BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18472_g1_i1 len=837 path=[1469:0-268 443:269-293 435:294-301
443:302-326 435:327-334 443:335-359 467:360-740 5:741-764 29:765-792
1807:793-793 368:794-812 1826:813-827 92:828-836]

Length=837
                                                                      Score     E

gb|KFU86943.1|  Ice nucleation protein                                62.4    2e-08   
ref|XP_009232085.1|  PREDICTED: S-antigen protein-like                50.8    6e-04   



>gb|KFU86943.1| Ice nucleation protein, partial [Chaetura pelagica]
Length=203

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 69/182 (38%), Gaps = 15/182 (8%)
 Frame = -2

Query  737  DANFGACSN---ASFDVDDDCCDPNFGASDDSCVANFGAGDGGCDVNFCVFSEGCNANFG  567
             A +G CS+   A + V    C   +G     C A +G     C   + V S  C A +G
Sbjct  24   TAGYGVCSSVCTAGYGVRSSVCTAGYGVCSSVCTAGYGVLSSVCTAGYGVCSSVCTAGYG  83

Query  566  AVDGGCDANFGAGDGGFEANFG---PSFDASVDVGKDCCDPNFAVDNSDSIPNFNAAVGG  396
             +   C A +G       A +G       A   V    C   + V +S     +      
Sbjct  84   VLSSVCTAGYGVCSSVCTAGYGVCSSVCTAGYGVLSSVCTAGYGVLSSVCTAGYG-----  138

Query  395  NFVAIFGDGESGCDAGFGDGESDCDAGFGDGESDCDAGFGDGNRGCDATFGVSDGGCNLD  216
                ++    S C AG+G   S C AG+G   S C AG+G  +  C A +GV    C   
Sbjct  139  ----VYSRVCSVCTAGYGVCSSVCTAGYGVLSSVCTAGYGVLSSVCTAGYGVLSSVCTAG  194

Query  215  FG  210
            +G
Sbjct  195  YG  196


 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 56/216 (26%), Positives = 76/216 (35%), Gaps = 26/216 (12%)
 Frame = -2

Query  773  CCDNLGVGDDGCDANFGACSN---ASFDVDDDCCDPNFGASDDSCVANFGAGDGGCDVNF  603
            C    GV    C A +G  S+   A + V    C   +G     C A +G     C   +
Sbjct  1    CTAGYGVLSSVCTAGYGVYSSVWTAGYGVCSSVCTAGYGVRSSVCTAGYGVCSSVCTAGY  60

Query  602  CVFSEGCNANFGAVDGGCDANFGAGDGGFEANFGPSFDASVDVGKDCCDPNFAVDNSDSI  423
             V S  C A +G     C A +G       A +G        V    C   + V +S   
Sbjct  61   GVLSSVCTAGYGVCSSVCTAGYGVLSSVCTAGYG--------VCSSVCTAGYGVCSSVCT  112

Query  422  PNFNAAVGGNFVAIFGDGESGCDAGFGDGESDCDAGFGDGE---SDCDAGFGDGNRGCDA  252
              +            G   S C AG+G   S C AG+G      S C AG+G  +  C A
Sbjct  113  AGY------------GVLSSVCTAGYGVLSSVCTAGYGVYSRVCSVCTAGYGVCSSVCTA  160

Query  251  TFGVSDGGCNLDFGVGNRECDLDPGANKGDCVTNFG  144
             +GV    C   +GV +  C    G     C   +G
Sbjct  161  GYGVLSSVCTAGYGVLSSVCTAGYGVLSSVCTAGYG  196



>ref|XP_009232085.1| PREDICTED: S-antigen protein-like [Pongo abelii]
Length=291

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 80/229 (35%), Gaps = 16/229 (7%)
 Frame = -2

Query  773  CCDNLGVGDDGCDANFGACSNA---SFDVDDDCCDPNFGASDDSCVANFGAGDGGCDVNF  603
            C  N+G  D  C  N G        +  + D  C  N G +D  C  N G  D  C  N 
Sbjct  17   CQGNVGTADRECQGNVGTADRECQGNVGMADRECQGNVGTADRECQGNVGTADRECQGNV  76

Query  602  CVFSEGCNANFGAVDGGCDANFGAGDGGFEANFGPS---FDASVDVGKDCCDPNFAVDNS  432
             +    C  N G VD  C  N G  D   + N G +      +V      C  N    + 
Sbjct  77   GMADRECQGNVGTVDRECQGNVGTVDRECQENVGTADRECQGNVGTADRECQGNAGTADR  136

Query  431  DSIPNFNAAVGGNFVAIFGDGESGCDAGFGDGESDCDAGF-------GDGESDCDAGFGD  273
            +S+      V     A+F    S   A    G    + GF       G  + +C    G 
Sbjct  137  ESL-QMCIMVRAILGAVFNT--SSTLAPQQRGFLKEEGGFATYVFHMGTADRECQGNAGT  193

Query  272  GNRGCDATFGVSDGGCNLDFGVGNRECDLDPGANKGDCVTNFGTDRGKW  126
             +R C    G  D  C  + G  +REC  + G    +C  N GT   +W
Sbjct  194  ADRECQGNAGTVDWECQGNAGTADRECQGNAGTADRECQGNVGTADREW  242



Lambda      K        H        a         alpha
   0.311    0.124    0.348    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1653286452180