Positives = 260/384 (68%), Gaps = 40/384 (10%)
 Frame = +3

Query  162   NGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaa  341
             NGQAFSDV F+++GR V+AH+C+LAARS FFR                          + 
Sbjct  22    NGQAFSDVAFAIDGRHVYAHKCVLAARSRFFRMVL----------------------TSN  59

Query  342   SPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVD  521
              P  + P V+PV++VG++ F+L ++FLYSGQ+ ++P   +P   C+E  CWH+ C +AVD
Sbjct  60    GPTQA-PLVMPVSAVGHDAFMLTLRFLYSGQLCLLPSNSQPDRGCKESSCWHSQCRAAVD  118

Query  522   LALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLV  701
              AL+ L AA+ FG+++L++L QK+LA+M EKASIED MR+L+ + +Q++ QLW+ CS L+
Sbjct  119   FALEALHAAQMFGIDELSVLVQKELAAMAEKASIEDAMRILVTAREQDLLQLWSVCSKLI  178

Query  702   AKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRM  881
             AKSGL  E L KH+P+++ A+IE +RHK           +++      +  L++Q+ RRM
Sbjct  179   AKSGLSTEALEKHVPVEIAAEIEAIRHK---------CGYYNASRADCSDSLDEQRTRRM  229

Query  882   RRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAG  1061
             ++ALDSSDVELVKL+VM EGL+LD+  ALHYAV +CSR+VV  LL+LGAADVN      G
Sbjct  230   QKALDSSDVELVKLLVMEEGLSLDKTFALHYAVAHCSRKVVSILLQLGAADVN-AVDVEG  288

Query  1062  RTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKG---AIPGLA  1232
             RTPLHIA E+  P+M++VLLDHHA P+VR+  G T LD++++     +F+    A  G A
Sbjct  289   RTPLHIAGELADPEMIAVLLDHHASPHVRSPAGTTALDMVQS----HVFQALTLASEGGA  344

Query  1233  HIEPNKLRLCLELVQSAAMVISRE  1304
               + +KL+LCLEL+Q+A  V S+E
Sbjct  345   PADHSKLKLCLELLQTAEPVSSQE  368



>emb|CBX25466.1| hypothetical_protein [Oryza glaberrima]
Length=450

 Score =   349 bits (895),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 203/368 (55%), Positives = 248/368 (67%), Gaps = 47/368 (13%)
 Frame = +3

Query  504   CTSAVDLALDTLSAARSFGVEQLALLTQ---------KQLASMVEKASIEDVMRVLIASG  656
             C +AVDLALDTL+AARSFGVEQLALL Q         KQL SMV++AS++DVM+VL+AS 
Sbjct  108   CGAAVDLALDTLAAARSFGVEQLALLVQVAQCNVLMQKQLESMVKEASVDDVMKVLMASR  167

Query  657   KQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhr--  830
             K EMQ+LW TCSHLVA+SGL  ++LAKHLPIDVVAKIEE+R KS LA ++          
Sbjct  168   KFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEIRAKSPLAAAAAPRSPFLTHH  227

Query  831   ---hdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREV  1001
                 +  ++A   D KIRRMR            LMVMGEGL+LD+ALA+HYAV++C+R+V
Sbjct  228   YLPMNPASSAADRDNKIRRMR------------LMVMGEGLDLDDALAVHYAVQHCNRDV  275

Query  1002  VKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDIL  1181
             VKALLELGAADVN  AG  G+T LH+AAEMVSPDMVSVLLDHHADPN RT DG+TPLD+L
Sbjct  276   VKALLELGAADVNSRAGPTGKTALHLAAEMVSPDMVSVLLDHHADPNSRTLDGVTPLDVL  335

Query  1182  RTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEGnaaannnsssaVIYPAA  1361
             R+LTS+FLFKGA+PGL HIEPNKLRLCLELVQSA MV +R++G                 
Sbjct  336   RSLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMVTTRDDGAPVTGG-----------  384

Query  1362  LAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLN--LGAVENSGGGGHHNQREAMTTRQN  1535
              A +      N P S    ++V+L ++S L+Y    + A   +G G   N          
Sbjct  385   -AEAGGSDGGNFPRSDADDSLVSLTMNSTLMYQGQEMAAAVAAGEGRKSNNGRG------  437

Query  1536  SGDPPSMY  1559
                PP+MY
Sbjct  438   -SPPPAMY  444


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +3

Query  159  INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC  269
            INGQAFSDV FSVEGRLVHAHRC+LAARSLFFRK FC
Sbjct  19   INGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFC  55



>ref|XP_001757508.1| predicted protein [Physcomitrella patens]
 gb|EDQ77565.1| predicted protein [Physcomitrella patens]
Length=463

 Score =   344 bits (882),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 187/379 (49%), Positives = 246/379 (65%), Gaps = 30/379 (8%)
 Frame = +3

Query  165   GQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaS  344
             GQ FSDV F VEGR V+AHRC+LAARS FFR  F       S++                
Sbjct  23    GQVFSDVAFEVEGRHVYAHRCVLAARSPFFRTIFWSDVQMMSNT---------------Q  67

Query  345   PRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDL  524
             P+ SIPQVI V  VGY+VF+ ++QFLYSG      Q       C+++ CWHTHC++AV  
Sbjct  68    PKPSIPQVISVGIVGYDVFMTLLQFLYSGSFQFSAQSSGRL--CQDKSCWHTHCSAAVKF  125

Query  525   ALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVA  704
              LD L+AA  FGVEQL+ +TQ  LASM EKASIEDVMR+L+ + KQ    LW  CS LVA
Sbjct  126   GLDILNAAVFFGVEQLSAITQNHLASMAEKASIEDVMRMLVIARKQNDLHLWHLCSKLVA  185

Query  705   KSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMR  884
             KSGL P++L K+LP D+V +++ +R K+     +  +               +QKI+RM+
Sbjct  186   KSGLSPKMLLKYLPGDLVQELQSIRQKTGYNSDTTASGSATL----------EQKIKRMQ  235

Query  885   RALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGR  1064
             +ALDSSDVELVKLMVMGEGLNLDE   LHYAV +CSR+VVK LLELGAA+VN      GR
Sbjct  236   KALDSSDVELVKLMVMGEGLNLDEVFGLHYAVSSCSRKVVKNLLELGAANVNL-QDLDGR  294

Query  1065  TPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEP  1244
             TPLHIAA++  P+ +++LLDHHA+P+ RTA   T +DI+++  ++    G     A  + 
Sbjct  295   TPLHIAAQLGDPEKIAMLLDHHAEPHTRTATCATAMDIVQSGAAEIQSAGRYNTKA--DH  352

Query  1245  NKLRLCLELVQSAAMVISR  1301
             N+LR C+EL++ AA+  +R
Sbjct  353   NRLRACMELLERAALASTR  371



>ref|NP_001066113.2| Os12g0138500 [Oryza sativa Japonica Group]
 dbj|BAF29132.2| Os12g0138500 [Oryza sativa Japonica Group]
Length=312

 Score =   337 bits (865),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 184/326 (56%), Positives = 230/326 (71%), Gaps = 27/326 (8%)
 Frame = +3

Query  603   MVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRH  782
             MV++AS++DVM+VL+AS K EMQ+LW TCSHLVA+SGL  ++LAKHLPIDVVAKIEE+R 
Sbjct  1     MVKEASVDDVMKVLMASRKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEIRA  60

Query  783   Ksslarssllahhhhr-----hdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLN  947
             KS LA ++              +  ++A   D KIRRMRRALD++D+ELVKLMVMGEGL+
Sbjct  61    KSPLAAAAAPRSPFLTHHYLPMNPASSAADRDNKIRRMRRALDAADIELVKLMVMGEGLD  120

Query  948   LDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDH  1127
             LD+ALA+HYAV++C+R+VVKALLELGAADVN  AG  G+T LH+AAEMVSPDMVSVLLDH
Sbjct  121   LDDALAVHYAVQHCNRDVVKALLELGAADVNSRAGPTGKTALHLAAEMVSPDMVSVLLDH  180

Query  1128  HADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREE  1307
             HADPN RT DG+TPLD+LR+LTS+FLFKGA+PGL HIEPNKLRLCLELVQSA MV +R++
Sbjct  181   HADPNSRTLDGVTPLDVLRSLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMVTTRDD  240

Query  1308  GnaaannnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVY--LNLGAVEN  1481
             G              P     +      N P S    ++V+L ++S L+Y    + A   
Sbjct  241   GA-------------PVTGGEAGGSDGGNFPRSDADDSLVSLTMNSTLMYQGQEMAAAVA  287

Query  1482  SGGGGHHNQREAMTTRQNSGDPPSMY  1559
             +G G   N             PP+MY
Sbjct  288   AGEGRKSNN-------GRGSPPPAMY  306



>ref|XP_001784176.1| predicted protein [Physcomitrella patens]
 gb|EDQ51035.1| predicted protein [Physcomitrella patens]
Length=367

 Score =   338 bits (868),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 179/375 (48%), Positives = 238/375 (63%), Gaps = 29/375 (8%)
 Frame = +3

Query  165   GQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaS  344
             GQAFSDVTF VE R V AHRC+LAARS FFR  FC      S                  
Sbjct  22    GQAFSDVTFKVEDRHVFAHRCVLAARSPFFRMVFCDDQQLNSA----------------Q  65

Query  345   PRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDL  524
             PR  IP VI V  VGY+VF+L++QFLYSG  S           C+++ CWHTHC+SAV+ 
Sbjct  66    PRPGIPNVISVGVVGYDVFMLLLQFLYSGNYSNFFSPQNCGRQCKDKSCWHTHCSSAVEF  125

Query  525   ALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVA  704
              LDT+ AA  FG++QL+ LTQK LA+M EKAS+EDVMR+L  +  QE + LW  CS LVA
Sbjct  126   GLDTMKAALFFGLDQLSTLTQKHLAAMAEKASVEDVMRILTTAHTQENKHLWNVCSKLVA  185

Query  705   KSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMR  884
             KSG   E+L KHLP ++V ++E++R K                   ++    +QK +RM+
Sbjct  186   KSGPFSEILQKHLPANIVCELEDIRRK----------SGFGFEAAMSSNTTSEQKTKRMQ  235

Query  885   RALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGR  1064
             +ALDSSDVELV+LM+ GEGLNLD+A ALHYAV  CSR+VVK LL+LG A+VN   G  G 
Sbjct  236   KALDSSDVELVQLMINGEGLNLDKAFALHYAVSKCSRKVVKTLLDLGKANVNL-RGPDGL  294

Query  1065  TPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEP  1244
             TPLHIAA++  P+ + +LL+H ADP+V++A G T + I++   ++ +  G        + 
Sbjct  295   TPLHIAAKLGDPEKIVMLLNHEADPHVQSASGATAMGIVQFGMTEIVSAGGYNSKG--DQ  352

Query  1245  NKLRLCLELVQSAAM  1289
             N+LRLC+EL++ A +
Sbjct  353   NRLRLCMELLERAIL  367



>emb|CBX25284.1| hypothetical_protein [Oryza brachyantha]
Length=581

 Score =   343 bits (880),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 180/298 (60%), Positives = 224/298 (75%), Gaps = 17/298 (6%)
 Frame = +3

Query  579   LTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVV  758
             + QKQL SMV++AS++DVM+VL+AS K EMQ+LW TCSHLVA+SGL  ++LAKHLPIDVV
Sbjct  261   ILQKQLESMVKEASVDDVMKVLMASRKFEMQELWATCSHLVARSGLSADLLAKHLPIDVV  320

Query  759   AKIEELRHKsslarssllahhhhr-----hdlgaaadlEDQKIRRMRRALDSSDVELVKL  923
             AKIEE+R KS L  ++              +  ++A   D KIRRMRRALD++D+ELVKL
Sbjct  321   AKIEEIRSKSPLTAATTPRSPFLTHHYLPINAASSAADRDNKIRRMRRALDAADIELVKL  380

Query  924   MVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPD  1103
             MVMGEGL+LD+ALA+HYAV++C+R+VVKALLELGAADVN  AG  G+T LH+AAEMVSPD
Sbjct  381   MVMGEGLDLDDALAVHYAVQHCNRDVVKALLELGAADVNSRAGPTGKTALHLAAEMVSPD  440

Query  1104  MVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSA  1283
             MVSVLLDHHADPN RT DG+TPLD+LR+LTS+FLFKGA+PGL HIEPNKLRLCLELVQSA
Sbjct  441   MVSVLLDHHADPNARTLDGVTPLDVLRSLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSA  500

Query  1284  AMVISREEGnaaannnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVY  1457
              MV +R++G               A    +      N P S    ++V+L ++S L+Y
Sbjct  501   VMVTTRDDGAPV------------AGAGEAGGSDGGNFPRSDADDSLVSLTMNSTLMY  546


 Score =   166 bits (420),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 113/196 (58%), Gaps = 32/196 (16%)
 Frame = +3

Query  159  INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC----------------gpdspgs  290
            INGQAFSDV FSVEGRLVHAHRC+LAARSLFFRK FC                 P + G 
Sbjct  19   INGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFCGLDPNHQPPPPPPPLNWPTTAGG  78

Query  291  dspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRP  470
               G   G  G G G      +   VIPV+S+ YEV +L++QFLYSGQ S+   K  P P
Sbjct  79   GPAGGGRGGAGGGGGGGGAPATPELVIPVSSIRYEVLVLVLQFLYSGQASVAAPKSGPLP  138

Query  471  NCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIA  650
             C  RGCWHT C +AVDLALDTL+AARSFGVEQLALL Q     +VEK            
Sbjct  139  GCGARGCWHTRCGAAVDLALDTLAAARSFGVEQLALLVQ-----VVEK-----------I  182

Query  651  SGKQEMQQLWTTCSHL  698
            SG       W TC  L
Sbjct  183  SGAPNTTYAWITCCRL  198



>ref|XP_010931590.1| PREDICTED: regulatory protein NPR5-like, partial [Elaeis guineensis]
Length=312

 Score =   332 bits (852),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 190/315 (60%), Positives = 228/315 (72%), Gaps = 17/315 (5%)
 Frame = +3

Query  603   MVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRH  782
             MVEKASI+DVM++L+ S KQ+M QLW TCSHL+A SGLPPEVL KHLPI++VAKIE+LR 
Sbjct  1     MVEKASIKDVMKILVTSHKQDMHQLWATCSHLIANSGLPPEVLGKHLPINIVAKIEDLRL  60

Query  783   Ks---slarssllahhhhrhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLD  953
             K    S       + HHH          +   I  + RALD+SD++LVKLMVMGEGL+LD
Sbjct  61    KPGHHSFHTHHSPSTHHHFPAAPTTGHDDHHNISSISRALDASDIDLVKLMVMGEGLDLD  120

Query  954   EALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHA  1133
              ALALHYAV+NCSREVVKALLELG ADVN+PA  AG+TPL IA EMV+PDMVSV LDHHA
Sbjct  121   NALALHYAVQNCSREVVKALLELGVADVNWPAVPAGKTPLPIAVEMVNPDMVSV-LDHHA  179

Query  1134  DPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREE--  1307
             DPNVRT DG++P DILR LTSDFLFKGA+PGL+HIEPNKLRL L+LV+SAAMV+SREE  
Sbjct  180   DPNVRTIDGVSPFDILRNLTSDFLFKGALPGLSHIEPNKLRLWLKLVKSAAMVLSREEEA  239

Query  1308  -GnaaannnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVYLNLGAVENS  1484
              G+     ++ +  IY    +MS E    NI S   S ++V  +LDSR+VYLN+G    S
Sbjct  240   VGSNPTGGSNPNTAIYQ---SMSTEGSDCNIASHTYS-SMVCRSLDSRMVYLNIGMAGTS  295

Query  1485  ------GGGGHHNQR  1511
                   G G H + R
Sbjct  296   HIGCTIGDGWHGSNR  310



>ref|XP_006665200.1| PREDICTED: regulatory protein NPR5-like, partial [Oryza brachyantha]
Length=238

 Score =   328 bits (842),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 166/237 (70%), Positives = 199/237 (84%), Gaps = 5/237 (2%)
 Frame = +3

Query  585   QKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAK  764
             QKQL SMV++AS++DVM+VL+AS K EMQ+LW TCSHLVA+SGL  ++LAKHLPIDVVAK
Sbjct  2     QKQLESMVKEASVDDVMKVLMASRKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAK  61

Query  765   IEELRHKsslarssllahhhhr-----hdlgaaadlEDQKIRRMRRALDSSDVELVKLMV  929
             IEE+R KS L  ++              +  ++A   D KIRRMRRALD++D+ELVKLMV
Sbjct  62    IEEIRSKSPLTAATTPRSPFLTHHYLPINAASSAADRDNKIRRMRRALDAADIELVKLMV  121

Query  930   MGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMV  1109
             MGEGL+LD+ALA+HYAV++C+R+VVKALLELGAADVN  AG  G+T LH+AAEMVSPDMV
Sbjct  122   MGEGLDLDDALAVHYAVQHCNRDVVKALLELGAADVNSRAGPTGKTALHLAAEMVSPDMV  181

Query  1110  SVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQS  1280
             SVLLDHHADPN RT DG+TPLD+LR+LTS+FLFKGA+PGL HIEPNKLRLCLELVQS
Sbjct  182   SVLLDHHADPNARTLDGVTPLDVLRSLTSEFLFKGAVPGLTHIEPNKLRLCLELVQS  238



>gb|AFW55825.1| hypothetical protein ZEAMMB73_056831 [Zea mays]
Length=318

 Score =   323 bits (829),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 172/289 (60%), Positives = 214/289 (74%), Gaps = 16/289 (6%)
 Frame = +3

Query  603   MVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRH  782
             MV++AS++DVM+VL+AS K EMQ+LW TCSHLVA+SGL  ++LAKHLPIDVVAKIEE+R 
Sbjct  1     MVKEASVDDVMKVLMASRKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEIRA  60

Query  783   Ksslarssllahhhh----rhdlgaaadlEDQKIRRMRRALDSSDVELVKLMVMGEGLNL  950
             KS +   +  +          +  ++A   D KIRRMRRALD++D+ELVKLMVMGEGL+L
Sbjct  61    KSPVPAGAPRSPFLTHHYLPINAASSAADRDHKIRRMRRALDAADIELVKLMVMGEGLDL  120

Query  951   DEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHH  1130
             D+ALA+HYAV++C R+VVKALLELGAADVN  AG  G+T LH+AAEMVSPDMVSVLLDHH
Sbjct  121   DDALAVHYAVQHCGRDVVKALLELGAADVNSRAGPTGKTALHLAAEMVSPDMVSVLLDHH  180

Query  1131  ADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLELVQSAAMVISREEG  1310
             ADP+ RT DG+TPLD+LR LTS+FLFKGA+PGL HIEPNKLRLCLELVQSA MV +R+  
Sbjct  181   ADPSARTLDGVTPLDVLRGLTSEFLFKGAVPGLTHIEPNKLRLCLELVQSAVMVTTRD--  238

Query  1311  naaannnsssaVIYPAALAMSEEHHHRNIPSSGGSGNIVNLNLDSRLVY  1457
                                 S+     N P S    ++V+L ++S L+Y
Sbjct  239   ----------VDAAGDDAGGSDGGGGGNFPRSDADDSLVSLTMNSTLMY  277



>gb|AET34794.1| BTB/POZ ankyrin repeat protein [Pisum sativum]
Length=265

 Score =   316 bits (809),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 190/217 (88%), Gaps = 10/217 (5%)
 Frame = +3

Query  108  TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
            ++EDSLRSLSLDYLNLLINGQAFSDV FSVEGRLVHAHRCILAARSLFFRKFFCGPD P 
Sbjct  2    SLEDSLRSLSLDYLNLLINGQAFSDVVFSVEGRLVHAHRCILAARSLFFRKFFCGPDPPS  61

Query  288  sdspgsRMGLVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPR  467
                    GL  +G    S   S   VIPVNSVGYEVFLLM+QFLYSGQVSIVPQKHEPR
Sbjct  62   --------GLDPSGNRVNSSTRS--GVIPVNSVGYEVFLLMLQFLYSGQVSIVPQKHEPR  111

Query  468  PNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLI  647
            PNC +RGCWHTHCTSAVDLALDTLSAAR FGVEQLALLTQKQLASMVEKASIEDVM+VL+
Sbjct  112  PNCGDRGCWHTHCTSAVDLALDTLSAARYFGVEQLALLTQKQLASMVEKASIEDVMKVLL  171

Query  648  ASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVV  758
            AS KQ+M QLWTTCSHLVAKSGLPPEVLAKHLPID++
Sbjct  172  ASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDII  208



>ref|XP_001759240.1| predicted protein [Physcomitrella patens]
 gb|EDQ75924.1| predicted protein [Physcomitrella patens]
Length=440

 Score =   306 bits (783),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 168/378 (44%), Positives = 237/378 (63%), Gaps = 28/378 (7%)
 Frame = +3

Query  165   GQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaS  344
             GQAFSDVTF+VE R V+AHRCILAARS FFR  FCG     + +                
Sbjct  22    GQAFSDVTFNVEDRHVYAHRCILAARSPFFRTLFCGDTQLMNSA---------------Q  66

Query  345   PRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDL  524
             PR S+P VI V  V Y+VF+L++QFLYSG  +           C+   CWH+ C+SAV  
Sbjct  67    PRSSLPSVIRVGIVSYDVFMLLLQFLYSGNCNGFFSPQISGRQCKVNSCWHSSCSSAVKF  126

Query  525   ALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVA  704
              L+ L A   FG+EQL+++ Q  L ++ EKAS ED+MR+LIA+  Q    LW  CS +VA
Sbjct  127   GLELLDAVSFFGLEQLSIIIQTHLGAIAEKASTEDLMRMLIAARYQMENHLWKLCSKVVA  186

Query  705   KSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMR  884
             KSGL PE+L K+LP ++V ++E +R +S  A  +  + +             + K + M+
Sbjct  187   KSGLTPEILHKYLPAEIVGELESIRQRSGYALEASSSGNDML----------ENKTKLMQ  236

Query  885   RALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGR  1064
             +AL+SSDVELV+LMVM EGL LD+A ALHYAV NCSR+VV+ LL++GAA+VN      G 
Sbjct  237   KALNSSDVELVRLMVMEEGLILDKAFALHYAVNNCSRKVVETLLKVGAANVNL-QDQDGE  295

Query  1065  TPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEP  1244
             TPLH+AA++  P+M+++LLDH A+P +++  G T +DI+++  +     G     +  + 
Sbjct  296   TPLHMAAKLGDPEMIALLLDHEANPLMQSVTGATAMDIVQSGAAGVQSAGGYN--SKSDQ  353

Query  1245  NKLRLCLELVQSAAMVIS  1298
              + RLC+EL+QSAA+  S
Sbjct  354   VRFRLCVELLQSAALSYS  371



>tpg|DAA39223.1| TPA: hypothetical protein ZEAMMB73_394788 [Zea mays]
Length=314

 Score =   290 bits (742),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 158/250 (63%), Positives = 195/250 (78%), Gaps = 17/250 (7%)
 Frame = +3

Query  603   MVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRH  782
             M ++AS++DVM+VL+AS K EMQ+LW TCSHLVA+SGL  ++LAKHLPIDVVAKIEE+R 
Sbjct  1     MAKEASVDDVMKVLMASRKFEMQELWATCSHLVARSGLSADLLAKHLPIDVVAKIEEIRA  60

Query  783   Ksslarsslla-----------------hhhhrhdlgaaadlEDQKIRRMRRALDSSDVE  911
              ++ +    ++                  +       A+    D ++RRMRRALD++D+E
Sbjct  61    AANKSPVCAVSGGGGPRSPFLLTHHYLPVNGASASASASEAERDHRVRRMRRALDAADIE  120

Query  912   LVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEM  1091
             LVKLMVMGEGL+LD ALA+HYAV++C R+VVKALLELGAADVN  AG AG+T LH+AAEM
Sbjct  121   LVKLMVMGEGLDLDAALAVHYAVQHCGRDVVKALLELGAADVNSRAGPAGKTALHLAAEM  180

Query  1092  VSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLRLCLEL  1271
             VSPDMVSVLLDHHADP+ RT DG+TPLD+LR LTS+FLF+GA+PGL HIEPNKLRLCLEL
Sbjct  181   VSPDMVSVLLDHHADPSARTLDGVTPLDVLRGLTSEFLFRGAVPGLTHIEPNKLRLCLEL  240

Query  1272  VQSAAMVISR  1301
             VQSA MV +R
Sbjct  241   VQSAVMVTTR  250



>ref|XP_006663189.1| PREDICTED: regulatory protein NPR5-like [Oryza brachyantha]
Length=205

 Score =   227 bits (579),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 137/209 (66%), Gaps = 36/209 (17%)
 Frame = +3

Query  159  INGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagaga  338
            INGQAFSDV FSVEGRLVHAHRC+LAARSLFFRK FC                       
Sbjct  19   INGQAFSDVAFSVEGRLVHAHRCVLAARSLFFRKLFC-----------------------  55

Query  339  aSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAV  518
                G  P                   L  G+ S+   K  P P C  RGCWHT C +AV
Sbjct  56   ----GLDPN---------HQPPPPPPPLNWGRASVAAPKSGPLPGCGARGCWHTRCGAAV  102

Query  519  DLALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHL  698
            DLALDTL+AARSFGVEQLALL QKQL SMV++AS++DVM+VL+AS K EMQ+LW TCSHL
Sbjct  103  DLALDTLAAARSFGVEQLALLVQKQLESMVKEASVDDVMKVLMASRKFEMQELWATCSHL  162

Query  699  VAKSGLPPEVLAKHLPIDVVAKIEELRHK  785
            VA+SGL  ++LAKHLPIDVVAKIEE+R K
Sbjct  163  VARSGLSADLLAKHLPIDVVAKIEEIRSK  191



>ref|XP_008466954.1| PREDICTED: regulatory protein NPR5-like [Cucumis melo]
Length=180

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 138/167 (83%), Gaps = 7/167 (4%)
 Frame = +3

Query  108  TVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspg  287
            T EDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCG  S  
Sbjct  2    TFEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGSSSDS  61

Query  288  sdspgsRMG-------LVgagagaaSPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIV  446
            + SPGS               +GA +P      VIPVNSVGYEVFLL++QFLYSGQVSI+
Sbjct  62   NSSPGSAFDSRSPSGSNSRGSSGATAPSLPPQGVIPVNSVGYEVFLLLLQFLYSGQVSIL  121

Query  447  PQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQ  587
            PQKHEPRPNC ERGCWHTHC+SAVDLAL+TL+AARSFGVEQLALLTQ
Sbjct  122  PQKHEPRPNCGERGCWHTHCSSAVDLALETLAAARSFGVEQLALLTQ  168



>ref|NP_001190116.1| protein BLADE ON PETIOLE 1 [Arabidopsis thaliana]
 gb|AEE79618.1| protein BLADE ON PETIOLE 1 [Arabidopsis thaliana]
Length=182

 Score =   203 bits (517),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 133/171 (78%), Gaps = 8/171 (5%)
 Frame = +3

Query  105  STVEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdsp  284
            +T E+SL+S+SLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFC  D  
Sbjct  3    NTFEESLKSMSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCESDPS  62

Query  285  gsdspgsRMGLVgagagaaSPRGS-IPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHE  461
                   + G   A    +  R + +  VIPVNSVGYEVFLL++QFLYSGQVSIVP KHE
Sbjct  63   -------QPGAEPANQTGSGARAAAVGGVIPVNSVGYEVFLLLLQFLYSGQVSIVPHKHE  115

Query  462  PRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQKQLASMVEK  614
            PR NC +RGCWHTHCT+AVDL+LD L+AAR FGVEQLALLTQ    S   +
Sbjct  116  PRSNCGDRGCWHTHCTAAVDLSLDILAAARYFGVEQLALLTQCNFLSRFRR  166



>gb|AFW83978.1| hypothetical protein ZEAMMB73_767493 [Zea mays]
Length=214

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 142/195 (73%), Gaps = 18/195 (9%)
 Frame = +3

Query  111  VEDslrslsldylnllINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgs  290
            +ED+L+SLS+DYLNLLINGQAFSDVTF+VEGRLVHAHRCILAARSLFFRKFFCG +   +
Sbjct  1    MEDTLKSLSMDYLNLLINGQAFSDVTFNVEGRLVHAHRCILAARSLFFRKFFCGAEQAAA  60

Query  291  dspgsRMGLVgagagaaSPRG-SIPQ----------VIPVNSVGYEVFLLMMQFLYSGQV  437
                    L+       SP G S P+          VIPVNSV YEVFLL++QFLYSGQV
Sbjct  61   GPG----ALLLDHLSPRSPSGTSSPRGASAAAPGAAVIPVNSVSYEVFLLLLQFLYSGQV  116

Query  438  SIVPQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARSFGVEQLALLTQ---KQLASMV  608
            S+VPQK EPRP C ER CWHTHC +AVDLALDTL+AARSFGVE+LALLTQ       S+ 
Sbjct  117  SLVPQKGEPRPGCGERACWHTHCAAAVDLALDTLAAARSFGVEELALLTQVTNNSSVSLA  176

Query  609  EKASIEDVMRVLIAS  653
               S   ++ +L++S
Sbjct  177  RSLSPTSILDLLVSS  191



>ref|XP_008348376.1| PREDICTED: LOW QUALITY PROTEIN: regulatory protein NPR3-like, 
partial [Malus domestica]
Length=586

 Score =   194 bits (493),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 132/370 (36%), Positives = 199/370 (54%), Gaps = 33/370 (9%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  V  +RCILA+RS FF++ F             R G          PR 
Sbjct  59    YSDAEIVVEGNTVGVNRCILASRSQFFQELF-------------RKG-SDDSNKEGKPRY  104

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++P   VGYE F + + +LY+G+++  P++      C + GC H  C  A++  ++
Sbjct  105   LMSELVPNGGVGYEAFKVFLNYLYTGKLNPSPREVS---TCVDDGCPHDACGPAINYVVE  161

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F +++L  L Q++L++ VEKA IEDV+ +L A+   ++ QL + C   +A+S 
Sbjct  162   LMYASSTFQMKELVQLVQRRLSNFVEKALIEDVIPILKAAFHCQLSQLLSHCIQRIARSD  221

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K  P +V   I+ LR KS     S +               ED++IRR+ +AL
Sbjct  222   LDYMAIGKEFPHEVSNDIKSLRLKSHENDESSMMEIELI---------EDKRIRRIHKAL  272

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELV L++    + LD+A ALHYAV  C  +VVK +L LG A++N    + G T L
Sbjct  273   DSDDVELVGLLLKESDITLDDAYALHYAVAYCDPKVVKEVLSLGEANLNL-RNSRGHTVL  331

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             H+AA    P ++  LLD  A     T+DG TP+ I R LT   DFL +    G    E N
Sbjct  332   HVAARRKLPAVLVPLLDRGASALETTSDGQTPVAICRRLTRPKDFL-ENTKQGQ---ESN  387

Query  1248  KLRLCLELVQ  1277
             K RLC+EL++
Sbjct  388   KDRLCIELLE  397



>ref|XP_011085427.1| PREDICTED: regulatory protein NPR3-like [Sesamum indicum]
 ref|XP_011085428.1| PREDICTED: regulatory protein NPR3-like [Sesamum indicum]
Length=587

 Score =   192 bits (488),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 125/368 (34%), Positives = 197/368 (54%), Gaps = 29/368 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  V  HRCILAARS FF + F            +  G V         + 
Sbjct  62    YSDAEIEVEGITVGVHRCILAARSQFFHEIF----------EKANQGSVKES----KQKY  107

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++P   +GYE F++++ +LY+G+V   P +      C +  C H  C  A++ A++
Sbjct  108   LLSELVPDGRIGYEAFMVVLHYLYTGKVKASPSE---VSTCVDESCAHDACAPAINYAVE  164

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F +++L ++ Q++L + VEKA +EDV+ +L+ + + E++QL + C   +A+S 
Sbjct  165   MMYASAAFQIKELVMVVQRRLLNYVEKAFVEDVIPILMVAFRSELKQLLSHCVQRIARSD  224

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP +V+  ++ LR K         +     HD      L ++ IRR+ RAL
Sbjct  225   LDDITIEKELPHEVLDGVKSLRIK---------SKQDEEHDSVQVDSLNEKSIRRIHRAL  275

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELVKL++    ++LD A ALHYA   C+ ++V  +L LG ADVN    + G T L
Sbjct  276   DSDDVELVKLLLDESNISLDAAYALHYATAYCNPKIVNEVLNLGNADVNL-RNSRGYTVL  334

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKL  1253
             H+AA    P +V  LL+  A  +  T DG T + I R LT    F  A       E NK 
Sbjct  335   HVAARRKDPSIVVGLLNQGASVSDTTGDGQTAVTICRRLTRPKDFHEATKHGQ--ETNKD  392

Query  1254  RLCLELVQ  1277
             RLC+++++
Sbjct  393   RLCIDVLE  400



>ref|XP_009399066.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=584

 Score =   191 bits (484),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 128/369 (35%), Positives = 188/369 (51%), Gaps = 34/369 (9%)
 Frame = +3

Query  177   SDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRGS  356
             +D    VEG  V  HRCILAARS FFR+ F    S        R G          PR  
Sbjct  72    TDAEIMVEGAPVGVHRCILAARSRFFRELF----SREGSGGAPREG---------KPRFD  118

Query  357   IPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDT  536
             + +++P   VG E F++ + +LY+G++   PQ       C +R C H  C  A+  A++ 
Sbjct  119   MDELVPGGRVGREAFMVFLSYLYTGKLKPAPQDVS---ICVDRFCAHDSCPPAIGFAVEL  175

Query  537   LSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGL  716
             + A+  F + +L  L Q++L + VEKA +EDV+ +L  +   ++ QL T C   VA+S L
Sbjct  176   MYASSVFQIAELVSLLQRRLLNFVEKALVEDVIPILQVASHSKLNQLLTHCVQRVARSDL  235

Query  717   PPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRALD  896
                 L K LP +V  +I  LR K              +        + +++I+R+ RALD
Sbjct  236   DDIALEKKLPQEVTDEIRSLRRK-----------SQPKESNVTVDPVHEKRIKRIHRALD  284

Query  897   SSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLH  1076
             S DVELVKL++   G+ LD+  ALHYA   C  +V+  LL+LG+A+VN      G TPLH
Sbjct  285   SDDVELVKLLLSESGVTLDDTYALHYAAAYCDSKVIAELLDLGSANVNL-KNDKGYTPLH  343

Query  1077  IAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPNK  1250
             +AA    P ++  LL   A     TADG   + I R LT   D+  K         E NK
Sbjct  344   VAAMRREPKVIVSLLTKGASALETTADGQNAVRICRRLTRAKDYFTKTE----QGQESNK  399

Query  1251  LRLCLELVQ  1277
              +LC+++++
Sbjct  400   NKLCIDILE  408



>gb|AHF20181.1| ankyrin-repeat protein, partial [Musa acuminata AAA Group]
Length=584

 Score =   190 bits (482),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 128/369 (35%), Positives = 188/369 (51%), Gaps = 34/369 (9%)
 Frame = +3

Query  177   SDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRGS  356
             +D    VEG  V  HRCILAARS FFR+ F    S        R G          PR  
Sbjct  72    TDAEIMVEGAPVGVHRCILAARSRFFRELF----SREGSGGAPREG---------KPRFD  118

Query  357   IPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDT  536
             + +++P   VG E F++ + +LY+G++   PQ       C +R C H  C  A+  A++ 
Sbjct  119   MDELVPGGRVGREAFMVFLSYLYTGKLKPAPQDVS---ICVDRFCAHDSCPPAIGFAVEL  175

Query  537   LSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGL  716
             + A+  F + +L  L Q++L + VEKA +EDV+ +L  +   ++ QL T C   VA+S L
Sbjct  176   MYASSVFQIAELVSLLQRRLLNFVEKALVEDVIPILQVASHSKLNQLLTHCVQRVARSDL  235

Query  717   PPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRALD  896
                 L K LP +V  +I  LR K              +        + +++I+R+ RALD
Sbjct  236   DDIALEKKLPQEVTDEIRSLRRK-----------SQPKGSNVTVDPVHEKRIKRIHRALD  284

Query  897   SSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLH  1076
             S DVELVKL++   G+ LD+  ALHYA   C  +V+  LL+LG+A+VN      G TPLH
Sbjct  285   SDDVELVKLLLNESGVTLDDTYALHYAAAYCDSKVIAELLDLGSANVNL-KNDKGYTPLH  343

Query  1077  IAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPNK  1250
             +AA    P ++  LL   A     TADG   + I R LT   D+  K         E NK
Sbjct  344   VAAMRREPKVIVSLLTKGASALETTADGQNAVRICRRLTRAKDYFTKTE----QGQESNK  399

Query  1251  LRLCLELVQ  1277
              +LC+++++
Sbjct  400   NKLCIDILE  408



>ref|XP_008229582.1| PREDICTED: regulatory protein NPR3-like [Prunus mume]
Length=589

 Score =   187 bits (475),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 127/370 (34%), Positives = 200/370 (54%), Gaps = 33/370 (9%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             ++D    VEG  V  +RCILAARS FF+  F        +    + G          P+ 
Sbjct  64    YNDAEIIVEGNTVGVNRCILAARSQFFQDLF-----KQGNDDSIKEG---------KPKY  109

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              +  ++P   VGYE F +++ +LY+G++   P++      C +  C H  C  A++ A++
Sbjct  110   LMSDLVPNGRVGYEAFKVILNYLYTGKLQPSPRE---VSTCVDDHCAHDACGPAINYAVE  166

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F +++L  L Q++L++ VEKA IEDV+ +L+ +   ++ QL + C   VA+S 
Sbjct  167   LMYASATFQMKELVQLVQRRLSNFVEKAFIEDVIPILVVAFHCQLSQLLSHCIQWVARSD  226

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP +V   I+ L  KS     S +               ED++IRR+ +AL
Sbjct  227   LDSVAIEKELPHEVSNVIKSLHLKSQEKDESSMMEMEPV---------EDKRIRRIHKAL  277

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELV+L++    + LD+A ALHYAV  C  +VVK +L LG A +N    A G T L
Sbjct  278   DSDDVELVELLLKESDITLDDAYALHYAVAYCDPKVVKEVLGLGLATINL-CNARGHTVL  336

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             H+AA   +P ++  LL+  A  +  TADG T + I R LT   DF ++  + G    E N
Sbjct  337   HVAARRKNPAVMVPLLNRGASASETTADGQTAVAICRRLTRPKDF-YENTMQGQ---ESN  392

Query  1248  KLRLCLELVQ  1277
             K R+C++L++
Sbjct  393   KDRMCIDLLE  402



>ref|XP_008451832.1| PREDICTED: LOW QUALITY PROTEIN: regulatory protein NPR3-like 
[Cucumis melo]
Length=586

 Score =   185 bits (470),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 120/369 (33%), Positives = 193/369 (52%), Gaps = 29/369 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             ++D    VEG  V  HRCILAARS FF + F                 V +      P+ 
Sbjct  63    YTDAVIVVEGIEVGVHRCILAARSQFFHELFKQE--------------VDSSTEDGKPKY  108

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++  + VG E F +++ +LY+G++   P +      C +  C H  C  A++ A++
Sbjct  109   CMSKLVAFSKVGIEAFKVILNYLYTGKLKPSPPEVS---TCVDEACAHDACGPAINYAVE  165

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F ++++ LL Q++L + VEKA++EDV+ +LIA+    + QL + C   VA+S 
Sbjct  166   LMYASATFKMKEMVLLVQRRLLNFVEKAAVEDVITILIAAFHCHLDQLHSPCIQRVARSD  225

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    L + LP +V ++I+ LR K                 +       ++KIRR+ +AL
Sbjct  226   LDAVSLERELPDEVASEIKSLRMK--------SQQDTEADIVEEVDLNREKKIRRLHKAL  277

Query  894   DSSDVELVKLMVM-GEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTP  1070
             DS DVEL+KL+++    + L++A ALHYA   C  +V+K +L LG AD+N      G+T 
Sbjct  278   DSDDVELLKLLLIESSDITLNDAYALHYATAYCDPKVIKEVLNLGLADLNL-KNLRGQTV  336

Query  1071  LHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNK  1250
             LH+AA    P ++  LLD  A     TADG T + I R LT    +          E NK
Sbjct  337   LHVAARRKDPKIIVALLDKGASALEPTADGQTAVTICRRLTRPRDYNETTQK--GQESNK  394

Query  1251  LRLCLELVQ  1277
              RLC+++++
Sbjct  395   DRLCIDVLE  403



>ref|XP_004169978.1| PREDICTED: regulatory protein NPR3-like [Cucumis sativus]
Length=585

 Score =   183 bits (465),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 122/374 (33%), Positives = 195/374 (52%), Gaps = 39/374 (10%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             ++D    VEG  V  HRCILAARS FF + F                 V +      P+ 
Sbjct  63    YTDAVIVVEGIEVGVHRCILAARSQFFHELFKQE--------------VDSSTEDGKPKY  108

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++    VG E F +++ +LY+G++   P +      C +  C H  C  A++ A++
Sbjct  109   CMSKLVAFRKVGIEAFKVILNYLYTGKLKPSPPEVS---TCVDEACAHDACGPAINYAVE  165

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F ++++ LL Q++L + VEKA++EDV+ +LIA+    + QL T C   VA+S 
Sbjct  166   LMYASATFKMKEMVLLVQRRLLNFVEKAAVEDVITLLIAAFHCHLDQLHTPCIQRVARSN  225

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    L + LP ++ ++I+ LR K                 +  A    ++KIRR+ +AL
Sbjct  226   LDAVSLGRELPDEIASEIKSLRMK--------SQQETEPDIVEEADLNREKKIRRLHKAL  277

Query  894   DSSDVELVKLMVM-GEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTP  1070
             DS DVEL+ L++     + L++A ALHYA   C  +V+K +L LG AD+N+     G+T 
Sbjct  278   DSDDVELLGLLLRESSDITLNDAYALHYATAYCDPKVIKEVLNLGLADLNH-KNLRGQTV  336

Query  1071  LHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLF-----KGAIPGLAH  1235
             LH+AA    P+++  LLD  A     TADG T + I R LT    F     KG +     
Sbjct  337   LHVAARRKDPNIIVALLDKGASALEPTADGQTAVTICRRLTRPRDFNETTQKGQV-----  391

Query  1236  IEPNKLRLCLELVQ  1277
                NK RLC+++++
Sbjct  392   --SNKDRLCIDVLE  403



>ref|XP_004147747.1| PREDICTED: regulatory protein NPR3-like [Cucumis sativus]
Length=585

 Score =   183 bits (464),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 121/374 (32%), Positives = 195/374 (52%), Gaps = 39/374 (10%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             ++D    VEG  V  HRCILAARS FF + F                 V +      P+ 
Sbjct  63    YTDAVIVVEGIEVGVHRCILAARSQFFHELFKQE--------------VDSSTEDGKPKY  108

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++    VG E F +++ +LY+G++   P +      C +  C H  C  A++ A++
Sbjct  109   CMSKLVAFRKVGIEAFKVILNYLYTGKLKPSPPEVS---TCVDEACAHDACGPAINYAVE  165

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F ++++ LL Q++L + VEKA++EDV+ +LIA+    + QL T C   VA+S 
Sbjct  166   LMYASATFKMKEMVLLVQRRLLNFVEKAAVEDVITLLIAAFHCHLDQLHTPCIQRVARSN  225

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    L + LP ++ ++I+ LR K                 +  A    ++KIRR+ +AL
Sbjct  226   LDAVSLGRELPDEIASEIKSLRMK--------SQQETEPDIVEEADLNREKKIRRLHKAL  277

Query  894   DSSDVELVKLMVM-GEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTP  1070
             DS DVEL+ L++     + L++A ALHYA   C  +++K +L LG AD+N+     G+T 
Sbjct  278   DSDDVELLGLLLRESSDITLNDAYALHYATAYCDPKIIKEVLNLGLADLNH-KNLRGQTV  336

Query  1071  LHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLF-----KGAIPGLAH  1235
             LH+AA    P+++  LLD  A     TADG T + I R LT    F     KG +     
Sbjct  337   LHVAARRKDPNIIVALLDKGASALEPTADGQTAVTICRRLTRPRDFNETTQKGQV-----  391

Query  1236  IEPNKLRLCLELVQ  1277
                NK RLC+++++
Sbjct  392   --SNKDRLCIDVLE  403



>ref|XP_002300863.2| hypothetical protein POPTR_0002s05740g, partial [Populus trichocarpa]
 gb|EEE80136.2| hypothetical protein POPTR_0002s05740g, partial [Populus trichocarpa]
Length=435

 Score =   179 bits (453),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 117/369 (32%), Positives = 190/369 (51%), Gaps = 29/369 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  V  HRC+LAARS FF + F             + G          PR 
Sbjct  63    YSDAEIFVEGTPVGVHRCVLAARSQFFHELF-------------KKG-NNNSTNGDKPRY  108

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              +  ++P   VGYE F + + +LY+G++   P +      C +  C H  C  A++  ++
Sbjct  109   LMSDLVPYGGVGYEAFHVFLHYLYTGKLKPSPPE---VSRCVDDACAHDVCRPAINYVVE  165

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F +++L LL Q++L + +EKA +EDV+ +L+A+   ++ QL + C   + +S 
Sbjct  166   LMCASATFQMKELVLLFQRRLLNFIEKALVEDVIPILMAAFHYQLDQLLSHCIERLVRSD  225

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP ++ +KI+ LR KS     S +                ++  RR+ +AL
Sbjct  226   LDSTCIDKELPDEISSKIKLLRKKSLPEAESSVEEVDPIL---------EKSFRRIHKAL  276

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELV+L++    L LD+A ALHYAV  C  ++VK +L LG+AD+N    + G + L
Sbjct  277   DSDDVELVELLLSESNLTLDDAYALHYAVAYCDPKIVKEVLSLGSADLNL-RNSRGYSVL  335

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKL  1253
             H+AA    P ++  LL   A  +  T DG   + I R LT    +          E NK 
Sbjct  336   HVAARRKEPSIIMALLTRGASASETTLDGQNAVAICRRLTRPKDYNENTK--QGQESNKD  393

Query  1254  RLCLELVQS  1280
             R+C++++++
Sbjct  394   RICIDVLET  402



>ref|XP_008787319.1| PREDICTED: regulatory protein NPR3-like [Phoenix dactylifera]
Length=585

 Score =   181 bits (460),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 129/369 (35%), Positives = 188/369 (51%), Gaps = 33/369 (9%)
 Frame = +3

Query  177   SDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRGS  356
             SD    VEG  V  HRCILAARS FF   F               G          PR  
Sbjct  63    SDAEVVVEGAPVGIHRCILAARSRFFHDLFSR-------------GGGRYRPEGGKPRYQ  109

Query  357   IPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDT  536
             + +++P   VGYE F+  + ++Y+G++   PQ+      C +  C H  C  AV+ A++ 
Sbjct  110   MGELVPCGRVGYEAFINFLSYIYTGKLKPAPQEASV---CADPMCAHDACRPAVNFAVEL  166

Query  537   LSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGL  716
             + A+  F + +L  L Q++L + VEKA +EDV+ +L+ +    + QL   C   VA+S L
Sbjct  167   MYASSVFQIPELVSLLQRRLLNFVEKALVEDVIPILLVAFHSHLNQLLGHCMKRVARSYL  226

Query  717   PPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRALD  896
                 L K LP DV  +I+ +RHK+     + L                +++IR + +ALD
Sbjct  227   DNISLEKELPHDVAEEIKLIRHKAQPDEPNSLTVDPVL----------EKRIRGIHKALD  276

Query  897   SSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLH  1076
             S DVELVKL++    + LD+A ALHYA   C  +VV  LLELG+A+VN      G TPLH
Sbjct  277   SDDVELVKLLLSESDITLDDANALHYAAAYCDSKVVAELLELGSANVNL-KNDRGYTPLH  335

Query  1077  IAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPNK  1250
             +AA    P ++  LL   A  +  TADG +   I R LT   D+  K       H E NK
Sbjct  336   VAAMRKEPAVIVSLLTKGASASETTADGQSAAMICRRLTRAKDYNTKTQ---QGH-ESNK  391

Query  1251  LRLCLELVQ  1277
              R+C+++++
Sbjct  392   DRICIDILE  400



>ref|XP_009399065.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=599

 Score =   181 bits (458),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 130/384 (34%), Positives = 190/384 (49%), Gaps = 49/384 (13%)
 Frame = +3

Query  177   SDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRGS  356
             +D    VEG  V  HRCILAARS FFR+ F    S        R G          PR  
Sbjct  72    TDAEIMVEGAPVGVHRCILAARSRFFRELF----SREGSGGAPREG---------KPRFD  118

Query  357   IPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDT  536
             + +++P   VG E F++ + +LY+G++   PQ       C +R C H  C  A+  A++ 
Sbjct  119   MDELVPGGRVGREAFMVFLSYLYTGKLKPAPQDVS---ICVDRFCAHDSCPPAIGFAVEL  175

Query  537   LSAARSFGVEQLALL---------------TQKQLASMVEKASIEDVMRVLIASGKQEMQ  671
             + A+  F + +L  L                Q++L + VEKA +EDV+ +L  +   ++ 
Sbjct  176   MYASSVFQIAELVSLLQFTAAEPTCSSFCNAQRRLLNFVEKALVEDVIPILQVASHSKLN  235

Query  672   QLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaa  851
             QL T C   VA+S L    L K LP +V  +I  LR KS    S++              
Sbjct  236   QLLTHCVQRVARSDLDDIALEKKLPQEVTDEIRSLRRKSQPKESNVTVDPV---------  286

Query  852   dlEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAA  1031
                +++I+R+ RALDS DVELVKL++   G+ LD+  ALHYA   C  +V+  LL+LG+A
Sbjct  287   --HEKRIKRIHRALDSDDVELVKLLLSESGVTLDDTYALHYAAAYCDSKVIAELLDLGSA  344

Query  1032  DVNYPAGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFL  1205
             +VN      G TPLH+AA    P ++  LL   A     TADG   + I R LT   D+ 
Sbjct  345   NVNL-KNDKGYTPLHVAAMRREPKVIVSLLTKGASALETTADGQNAVRICRRLTRAKDYF  403

Query  1206  FKGAIPGLAHIEPNKLRLCLELVQ  1277
              K         E NK +LC+++++
Sbjct  404   TKTE----QGQESNKNKLCIDILE  423



>ref|XP_007214958.1| hypothetical protein PRUPE_ppa003232mg [Prunus persica]
 gb|EMJ16157.1| hypothetical protein PRUPE_ppa003232mg [Prunus persica]
Length=590

 Score =   180 bits (457),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 123/370 (33%), Positives = 197/370 (53%), Gaps = 33/370 (9%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             ++D    VEG  V  +RCILAARS FF+  F        +    + G          P+ 
Sbjct  64    YNDAEIIVEGNTVGVNRCILAARSEFFQDLF-----KQGNDDSIKEG---------KPKY  109

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              +  ++P   VGYE F +++ +LY+G++   P++      C +  C H  C  A++ A++
Sbjct  110   LMSDLVPNGRVGYEAFKVILNYLYTGKLQPSPREVS---TCVDHHCAHDACGPAINYAVE  166

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F +++L  L Q++L++ VEKA IEDV+ +L+ +   ++ QL + C   VA+S 
Sbjct  167   LMYASATFQMKELVQLVQRRLSNFVEKAFIEDVIPILVVAFHCQLSQLLSDCIQRVARSD  226

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP +V   I+ L          L +       +     ++D++IRR+ +AL
Sbjct  227   LDSVAIEKELPHEVSNDIKSL---------CLRSQEKDESSMMEMEPVKDKRIRRIHKAL  277

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELV+L++    + LD+A ALHYAV  C  +VVK +L LG A +N    A G T L
Sbjct  278   DSDDVELVELLLKESDITLDDAYALHYAVAYCDPKVVKEVLGLGLATINL-CNARGYTVL  336

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             H+AA    P ++  LL+  A  +  T DG T + I R LT   DF ++    G    E N
Sbjct  337   HVAARRKHPAVMVPLLNRGASASETTVDGRTAVAICRRLTRPKDF-YENTEKGQ---ESN  392

Query  1248  KLRLCLELVQ  1277
             K R+C++L++
Sbjct  393   KDRMCIDLLE  402



>ref|XP_010911274.1| PREDICTED: regulatory protein NPR5-like [Elaeis guineensis]
Length=180

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 104/147 (71%), Gaps = 26/147 (18%)
 Frame = +3

Query  867   KIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYP  1046
             KI RMRRALDSSD++L+          L+ ALA+HYAV+NCS +V+KALLE GA DVN  
Sbjct  32    KIHRMRRALDSSDIDLI----------LENALAVHYAVQNCSHDVLKALLEFGATDVNCL  81

Query  1047  AGAAGRTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPG  1226
              G  G TPLHI AEMV+PD+                DG++P DILR LTSDFLFK A+PG
Sbjct  82    VGPVGNTPLHIVAEMVNPDI----------------DGVSPFDILRNLTSDFLFKEAVPG  125

Query  1227  LAHIEPNKLRLCLELVQSAAMVISREE  1307
             L+HIEPNKLR CL+LVQSA MV+SRE+
Sbjct  126   LSHIEPNKLRQCLKLVQSAVMVLSREQ  152



>ref|XP_009356589.1| PREDICTED: regulatory protein NPR3-like [Pyrus x bretschneideri]
 ref|XP_009356590.1| PREDICTED: regulatory protein NPR3-like [Pyrus x bretschneideri]
Length=591

 Score =   177 bits (450),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 129/370 (35%), Positives = 201/370 (54%), Gaps = 33/370 (9%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  V  +RCILA+RS FF++ F             R G          PR 
Sbjct  64    YSDAEIVVEGNTVGVNRCILASRSQFFQELF-------------RKG-SDDSNKEGKPRY  109

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++P   VGYE F + + +LY+G+++  P++      C + GC H  C  A++ A++
Sbjct  110   LMSELVPNGGVGYEAFKVFLNYLYTGKLNPSPREVS---TCVDDGCPHDACGPAINYAVE  166

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F +++L  L Q++L++ VEKA IEDV+ +LIA+   ++ QL + C   + +S 
Sbjct  167   LMYASSTFQMKELVQLVQRRLSNFVEKALIEDVIPILIAAFHCQLSQLLSHCIQRIVRSK  226

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K  P +V   I+ LR K         +H +    +     +ED++IRR+ +AL
Sbjct  227   LDNMAIEKEFPHEVSNDIKSLRLK---------SHENDESSMMEIESIEDKRIRRIHKAL  277

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELV L++    + LD+A ALHYA   C  +VVK +L LG A++N    + G T L
Sbjct  278   DSDDVELVGLLLKESDITLDDAYALHYAAAYCDPKVVKEVLGLGEANLNL-RNSRGHTVL  336

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             H+AA    P ++  LLD  A     T+DG TP+ I R LT   DF ++    G    E N
Sbjct  337   HVAARRKLPAVLVPLLDRGASALETTSDGQTPVAICRRLTRPKDF-WENTKQGQ---ESN  392

Query  1248  KLRLCLELVQ  1277
             K RLC++L++
Sbjct  393   KDRLCIDLLE  402



>ref|XP_011026213.1| PREDICTED: regulatory protein NPR3-like [Populus euphratica]
 ref|XP_011026214.1| PREDICTED: regulatory protein NPR3-like [Populus euphratica]
Length=591

 Score =   177 bits (449),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 117/369 (32%), Positives = 190/369 (51%), Gaps = 29/369 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  V  HRC+LAARS FF + F             + G          PR 
Sbjct  63    YSDAEIFVEGTPVGVHRCVLAARSQFFHELF-------------KKG-NNNSTNGDKPRY  108

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              +  ++P   VGYE F + + +LY+G++   P +      C +  C H  C  A++  ++
Sbjct  109   LMSDLVPYGGVGYEAFHVFLHYLYTGKLKPCPPEVS---RCVDDACAHDACRPAINYVVE  165

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F +++L LL Q++L + +EKA +EDV+ +L+A+   ++ QL + C   + +S 
Sbjct  166   LMCASATFQMKELVLLFQRRLLNFIEKALVEDVIPILMAAFHYQLGQLLSHCIERLVRSD  225

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP ++ +KI+ LR KS     S +                ++  RR+ +AL
Sbjct  226   LDSTCIDKELPDEISSKIKLLRKKSLPEAESSVEEVDPIL---------ERSFRRIHQAL  276

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELV+L++    L LD+A ALHYAV  C  ++VK +L LG+AD+N    + G + L
Sbjct  277   DSDDVELVELLLRESNLTLDDAYALHYAVAYCDPKIVKEVLGLGSADLNL-RNSRGYSVL  335

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKL  1253
             H+AA    P ++  LL   A  +  T DG   + I R LT    +          E NK 
Sbjct  336   HVAARRKEPSIIMALLTRGASASETTLDGQNAVAICRRLTRSKDYNENTK--QGQESNKD  393

Query  1254  RLCLELVQS  1280
             R+C++++++
Sbjct  394   RICIDVLET  402



>gb|KEH28396.1| NPR1/NIM1-like regulatory protein, putative [Medicago truncatula]
Length=456

 Score =   175 bits (443),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 124/370 (34%), Positives = 194/370 (52%), Gaps = 29/370 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             + D    VE   V  HRCILA+RS FF + F             + G V  G G   PR 
Sbjct  66    YCDAEILVEEIPVGIHRCILASRSQFFHELF----------KKGKDGEVKDGKG--KPRY  113

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++P  SVGYE F++ + +LY+G++   P +      C +  C H  C  A++ AL+
Sbjct  114   LMKELVPYGSVGYEAFIVFLHYLYTGKLKAPPPE---VTTCVDEACIHDSCRPAINFALE  170

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F +++LAL+ Q+ L + V+KA +EDV+ +L+A+   +  QL + C   VA+S 
Sbjct  171   LMYASSTFQMKELALVFQRCLLNYVDKALVEDVIPILMAAHHCKQDQLLSHCIQRVARSD  230

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             +    L + LP +VV +I+ LR          L              + D+ IR++ +AL
Sbjct  231   MEIIYLERELPHEVVTEIKSLR-------VQSLPESTPDSMEVEPVIVSDKSIRKILKAL  283

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVEL+KL++    + LD+A ALHYA   C  +VV+ +L LG AD+       G T L
Sbjct  284   DSDDVELLKLLLDESSVTLDDAYALHYACAYCDSKVVQEVLTLGLADI-LLKNPRGYTVL  342

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             H+AA    P ++  LL + A  +  T DG T L I + LT   D+  K A    +H    
Sbjct  343   HVAARRKDPSILVALLKNGACASETTLDGQTALSICQRLTRRKDYHEKTATGKESH----  398

Query  1248  KLRLCLELVQ  1277
             K RLC+++++
Sbjct  399   KDRLCVDVLE  408



>ref|XP_009377037.1| PREDICTED: regulatory protein NPR3-like [Pyrus x bretschneideri]
Length=583

 Score =   177 bits (448),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 125/370 (34%), Positives = 189/370 (51%), Gaps = 41/370 (11%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  V  +RCILA+RS FF+  F             R G          PR 
Sbjct  64    YSDAEIVVEGNTVGVNRCILASRSQFFQDLF-------------RKG-SDDAKKEGKPRY  109

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++P   VGYE F + + +LY+G+++  P +      C +  C H  C  A+  A++
Sbjct  110   LMSELVPNGKVGYEAFKVFLNYLYTGKLNPSPVE---VSTCVDDRCPHDACGPAISYAVE  166

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F +++L  L +  L++ VEKA +EDV+ +L+A+   ++ QL + C  +VA S 
Sbjct  167   LMYASSTFQMKELVQLVEHHLSNFVEKALVEDVIPILVAAFHCQLDQLLSHCIQMVASSD  226

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP  V   I+  R K                        ED++IR + +AL
Sbjct  227   LDIMAIEKELPHKVSNDIKLNRPKPQEMEPV-----------------EDKRIRSIHKAL  269

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELV L++   G+ LDEA ALHYAV  C  +VVK +L LG A+ N    + G T L
Sbjct  270   DSDDVELVGLLLKESGITLDEAYALHYAVAYCDPKVVKEVLGLGKANPNL-CNSRGHTAL  328

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             H+AA    P ++  LL   A  +  T++G TP  I R LT   D+ ++    G    E N
Sbjct  329   HVAARRKLPAVLFPLLKWGASASETTSNGQTPAAICRRLTRPKDY-WENTQQGQ---ESN  384

Query  1248  KLRLCLELVQ  1277
             K RLC++L++
Sbjct  385   KDRLCIDLLE  394



>ref|XP_010942675.1| PREDICTED: regulatory protein NPR3-like [Elaeis guineensis]
Length=604

 Score =   176 bits (447),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 121/367 (33%), Positives = 185/367 (50%), Gaps = 25/367 (7%)
 Frame = +3

Query  177   SDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRGS  356
             SD    VEG  V  HRCILAARS FF   F G  +          G          PR  
Sbjct  75    SDAEIVVEGVPVGVHRCILAARSRFFHDLFSGAGAGAGGGCRQEGG---------KPRYE  125

Query  357   IPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDT  536
             I +++P   VG E F+  + +LY+G++   P +      C +  C H  C  A++  ++ 
Sbjct  126   ISELVPCGRVGREAFMNFLSYLYTGKLRPAPPEVSV---CVDPMCAHDACRPAINFVVEL  182

Query  537   LSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGL  716
             L A+  F + +L  L Q++L + VEKA +EDV+ +L+ +   ++ QL + C   +A+S L
Sbjct  183   LYASSVFQIPELVSLLQRRLLNFVEKALVEDVIPILLVAVHSQLNQLLSHCIKRIARSDL  242

Query  717   PPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRALD  896
                 L K LP +   +I+ +R K+     +                  +++IRR+ RALD
Sbjct  243   DNISLDKQLPHEAAEEIKLIRRKAQPDEPNSSIVDPI----------HEKRIRRIHRALD  292

Query  897   SSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLH  1076
             S DVELVKL++    + LD+A A+HYA   C  +VV  LLELG+A+VN      G TPLH
Sbjct  293   SDDVELVKLLLSESDITLDDANAIHYAAAYCDSKVVSELLELGSANVNL-KNDRGYTPLH  351

Query  1077  IAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKLR  1256
             +AA    P ++  LL   A  +  T+DG + + I R LT    +          E NK R
Sbjct  352   VAAMRREPAIIVSLLTKGASASETTSDGQSAVMICRRLTRAKDYNTKTQQCQ--ESNKDR  409

Query  1257  LCLELVQ  1277
             +C+++++
Sbjct  410   VCIDILE  416



>ref|XP_008806697.1| PREDICTED: regulatory protein NPR3-like [Phoenix dactylifera]
 ref|XP_008806698.1| PREDICTED: regulatory protein NPR3-like [Phoenix dactylifera]
 ref|XP_008806699.1| PREDICTED: regulatory protein NPR3-like [Phoenix dactylifera]
Length=591

 Score =   176 bits (446),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 126/369 (34%), Positives = 187/369 (51%), Gaps = 34/369 (9%)
 Frame = +3

Query  177   SDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRGS  356
             SD    VEG  V  HRCILAARS FF   F               G  G       PR  
Sbjct  68    SDAEIVVEGAPVGVHRCILAARSRFFHDLFS--------------GCGGRRQEGGKPRYE  113

Query  357   IPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDT  536
             + +++P   VG E F+  + +LY+G++   P +      C +  C H  C  A++  ++ 
Sbjct  114   MSELVPCGRVGREAFMNFLSYLYTGKLKPAPPEVSV---CVDPMCAHDACRPAINFVVEL  170

Query  537   LSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGL  716
             L A+  F + +L  L Q++L + VEKA +EDV+ +L  +   ++ QL + C   VA+S L
Sbjct  171   LYASSVFQISELVSLLQRRLLNFVEKALVEDVIPILRVALHSQLNQLRSHCIKRVARSDL  230

Query  717   PPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRALD  896
                 L K LP +V  +I+ +R K+     + L                +++ RR+ RALD
Sbjct  231   DKISLEKELPHEVAEEIKSIRCKAQPDEPNSLTVDPV----------HEKRTRRILRALD  280

Query  897   SSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLH  1076
             S DVELVKL++    + LD+A ALHYA   C  +VV  LLELG+A+VN      G TPLH
Sbjct  281   SDDVELVKLLLSESDITLDDANALHYAAAYCDSKVVAELLELGSANVNL-KNVRGYTPLH  339

Query  1077  IAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPNK  1250
             +AA  + P ++  LL   A  +  TADG + + I R LT   D+  K         E NK
Sbjct  340   VAAMRMEPAIIVSLLTKGASVSETTADGQSAVMICRRLTRAKDYNAKTQ----QGQESNK  395

Query  1251  LRLCLELVQ  1277
              R+C+++++
Sbjct  396   DRICIDILE  404



>ref|XP_008383328.1| PREDICTED: regulatory protein NPR3-like [Malus domestica]
Length=584

 Score =   176 bits (446),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 193/374 (52%), Gaps = 33/374 (9%)
 Frame = +3

Query  162   NGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaa  341
             +G  +SD   +VEG  V  HRCILA+RS FF K F   +                     
Sbjct  56    SGGDYSDAEITVEGVPVAVHRCILASRSEFFAKVFSRENGGSEKEG--------------  101

Query  342   SPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVD  521
              PR  +  ++P   VGYE F++ + F+Y+ ++   P +     +C    C H  C  A+D
Sbjct  102   KPRYFLSDLLPFGHVGYEAFVVFLGFVYTAKLKAFPVEVS---SCVHIVCGHEACRPAID  158

Query  522   LALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLV  701
              AL+ + A+  FG+ +LA + Q+QLA  V KA  +DV+ +L+ +   ++ QL   C   V
Sbjct  159   FALELMCASSVFGMPELASVLQRQLADFVVKAVADDVIPILVVAFNCQLSQLIDQCIERV  218

Query  702   AKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRM  881
             A S L    L K LP +VVAKI+ LR           + H+   ++     L +++IRR+
Sbjct  219   AHSDLDSISLEKRLPDEVVAKIKILRRN---------SQHYCDPNMPIVDPLREKRIRRI  269

Query  882   RRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAG  1061
              +ALDS DVEL+KL++    + LDEA ALHYA   C  +VV  +L LG ADVN    + G
Sbjct  270   HKALDSDDVELMKLLLTESDVTLDEANALHYAAAYCDPKVVTEVLGLGLADVNL-RDSRG  328

Query  1062  RTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAH  1235
              T LHIA     P ++ +LL + A  +  T +G + + I R LT   D+  K        
Sbjct  329   FTVLHIAVMRKEPSIIILLLSNGARASEPTLEGESAVSICRRLTRPKDYHTKTE----RG  384

Query  1236  IEPNKLRLCLELVQ  1277
              E NK R+C+++++
Sbjct  385   QEANKDRICIDVLE  398



>ref|XP_010908601.1| PREDICTED: regulatory protein NPR3-like [Elaeis guineensis]
 ref|XP_010908602.1| PREDICTED: regulatory protein NPR3-like [Elaeis guineensis]
Length=587

 Score =   176 bits (446),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 124/368 (34%), Positives = 187/368 (51%), Gaps = 29/368 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  V  HRCILAARS FF   F            SR G          PR 
Sbjct  64    YSDAEIVVEGAPVGVHRCILAARSRFFLDLF------------SRDG-GRCRPEGGKPRY  110

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++P   VG E F+  + ++Y+G++   P +      C +  C H  C  AV+  ++
Sbjct  111   QMSELVPCGRVGREAFMNFLSYIYTGKLKPAPPEVSV---CVDPMCAHDACWPAVNFVVE  167

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              ++A+  F + ++  L Q++L + VEKA +EDV+ +L+ +   ++ QL + C   VA+S 
Sbjct  168   LMNASSVFQIPEMVSLLQRRLLNFVEKAFVEDVIPILLVAFHSQLSQLLSHCMKRVARSD  227

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    L K LP +V  +I+ +RHK+     + L                +++IRR+ RAL
Sbjct  228   LDNISLQKELPQEVAEEIKLIRHKAQTDEPNSLTVDPVL----------EKRIRRIHRAL  277

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELVKL++      LD+A ALHYA   C  +VV  LLE+G+A+VN      G TPL
Sbjct  278   DSDDVELVKLLLSESDTTLDDANALHYAAAYCDSKVVAELLEMGSANVNL-RNNRGYTPL  336

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKL  1253
             H+AA    P ++  LL   A  +  TADG     I R LT    +          E NK 
Sbjct  337   HVAAMRKEPAVIVSLLTKGASASETTADGQNAAMICRRLTRAKDYNTNTQ--QGQESNKD  394

Query  1254  RLCLELVQ  1277
             R+C+++++
Sbjct  395   RICIDILE  402



>gb|ACE86413.1| NPR1-like protein [Musa ABB Group]
Length=574

 Score =   176 bits (445),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 125/373 (34%), Positives = 189/373 (51%), Gaps = 34/373 (9%)
 Frame = +3

Query  177   SDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRGS  356
             +D   +VEG  V  HRCILAARS FFR  F            SR G  G       PR  
Sbjct  52    TDAEIAVEGTPVGIHRCILAARSRFFRDLF------------SREG-SGGNRQEGKPRYV  98

Query  357   IPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDT  536
             + +++P   +G E  ++ + +LY+G++   PQ       C +R C H  C  A+  A++ 
Sbjct  99    MNELVPGGRIGREALMVFLSYLYTGKLRAAPQDVSI---CVDRFCAHDACRPAIGFAVEL  155

Query  537   LSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGL  716
             L A+  F + +L  L Q++L + V+KA +EDV+ +L  +   ++ QL + C   VA+S L
Sbjct  156   LYASSVFQIAELVSLLQRRLLNFVDKAMVEDVIPILQVASHSKLNQLLSHCVQRVARSDL  215

Query  717   PPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRALD  896
                 L K L  +V  +I  LR +S    S+                  +++I+R+ RALD
Sbjct  216   DDIALEKELLQEVAEEIRLLRRESQPKESTATVDPML-----------EKRIKRIHRALD  264

Query  897   SSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLH  1076
             S DVELVKL++   G+ LD+  ALHYA   C  +V+  LL+LG+A+VN      G TPLH
Sbjct  265   SDDVELVKLLLNESGVTLDDTYALHYAAAYCDSKVIAELLDLGSANVNL-KNDRGYTPLH  323

Query  1077  IAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPNK  1250
             +AA    P ++  LL   A     TADG   + I R LT   D+  +         E NK
Sbjct  324   LAAMRREPAVIVSLLTKGASALETTADGQNAVRICRRLTRAKDYFTRTE----QGQESNK  379

Query  1251  LRLCLELVQSAAM  1289
              ++C+++++   M
Sbjct  380   NKICIDILEREMM  392



>ref|XP_011040366.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Populus euphratica]
Length=587

 Score =   176 bits (445),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 124/370 (34%), Positives = 188/370 (51%), Gaps = 33/370 (9%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  +  HRCIL ARS FF + F             + G          P+ 
Sbjct  63    YSDADIVVEGTAIGVHRCILGARSRFFHELF-----RREKGSSEKEG---------KPKY  108

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              +  ++P   VGYE FL+ + +LY+G++   P +      C +  C H  C  A++ A++
Sbjct  109   CMSDLLPCGKVGYEAFLIFLSYLYTGKLKPSPMEV---STCVDNVCAHDACRPAINFAVE  165

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              L A+  F V +L  L Q++L + V KA +ED++ +L+ +   ++ QL T C   VA+S 
Sbjct  166   LLYASSIFQVPELVSLFQRRLQNFVGKALVEDMIPILVVAFHCQLSQLVTQCVDRVARSD  225

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP DV  +I+ LR K         +     ++  A   L +++I+R+  AL
Sbjct  226   LDNISIEKELPHDVAVEIKLLRRK---------SISDEENNTEAVDALREKRIKRIHMAL  276

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELVKL++    + LD+A ALHYA   C  +VV  +L LG ADVN    + G T L
Sbjct  277   DSDDVELVKLLLTESDITLDDANALHYAASYCDLKVVSEVLSLGLADVNL-RNSRGYTVL  335

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             HIAA    P ++  +L   A     T+DG + + I R LT   D+  K         E N
Sbjct  336   HIAAMRKEPSVIVSMLAKGASALDLTSDGQSAVSICRRLTRPKDYHAKTE----QGQEAN  391

Query  1248  KLRLCLELVQ  1277
             K RLC+++++
Sbjct  392   KDRLCIDILE  401



>ref|XP_011040365.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Populus euphratica]
Length=589

 Score =   175 bits (444),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 124/370 (34%), Positives = 188/370 (51%), Gaps = 33/370 (9%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  +  HRCIL ARS FF + F             + G          P+ 
Sbjct  63    YSDADIVVEGTAIGVHRCILGARSRFFHELF-----RREKGSSEKEG---------KPKY  108

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              +  ++P   VGYE FL+ + +LY+G++   P +      C +  C H  C  A++ A++
Sbjct  109   CMSDLLPCGKVGYEAFLIFLSYLYTGKLKPSPMEV---STCVDNVCAHDACRPAINFAVE  165

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              L A+  F V +L  L Q++L + V KA +ED++ +L+ +   ++ QL T C   VA+S 
Sbjct  166   LLYASSIFQVPELVSLFQRRLQNFVGKALVEDMIPILVVAFHCQLSQLVTQCVDRVARSD  225

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP DV  +I+ LR K         +     ++  A   L +++I+R+  AL
Sbjct  226   LDNISIEKELPHDVAVEIKLLRRK---------SISDEENNTEAVDALREKRIKRIHMAL  276

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELVKL++    + LD+A ALHYA   C  +VV  +L LG ADVN    + G T L
Sbjct  277   DSDDVELVKLLLTESDITLDDANALHYAASYCDLKVVSEVLSLGLADVNL-RNSRGYTVL  335

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             HIAA    P ++  +L   A     T+DG + + I R LT   D+  K         E N
Sbjct  336   HIAAMRKEPSVIVSMLAKGASALDLTSDGQSAVSICRRLTRPKDYHAKTE----QGQEAN  391

Query  1248  KLRLCLELVQ  1277
             K RLC+++++
Sbjct  392   KDRLCIDILE  401



>ref|XP_003519533.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Glycine max]
 ref|XP_006575639.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Glycine max]
 ref|XP_006575640.1| PREDICTED: regulatory protein NPR3-like isoform X3 [Glycine max]
Length=590

 Score =   174 bits (442),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 122/369 (33%), Positives = 189/369 (51%), Gaps = 31/369 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VE   V  HRCILA+RSLFF + F             + G          PR 
Sbjct  62    YSDAEILVEDIPVGIHRCILASRSLFFHELF-------------KKG-TDGSGKEGKPRY  107

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              +  ++P  +VGYE F + + +LY+G++   P +      C +  C H  C  A++ AL+
Sbjct  108   LMSDLVPYGTVGYEAFQVFLYYLYTGRLKASPTE---VTTCVDETCTHDACRPAINYALE  164

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F +++L LL Q+ L + VEKA +EDV+ +L+A+   ++ QL + C   VA+S 
Sbjct  165   LMYASATFQMKELVLLFQRHLLNFVEKALVEDVIPILMAAFNCQLDQLLSQCIRRVARSD  224

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
                  L K LP +VV +I+ LR         L        +      L ++ IRR+ +AL
Sbjct  225   FDNTSLEKELPREVVTEIKLLR---------LPFQPESTPNAMEVESLNEKSIRRIHKAL  275

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVEL+KL++    + LD+A ALHYA      +V++ +L LG AD+     + G T L
Sbjct  276   DSDDVELLKLLLNESSVTLDDAHALHYACAYSDSKVIQEVLSLGMADI-LRRNSRGYTVL  334

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHI-EPNK  1250
             H+AA    P ++  LL+  A  +  T DG T L I + LT    +K          E NK
Sbjct  335   HVAARRKDPSILVALLNKGACASDTTPDGQTALAICQRLTR---YKDYQEQTVQCKESNK  391

Query  1251  LRLCLELVQ  1277
              RLC+++++
Sbjct  392   DRLCVDVLE  400



>ref|XP_002322351.2| ankyrin repeat family protein [Populus trichocarpa]
 gb|EEF06478.2| ankyrin repeat family protein [Populus trichocarpa]
Length=587

 Score =   174 bits (441),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 122/370 (33%), Positives = 188/370 (51%), Gaps = 33/370 (9%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  +  HRCIL ARS FF + F             + G          P+ 
Sbjct  63    YSDADIVVEGTAIGVHRCILGARSKFFHELF-----RREKGSSEKEG---------KPKY  108

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              +  ++P   VGYE FL+ + +LY+G++   P +      C +  C H  C  A++ A++
Sbjct  109   CMSDLLPCGKVGYEAFLIFLSYLYTGKLKPSPMEVS---TCVDNVCAHDACRPAINFAVE  165

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+  F V +L  L Q++L + V KA +ED++ +L+ +   ++ QL T C   +A+S 
Sbjct  166   LMYASSIFQVPELVSLFQRRLQNFVGKALVEDMIPILVVAFHCQLSQLVTQCVDRIARSD  225

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP DV  +I+ LR K         +     ++  A   L +++I+R+  AL
Sbjct  226   LDNISIEKELPHDVAVEIKLLRRK---------SISDEENNTEAVDALREKRIKRIHMAL  276

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELVKL++    + LD+A ALHYA   C  +VV  +L LG ADVN    + G T L
Sbjct  277   DSDDVELVKLLLTESDITLDDANALHYAASYCDLKVVSEVLSLGLADVNL-RNSRGYTVL  335

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             HIAA    P ++  +L   A     T+DG + + I R LT   D+  K         E N
Sbjct  336   HIAAMRKEPSVIVSMLAKGASALDLTSDGQSAVSICRRLTRPKDYHAKTE----QGQEAN  391

Query  1248  KLRLCLELVQ  1277
             K RLC+++++
Sbjct  392   KDRLCIDILE  401



>ref|XP_003617362.1| NPR1-1 protein [Medicago truncatula]
 gb|AET00321.1| NPR1/NIM1-like regulatory protein, putative [Medicago truncatula]
Length=594

 Score =   174 bits (441),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 124/370 (34%), Positives = 194/370 (52%), Gaps = 29/370 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             + D    VE   V  HRCILA+RS FF + F             + G V  G G   PR 
Sbjct  66    YCDAEILVEEIPVGIHRCILASRSQFFHELF----------KKGKDGEVKDGKG--KPRY  113

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++P  SVGYE F++ + +LY+G++   P +      C +  C H  C  A++ AL+
Sbjct  114   LMKELVPYGSVGYEAFIVFLHYLYTGKLKAPPPE---VTTCVDEACIHDSCRPAINFALE  170

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F +++LAL+ Q+ L + V+KA +EDV+ +L+A+   +  QL + C   VA+S 
Sbjct  171   LMYASSTFQMKELALVFQRCLLNYVDKALVEDVIPILMAAHHCKQDQLLSHCIQRVARSD  230

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             +    L + LP +VV +I+ LR          L              + D+ IR++ +AL
Sbjct  231   MEIIYLERELPHEVVTEIKSLR-------VQSLPESTPDSMEVEPVIVSDKSIRKILKAL  283

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVEL+KL++    + LD+A ALHYA   C  +VV+ +L LG AD+       G T L
Sbjct  284   DSDDVELLKLLLDESSVTLDDAYALHYACAYCDSKVVQEVLTLGLADI-LLKNPRGYTVL  342

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             H+AA    P ++  LL + A  +  T DG T L I + LT   D+  K A    +H    
Sbjct  343   HVAARRKDPSILVALLKNGACASETTLDGQTALSICQRLTRRKDYHEKTATGKESH----  398

Query  1248  KLRLCLELVQ  1277
             K RLC+++++
Sbjct  399   KDRLCVDVLE  408



>ref|XP_010092646.1| Regulatory protein [Morus notabilis]
 gb|EXB51897.1| Regulatory protein [Morus notabilis]
Length=582

 Score =   172 bits (437),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 122/368 (33%), Positives = 188/368 (51%), Gaps = 28/368 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  V  HRCILAARS FF   F             +     +  G   P+ 
Sbjct  56    YSDADVIVEGTRVGVHRCILAARSGFFHDLF-------------KKDKGVSEKGGGKPKY  102

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              +  ++P  SVGYE FL+++ ++Y+G++   P +      C +  C H  C  A++ A++
Sbjct  103   CLEDLLPYGSVGYEAFLVLLSYVYTGKLKPSPMEVS---TCVDNICPHDSCRPAINFAVE  159

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+  F + +L    Q++L + V KA +EDV+ +L+ +   ++ QL+  C   VA+S 
Sbjct  160   LMYASSIFQMPELVSPFQRRLLNFVGKALVEDVIPILVVAFHCQLSQLFAQCVDRVARSD  219

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    L K LP +VV  I+ LR KS  +                     +++IRR+ +AL
Sbjct  220   LEIVSLEKELPHEVVENIKVLRGKSQCSDKDNTESVDPL---------REKRIRRIHKAL  270

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELVKL++    + LD+A ALHYA   C  +VV  +L LG ADVN    + G T L
Sbjct  271   DSDDVELVKLLLTESEITLDDANALHYAAAYCDPKVVNEVLGLGLADVNL-QNSRGYTVL  329

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKL  1253
             HIAA    P ++  LL   A  +  T+DG + + I R LT    +   +      E NK 
Sbjct  330   HIAAMRKEPSIIVSLLTKGACASDLTSDGQSAVSICRRLTRPKDYHAKME--QGQETNKD  387

Query  1254  RLCLELVQ  1277
             R+C+++++
Sbjct  388   RICIDVLE  395



>ref|XP_006853358.1| hypothetical protein AMTR_s00032p00112510 [Amborella trichopoda]
 gb|ERN14825.1| hypothetical protein AMTR_s00032p00112510 [Amborella trichopoda]
Length=595

 Score =   172 bits (437),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 117/343 (34%), Positives = 171/343 (50%), Gaps = 30/343 (9%)
 Frame = +3

Query  168   QAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSP  347
               FSD    VEG  +  HRCILAARS  FR+ F                          P
Sbjct  72    NGFSDAEIEVEGVPIGVHRCILAARSSVFREVFSREKKHEG-----------------KP  114

Query  348   RGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLA  527
             + SI +++P   VGYE F +++ +LY+G++   P +      C E+ C H  C  AVD A
Sbjct  115   KYSIEELVPSGKVGYEAFRIVLNYLYTGRLKSAPPEVS---TCVEKVCAHDDCRPAVDFA  171

Query  528   LDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAK  707
             ++ + A+  F +++L  + Q++L S VEKA +EDV+ +L+ +    +  L T C   +A+
Sbjct  172   VEVVRASAVFQIQELGSVWQRRLLSYVEKAQVEDVIPILLVASSCHLSPLDTHCIQRMAR  231

Query  708   SGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRR  887
             S L    L K    ++V +I  LR KS +    L                  +  +R+ +
Sbjct  232   SDLDDISLEKSFSREIVEEILSLRLKSRIDDEPLSPKKDPLQL---------KNFKRIHK  282

Query  888   ALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRT  1067
             ALDS D+ELVK+++M     LD+A ALHYA   C  +VV  LLELG ADVN    + G T
Sbjct  283   ALDSDDLELVKMLLMEGNTTLDDAEALHYAAAYCDSKVVAELLELGGADVN-KRNSRGYT  341

Query  1068  PLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTS  1196
              LH+AA    P ++  LL   A     T+DG +   I R LT+
Sbjct  342   VLHVAAMRQEPAVLVALLSKEARACELTSDGRSGARICRRLTT  384



>gb|ABA38903.1| NPR1-like protein, partial [Pyrus communis]
Length=353

 Score =   167 bits (424),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 125/374 (33%), Positives = 190/374 (51%), Gaps = 33/374 (9%)
 Frame = +3

Query  162   NGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaa  341
             +G  +SD   +VEG  V  HRCILA+RS  F K F        +    + G         
Sbjct  9     SGGDYSDAEITVEGVPVPVHRCILASRSEVFAKVF-----SRENGGSEKEG---------  54

Query  342   SPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVD  521
              PR  +  ++P   VGYE F++ + F+Y+ ++   P +     +C    C H  C  A+D
Sbjct  55    KPRYCLSDLLPFGHVGYEAFVVFLGFVYTAKLKAFPVEVS---SCVHNVCGHEACRPAID  111

Query  522   LALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLV  701
              AL+   A+  FG+ +L  + Q+QL   V KA  +DV+ +L+ +   ++ QL   C   V
Sbjct  112   FALELTCASSVFGMPELVSVLQRQLTDFVVKALADDVIPILVVAFHCQLSQLIDQCIERV  171

Query  702   AKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRM  881
             A S L    L K LP +VV KI+ LR           + H+   ++     L +++IRR+
Sbjct  172   AHSDLDSISLEKRLPDEVVEKIKILRRN---------SQHYCDPNMPIVDPLREKRIRRI  222

Query  882   RRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAG  1061
              +ALDS DVEL+KL++    + LDEA ALHYA   C  +VV  +L LG ADVN    + G
Sbjct  223   HKALDSDDVELMKLLLTESDVTLDEANALHYAAAYCDPKVVTEVLGLGLADVNL-RDSRG  281

Query  1062  RTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAH  1235
              T LHIA     P ++ +LL + A  +  T +G + + I R LT   D+  K        
Sbjct  282   FTVLHIAVMRKEPSIIILLLSNGARASEPTLEGESAVSICRRLTRPKDYHTKTE----RG  337

Query  1236  IEPNKLRLCLELVQ  1277
              E NK R+C+++++
Sbjct  338   QEANKDRICIDVLE  351



>ref|XP_008342333.1| PREDICTED: regulatory protein NPR3-like [Malus domestica]
Length=585

 Score =   172 bits (435),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 125/370 (34%), Positives = 187/370 (51%), Gaps = 41/370 (11%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VE   V  +RCILA+RS FF+  F             R G          PR 
Sbjct  66    YSDAEIVVEXBTVGVNRCILASRSQFFQXLF-------------RKG-SDDAKXEGKPRY  111

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++P   VG E F + + +LY+G+++  P   E    C +  C H  C  A+  A++
Sbjct  112   LMSELVPNGRVGXEAFKVFLXYLYTGKLN--PSXGEV-STCVDDRCPHDACGPAISYAVE  168

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F +++L  L Q+ L++ VEKA +EDV+ +L+A+   ++ QL + C   VA+S 
Sbjct  169   LMYASSTFQMKELVQLVQRHLSNFVEKALVEDVIPILVAAFHCQLDQLLSHCIQRVARSD  228

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP +V   I+ +R K                       +ED++IR + +AL
Sbjct  229   LDNVAIEKELPHEVSNDIKLIRLK-----------------HQEMEPVEDKRIRSIHKAL  271

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELV L++    + LDEA ALHYAV  C  +VVK +L LG A+ N    + G T L
Sbjct  272   DSDDVELVGLLLKESDITLDEAYALHYAVAYCDPKVVKEVLGLGKANPNL-RNSRGHTVL  330

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             H+AA    P ++  LL   A  +  T DG TP+ I R LT   DFL           E N
Sbjct  331   HVAARRKLPSVLVPLLKWGASASETTLDGQTPVAICRRLTRPKDFLENTQTGQ----ESN  386

Query  1248  KLRLCLELVQ  1277
             K R+C+ L++
Sbjct  387   KDRMCIGLLE  396



>ref|XP_011096773.1| PREDICTED: regulatory protein NPR3-like [Sesamum indicum]
Length=563

 Score =   171 bits (434),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 120/372 (32%), Positives = 188/372 (51%), Gaps = 29/372 (8%)
 Frame = +3

Query  162   NGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaa  341
             +G  FSD    VE   V  HRCILAARS FF   F               G VG      
Sbjct  36    SGADFSDADIVVEDNSVGIHRCILAARSKFFFDLF-----------RKDKGCVGKEG---  81

Query  342   SPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVD  521
              P+  +  ++P   +GYE FL  + +LY+G++   P +      C +  C H  C  A+D
Sbjct  82    KPKYWMTNILPYGRIGYEAFLTFLSYLYTGKLRPSPVEVS---TCVDNICAHDVCRPAID  138

Query  522   LALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLV  701
              A++ + A+  F V +L  L Q++L ++V KA +EDV+ +++ +   ++ QL T C H V
Sbjct  139   FAVELMYASAIFQVSELVSLFQRRLLNLVGKAVVEDVIPIVVVAFHCQLSQLLTQCIHRV  198

Query  702   AKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRM  881
             A+S L    + K LP  V  +I  LR         L +     + +     L +++++R+
Sbjct  199   ARSDLEAISIEKELPSKVAEEIRLLR---------LNSQVEQENKVATVDPLHEKRVKRI  249

Query  882   RRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAG  1061
              +ALDS DVELV+L++    + LDEA ALHYA+  C  ++V  +L LG +DVN      G
Sbjct  250   HKALDSDDVELVRLLLTESDITLDEAYALHYAIAYCDPKIVTEVLSLGLSDVNL-RNTRG  308

Query  1062  RTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIE  1241
              T LHIAA    P ++  LL   A  +  T +G + L I +  T    ++  +      E
Sbjct  309   NTVLHIAARRKEPSIIVSLLTKGASASEPTFEGQSALSICKRSTRPKEYQ--MKREKGQE  366

Query  1242  PNKLRLCLELVQ  1277
              NK R+C+++++
Sbjct  367   ANKDRMCIDILE  378



>gb|AIM54370.1| nonexpressor of pathogenesis-related protein 1 [Gladiolus hybrid 
cultivar]
Length=588

 Score =   172 bits (435),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 125/372 (34%), Positives = 193/372 (52%), Gaps = 30/372 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRL-VHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPR  350
             F D   +++G   V  HRCILAARS  FR  F  P + G        G          PR
Sbjct  57    FIDADVALDGGADVGVHRCILAARSRVFRDLFSRPSNGGPQQSVGPAG--------GRPR  108

Query  351   GSIPQVIPVNS-VGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLA  527
               + +++P  + +G E F++ + +LY+G++   P        C +  C H  C+ AV  A
Sbjct  109   YRVAELLPPGARLGREAFMVFLGYLYTGKLRQAPLDA---ATCVDPVCAHDACSPAVSFA  165

Query  528   LDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAK  707
             ++ + AA  F + +L  L Q++L + VEK  +EDV+ +L+ +   ++ QL  TC   VA+
Sbjct  166   VELMYAASVFDIPELGSLFQRRLLNFVEKTLVEDVIPILLVAFHSQLNQLLRTCVQRVAR  225

Query  708   SGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRR  887
             S L    L K LP +VVA+I+ +R               +  D+ +   + +++IRR+  
Sbjct  226   SNLDNISLEKELPSEVVAEIKSVRRS----------FQVNDCDVPSVDTVHEKRIRRIHG  275

Query  888   ALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRT  1067
             ALDS DVELVKL++    + LD+A ALHYA   C  +VV  +LEL  A+VN      G T
Sbjct  276   ALDSDDVELVKLLLKESDVTLDDATALHYAAAYCDSKVVAEVLELDLANVNL-KNERGYT  334

Query  1068  PLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIE  1241
             PLH+AA    P ++  LLD  A  +  T+DG   + I R LT   D+  K     +   E
Sbjct  335   PLHVAAMRREPAVIVSLLDKGASASEATSDGQDAVSICRRLTRAKDYYAK----TMQCQE  390

Query  1242  PNKLRLCLELVQ  1277
              NK R+C+++++
Sbjct  391   SNKDRICIDILE  402



>ref|XP_007141442.1| hypothetical protein PHAVU_008G195900g [Phaseolus vulgaris]
 gb|ESW13436.1| hypothetical protein PHAVU_008G195900g [Phaseolus vulgaris]
Length=588

 Score =   171 bits (434),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 124/370 (34%), Positives = 189/370 (51%), Gaps = 33/370 (9%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VE   V  HRCILA+RS FF + F             + G          PR 
Sbjct  62    YSDAEIVVEDISVGVHRCILASRSPFFHELF-------------KKG-TDGSGKEGKPRY  107

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++P  +VGYE F + + +LY+G++   P +      C    C H  C  A+D AL+
Sbjct  108   LMSELVPYGAVGYEAFQVFLYYLYTGRLKDSPTE---VTTCVGETCIHDACRPAIDYALE  164

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F +++L LL Q+QL + V+KA +EDV+ +L+A+   +++QL + C H VA S 
Sbjct  165   LMYASAAFLMKELVLLFQRQLLNFVDKALVEDVIPILMAAFNCQLEQLLSRCIHKVASSD  224

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
                  L K LP +VV +I+  R         L        D      L ++ I R+ +AL
Sbjct  225   FDSISLEKELPHEVVTEIKSCR---------LSFQPESAADAMEVEPLSEKSIMRIHKAL  275

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVEL+KL++    + LD+A ALHYA      +V++ LL LG AD+     + G T L
Sbjct  276   DSDDVELLKLLLNESRVTLDDAYALHYACAYSDSKVIQELLGLGMADI-LRRNSRGYTVL  334

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             H+AA    P ++  LL+  A     T DG T L I + LT   D+  K     +   E N
Sbjct  335   HVAARRKDPSILVALLNKGACATDTTPDGQTALSICQRLTRRKDYHEK----TVKCKESN  390

Query  1248  KLRLCLELVQ  1277
             K RLC+++++
Sbjct  391   KDRLCVDVLE  400



>ref|XP_003545296.1| PREDICTED: regulatory protein NPR3-like [Glycine max]
Length=590

 Score =   171 bits (434),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 120/370 (32%), Positives = 191/370 (52%), Gaps = 33/370 (9%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    +E   V  HRCILA+RS FF + F             + G          PR 
Sbjct  62    YSDAEILIEDIPVGIHRCILASRSPFFHELF-------------KKG-TDGSGKEGKPRY  107

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              +  ++P  +VGY+ F + + +LY+G++   P +      C +  C H  C  A++ AL+
Sbjct  108   LMSDLMPYGTVGYQAFQVFLYYLYTGRLKASPTEE---TTCVDETCIHVACRPAINHALE  164

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F +++L LL Q+ L + VEKA +EDV+ +L+A+   ++ QL + C   VA+S 
Sbjct  165   LMYASATFQMKELVLLFQRHLLNFVEKALVEDVIPILMAAFNCQLDQLLSRCIQRVARSD  224

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
                  L K LP +V+ +I+ LR         L        +   A  L ++ IRR+ +AL
Sbjct  225   FDNTSLEKELPHEVLTEIKSLR---------LSFQPESTPNAMEAESLNEKSIRRIHKAL  275

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVEL+KL++    + LD+A ALHYA      +V++ +L LG AD+     + G T L
Sbjct  276   DSDDVELLKLLLNESSVTLDDAYALHYACAYSDSKVIQEVLSLGMADI-LRRNSRGYTVL  334

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             H+AA    P ++  LL+  A  +  T DG T L I + LT   D+  K     +   E N
Sbjct  335   HVAARRKDPSILVALLNKGARASDTTPDGQTALAICQRLTRCKDYHEK----TVQCKESN  390

Query  1248  KLRLCLELVQ  1277
             K RLC+++++
Sbjct  391   KDRLCVDVLE  400



>gb|EYU42809.1| hypothetical protein MIMGU_mgv1a003347mg [Erythranthe guttata]
Length=591

 Score =   171 bits (433),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 118/368 (32%), Positives = 197/368 (54%), Gaps = 24/368 (7%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  V   RCILAARS FF + F   ++       ++ G          P+ 
Sbjct  64    YSDAEIEVEGIAVGVSRCILAARSHFFHEIF--KNNNAESRSSTKEG--------KKPKY  113

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++P   +GYE F +++ +LY+G+V   P +      C +  C H  C  A++ A++
Sbjct  114   ILSELVPHGKIGYEAFTVVLNYLYTGKVKASPAEV---ATCVDESCAHDACGPAINYAVE  170

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F +++L ++ Q++L + V+KA +EDV+ +LI +    + +L + C   +A+S 
Sbjct  171   MMYASATFQIKELVMVVQRRLLNFVDKAFVEDVIPILIVASTCNLNELLSHCLQRIARSD  230

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L   ++ K LP     +++ LR KS+       +               +++I+R+ RAL
Sbjct  231   LDNTIIEKELPYQTQNEVKSLRLKSNNQEEEHDSIQADPT--------NEKRIKRIHRAL  282

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS+DVELVK+++   G++LD ALALHYA   C+ ++V  +L LG ADV+      G T L
Sbjct  283   DSNDVELVKMLLEESGISLDSALALHYAAAYCNPKIVAEVLNLGFADVSL-RDPRGYTVL  341

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKL  1253
             H+AA    P +V  LL   A  + RT DG+T + I R LT    F  A   +   E N  
Sbjct  342   HVAARRKDPSIVVGLLTKGASVSDRTRDGVTAVTICRRLTRPKDFNEA--SVHGKETNTD  399

Query  1254  RLCLELVQ  1277
             RLC+++++
Sbjct  400   RLCIDVLE  407



>gb|KDP22628.1| hypothetical protein JCGZ_02854 [Jatropha curcas]
Length=587

 Score =   171 bits (433),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 118/368 (32%), Positives = 181/368 (49%), Gaps = 29/368 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG+ V  HRCILAARS FF + F             + G          P+ 
Sbjct  66    YSDAEIIVEGKPVGVHRCILAARSKFFHELF-----KQEKGSSDKGG---------KPKY  111

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              +  ++P   VGYE FL+ + ++Y+G++   P +      C +  C H  C  A++ A++
Sbjct  112   EMSDLLPYGKVGYEAFLIFLNYMYTGKLKPSPMEVS---TCVDNVCSHDACRPAINFAVE  168

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              L A+  F V +L  L Q++L + V KA +EDV+ +L+ +   +  QL   C   +A+S 
Sbjct  169   LLYASSIFQVPELVSLFQRRLLNFVGKAYVEDVIPILVVAFHCQSNQLVAQCVDRIARSD  228

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + + LP +V   I+ LR +                         +++IRR+ +AL
Sbjct  229   LDNMSIERELPYEVSEDIKFLRKRPVSEDEENTEAVDPM---------HEKRIRRIHKAL  279

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELVKL++    + LD+A ALHYA   C  +VV  +L L  ADVN    + G T L
Sbjct  280   DSDDVELVKLLLTESAVTLDDARALHYAAAYCDPKVVSEVLSLDLADVNL-TNSQGYTVL  338

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKL  1253
             H+AA    P ++  LL   A     T+DG + + I R LT    +   I      E NK 
Sbjct  339   HVAAMRREPSVIVSLLAKGACALDLTSDGRSAVSICRRLTRPKDYHAKIE--QGQEANKD  396

Query  1254  RLCLELVQ  1277
             RLC+++++
Sbjct  397   RLCIDVLE  404



>ref|XP_009357279.1| PREDICTED: regulatory protein NPR3-like [Pyrus x bretschneideri]
Length=586

 Score =   170 bits (431),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 124/373 (33%), Positives = 188/373 (50%), Gaps = 33/373 (9%)
 Frame = +3

Query  165   GQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaS  344
             G  FSD    VEG  V  HRCILA+RS FFR+ F             + G          
Sbjct  59    GCDFSDADIVVEGIPVGVHRCILASRSRFFRELF-----KREKGSSGKEG---------R  104

Query  345   PRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDL  524
             PR S+  ++P   VGYE FL+ + ++Y+G++   P +      C   GC H  C  A++ 
Sbjct  105   PRYSMSDLLPYGDVGYEAFLVFLSYVYTGKLKPSPMEVS---TCVHNGCAHDACRPAINF  161

Query  525   ALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVA  704
              ++ + AA  F +  L  + +++L + V KA  ++V+ +L+ +   ++ QL       VA
Sbjct  162   VVELMYAASVFQMPDLVSIFERRLLNFVGKALPDNVIPILVVAFHCQLNQLIAEGIERVA  221

Query  705   KSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMR  884
             +S +    + K LP +VV KI+ LR K+     S L                +++IRR+ 
Sbjct  222   RSDIDDISIEKGLPDEVVKKIKVLRCKTQQDCVSNLPPVDPL---------REKRIRRIH  272

Query  885   RALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGR  1064
             +ALDS DVELVKL++    + LDEA ALHYA   C  +VV  +L+LG ADVN    + G 
Sbjct  273   KALDSDDVELVKLLLTESNITLDEANALHYAAAYCDPKVVTEVLDLGLADVNL-RNSRGY  331

Query  1065  TPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHI  1238
             T LHIA     P ++ +LL   A  +  T+DG   + I R LT   D+  K         
Sbjct  332   TVLHIAVMRKEPSIIVLLLTKGARASELTSDGQNAVSICRRLTRPKDYHSKTE----QGQ  387

Query  1239  EPNKLRLCLELVQ  1277
             E NK R+C+++++
Sbjct  388   EANKDRICIDVLE  400



>gb|KHG00475.1| Regulatory NPR3 -like protein [Gossypium arboreum]
Length=587

 Score =   169 bits (429),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 121/374 (32%), Positives = 185/374 (49%), Gaps = 33/374 (9%)
 Frame = +3

Query  162   NGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaa  341
             N   FSD    VEG  V  HRCILA RS FF + F             + G         
Sbjct  59    NCPVFSDADIVVEGVAVGVHRCILAVRSKFFNEVF-----KEGSGSSEKDG---------  104

Query  342   SPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVD  521
              P  ++ +++P   +G E F + + +LY+G++   P +      C +  C H  C  A+ 
Sbjct  105   KPSYNMSELLPYGKIGLEAFQVFLSYLYTGKLKPSPMEVS---TCVDNVCAHDACRPAIS  161

Query  522   LALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLV  701
              A++++ A+  F + +L  L Q++L + VEKA +ED+M +L+ +   +  QL + C   V
Sbjct  162   FAVESMYASSIFQILELVPLFQRRLLNFVEKALLEDIMPILVVAFHCQCSQLVSQCVDRV  221

Query  702   AKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRM  881
             A+S L    + K LP +V   I  LR K         +      +      L +++IRR+
Sbjct  222   ARSDLDSICIEKELPYEVTESIRLLRCK---------SPSDGEGNEAVVDPLREKRIRRI  272

Query  882   RRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAG  1061
              +ALDS DVELVKL++    + LD+A ALHYA   C  +VV  +L L  ADVN    + G
Sbjct  273   HKALDSDDVELVKLLLTESDITLDDATALHYAAAYCDPKVVSEVLGLRLADVNL-RNSRG  331

Query  1062  RTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAH  1235
              T LHIAA    P ++  LL   A  +  T DG + ++I R LT   D+  K        
Sbjct  332   YTVLHIAAMRKEPSVIMALLAKGASASTLTLDGQSAVNICRRLTRPKDYHAKTE----QG  387

Query  1236  IEPNKLRLCLELVQ  1277
              E NK R+C+++++
Sbjct  388   KETNKDRICIDILE  401



>gb|KHN11992.1| Regulatory protein NPR3 [Glycine soja]
Length=590

 Score =   169 bits (429),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 120/370 (32%), Positives = 191/370 (52%), Gaps = 33/370 (9%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    +E   V  HRCILA+RS FF + F             + G          PR 
Sbjct  62    YSDAEILIEDIPVGIHRCILASRSPFFHELF-------------KKG-TDGSGKEGKPRY  107

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              +  ++P  +VGY+ F + + +LY+G++   P +      C +  C H  C  A++ AL+
Sbjct  108   LMSDLMPYGTVGYQAFQVFLYYLYTGRLKASPTEE---TTCVDETCIHVACRPAINHALE  164

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F +++L LL Q+ L + VEKA +EDV+ +L+A+   ++ QL + C   VA+S 
Sbjct  165   LMYASVTFQMKELVLLFQRHLLNFVEKALVEDVIPILMAAFNCQLDQLLSRCIQRVARSD  224

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
                  L K LP +V+ +I+ LR         L        +   A  L ++ IRR+ +AL
Sbjct  225   FDNTSLEKELPHEVLTEIKSLR---------LPFQPESTPNAMEAESLNEKSIRRIHKAL  275

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVEL+KL++    + LD+A ALHYA      +V++ +L LG AD+     + G T L
Sbjct  276   DSDDVELLKLLLNESSVTLDDAHALHYACAYSDSKVIQEVLSLGMADI-LRRNSRGYTVL  334

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             H+AA    P ++  LL+  A  +  T DG T L I + LT   D+  K     +   E N
Sbjct  335   HVAARRKDPSILVALLNKGARASDTTPDGQTALAICQRLTRCKDYHEK----TVQCKESN  390

Query  1248  KLRLCLELVQ  1277
             K RLC+++++
Sbjct  391   KDRLCVDVLE  400



>gb|AEE81755.1| regulatory protein NPR2 [Populus deltoides]
Length=587

 Score =   169 bits (429),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 119/370 (32%), Positives = 183/370 (49%), Gaps = 33/370 (9%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  +  HRCIL ARS FF + F             + G          P+ 
Sbjct  63    YSDADIVVEGTAIGVHRCILGARSKFFHELF-----RREKGSSEKEG---------KPKY  108

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              +  ++    VGYE FL+ + +LY+G++   P +      C +  C H  C  A++ A++
Sbjct  109   CLSDLLTCGKVGYEAFLIFLSYLYTGKLKPSPMEV---STCVDNVCAHDACRPAINFAVE  165

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+  F V +L  L Q++L + V KA +ED++ +L+ +   ++ QL T C   +A+S 
Sbjct  166   LMYASSIFQVPELVSLFQRRLQNFVGKALVEDMIPILVVAFHCQLSQLVTQCVDRIARSD  225

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP DV  +I+ LR  S     +                  +++I+R+  AL
Sbjct  226   LDNISIEKELPHDVAVEIKLLRRNSISDEENNTEAVDAL---------REKRIKRIHMAL  276

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELVKL++    + LD+A ALHYA   C  +VV  +L LG ADVN    + G T L
Sbjct  277   DSDDVELVKLLLTESDITLDDANALHYAASYCDLKVVSEVLSLGLADVNL-RNSRGYTVL  335

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             HIAA    P ++  +L   A     T+DG + + I R LT   D+  K         E N
Sbjct  336   HIAAMRKEPSVIVSMLAKGASALQLTSDGQSAVSICRRLTRPKDYHAKTE----QGQEAN  391

Query  1248  KLRLCLELVQ  1277
             K RLC+++++
Sbjct  392   KDRLCIDILE  401



>ref|XP_002520549.1| Regulatory protein NPR1, putative [Ricinus communis]
 gb|EEF41835.1| Regulatory protein NPR1, putative [Ricinus communis]
Length=590

 Score =   169 bits (427),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 122/370 (33%), Positives = 181/370 (49%), Gaps = 33/370 (9%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG+ V  HRCILAARS FF   F             + G          P+ 
Sbjct  63    YSDADIVVEGKPVGIHRCILAARSRFFHDLF-----KQEKGSLEKDG---------KPKY  108

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              +  ++P   VGYE FL+ + +LY+G++   P +      C +  C H  C  A++ A++
Sbjct  109   CMNDLLPCGEVGYEAFLIFLNYLYTGKLKPSPMEVS---TCVDNVCTHDACRPAINFAVE  165

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              L A+  F V +L  L Q++L + V K  +EDV+ +L+ +   +  QL   C   +A+S 
Sbjct  166   LLYASSIFQVPELVSLFQRRLLNFVGKTYVEDVIPILVVAFHCQSNQLVAQCVDRIARSD  225

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP +V   I  LR K        +                +++IRR+ +AL
Sbjct  226   LDNISIEKELPYEVAENIRLLRIKPISDDEENVEVVDPL---------REKRIRRIHKAL  276

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELVKL++    + +D+A ALHYA   C  +VV  +L LG ADVN    + G T L
Sbjct  277   DSDDVELVKLLLTESEVTMDDANALHYATAYCDPKVVSEVLGLGLADVNR-RNSQGYTVL  335

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             HIAA    P ++  LL   A     T+DG + + I R LT   D+  K         E N
Sbjct  336   HIAAMRREPSVIVSLLTKGACALDLTSDGRSAVSICRRLTRPKDYHAKTE----QGQEAN  391

Query  1248  KLRLCLELVQ  1277
             K RLC+++++
Sbjct  392   KDRLCIDVLE  401



>gb|ACJ04030.1| NPR1-like protein [Musa ABB Group]
 gb|ACJ04031.1| NPR1-like protein [Musa ABB Group]
Length=595

 Score =   168 bits (426),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 128/373 (34%), Positives = 191/373 (51%), Gaps = 34/373 (9%)
 Frame = +3

Query  177   SDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRGS  356
             +D   +VEG  V  HRCILAARS FFR  F            SR G  G       PR  
Sbjct  73    TDAEIAVEGTPVGIHRCILAARSRFFRDLF------------SREG-SGGNRQEGKPRYV  119

Query  357   IPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDT  536
             + +++P   +G E  ++ + +LY+G++   PQ       C +R C H  C  A+  A++ 
Sbjct  120   MNELVPGGRIGREALMVFLSYLYTGKLRAAPQDVSI---CVDRFCAHDACRPAIGFAVEL  176

Query  537   LSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGL  716
             L A+  F + +L  L Q++L + V+KA +EDV+ +L  +   ++ QL + C   VA+S L
Sbjct  177   LYASSVFQIAELVSLLQRRLLNFVDKAMVEDVIPILQVASHSKLNQLLSHCVQRVARSDL  236

Query  717   PPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRALD  896
                 L K LP +V  +I  LR +S    S+                  +++I+R+ RALD
Sbjct  237   DDVSLEKELPQEVAEEIRLLRRESQPKESTATVDPML-----------EKRIKRIHRALD  285

Query  897   SSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLH  1076
             S DVELVKL++   G+ LD+A ALHYA   C  +VV  LL+LG+A+VN      G TPLH
Sbjct  286   SDDVELVKLLLSESGVTLDDAYALHYAAAYCDSKVVAELLDLGSANVNL-KNDRGYTPLH  344

Query  1077  IAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPNK  1250
             +AA    P ++  LL   A     TADG   + I R LT   D+  +         E NK
Sbjct  345   LAAMRREPAVIVSLLTKGASALETTADGQNAVRICRRLTRAKDYFTRTE----QGQESNK  400

Query  1251  LRLCLELVQSAAM  1289
              ++C+++++   M
Sbjct  401   NKICIDILEREMM  413



>gb|ABA38911.1| NPR1-like protein, partial [Prunus avium]
Length=336

 Score =   163 bits (412),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 117/363 (32%), Positives = 183/363 (50%), Gaps = 33/363 (9%)
 Frame = +3

Query  195   VEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRGSIPQVIP  374
             VEG  V  HRCILA+RS FFR  F             + G   +    + P+  +  ++P
Sbjct  3     VEGISVGVHRCILASRSSFFRDLF-----------KQKKG---SSGKESRPKYCMSDLLP  48

Query  375   VNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARS  554
                VGYE FL+ + ++Y+G++   P++      C    C H  C  A++  ++ + A+  
Sbjct  49    YGDVGYEAFLVFLSYVYTGKLKPSPREVS---TCVHNVCAHDACRPAINFVVELMYASSI  105

Query  555   FGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLA  734
             F +  L  + Q++L + V KA  +DV+ +L+ +   ++ QL   C   VA+S +    L 
Sbjct  106   FQMPDLVSIFQRRLLNFVGKALADDVIPILVVAFHCQLSQLIAQCIERVARSDIDSISLE  165

Query  735   KHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRALDSSDVEL  914
             K LP +V+ KI+ LR  S       +                +++IRR+ +ALDS DVEL
Sbjct  166   KGLPDEVIEKIKILRRNSQQDCDPNMPAVDPL---------HEKRIRRIHKALDSDDVEL  216

Query  915   VKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMV  1094
             VKL++    + LDEA ALHYA   C  +VV  +L LG ADVN    + G T LHIA    
Sbjct  217   VKLLLSESAITLDEANALHYAAAYCDPKVVTEVLGLGLADVNL-RNSRGYTVLHIAVMRK  275

Query  1095  SPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPNKLRLCLE  1268
              P ++ +LL   A  +  T+DG + + I R LT   D+  K         E NK R+C++
Sbjct  276   EPSIIVLLLTKGARASELTSDGQSAVSICRRLTRPKDYHSKTE----QGQEANKDRICID  331

Query  1269  LVQ  1277
             +++
Sbjct  332   VLE  334



>ref|XP_004303897.1| PREDICTED: regulatory protein NPR3-like [Fragaria vesca subsp. 
vesca]
Length=578

 Score =   167 bits (423),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 125/372 (34%), Positives = 193/372 (52%), Gaps = 33/372 (9%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  V  +RCILAAR  FF + F            S+ G          P+ 
Sbjct  64    YSDAEIVVEGTPVSVNRCILAARGQFFHEVF-----QKGSDNKSKEG---------KPQY  109

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++P   VG E F + + +LY+G++   P +      C E  C H  C  A++ A++
Sbjct  110   VMSELVPCGRVGCEAFKVFLNYLYTGKLKPSPPE---VSTCVEDVCAHDACGPAINYAVE  166

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F +++L  + Q++L + V+KA +EDV+ +L+A+   ++ QL + C   V++S 
Sbjct  167   LMYASSTFQMKELVQVVQRRLWNFVDKALVEDVIPILVAAFHCQLSQLLSHCVQRVSRSD  226

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQK---IRRMR  884
             L    L K LP +V   I+ LR KS     S++     R         ED++   IRR+ 
Sbjct  227   LDNVALEKELPHEVFDDIKSLRLKSQEKDESVMLEQEPR---------EDKRLKSIRRIH  277

Query  885   RALDSSDVELVKLMVM-GEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAG  1061
             RALDS DVELV L++   + + LD+A ALHYAV  C  ++VK +L LG ADVN    A  
Sbjct  278   RALDSDDVELVTLLLNESDSITLDDAHALHYAVAYCDPKIVKEVLGLGLADVNL-RNARE  336

Query  1062  RTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIE  1241
              T LH+AA    P ++  LL+  A     T+DG T + I R LT    +          E
Sbjct  337   HTVLHVAARRKEPSVIVHLLNKGASALETTSDGQTAVAICRRLTRPKDYNENTKQGE--E  394

Query  1242  PNKLRLCLELVQ  1277
              NK R+C++L++
Sbjct  395   SNKDRMCIDLLE  406



>gb|KDO44757.1| hypothetical protein CISIN_1g007550mg [Citrus sinensis]
Length=513

 Score =   166 bits (421),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 120/370 (32%), Positives = 198/370 (54%), Gaps = 30/370 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             ++D    VEG+ V  HRCIL+ARS FF + F   +     +                P+ 
Sbjct  65    YTDADIVVEGKSVAVHRCILSARSQFFHELFKKGNDNDGSAVSE-----------GKPKY  113

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++P   VGYE F +++ + Y+G++   P +      C +  C H  C  A++ A++
Sbjct  114   LMTELVPYGKVGYEAFNVILYYFYTGKLKPSPSE---VSTCVDDACAHDACPPAINYAIE  170

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F +++L LL Q++L + VEKA +EDV+ +L+A+   ++ QL + C   V +S 
Sbjct  171   LMYASAAFQMKELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSN  230

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    L K LP +V  +I+ LR KS     + +A     H          +++RR+ +AL
Sbjct  231   LDDVCLEKELPDEVSGEIKSLRVKSDEECEANIAEVDPMHA---------KRVRRIHKAL  281

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVEL+KL++    + LD+A ALHYA   C+ +V K +L +G AD+N    A G T L
Sbjct  282   DSDDVELLKLLLDESNVTLDDAYALHYAAAYCNPKVFKEVLNMGLADLNL-KNARGHTVL  340

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             H+AA    P ++  LL   A  +  T+DG T + I R +T   D++ +    G    E N
Sbjct  341   HVAARRKEPAVLVTLLSKGACASETTSDGQTAVAICRRMTRRKDYI-EATKQGQ---ETN  396

Query  1248  KLRLCLELVQ  1277
             K RLC+++++
Sbjct  397   KDRLCIDVLE  406



>ref|XP_009357280.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Pyrus x bretschneideri]
Length=580

 Score =   167 bits (423),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 126/374 (34%), Positives = 191/374 (51%), Gaps = 33/374 (9%)
 Frame = +3

Query  162   NGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaa  341
             +G  +SD   +VEG  V  HRCILA+RS FF + F        +    + G         
Sbjct  54    SGGDYSDAEITVEGVPVAVHRCILASRSEFFAELF-----RRENGDSEKEG---------  99

Query  342   SPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVD  521
              P+  +  ++P   VGYE FL+ + F+Y+ +V   P +     +C    C H  C  A++
Sbjct  100   KPKYCMSDLLPFGHVGYEAFLVFLSFVYTAKVRDFPVEVS---SCVHNVCGHEACRPAIE  156

Query  522   LALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLV  701
              AL+ + A+  FG+  L  + Q+QL   V KA  +DV+ +L+ +   ++ QL   C   V
Sbjct  157   FALELMCASSVFGMPDLVSILQRQLIDFVVKALADDVIPILVVAFHCQLSQLIDQCIERV  216

Query  702   AKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRM  881
             A S L    L K LP +VV KI+ LR           + H    ++ A   L +++IRR+
Sbjct  217   AHSDLDSISLEKTLPDEVVEKIKILRRN---------SQHCCDPNMPAVDPLREKRIRRI  267

Query  882   RRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAG  1061
              +ALDS DVEL+KL++    + LDEA ALHYA   C  +VV  +L LG ADVN    + G
Sbjct  268   HKALDSDDVELMKLLLTESDVTLDEANALHYAAAYCDPKVVAEVLGLGLADVNL-RDSRG  326

Query  1062  RTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAH  1235
              T LHIA     P ++ +LL + A  +  T +G + + I R LT   D+  K        
Sbjct  327   YTVLHIAMMRKEPSIIILLLSNGARASEPTLEGESAVSICRRLTRPKDYHTKTE----RG  382

Query  1236  IEPNKLRLCLELVQ  1277
              E NK R+C+++++
Sbjct  383   QEANKDRICIDVLE  396



>gb|KDO77445.1| hypothetical protein CISIN_1g007849mg [Citrus sinensis]
Length=501

 Score =   166 bits (419),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 117/368 (32%), Positives = 182/368 (49%), Gaps = 29/368 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  V  HRCILAARS FF + F               G V        P+ 
Sbjct  63    YSDAEIIVEGIPVCVHRCILAARSKFFYELF-----------KREKGSVDKEG---KPKY  108

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++P   VGYE FL+ + + YSG++   P +      C +  C H  C  A++ A++
Sbjct  109   PMSELLPYGKVGYEAFLIFLSYTYSGKLKPFPMEVS---TCVDNICVHDACRPAINFAVE  165

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+  F + +L  L Q++L + V KA  ED++ +L+A+   ++ QL   C   + +S 
Sbjct  166   MMYASSIFELPELVSLFQRRLLNFVGKAVAEDIIPILLAAFHCQLSQLLAQCVDRIVRSD  225

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP +V  +I  LR KS     +                  +++I+R+ +AL
Sbjct  226   LDTISIEKELPTEVAEEIRMLRLKSFPDDENTAVEVDPL---------REKRIKRIHKAL  276

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELV+L++    + LDEA ALHYA   C  +V+  +L LG ADVN    + G T L
Sbjct  277   DSDDVELVRLLLSESEITLDEANALHYAAAYCDPKVLSEVLSLGLADVNL-RSSRGYTVL  335

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKL  1253
             HI A    P ++  LL   A  +  T DG + + I R LT    ++         E NK 
Sbjct  336   HIGAMRKEPSVIVSLLTKGACASDLTLDGRSAVSICRRLTRPKDYQAKTE--QGKETNKD  393

Query  1254  RLCLELVQ  1277
             R+C+++++
Sbjct  394   RICIDVLE  401



>gb|KGN53513.1| hypothetical protein Csa_4G063470 [Cucumis sativus]
Length=358

 Score =   162 bits (411),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 101/310 (33%), Positives = 164/310 (53%), Gaps = 27/310 (9%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             ++D    VEG  V  HRCILAARS FF + F                 V +      P+ 
Sbjct  63    YTDAVIVVEGIEVGVHRCILAARSQFFHELFKQE--------------VDSSTEDGKPKY  108

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++    VG E F +++ +LY+G++   P +      C +  C H  C  A++ A++
Sbjct  109   CMSKLVAFRKVGIEAFKVILNYLYTGKLKPSPPE---VSTCVDEACAHDACGPAINYAVE  165

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F ++++ LL Q++L + VEKA++EDV+ +LIA+    + QL T C   VA+S 
Sbjct  166   LMYASATFKMKEMVLLVQRRLLNFVEKAAVEDVITLLIAAFHCHLDQLHTPCIQRVARSN  225

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    L + LP ++ ++I+ LR K                 +  A    ++KIRR+ +AL
Sbjct  226   LDAVSLGRELPDEIASEIKSLRMK--------SQQETEPDIVEEADLNREKKIRRLHKAL  277

Query  894   DSSDVELVKLMVM-GEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTP  1070
             DS DVEL+ L++     + L++A ALHYA   C  +V+K +L LG AD+N+     G+T 
Sbjct  278   DSDDVELLGLLLRESSDITLNDAYALHYATAYCDPKVIKEVLNLGLADLNHK-NLRGQTV  336

Query  1071  LHIAAEMVSP  1100
             LH+AA    P
Sbjct  337   LHVAARRKDP  346



>ref|XP_002307566.2| hypothetical protein POPTR_0005s22770g [Populus trichocarpa]
 gb|EEE94562.2| hypothetical protein POPTR_0005s22770g [Populus trichocarpa]
Length=586

 Score =   167 bits (422),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 117/373 (31%), Positives = 187/373 (50%), Gaps = 37/373 (10%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  V  HRCILAARS FF + F                +         PR 
Sbjct  63    YSDAEIVVEGIPVGVHRCILAARSQFFHELF--------------KKVDSNSTSGDKPRY  108

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRP----NCRERGCWHTHCTSAVD  521
              +  ++P   VGYE F + + +LY+G       KH+  P     C    C H  C  A++
Sbjct  109   LMSDLMPYGGVGYEAFNVFLHYLYTG-------KHKSSPPEVSQCVYDACAHDACRPAIN  161

Query  522   LALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLV  701
              A++ + A+ +F +++L LL Q++L S ++KA  EDV+ +++A+   ++ QL + C   +
Sbjct  162   YAVELMYASATFQMKELVLLFQRRLLSFIDKALDEDVIPIVMAAFHCQLDQLLSLCIERL  221

Query  702   AKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRM  881
              +S L    + K LP ++ +K++ LR KS     S +                ++++ R+
Sbjct  222   VRSDLDSVCIDKELPHEISSKVKLLRKKSLEEAESSVEEVDPM---------REKRMSRI  272

Query  882   RRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAG  1061
              +AL+S DVELV+L++      LD+A ALHYAV  C  +VVK +L LG AD+N    + G
Sbjct  273   HKALESDDVELVQLLLSESNFTLDDAYALHYAVSYCDPKVVKEVLALGLADLNL-RNSRG  331

Query  1062  RTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIE  1241
              T LH+AA      ++  LL   A  +  T DG   + I R+LT    +          E
Sbjct  332   YTVLHVAARRKESSILVALLAKGARASEITMDGRNAVSIWRSLTRPKDYNANTK--QGQE  389

Query  1242  PNKLRLCLELVQS  1280
              NK R+C+E++++
Sbjct  390   SNKDRICIEILET  402



>gb|AHF20180.1| ankyrin-repeat protein [Musa acuminata AAA Group]
Length=595

 Score =   167 bits (422),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 127/373 (34%), Positives = 190/373 (51%), Gaps = 34/373 (9%)
 Frame = +3

Query  177   SDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRGS  356
             +D   +VEG  V  HRCILAARS FFR  F             R G  G       PR  
Sbjct  73    TDAEIAVEGAPVGIHRCILAARSRFFRDLFS------------REG-SGGNRQEGKPRYV  119

Query  357   IPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDT  536
             + +++P   +G E F++ + +LY+G++   PQ       C +R C H  C  A+  A++ 
Sbjct  120   MNELVPGGRIGREAFMVFLSYLYTGKLRAAPQDVSI---CVDRFCAHDACRPAIGFAVEL  176

Query  537   LSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGL  716
             L A+  F + +L  L Q++L + V+KA +EDV+ +L  +   ++ QL + C   VA+S L
Sbjct  177   LYASSVFQIAELVSLLQRRLLNFVDKAMVEDVIPILQVASHSKLNQLLSHCVQRVARSDL  236

Query  717   PPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRALD  896
                 L K LP +V  +I  LR +S    S+                  +++I+R+ RALD
Sbjct  237   DDIALEKELPQEVAEEIRLLRRESQPKESTATVDPML-----------EKRIKRIHRALD  285

Query  897   SSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLH  1076
             S DVELVKL++   G+ LD+A ALHYA      +VV  LL+LG+A+VN      G TPLH
Sbjct  286   SDDVELVKLLLSESGVTLDDAYALHYAAAYSDSKVVAELLDLGSANVNL-KNDRGYTPLH  344

Query  1077  IAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPNK  1250
             +AA    P ++  LL   A     TADG   + I R LT   D+  +         E NK
Sbjct  345   LAAMRREPAVIVSLLTKGASALETTADGQNAVRICRRLTRAKDYFTRTE----QGQESNK  400

Query  1251  LRLCLELVQSAAM  1289
              ++C+++++   M
Sbjct  401   NKICIDILEREIM  413



>ref|XP_011032773.1| PREDICTED: regulatory protein NPR3-like [Populus euphratica]
Length=586

 Score =   167 bits (422),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 119/372 (32%), Positives = 187/372 (50%), Gaps = 37/372 (10%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  V  HRCILAARS FF + F              M + G       PR 
Sbjct  63    YSDAEIVVEGIPVGVHRCILAARSQFFHELF--------------MKVDGNSTSGDKPRY  108

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRP----NCRERGCWHTHCTSAVD  521
              +  ++P   VGYE F + + +LY+G       KH+  P     C    C H  C  A++
Sbjct  109   LMSDLMPYGGVGYEAFNVFLHYLYTG-------KHKSSPPEVSQCVYGACAHDACRPAIN  161

Query  522   LALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLV  701
              A++ + A+ +F +++L LL Q++L S ++KA  EDV+ + +A+   ++ QL + C   +
Sbjct  162   YAVELMYASATFQMKELVLLFQRRLLSFIDKALDEDVIPIAMAAFHCQLDQLLSHCIERL  221

Query  702   AKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRM  881
              +S L    + K LP ++ +K++ LR KS     S +                ++++ R+
Sbjct  222   VRSDLDSVCIDKELPHEISSKVKLLRKKSLEEAESSVEEEDPV---------REKRMSRI  272

Query  882   RRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAG  1061
              +AL+S DVELV+L++      LD+A ALHYAV  C  +VVK +L LG AD+N    + G
Sbjct  273   HKALESDDVELVRLLLSESNFTLDDAHALHYAVSYCDPKVVKEVLALGLADLNL-RNSRG  331

Query  1062  RTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIE  1241
              T LH+AA      ++  LL   A  +  T DG   + I R+LT    +          E
Sbjct  332   YTVLHVAARRKESSILVALLAKGARASETTMDGRNAVSIWRSLTRPKDYNANTK--QGQE  389

Query  1242  PNKLRLCLELVQ  1277
              NK R+C+E+++
Sbjct  390   SNKDRICIEILE  401



>ref|XP_008371834.1| PREDICTED: regulatory protein NPR3 isoform X1 [Malus domestica]
Length=580

 Score =   166 bits (421),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 123/374 (33%), Positives = 187/374 (50%), Gaps = 33/374 (9%)
 Frame = +3

Query  162   NGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaa  341
             +G  +SD   +VEG  V  HRCILA+RS FF + F        +    + G         
Sbjct  54    SGGDYSDAEITVEGVPVAVHRCILASRSEFFAELF-----RRENGDSEQEG---------  99

Query  342   SPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVD  521
              P+  +  ++P   VGYE FL+ + F+Y+ +V   P +     +C    C H  C  A++
Sbjct  100   KPKYCMSDLLPFGHVGYEAFLVFLSFVYTAKVRDFPVEVS---SCVHNVCGHEACRPAIE  156

Query  522   LALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLV  701
              +L+ + A+  FG+  L  + Q+QL   V KA  +DV+ +L+ +   ++ QL   C   V
Sbjct  157   FSLELMCASSVFGMPDLVSILQRQLIDFVLKALADDVIPILVVAFHCQLSQLIDQCIERV  216

Query  702   AKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRM  881
             A S L    L K LP +VV KI+ LR  S       +                +++IRR+
Sbjct  217   AHSDLDSISLEKALPDEVVEKIKILRRNSQHCCDPNMPAVDPL---------REKRIRRI  267

Query  882   RRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAG  1061
              +ALDS DVEL+KL++    + LDEA ALHYA   C  +VV  +L LG ADVN    + G
Sbjct  268   HKALDSDDVELMKLLLTESDVTLDEANALHYAAAYCDPKVVAEVLGLGLADVNL-RDSRG  326

Query  1062  RTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAH  1235
              T LHIA     P ++ +LL + A  +  T +G + + I R LT   D+  K        
Sbjct  327   YTVLHIAVXRKEPSIIILLLSNGARASEPTLEGESAVSICRRLTRQKDYHTKTE----RG  382

Query  1236  IEPNKLRLCLELVQ  1277
              E NK R+C+++++
Sbjct  383   QEANKDRICIDVLE  396



>gb|KDO77446.1| hypothetical protein CISIN_1g007849mg [Citrus sinensis]
Length=532

 Score =   166 bits (419),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 117/368 (32%), Positives = 182/368 (49%), Gaps = 29/368 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  V  HRCILAARS FF + F               G V        P+ 
Sbjct  63    YSDAEIIVEGIPVCVHRCILAARSKFFYELF-----------KREKGSVDKEG---KPKY  108

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++P   VGYE FL+ + + YSG++   P +      C +  C H  C  A++ A++
Sbjct  109   PMSELLPYGKVGYEAFLIFLSYTYSGKLKPFPMEVS---TCVDNICVHDACRPAINFAVE  165

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+  F + +L  L Q++L + V KA  ED++ +L+A+   ++ QL   C   + +S 
Sbjct  166   MMYASSIFELPELVSLFQRRLLNFVGKAVAEDIIPILLAAFHCQLSQLLAQCVDRIVRSD  225

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP +V  +I  LR KS     +                  +++I+R+ +AL
Sbjct  226   LDTISIEKELPTEVAEEIRMLRLKSFPDDENTAVEVDPL---------REKRIKRIHKAL  276

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELV+L++    + LDEA ALHYA   C  +V+  +L LG ADVN    + G T L
Sbjct  277   DSDDVELVRLLLSESEITLDEANALHYAAAYCDPKVLSEVLSLGLADVNL-RSSRGYTVL  335

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKL  1253
             HI A    P ++  LL   A  +  T DG + + I R LT    ++         E NK 
Sbjct  336   HIGAMRKEPSVIVSLLTKGACASDLTLDGRSAVSICRRLTRPKDYQAKTE--QGKETNKD  393

Query  1254  RLCLELVQ  1277
             R+C+++++
Sbjct  394   RICIDVLE  401



>gb|KEH37013.1| regulatory protein NPR1 [Medicago truncatula]
Length=509

 Score =   165 bits (418),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 119/370 (32%), Positives = 183/370 (49%), Gaps = 31/370 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             + D    VEG  V  HRCIL +RS FF + F      G      R+            + 
Sbjct  63    YGDADIIVEGIPVRIHRCILGSRSKFFHEIFKRSKDKGLSKNEGRL------------KY  110

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              +  ++P   VGYE FL+ + ++YSG++   P +      C +  C H  C  A++ A++
Sbjct  111   CLSDLLPYGKVGYEAFLIFLSYVYSGKLKPSPME---VSTCVDNVCAHDACGPAINFAVE  167

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+  F + +L  L Q++L + V KA +EDV+ +L+AS   ++ QL   C   VA+S 
Sbjct  168   LMYASSIFQIPELVSLFQRRLLNFVGKALVEDVISILMASFHCQLNQLAAQCVDRVARSD  227

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP ++  K++ LR        +                   ++I R+ +AL
Sbjct  228   LDQISIEKELPHELSEKVKLLRRDLHQNDENDAPVVDTLSL---------KRITRIHKAL  278

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELVKL++    + LDEA ALHYAV +C  +VV  +L LG A+VN    + G T L
Sbjct  279   DSDDVELVKLLLNESDITLDEAGALHYAVAHCDPKVVSEVLGLGLANVNL-RNSRGYTVL  337

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             HIAA    P ++  LL   A  +  T DG + + I R LT   D+  K         E N
Sbjct  338   HIAAMRKEPSIIVSLLTKGACASDLTFDGQSAVSICRRLTRPKDYHTKTE----QGKETN  393

Query  1248  KLRLCLELVQ  1277
             K R+C+++++
Sbjct  394   KDRICIDVLE  403



>gb|AGL61506.1| NPR1 [Morus alba var. multicaulis]
Length=581

 Score =   166 bits (420),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 119/368 (32%), Positives = 185/368 (50%), Gaps = 28/368 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  V  HRCILAARS FF   F             +     +  G   P+ 
Sbjct  56    YSDADVIVEGTHVGVHRCILAARSGFFHDLF-------------KKDKGISEKGGGKPKY  102

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              +  ++P  SVGYE FL+++ ++Y+G++   P +      C +  C H  C  A++ A++
Sbjct  103   CLKDLLPYGSVGYEAFLVLLSYVYTGKLKPSPMEVS---TCVDNICAHDSCRPAINFAVE  159

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+  F + +L    Q++L + V KA +EDV+ +L  +   ++ QL+  C   VA+S 
Sbjct  160   LMYASSIFQMPELVSQFQRRLLNFVGKALVEDVIPILGVAFHCQLSQLFAECVDRVARSD  219

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    L K LP +V   I+ LR KS                        +++IRR+ +AL
Sbjct  220   LEIVSLEKELPHEVAENIKVLRRKSPCGDKDNTESADPL---------REKRIRRIHKAL  270

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELV+L++    + LD+A ALHYA   C  +VV  +L LG ADVN    + G T L
Sbjct  271   DSDDVELVELLLTESEITLDDANALHYAAAYCDPKVVTEVLGLGLADVNL-QNSRGYTVL  329

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKL  1253
             H+AA    P ++  LL   A  +  T+DG + + I R LT    +   +      E NK 
Sbjct  330   HVAAMRKVPSIIVSLLTKGAYASDLTSDGQSAVSICRRLTRPKDYHAKME--QGQETNKD  387

Query  1254  RLCLELVQ  1277
             R+C+++++
Sbjct  388   RICIDVLE  395



>gb|ABA38910.1| NPR1-like protein, partial [Prunus avium]
Length=336

 Score =   161 bits (407),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 118/363 (33%), Positives = 185/363 (51%), Gaps = 33/363 (9%)
 Frame = +3

Query  195   VEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRGSIPQVIP  374
             VEG+ V  +RCILA+RS FF + F       ++    + G          P+  +  ++P
Sbjct  3     VEGKSVGVYRCILASRSSFFGELF-----KRANGSSEKEG---------KPKYCMSDLLP  48

Query  375   VNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDTLSAARS  554
               +VGYE FL+ + ++Y+G++   P +      C    C H  C  A++ A++ + A+  
Sbjct  49    YGNVGYEAFLVFLSYVYTGKLKPFPTEVS---TCVYSVCAHDACGPAINFAVELMYASSV  105

Query  555   FGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGLPPEVLA  734
             F +  L  + Q++L + V KA  +DV+ +L+     ++ QL   C   VA+S L    L 
Sbjct  106   FQMPDLVSILQRRLINFVGKALADDVIPILVVGFHCKLSQLIDQCIERVARSDLDSISLE  165

Query  735   KHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRALDSSDVEL  914
             K LP +VV KI+ +RH S     S +A               +++IRR+ +ALDS DVEL
Sbjct  166   KELPDEVVEKIKIIRHNSQQDCDSNIAAVDPL---------REKRIRRIHKALDSDDVEL  216

Query  915   VKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLHIAAEMV  1094
             VKL++    + LDEA ALHYA   C  +VV  ++ LG  DVN    + G T LHIA    
Sbjct  217   VKLLLSESDITLDEANALHYAAAYCDPKVVTEVIGLGLVDVNL-RNSRGYTVLHIAVMRK  275

Query  1095  SPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPNKLRLCLE  1268
              P ++ +LL   A  +  T DG + + I R LT   D+  K         E NK R+C++
Sbjct  276   EPSIIVLLLTKGARVSELTLDGESAVSICRRLTRAKDYHSKTE----RGEEANKDRICID  331

Query  1269  LVQ  1277
             +++
Sbjct  332   VLE  334



>ref|XP_009341186.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Pyrus x bretschneideri]
Length=580

 Score =   166 bits (419),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 123/374 (33%), Positives = 186/374 (50%), Gaps = 33/374 (9%)
 Frame = +3

Query  162   NGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaa  341
             +G  +SD   +VEG  V  HRCILA+RS FF + F        +    + G         
Sbjct  54    SGGDYSDAEITVEGVPVAVHRCILASRSEFFAELF-----RRENGDSEKEG---------  99

Query  342   SPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVD  521
              P+  +  ++P   VGYE FL+ + F+Y+ +V   P +     +C    C H  C  A++
Sbjct  100   KPKYCMSDLLPFGHVGYEAFLVFLSFVYTAKVRDFPVEVS---SCVHNVCGHEACRPAIE  156

Query  522   LALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLV  701
              AL+ + A+  FG+  L  + Q+QL   V KA  +DV+ +L+ +   ++ QL   C   V
Sbjct  157   FALELMCASSVFGMPDLVSILQRQLIDFVVKALADDVIPILVVAFHCQLSQLIDQCIERV  216

Query  702   AKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRM  881
             A S L    L K LP +V  KI+ LR  S       +                +++IRR+
Sbjct  217   AHSDLDSISLEKTLPDEVAEKIKILRRNSQHCCDPNMPAVDPL---------REKRIRRI  267

Query  882   RRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAG  1061
              +ALDS DVEL+KL++    + LDEA ALHYA   C  +VV  +L LG ADVN    + G
Sbjct  268   HKALDSDDVELMKLLLTESDVTLDEANALHYAAAYCDPKVVAEVLGLGLADVNL-RDSRG  326

Query  1062  RTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAH  1235
              T LHIA     P ++ +LL + A  +  T +G + + I R LT   D+  K        
Sbjct  327   YTVLHIAMMRKEPSIIILLLSNGARASEPTLEGESAVSICRRLTRPKDYHTKTE----RG  382

Query  1236  IEPNKLRLCLELVQ  1277
              E NK R+C+++++
Sbjct  383   QEANKDRICIDVLE  396



>gb|KDO44755.1| hypothetical protein CISIN_1g007550mg [Citrus sinensis]
Length=599

 Score =   166 bits (419),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 120/370 (32%), Positives = 198/370 (54%), Gaps = 30/370 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             ++D    VEG+ V  HRCIL+ARS FF + F   +     +                P+ 
Sbjct  65    YTDADIVVEGKSVAVHRCILSARSQFFHELFKKGNDNDGSAVSE-----------GKPKY  113

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++P   VGYE F +++ + Y+G++   P +      C +  C H  C  A++ A++
Sbjct  114   LMTELVPYGKVGYEAFNVILYYFYTGKLKPSPSE---VSTCVDDACAHDACPPAINYAIE  170

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F +++L LL Q++L + VEKA +EDV+ +L+A+   ++ QL + C   V +S 
Sbjct  171   LMYASAAFQMKELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSN  230

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    L K LP +V  +I+ LR KS     + +A     H          +++RR+ +AL
Sbjct  231   LDDVCLEKELPDEVSGEIKSLRVKSDEECEANIAEVDPMHA---------KRVRRIHKAL  281

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVEL+KL++    + LD+A ALHYA   C+ +V K +L +G AD+N    A G T L
Sbjct  282   DSDDVELLKLLLDESNVTLDDAYALHYAAAYCNPKVFKEVLNMGLADLNL-KNARGHTVL  340

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             H+AA    P ++  LL   A  +  T+DG T + I R +T   D++ +    G    E N
Sbjct  341   HVAARRKEPAVLVTLLSKGACASETTSDGQTAVAICRRMTRRKDYI-EATKQGQ---ETN  396

Query  1248  KLRLCLELVQ  1277
             K RLC+++++
Sbjct  397   KDRLCIDVLE  406



>gb|KDO44756.1| hypothetical protein CISIN_1g007550mg [Citrus sinensis]
Length=595

 Score =   166 bits (419),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 120/370 (32%), Positives = 198/370 (54%), Gaps = 30/370 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             ++D    VEG+ V  HRCIL+ARS FF + F   +     +                P+ 
Sbjct  65    YTDADIVVEGKSVAVHRCILSARSQFFHELFKKGNDNDGSAVSE-----------GKPKY  113

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++P   VGYE F +++ + Y+G++   P +      C +  C H  C  A++ A++
Sbjct  114   LMTELVPYGKVGYEAFNVILYYFYTGKLKPSPSE---VSTCVDDACAHDACPPAINYAIE  170

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+ +F +++L LL Q++L + VEKA +EDV+ +L+A+   ++ QL + C   V +S 
Sbjct  171   LMYASAAFQMKELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSN  230

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    L K LP +V  +I+ LR KS     + +A     H          +++RR+ +AL
Sbjct  231   LDDVCLEKELPDEVSGEIKSLRVKSDEECEANIAEVDPMHA---------KRVRRIHKAL  281

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVEL+KL++    + LD+A ALHYA   C+ +V K +L +G AD+N    A G T L
Sbjct  282   DSDDVELLKLLLDESNVTLDDAYALHYAAAYCNPKVFKEVLNMGLADLNL-KNARGHTVL  340

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             H+AA    P ++  LL   A  +  T+DG T + I R +T   D++ +    G    E N
Sbjct  341   HVAARRKEPAVLVTLLSKGACASETTSDGQTAVAICRRMTRRKDYI-EATKQGQ---ETN  396

Query  1248  KLRLCLELVQ  1277
             K RLC+++++
Sbjct  397   KDRLCIDVLE  406



>ref|XP_010272311.1| PREDICTED: regulatory protein NPR3 isoform X1 [Nelumbo nucifera]
Length=571

 Score =   165 bits (418),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 123/373 (33%), Positives = 186/373 (50%), Gaps = 35/373 (9%)
 Frame = +3

Query  165   GQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaS  344
             G  +SD    VEG  V  HRCILAARS FF + F                          
Sbjct  60    GLDYSDAEVIVEGNTVGVHRCILAARSRFFHELFTKTKGSPQKEG--------------K  105

Query  345   PRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDL  524
             P+ ++  ++P   VGYE F + + +LY+G++   P +      C +  C H  C  A++ 
Sbjct  106   PQYNMTDLVPYGKVGYEAFTIFLSYLYTGKLKPSPAEVS---TCVDSSCAHDACRPAINF  162

Query  525   ALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVA  704
              ++ +  +  F + +L  L Q++L   VEKA  EDV+ +L+ +   ++  L   C   +A
Sbjct  163   IVELMYTSAHFQITELVSLFQRRLLIFVEKAFAEDVIPILMVAFHCQLNHLIDHCVQRIA  222

Query  705   KSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMR  884
             +S L    L K LP +V   I+ LR KS L  +S +                ++ IRR+ 
Sbjct  223   RSDLDSISLEK-LPNEVKMDIKSLRLKSHLDEASAMDVDPV----------REKNIRRIH  271

Query  885   RALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGR  1064
             +ALDS DVELVKL++   G+ LD+A ALHYA   C  +VV  +L+LG A+ N    A G 
Sbjct  272   KALDSDDVELVKLLLNESGVTLDDANALHYAAAYCDPKVVAEVLDLGLANANL-RDARGY  330

Query  1065  TPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHI  1238
             T LH+AA    P ++  LL+  A     T+DG + + I R LT   D+  K  I G    
Sbjct  331   TVLHVAAMRKEPSIIVRLLNKGASALELTSDGQSAVRICRRLTRPKDYNAK-TIQGQ---  386

Query  1239  EPNKLRLCLELVQ  1277
             E NK R+C+++++
Sbjct  387   ETNKDRICIDILE  399



>ref|XP_010272312.1| PREDICTED: regulatory protein NPR3 isoform X2 [Nelumbo nucifera]
Length=570

 Score =   165 bits (418),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 123/373 (33%), Positives = 186/373 (50%), Gaps = 35/373 (9%)
 Frame = +3

Query  165   GQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaS  344
             G  +SD    VEG  V  HRCILAARS FF + F                          
Sbjct  60    GLDYSDAEVIVEGNTVGVHRCILAARSRFFHELFTKTKGSPQKEG--------------K  105

Query  345   PRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDL  524
             P+ ++  ++P   VGYE F + + +LY+G++   P +      C +  C H  C  A++ 
Sbjct  106   PQYNMTDLVPYGKVGYEAFTIFLSYLYTGKLKPSPAEVS---TCVDSSCAHDACRPAINF  162

Query  525   ALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVA  704
              ++ +  +  F + +L  L Q++L   VEKA  EDV+ +L+ +   ++  L   C   +A
Sbjct  163   IVELMYTSAHFQITELVSLFQRRLLIFVEKAFAEDVIPILMVAFHCQLNHLIDHCVQRIA  222

Query  705   KSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMR  884
             +S L    L K LP +V   I+ LR KS L  +S +                ++ IRR+ 
Sbjct  223   RSDLDSISLEK-LPNEVKMDIKSLRLKSHLDEASAMDVDPV----------REKNIRRIH  271

Query  885   RALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGR  1064
             +ALDS DVELVKL++   G+ LD+A ALHYA   C  +VV  +L+LG A+ N    A G 
Sbjct  272   KALDSDDVELVKLLLNESGVTLDDANALHYAAAYCDPKVVAEVLDLGLANANL-RDARGY  330

Query  1065  TPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHI  1238
             T LH+AA    P ++  LL+  A     T+DG + + I R LT   D+  K  I G    
Sbjct  331   TVLHVAAMRKEPSIIVRLLNKGASALELTSDGQSAVRICRRLTRPKDYNAK-TIQGQ---  386

Query  1239  EPNKLRLCLELVQ  1277
             E NK R+C+++++
Sbjct  387   ETNKDRICIDILE  399



>ref|XP_006468441.1| PREDICTED: regulatory protein NPR3-like [Citrus sinensis]
Length=587

 Score =   165 bits (418),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 117/368 (32%), Positives = 183/368 (50%), Gaps = 29/368 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  V  HRCILAARS FF + F               G V        P+ 
Sbjct  63    YSDAEIIVEGIPVCVHRCILAARSKFFYELF-----------KREKGSVDKEG---KPKY  108

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++P   VGYE FL+ + + YSG++   P +      C +  C H  C  A++ A++
Sbjct  109   PMSELLPYGKVGYEAFLIFLSYTYSGKLKPFPMEVS---TCVDNICVHDACRPAINFAVE  165

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+  F + +L  L Q++L + V KA  ED++ +L+A+   ++ QL   C   + +S 
Sbjct  166   MMYASSIFELPELVSLFQRRLLNFVGKAVAEDIIPILLAAFHCQLSQLLAQCVDRIVRSD  225

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP +V  +I  LR KS     +                  +++I+R+ +AL
Sbjct  226   LDTISIQKELPTEVAEEIRMLRLKSFPDDENTAVEVDPL---------REKRIKRIHKAL  276

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELV+L++    + LDEA ALHYA   C  +V+  +L LG ADVN  + + G T L
Sbjct  277   DSDDVELVRLLLSESEITLDEANALHYAAAYCDPKVLSEVLSLGLADVNLRS-SRGYTVL  335

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKL  1253
             HI A    P ++  LL   A  +  T DG + + I R LT    ++         E NK 
Sbjct  336   HIGAMRKEPSVIVSLLTKGACASDLTLDGRSAVSICRRLTRPKDYQAKTE--QGKETNKD  393

Query  1254  RLCLELVQ  1277
             R+C+++++
Sbjct  394   RICIDVLE  401



>ref|XP_002274045.1| PREDICTED: regulatory protein NPR3 isoform X1 [Vitis vinifera]
Length=587

 Score =   165 bits (418),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 126/372 (34%), Positives = 185/372 (50%), Gaps = 29/372 (8%)
 Frame = +3

Query  162   NGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaa  341
             +G  +SD    VEG  V  HRCILAARS FF   F         S   + G         
Sbjct  59    SGCDYSDAEIIVEGIPVGVHRCILAARSRFFYDLF-----KREKSSSEKDG---------  104

Query  342   SPRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVD  521
              PR  +   +P   VGYE FL+ + +LY+G++   P +      C + GC H  C  A+D
Sbjct  105   KPRYCMSDFLPYGKVGYEAFLIFLSYLYTGKLKASPLEVS---TCVDTGCAHDACRPAID  161

Query  522   LALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLV  701
              +++ + A+  F V +L  L Q++L + + KA +EDV+ +L+ +   +   L   C   V
Sbjct  162   FSVELMYASAIFQVPELVSLFQRRLTNFIGKALLEDVIPILVVAYHCKSSVLVNQCVDRV  221

Query  702   AKSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRM  881
             A+S L    L K LP +V   I+ LR KS                        ++++RR+
Sbjct  222   ARSDLDSISLEKDLPYEVAESIKLLRLKSQPDDECNTVPVDPV---------HEKRVRRI  272

Query  882   RRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAG  1061
              +ALDS DVELVKL++   G+ LDEA ALHYA   C  +VV  +L LG ADVN      G
Sbjct  273   LKALDSDDVELVKLLLSESGITLDEAYALHYAAAYCDPKVVSEVLSLGLADVNR-HNPRG  331

Query  1062  RTPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIE  1241
              T LH+AA    P ++  LL   A  + RT+DG + + I R LT    +   +      E
Sbjct  332   YTVLHVAAMRKEPSIIVSLLTKGAHASERTSDGQSAVSICRRLTRPKDYHAKME--QGQE  389

Query  1242  PNKLRLCLELVQ  1277
              NK R+C+++++
Sbjct  390   TNKDRICIDVLE  401



>gb|KDO77444.1| hypothetical protein CISIN_1g007849mg [Citrus sinensis]
Length=587

 Score =   165 bits (418),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 117/368 (32%), Positives = 183/368 (50%), Gaps = 29/368 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  V  HRCILAARS FF + F               G V        P+ 
Sbjct  63    YSDAEIIVEGIPVCVHRCILAARSKFFYELF-----------KREKGSVDKEG---KPKY  108

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++P   VGYE FL+ + + YSG++   P +      C +  C H  C  A++ A++
Sbjct  109   PMSELLPYGKVGYEAFLIFLSYTYSGKLKPFPMEVS---TCVDNICVHDACRPAINFAVE  165

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+  F + +L  L Q++L + V KA  ED++ +L+A+   ++ QL   C   + +S 
Sbjct  166   MMYASSIFELPELVSLFQRRLLNFVGKAVAEDIIPILLAAFHCQLSQLLAQCVDRIVRSD  225

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP +V  +I  LR KS     +                  +++I+R+ +AL
Sbjct  226   LDTISIEKELPTEVAEEIRMLRLKSFPDDENTAVEVDPL---------REKRIKRIHKAL  276

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELV+L++    + LDEA ALHYA   C  +V+  +L LG ADVN  + + G T L
Sbjct  277   DSDDVELVRLLLSESEITLDEANALHYAAAYCDPKVLSEVLSLGLADVNLRS-SRGYTVL  335

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKL  1253
             HI A    P ++  LL   A  +  T DG + + I R LT    ++         E NK 
Sbjct  336   HIGAMRKEPSVIVSLLTKGACASDLTLDGRSAVSICRRLTRPKDYQAKTE--QGKETNKD  393

Query  1254  RLCLELVQ  1277
             R+C+++++
Sbjct  394   RICIDVLE  401



>ref|XP_004486433.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Cicer arietinum]
Length=595

 Score =   165 bits (418),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 120/369 (33%), Positives = 186/369 (50%), Gaps = 28/369 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG LV  HRC+LA+RS FF + F      GS     ++            + 
Sbjct  64    YSDAEIVVEGILVRVHRCVLASRSKFFHELFKRGKDKGSSKNEGKL------------KY  111

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              +  ++P   VGYE F++ + ++YSG++   P +      C +  C H  C  A++ A++
Sbjct  112   CLSDLLPYGKVGYEAFIIFLSYVYSGKLKPSPME---VSTCVDNVCAHDACGPAINFAVE  168

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+  F + +L  L Q++L + V KA +EDV+ +L+ +   ++ QL   C   VA+S 
Sbjct  169   VMYASSIFQIPELVSLFQRRLLNFVGKALVEDVIPILMVAFHCQLSQLVALCVDRVARSD  228

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP ++  K++ LR       S   A       L        ++I R+ +AL
Sbjct  229   LNQISIEKELPCELSEKVKLLRRDLQQQDSENYAPVVDALSL--------KRITRIHKAL  280

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELVKL++    + LDEA ALHYA   C  +VV  +L LG A+VN    + G T L
Sbjct  281   DSDDVELVKLLLNESDITLDEAGALHYAAAYCDPKVVSEVLGLGMANVNL-RNSRGYTVL  339

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAH-IEPNK  1250
             H+AA    P ++  LL + A  +  T DG + + I R LT     K   P      E NK
Sbjct  340   HVAAMRKEPSIIVSLLTNGACASDLTFDGQSAVSICRRLTRP---KDYHPKTEQGKETNK  396

Query  1251  LRLCLELVQ  1277
              R+C++++Q
Sbjct  397   DRICIDVLQ  405



>ref|XP_009602190.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
Length=580

 Score =   165 bits (418),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 123/368 (33%), Positives = 182/368 (49%), Gaps = 30/368 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             FSD    VEG  +  HRCILAARS FF+  F             + G          PR 
Sbjct  65    FSDAEIVVEGVSLGVHRCILAARSKFFQDLF-----RKEKGSCGKEG---------KPRY  110

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
             S+  ++P   VGYE FL  + +LYSG++   P +      C +  C H  C  A+  +++
Sbjct  111   SMADILPYGKVGYEAFLTFLSYLYSGKLKHFPPE---VSTCTDTICAHDSCRPAISFSVE  167

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+  F V +L  L  ++L + V KA +EDV+ +L  +   ++ +L T C   VA+S 
Sbjct  168   LMYASSVFQVPELVSLFLRRLINFVGKALVEDVIPILRVAFHCQLSELLTHCVDRVARSD  227

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K +P +V   I+ LR K  +  S +L                +++  R+ +AL
Sbjct  228   LEIICIEKEVPFEVAESIKLLRPKCQVDESKVLPVDPL----------HEKRKNRIYKAL  277

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELVKL++    ++LDEA ALHYAV  C  +VV  +L LG ADVN      G T L
Sbjct  278   DSDDVELVKLLLNESEISLDEAYALHYAVAYCDPKVVTEVLGLGVADVNL-RNTRGYTVL  336

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEPNKL  1253
             HIAA    P ++  LL   A  +  T DG + + I R LT    +          E NK 
Sbjct  337   HIAAMRKEPAIIVSLLTKGAHVSEITLDGQSAVSICRRLTRPKEYHAKTE--QGQEANKD  394

Query  1254  RLCLELVQ  1277
             R+C+++++
Sbjct  395   RVCIDVLE  402



>ref|XP_004486434.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Cicer arietinum]
Length=591

 Score =   165 bits (418),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 120/369 (33%), Positives = 186/369 (50%), Gaps = 28/369 (8%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG LV  HRC+LA+RS FF + F      GS     ++            + 
Sbjct  64    YSDAEIVVEGILVRVHRCVLASRSKFFHELFKRGKDKGSSKNEGKL------------KY  111

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              +  ++P   VGYE F++ + ++YSG++   P +      C +  C H  C  A++ A++
Sbjct  112   CLSDLLPYGKVGYEAFIIFLSYVYSGKLKPSPME---VSTCVDNVCAHDACGPAINFAVE  168

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+  F + +L  L Q++L + V KA +EDV+ +L+ +   ++ QL   C   VA+S 
Sbjct  169   VMYASSIFQIPELVSLFQRRLLNFVGKALVEDVIPILMVAFHCQLSQLVALCVDRVARSD  228

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP ++  K++ LR       S   A       L        ++I R+ +AL
Sbjct  229   LNQISIEKELPCELSEKVKLLRRDLQQQDSENYAPVVDALSL--------KRITRIHKAL  280

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELVKL++    + LDEA ALHYA   C  +VV  +L LG A+VN    + G T L
Sbjct  281   DSDDVELVKLLLNESDITLDEAGALHYAAAYCDPKVVSEVLGLGMANVNL-RNSRGYTVL  339

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAH-IEPNK  1250
             H+AA    P ++  LL + A  +  T DG + + I R LT     K   P      E NK
Sbjct  340   HVAAMRKEPSIIVSLLTNGACASDLTFDGQSAVSICRRLTRP---KDYHPKTEQGKETNK  396

Query  1251  LRLCLELVQ  1277
              R+C++++Q
Sbjct  397   DRICIDVLQ  405



>emb|CDP17620.1| unnamed protein product [Coffea canephora]
Length=588

 Score =   165 bits (417),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 116/371 (31%), Positives = 186/371 (50%), Gaps = 29/371 (8%)
 Frame = +3

Query  165   GQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaS  344
             G  +SD    VE   +  HRCI+AARS FF   F               G    G+    
Sbjct  61    GCDYSDAEIEVEAISIGIHRCIVAARSKFFHDLF-----------RKEKGY---GSKDDK  106

Query  345   PRGSIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDL  524
             P+ ++ +++P   V YE FL+ + +LY+G++   P +      C +  C H  C  A+D 
Sbjct  107   PKYTMEELLPYGKVRYEAFLIFLGYLYTGKLKPFPVEA---STCVDGMCAHDACRPAIDF  163

Query  525   ALDTLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVA  704
             A++ + A+  F + +L  L Q++L + + KA +EDV+ +L+A+   +  QL + C   V+
Sbjct  164   AVELMYASSIFQIPELVSLFQRRLLNFIGKAFVEDVIPILVAAYYCQSNQLLSQCIDRVS  223

Query  705   KSGLPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMR  884
             +S +    L K +P ++   I+  R KS       +    H           +++IRR+ 
Sbjct  224   RSDIESISLEKEIPCEIAENIKSCRLKSDAGEKDNVVLVDHL---------HEKRIRRIH  274

Query  885   RALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGR  1064
             +ALDS D+ELV+L++    + LDEA ALHYAV  C  ++V  LL L  ADVN    A G 
Sbjct  275   KALDSDDIELVRLLLTESDVTLDEAYALHYAVAYCDPKIVSELLGLSLADVNL-QNARGY  333

Query  1065  TPLHIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLTSDFLFKGAIPGLAHIEP  1244
             + LHIAA    P ++  LL   A  +  T DG T + I R LT    +   I      E 
Sbjct  334   SVLHIAAMRKEPSIIVSLLTKGACVSETTLDGRTAVSICRRLTRPKDYHAKIN--LERES  391

Query  1245  NKLRLCLELVQ  1277
             +K ++C+++++
Sbjct  392   SKDKICIDVLE  402



>ref|XP_009133120.1| PREDICTED: regulatory protein NPR4 [Brassica rapa]
Length=588

 Score =   165 bits (417),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 115/369 (31%), Positives = 182/369 (49%), Gaps = 38/369 (10%)
 Frame = +3

Query  177   SDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRGS  356
             +D+TF  E R V  HRC+LAARS FF   F        +                 P+  
Sbjct  62    ADITFEGESRAVGVHRCLLAARSKFFLDLFKKDRGSEEEKK--------------KPKYH  107

Query  357   IPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALDT  536
             I  ++P   VG E FL  + ++Y+G++   P +      C + GC H  C  A+D A++ 
Sbjct  108   IKDLLPNGHVGREAFLHFLNYIYTGKLKPFPVEVS---TCVDTGCVHDSCKPAIDFAVEL  164

Query  537   LSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSGL  716
             + A+ +F + +L    Q++L + VEK+ +E+V+ +L+ +   ++ QL   C   VA+S L
Sbjct  165   MYASYTFKITELVSSFQRRLCNYVEKSLVENVLAILLVAFHCDLTQLLDQCIERVARSDL  224

Query  717   PPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRALD  896
                 + K LP++V  KI++LR KS                         ++  ++ +ALD
Sbjct  225   DRFYIEKELPLEVSEKIKKLRVKSMNTDEVADKLI--------------ERTGKVLKALD  270

Query  897   SSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPLH  1076
             S DVELVKL++      LD+A  LHY V     +VV  +L L  ADVNY   + G T LH
Sbjct  271   SDDVELVKLLLTESDTTLDQANGLHYVVAYSDPKVVAEVLALDMADVNY-RNSRGYTVLH  329

Query  1077  IAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPNK  1250
              AA    P ++  LL   A+ +  T DG + ++I R +T   D+  K A       E +K
Sbjct  330   YAAMRREPSIIISLLKKGANASDFTFDGRSAVNICRRMTRPKDYYTKNA----KGDEASK  385

Query  1251  LRLCLELVQ  1277
              RLC+++++
Sbjct  386   DRLCIDILE  394



>ref|XP_011001309.1| PREDICTED: regulatory protein NPR3-like [Populus euphratica]
Length=587

 Score =   164 bits (416),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 119/370 (32%), Positives = 184/370 (50%), Gaps = 33/370 (9%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  V  HRCILA+RS FF + F             + G          P+ 
Sbjct  63    YSDADIVVEGIAVGVHRCILASRSKFFHELF-----RREKGSLEKDG---------KPKY  108

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++P  +VGYE FL+ + +LY+G++   P +      C +  C H  C  A+  A++
Sbjct  109   CMSELLPYGNVGYEAFLIFLSYLYTGKLKPSPME---VSTCVDNVCAHDACRPAITFAVE  165

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
              + A+  F V +L  L Q++L + V KA  EDV+ +L+ +   +  QL   C   +A S 
Sbjct  166   LMYASSIFQVPELVSLFQRRLLNFVRKALAEDVIPILVVAFHCQSSQLIAQCVDRIAVSN  225

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP +V  KI++LR K      +      H           +++I+R+  AL
Sbjct  226   LENISIEKELPHEVADKIKQLRRKPISDDENNTEAGDHL---------REKRIKRIHMAL  276

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELVKL++    ++LD+A ALHY    C  +V+  +L LG A+VN    + G T L
Sbjct  277   DSDDVELVKLLLTESDISLDDANALHYCASYCDLKVMSEVLSLGLANVNL-RNSRGYTVL  335

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             HIAA    P ++  LL   A     T+DG + + + R LT   D+  K         E N
Sbjct  336   HIAAMRKEPSLIVSLLAKGASALDLTSDGQSAVSLCRRLTRPKDYHAKTE----QGQEAN  391

Query  1248  KLRLCLELVQ  1277
             K RLC+++++
Sbjct  392   KDRLCIDILE  401



>ref|XP_006376994.1| hypothetical protein POPTR_0012s11900g [Populus trichocarpa]
 gb|ERP54791.1| hypothetical protein POPTR_0012s11900g [Populus trichocarpa]
Length=587

 Score =   164 bits (416),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 119/370 (32%), Positives = 182/370 (49%), Gaps = 33/370 (9%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  V  HRCILA+RS FF + F             + G          P+ 
Sbjct  63    YSDADIVVEGIAVGVHRCILASRSKFFHELF-----RREKGSLEKDG---------KPKY  108

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
              + +++P  +VGYE FL+ + +LY+G++   P +      C +  C H  C  A+  A++
Sbjct  109   CMSELLPYGNVGYEAFLIFLSYLYTGKLKPSPMEVS---TCVDNVCAHDSCRPAITFAVE  165

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
                A+  F V +L  L Q++L + V KA  EDV+ +L+ +   +  QL   C   +A S 
Sbjct  166   LTYASSIFQVPELVSLFQRRLLNFVRKALAEDVIPILVVAFHCQSSQLIAQCVDRIAVSN  225

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP +V  KI++LR K      +                  +++I+R+  AL
Sbjct  226   LDNISIEKELPHEVADKIKQLRRKPISDDENNTEAGDPL---------REKRIKRIHMAL  276

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             DS DVELVKL++    ++LD+A ALHY    C  +V+  +L LG A+VN    + G T L
Sbjct  277   DSDDVELVKLLLTESDISLDDANALHYCASYCDLKVMSEVLSLGLANVNL-RNSRGYTVL  335

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             HIAA    P ++  LL   A     T+DG + + I R LT   D+  K         E N
Sbjct  336   HIAAMRKEPSVIVSLLAKGASALDLTSDGQSAVSICRRLTRPKDYHAKTE----QGQEAN  391

Query  1248  KLRLCLELVQ  1277
             K RLC+++++
Sbjct  392   KDRLCIDILE  401



>gb|AAT57642.1| NIM1-like protein 1 [Helianthus annuus]
Length=591

 Score =   164 bits (416),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 114/370 (31%), Positives = 187/370 (51%), Gaps = 33/370 (9%)
 Frame = +3

Query  174   FSDVTFSVEGRLVHAHRCILAARSLFFRKFFCgpdspgsdspgsRMGLVgagagaaSPRG  353
             +SD    VEG  V  HRCILA RS FF   F               G V   +    P+ 
Sbjct  67    YSDAEVVVEGISVGIHRCILATRSTFFSDLF-----------KKNKGCVEKDS---KPKY  112

Query  354   SIPQVIPVNSVGYEVFLLMMQFLYSGQVSIVPQKHEPRPNCRERGCWHTHCTSAVDLALD  533
             ++  ++P  SVGY+ FL+ + ++Y+G++   P +      C + GC H  C  A++ A++
Sbjct  113   NMSDLLPYGSVGYDAFLVFLSYVYTGKLKASPPEVS---TCVDDGCLHDACWPAINFAVE  169

Query  534   TLSAARSFGVEQLALLTQKQLASMVEKASIEDVMRVLIASGKQEMQQLWTTCSHLVAKSG  713
                A+  F V +L  L Q++L + V+KA +EDV+ +L+ +   ++Q + + C   V +S 
Sbjct  170   LTYASSVFQVPELVSLFQRRLLNFVDKALVEDVIPILVVAFHCQLQNVLSRCIDRVVRSK  229

Query  714   LPPEVLAKHLPIDVVAKIEELRHKsslarssllahhhhrhdlgaaadlEDQKIRRMRRAL  893
             L    + K LP +V   I+ + +         +      H + +   L +++I+ + +AL
Sbjct  230   LDTISIEKELPFEVTQMIKSIDN---------IIQEDDEHTVESEVVLREKRIKSIHKAL  280

Query  894   DSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGAAGRTPL  1073
             D  DVELVK+++    + LDEA ALHYAV  C++EV K +L L  ADVN    +   T L
Sbjct  281   DCDDVELVKMILDESKITLDEACALHYAVMYCNQEVAKEILNLNRADVNL-RNSRDYTVL  339

Query  1074  HIAAEMVSPDMVSVLLDHHADPNVRTADGITPLDILRTLT--SDFLFKGAIPGLAHIEPN  1247
             H+AA    P ++  +L   A  +  T DG + + I R  T   D+  K         E N
Sbjct  340   HVAAMRKEPSLIVSILSKGACASDTTFDGQSAVSICRRRTRPKDYYVKTE----HGQETN  395

Query  1248  KLRLCLELVQ  1277
             K R+C+++++
Sbjct  396   KDRICIDVLE  405



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5169077489433