BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18460_g1_i1 len=2225 path=[1:0-620 622:621-770 772:771-2224]

Length=2225
                                                                      Score     E

dbj|BAB16380.1|  Na+/H+ exchanger                                       994   0.0      Ipomoea nil [qian niu]
dbj|BAB60901.1|  Na+/H+ exchanger                                       981   0.0      Ipomoea tricolor [campanilla]
dbj|BAF75378.1|  Na+/H+ antioprter                                      977   0.0      Ipomoea tricolor [campanilla]
ref|XP_009629497.1|  PREDICTED: sodium/hydrogen exchanger 1-like        780   0.0      
gb|AGS56985.1|  sodium/hydrogen exchanger 1                             776   0.0      
ref|XP_009759403.1|  PREDICTED: sodium/hydrogen exchanger 1-like        770   0.0      
ref|XP_009352430.1|  PREDICTED: sodium/hydrogen exchanger 2-like        764   0.0      
ref|XP_010041937.1|  PREDICTED: sodium/hydrogen exchanger 2             764   0.0      
ref|XP_007144782.1|  hypothetical protein PHAVU_007G184100g             763   0.0      
ref|XP_009342012.1|  PREDICTED: sodium/hydrogen exchanger 2-like        763   0.0      
ref|XP_008370653.1|  PREDICTED: sodium/hydrogen exchanger 2-like        761   0.0      
ref|XP_004289614.1|  PREDICTED: sodium/hydrogen exchanger 2-like        760   0.0      
ref|XP_010324152.1|  PREDICTED: (Sodium/potassium)/proton exchang...    760   0.0      
gb|AGE13941.1|  vacuolar Na+/H+ antiporter                              760   0.0      
ref|XP_007208463.1|  hypothetical protein PRUPE_ppa003943mg             759   0.0      
gb|AGF50178.1|  vacuolar Na+/H+ antiporter                              759   0.0      
gb|AGE13940.1|  vacuolar Na+/H+ antiporter                              759   0.0      
gb|KCW84936.1|  hypothetical protein EUGRSUZ_B01758                     759   0.0      
ref|NP_001289221.1|  sodium/hydrogen exchanger 2-like                   759   0.0      
gb|AGE13943.1|  vacuolar Na+/H+ antiporter                              758   0.0      
dbj|BAD93487.1|  vacuolar Na+/H+ antiporter                             757   0.0      Rosa hybrid cultivar
gb|AAY43006.1|  Na+/H+ antiporter                                       756   0.0      Glycine max [soybeans]
ref|XP_008218158.1|  PREDICTED: sodium/hydrogen exchanger 1             755   0.0      
ref|NP_001237166.1|  sodium/proton antiporter                           752   0.0      
gb|AIL23819.1|  NHX1                                                    750   0.0      
ref|XP_009766186.1|  PREDICTED: sodium/hydrogen exchanger 2-like        748   0.0      
gb|AFO54606.1|  vacuolar Na+/H+ antiporter                              748   0.0      
gb|AFD97541.1|  vacuolar Na+/H+ antiporter                              749   0.0      
ref|XP_009624940.1|  PREDICTED: sodium/hydrogen exchanger 2-like        748   0.0      
gb|KDO75034.1|  hypothetical protein CISIN_1g009116mg                   748   0.0      
emb|CAN99589.1|  vacuolar Na+/H+ antiporter                             748   0.0      Mesembryanthemum crystallinum
gb|AEO50758.1|  vacuolar sodium proton antiporter                       747   0.0      
gb|AEO72079.2|  vacuolar sodium proton antiporter                       747   0.0      
ref|XP_002307194.2|  Na+/H+ antiporter family protein                   746   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010649604.1|  PREDICTED: nhx1 antiporter isoform X1              746   0.0      
ref|XP_006489167.1|  PREDICTED: sodium/hydrogen exchanger 2-like        746   0.0      
gb|ADK74832.1|  Na+/H+ antiporter                                       746   0.0      
ref|XP_010672472.1|  PREDICTED: sodium/hydrogen exchanger 1-like        747   0.0      
gb|ADB92598.1|  vacuolar Na+/H+ antiporter                              746   0.0      Malus domestica [apple tree]
ref|XP_008359889.1|  PREDICTED: LOW QUALITY PROTEIN: sodium/hydro...    745   0.0      
ref|XP_002266345.3|  PREDICTED: sodium/hydrogen exchanger 2 isofo...    744   0.0      Vitis vinifera
gb|ADB80440.1|  NHX1                                                    744   0.0      Malus zumi
ref|XP_006419681.1|  hypothetical protein CICLE_v10004687mg             744   0.0      
gb|AAQ08988.1|  Na/H antiporter Nhx1                                    744   0.0      
ref|XP_009364578.1|  PREDICTED: sodium/hydrogen exchanger 2-like        743   0.0      
ref|XP_007035466.1|  Sodium/hydrogen exchanger                          743   0.0      
ref|NP_001291231.1|  uncharacterized protein LOC105124949               743   0.0      
ref|XP_011023477.1|  PREDICTED: sodium/hydrogen exchanger 1-like        743   0.0      
gb|KDP23597.1|  hypothetical protein JCGZ_23430                         742   0.0      
ref|XP_011032540.1|  PREDICTED: sodium/hydrogen exchanger 1-like        742   0.0      
ref|XP_010320629.1|  PREDICTED: (Sodium/potassium)/proton exchang...    742   0.0      
ref|NP_001265892.1|  uncharacterized protein LOC101515538               742   0.0      
ref|XP_006342736.1|  PREDICTED: sodium/hydrogen exchanger 2-like        741   0.0      
dbj|BAB11940.1|  Na/H antiporter Nhx1                                   741   0.0      Atriplex gmelinii
gb|ABY86892.1|  Na+/H+ antiporter                                       741   0.0      Populus euphratica
gb|AAT36679.1|  NHX1                                                    741   0.0      Citrus reticulata [mandarin orange]
gb|AAN08157.1|  Na+/H+ antiporter Nhx1                                  741   0.0      Salicornia europaea [chicken-claws]
ref|XP_006433113.1|  hypothetical protein CICLE_v10000781mg             740   0.0      
ref|XP_010324162.1|  PREDICTED: (Sodium/potassium)/proton exchang...    739   0.0      
ref|XP_007223073.1|  hypothetical protein PRUPE_ppa003745mg             740   0.0      
gb|AAR19085.1|  Na+/H+ antiporter                                       739   0.0      Medicago sativa [alfalfa]
ref|NP_001234255.1|  (Sodium/potassium)/proton exchanger 3              739   0.0      
gb|KEH43058.1|  Na+/H+ exchanger 1                                      739   0.0      
dbj|BAB56105.1|  Na H-antiportor                                        739   0.0      Petunia x hybrida [garden petunia]
gb|ABN71591.2|  Na+/H+ antiporter                                       739   0.0      Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AAS84487.1|  Na+/H+ antiporter                                       739   0.0      Medicago sativa [alfalfa]
gb|ABD66754.1|  Na+/H+ antiporter                                       739   0.0      Populus euphratica
gb|AHC54576.1|  Na+/H+ antiporter 1                                     739   0.0      
gb|AHY19032.1|  Na+/H+ antiporter                                       738   0.0      
gb|ADB27460.1|  Na+/H+ antiporter NHX1                                  738   0.0      Medicago falcata [sickle alfalfa]
gb|AAZ82019.1|  Na+/H+ antiporter                                       738   0.0      Salicornia bigelovii
ref|XP_002512282.1|  sodium/hydrogen exchanger, putative                738   0.0      Ricinus communis
ref|NP_001291226.1|  uncharacterized protein LOC105131313               737   0.0      
gb|AAV84586.1|  Na+/H+ antiporter                                       737   0.0      Populus tomentosa [Chinese white poplar]
ref|XP_002319592.1|  Na+/H+ antiporter family protein                   737   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010245360.1|  PREDICTED: sodium/hydrogen exchanger 2             737   0.0      
gb|AAQ72785.1|  Na+/H+ antiporter                                       737   0.0      Oxybasis glauca [oakleaf goosefoot]
gb|AHY19033.1|  Na+/H+ antiporter                                       736   0.0      
gb|AAM54141.2|AF515632_1  Na/H antiporter                               735   0.0      Gossypium hirsutum [American cotton]
gb|AAO48271.1|  Na/H antiporter Nhx1                                    736   0.0      Atriplex dimorphostegia
gb|AID55215.1|  Na+/H+ antiporter                                       735   0.0      
ref|XP_003554675.1|  PREDICTED: sodium/hydrogen exchanger 2-like ...    734   0.0      
dbj|BAE95195.1|  putative Na+/H+ antiporter                             735   0.0      Suaeda japonica
gb|ACF05807.1|  Na+/H+ antiporter protein                               734   0.0      Limonium gmelinii
ref|XP_010921731.1|  PREDICTED: sodium/hydrogen exchanger 2-like        734   0.0      
gb|ABV00895.1|  Na+/H+ antiporter                                       734   0.0      Trifolium repens [creeping white clover]
ref|NP_001240203.1|  uncharacterized protein LOC100816746               734   0.0      
gb|AAK27314.2|  sodium/proton exchanger                                 733   0.0      Citrus x paradisi [grapefruit]
dbj|BAB56106.1|  Na H-antiportor                                        732   0.0      Nierembergia coerulea
ref|XP_004296789.1|  PREDICTED: sodium/hydrogen exchanger 2-like        731   0.0      
ref|XP_010241138.1|  PREDICTED: sodium/hydrogen exchanger 2-like        731   0.0      
gb|ACA33931.1|  Na+/H+ antiporter                                       732   0.0      Salicornia brachiata
emb|CDP18377.1|  unnamed protein product                                730   0.0      
ref|XP_007030156.1|  Sodium/hydrogen exchanger                          730   0.0      
gb|AAV73803.1|  Na+/H+ antiporter NHX                                   730   0.0      Kalidium foliatum
gb|ADK62565.1|  Na+/H+ antiporter                                       729   0.0      
gb|AAT36678.1|  NHX1                                                    728   0.0      Citrus trifoliata [hardy orange]
gb|ADD70241.1|  Na/H antiporter                                         728   0.0      
gb|ABM17091.1|  antiporter protein                                      728   0.0      Helianthus tuberosus [Jerusalem artichoke]
ref|XP_009384394.1|  PREDICTED: sodium/hydrogen exchanger 2-like        728   0.0      
gb|ABG89337.1|  Na+/H+ antiporter                                       727   0.0      Caragana korshinskii
ref|XP_004135647.1|  PREDICTED: sodium/hydrogen exchanger 2-like        727   0.0      
dbj|BAD95562.1|  putative Na+/H+ antiporter                             726   0.0      Phragmites australis
ref|XP_004958612.1|  PREDICTED: sodium/hydrogen exchanger 2-like        726   0.0      
ref|XP_009414185.1|  PREDICTED: sodium/hydrogen exchanger 2-like        726   0.0      
gb|AAU81619.1|  Na+/H+ antiporter                                       726   0.0      Iris lactea
dbj|BAP90754.1|  vacuolar Na+/H+ antiporter                             725   0.0      
gb|ABF68604.1|  putative vacuolar Na+/H+ antiporter                     725   0.0      Suaeda corniculata
gb|ACZ97405.1|  putative vacuolar Na+/H+ antiporter                     724   0.0      Aeluropus lagopoides
ref|NP_001233885.1|  (Sodium/potassium)/proton exchanger 4              723   0.0      
ref|XP_003520827.1|  PREDICTED: sodium/hydrogen exchanger 2-like        723   0.0      
ref|XP_002884487.1|  hypothetical protein ARALYDRAFT_477785             723   0.0      
ref|XP_011009463.1|  PREDICTED: sodium/hydrogen exchanger 2-like        722   0.0      
ref|XP_008653443.1|  PREDICTED: sodium/hydrogen exchanger 2-like        722   0.0      
ref|XP_006855405.1|  hypothetical protein AMTR_s00057p00151470          722   0.0      
ref|XP_002315532.2|  Na+/H+ antiporter family protein                   722   0.0      Populus trichocarpa [western balsam poplar]
gb|ABY59540.1|  Na+/H+ antiporter                                       722   0.0      Galega orientalis
gb|AEN03787.1|  Na/H antiporter                                         722   0.0      
ref|XP_010485901.1|  PREDICTED: sodium/hydrogen exchanger 2             722   0.0      
ref|XP_008450735.1|  PREDICTED: LOW QUALITY PROTEIN: sodium/hydro...    721   0.0      
gb|AAK53432.1|  Na+/H+ antiporter                                       722   0.0      Suaeda salsa
ref|NP_187154.1|  K+/H+ exchanger                                       721   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003562486.1|  PREDICTED: sodium/hydrogen exchanger 2             720   0.0      
gb|AAV80466.1|  Na+/H+ antiporter                                       720   0.0      Aeluropus littoralis
ref|XP_010422043.1|  PREDICTED: sodium/hydrogen exchanger 2-like        720   0.0      
dbj|BAA83337.1|  OsNHX1                                                 719   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060571.2|  Os07g0666900                                       719   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ABU92562.1|  vacuolar Na+/H+ antiporter                              719   0.0      Zygophyllum xanthoxylon
ref|XP_006408118.1|  hypothetical protein EUTSA_v10020432mg             719   0.0      
ref|XP_010105014.1|  Sodium/hydrogen exchanger 2                        718   0.0      
ref|XP_008812301.1|  PREDICTED: sodium/hydrogen exchanger 2-like        718   0.0      
gb|ADB54780.1|  Na+/H+ exchanger                                        717   0.0      Phyllostachys edulis [kikko-chiku]
ref|XP_010464004.1|  PREDICTED: sodium/hydrogen exchanger 2-like        716   0.0      
dbj|BAD91200.1|  sodium proton antiporter                               716   0.0      Ipomoea nil [qian niu]
ref|XP_009129852.1|  PREDICTED: sodium/hydrogen exchanger 1             716   0.0      
ref|XP_009147289.1|  PREDICTED: sodium/hydrogen exchanger 2             716   0.0      
dbj|BAJ06110.1|  sodium/proton antiporter                               716   0.0      
ref|NP_001291254.1|  uncharacterized protein LOC105114582               714   0.0      
emb|CDY27804.1|  BnaA05g32130D                                          714   0.0      
ref|XP_008799262.1|  PREDICTED: sodium/hydrogen exchanger 2 isofo...    713   0.0      
gb|AAP15178.1|  Na+/H+ antiporter                                       714   0.0      Suaeda salsa
emb|CDY41925.1|  BnaC05g46790D                                          713   0.0      
gb|ACE78322.1|  NHX1-like protein                                       713   0.0      Lotus tenuis [slender trefoil]
gb|AID51453.1|  vacuolar Na+/H+ reverse transporter                     712   0.0      
ref|XP_007147113.1|  hypothetical protein PHAVU_006G097100g             713   0.0      
dbj|BAK23261.1|  Na+/H+ exchanger                                       712   0.0      
gb|AAQ74383.1|  putative Na/H antiporter                                712   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ABY19311.2|  Na+/H+ antiporter                                       712   0.0      Zoysia japonica [Japanese lawn grass]
gb|AES82581.2|  cation/H+ exchanger 3                                   712   0.0      
emb|CDY50586.1|  BnaC02g39600D                                          712   0.0      
ref|XP_010941780.1|  PREDICTED: sodium/hydrogen exchanger 2-like        711   0.0      
gb|AFQ00709.1|  sodium/hydrogen exchanger 1                             711   0.0      
ref|XP_010904755.1|  PREDICTED: sodium/hydrogen exchanger 2             711   0.0      
ref|XP_010524896.1|  PREDICTED: sodium/hydrogen exchanger 2             710   0.0      
ref|XP_008223097.1|  PREDICTED: sodium/hydrogen exchanger 2-like        708   0.0      
gb|AFM85232.1|  Na+/H+ antiporter                                       707   0.0      
emb|CDO98922.1|  unnamed protein product                                707   0.0      
ref|XP_011071486.1|  PREDICTED: sodium/hydrogen exchanger 2-like        707   0.0      
gb|ABU49649.1|  Na+/H+ antiporter                                       706   0.0      Salsola soda [su da zhu mao cai]
ref|XP_004144972.1|  PREDICTED: sodium/hydrogen exchanger 2-like        706   0.0      
ref|NP_001267815.1|  nhx1 antiporter                                    705   0.0      
ref|XP_011090859.1|  PREDICTED: sodium/hydrogen exchanger 1-like        705   0.0      
emb|CDY19707.1|  BnaA09g03600D                                          703   0.0      
ref|XP_006299163.1|  hypothetical protein CARUB_v10015306mg             703   0.0      
emb|CDY00002.1|  BnaC09g02990D                                          703   0.0      
ref|XP_009111931.1|  PREDICTED: sodium/hydrogen exchanger 1             703   0.0      
ref|XP_006658079.1|  PREDICTED: sodium/hydrogen exchanger 2-like ...    703   0.0      
dbj|BAC56698.1|  sodium/proton antiporter                               702   0.0      Hordeum vulgare [barley]
ref|NP_001284448.1|  uncharacterized protein LOC103497886               703   0.0      
ref|NP_001267987.1|  sodium/hydrogen exchanger 2-like                   701   0.0      
emb|CBI32267.3|  unnamed protein product                                701   0.0      
ref|XP_006394990.1|  hypothetical protein EUTSA_v10003949mg             701   0.0      
gb|ABF48496.1|  sodium proton exchanger                                 701   0.0      Eutrema halophilum
gb|AES91776.2|  Na+/H+ exchanger 1                                      699   0.0      
gb|AFF57538.1|  vacuolar sodium proton antiporter                       699   0.0      
gb|ABC18331.1|  vacuolar Na+/H+ antiporter Nhx2                         698   0.0      Karelinia caspia
ref|XP_002516862.1|  sodium/hydrogen exchanger, putative                697   0.0      Ricinus communis
gb|ABW93557.1|  Na+/H+ antiporter protein                               698   0.0      Plantago maritima [goose tongue]
ref|XP_010024554.1|  PREDICTED: sodium/hydrogen exchanger 2-like        697   0.0      
gb|AAK76738.2|  Na+/H+ antiporter                                       697   0.0      Triticum aestivum [Canadian hard winter wheat]
gb|ACZ92142.1|  Na+/H+ antiporter                                       697   0.0      Brassica napus [oilseed rape]
ref|XP_006394989.1|  hypothetical protein EUTSA_v10003949mg             697   0.0      
gb|AAR17789.2|  Na+/H+ antiporter                                       696   0.0      Elymus elongatus [tall wheatgrass]
ref|XP_008390734.1|  PREDICTED: sodium/hydrogen exchanger 2-like        697   0.0      
ref|XP_008353238.1|  PREDICTED: sodium/hydrogen exchanger 2-like        696   0.0      
ref|XP_009369099.1|  PREDICTED: sodium/hydrogen exchanger 2-like        696   0.0      
ref|XP_006584042.1|  PREDICTED: sodium/hydrogen exchanger 2-like ...    694   0.0      
dbj|BAG48260.1|  vacuolar Na+/H+ antiporter                             694   0.0      Zostera marina
gb|AAS17948.1|  Na+/H+ antiporter precursor                             693   0.0      Hordeum vulgare [barley]
ref|XP_004494660.1|  PREDICTED: sodium/hydrogen exchanger 2-like        693   0.0      
gb|AAR19752.1|  Na+/H+ antiporter                                       693   0.0      Elymus elongatus [tall wheatgrass]
ref|XP_007154223.1|  hypothetical protein PHAVU_003G1006000g            693   0.0      
ref|XP_009628390.1|  PREDICTED: sodium/hydrogen exchanger 2-like ...    692   0.0      
ref|XP_009628391.1|  PREDICTED: sodium/hydrogen exchanger 2-like ...    692   0.0      
ref|XP_006287445.1|  hypothetical protein CARUB_v10000654mg             692   0.0      
ref|XP_003626363.1|  Sodium/hydrogen exchanger                          691   0.0      
ref|XP_009352200.1|  PREDICTED: sodium/hydrogen exchanger 2-like        691   0.0      
ref|XP_006600336.1|  PREDICTED: sodium/hydrogen exchanger 2-like        691   0.0      
ref|XP_009393239.1|  PREDICTED: sodium/hydrogen exchanger 2-like        691   0.0      
gb|ABQ58865.1|  Na+/H+ antiporter                                       690   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AGG11160.1|  NHX-like protein                                        689   0.0      
ref|NP_198067.1|  sodium/hydrogen exchanger 1                           689   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AEA51351.1|  Na+/H+ antiporter-like protein                          688   0.0      
ref|NP_001105224.1|  Na+/H+ antiporter NHX6                             688   0.0      Zea mays [maize]
ref|XP_010036683.1|  PREDICTED: sodium/hydrogen exchanger 3-like ...    687   0.0      
ref|XP_002874403.1|  hypothetical protein ARALYDRAFT_910883             687   0.0      
gb|ACN40903.1|  unknown                                                 687   0.0      Picea sitchensis
ref|XP_009777204.1|  PREDICTED: sodium/hydrogen exchanger 1-like        687   0.0      
gb|AAM34759.1|AF510074_1  Na+/H+ antiporter                             686   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EYU45585.1|  hypothetical protein MIMGU_mgv1a004101mg                686   0.0      
gb|KHF98023.1|  Sodium/hydrogen exchanger 2 -like protein               686   0.0      
ref|XP_007050783.1|  Sodium/hydrogen exchanger isoform 1                686   0.0      
ref|XP_010421653.1|  PREDICTED: sodium/hydrogen exchanger 1             686   0.0      
gb|ABS11687.1|  Na+/H+ transporter                                      685   0.0      Robinia pseudoacacia [black locust]
gb|AAT95387.1|  sodium proton exchanger                                 685   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010546638.1|  PREDICTED: sodium/hydrogen exchanger 2             685   0.0      
ref|XP_010494039.1|  PREDICTED: sodium/hydrogen exchanger 1-like        685   0.0      
ref|XP_010455152.1|  PREDICTED: sodium/hydrogen exchanger 1-like        684   0.0      
gb|EAZ41007.1|  hypothetical protein OsJ_25492                          682   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663078.1|  PREDICTED: sodium/hydrogen exchanger 2-like        683   0.0      
gb|EMT05063.1|  Sodium/hydrogen exchanger 2                             682   0.0      
dbj|BAB56107.1|  Na H-antiportor                                        681   0.0      Torenia hybrid cultivar
ref|NP_001105531.1|  Na+/H+ antiporter NHX2                             679   0.0      Zea mays [maize]
ref|XP_009412081.1|  PREDICTED: sodium/hydrogen exchanger 2-like ...    679   0.0      
ref|NP_001105943.1|  Na+/H+ antiporter NHX4                             679   0.0      Zea mays [maize]
gb|AHK80837.1|  Na+/H+ antiporter                                       677   0.0      
gb|EYU33528.1|  hypothetical protein MIMGU_mgv1a023716mg                676   0.0      
gb|KDP28082.1|  hypothetical protein JCGZ_13853                         676   0.0      
ref|NP_001105221.1|  Na+/H+ antiporter NHX1                             675   0.0      Zea mays [maize]
gb|AAO25547.1|  Na+/H+ antiporter                                       673   0.0      Hordeum brevisubulatum
ref|XP_010097354.1|  Sodium/hydrogen exchanger 2                        671   0.0      
ref|XP_003609579.1|  Sodium/hydrogen exchanger                          672   0.0      
ref|XP_002520686.1|  sodium/hydrogen exchanger, putative                672   0.0      Ricinus communis
gb|KHG14035.1|  Sodium/hydrogen exchanger 2 -like protein               671   0.0      
gb|KHN16165.1|  Sodium/hydrogen exchanger 2                             670   0.0      
gb|EEC83172.1|  hypothetical protein OsI_28401                          671   0.0      Oryza sativa Indica Group [Indian rice]
dbj|BAJ90308.1|  predicted protein                                      671   0.0      
gb|ABB86294.1|  vacuolar Na+/H+ antiporter                              670   0.0      Hordeum brevisubulatum
ref|XP_004979862.1|  PREDICTED: sodium/hydrogen exchanger 2-like        670   0.0      
ref|NP_001068371.1|  Os11g0648000                                       670   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AFU88788.1|  Na+/H+ antiporter                                       670   0.0      
ref|XP_003568941.1|  PREDICTED: sodium/hydrogen exchanger 2-like        670   0.0      
gb|KHG14686.1|  Sodium/hydrogen exchanger 2 -like protein               667   0.0      
gb|AAS17949.1|  Na+/H+ antiporter precursor                             668   0.0      Triticum aestivum [Canadian hard winter wheat]
gb|ACT53748.1|  vacuolar Na+/H+ antiporter                              668   0.0      Rhizophora stylosa
ref|XP_003577286.2|  PREDICTED: sodium/hydrogen exchanger 2-like        667   0.0      
ref|XP_008234992.1|  PREDICTED: sodium/hydrogen exchanger 2-like        667   0.0      
ref|XP_008386615.1|  PREDICTED: sodium/hydrogen exchanger 2-like        666   0.0      
ref|XP_002451198.1|  hypothetical protein SORBIDRAFT_05g025700          665   0.0      Sorghum bicolor [broomcorn]
ref|XP_002884574.1|  hypothetical protein ARALYDRAFT_896752             666   0.0      
ref|XP_009420287.1|  PREDICTED: sodium/hydrogen exchanger 2-like        663   0.0      
ref|XP_002320366.1|  Na+/H+ antiporter family protein                   662   0.0      Populus trichocarpa [western balsam poplar]
gb|ACG43655.1|  sodium/hydrogen exchanger 2                             662   0.0      Zea mays [maize]
ref|XP_009405423.1|  PREDICTED: sodium/hydrogen exchanger 1-like ...    663   0.0      
gb|ACR35112.1|  unknown                                                 662   0.0      Zea mays [maize]
gb|KHN03394.1|  Sodium/hydrogen exchanger 2                             660   0.0      
ref|NP_001142115.1|  uncharacterized protein LOC100274279               660   0.0      Zea mays [maize]
gb|AEK81534.1|  Na+/H+ antiporter                                       660   0.0      
ref|XP_007199474.1|  hypothetical protein PRUPE_ppa027158mg             659   0.0      
ref|XP_009604453.1|  PREDICTED: sodium/hydrogen exchanger 3-like ...    657   0.0      
ref|XP_009604452.1|  PREDICTED: sodium/hydrogen exchanger 3-like ...    657   0.0      
ref|XP_009604455.1|  PREDICTED: sodium/hydrogen exchanger 3-like ...    657   0.0      
gb|AAO38856.1|  Na+/H+ vacuolar antiporter                              655   0.0      Brassica napus [oilseed rape]
ref|XP_006654045.1|  PREDICTED: sodium/hydrogen exchanger 2-like        656   0.0      
ref|XP_004508313.1|  PREDICTED: sodium/hydrogen exchanger 2-like ...    654   0.0      
ref|XP_004960287.1|  PREDICTED: sodium/hydrogen exchanger 2-like        655   0.0      
gb|AEY76088.1|  Na/H antiproter                                         654   0.0      
gb|AAX45242.1|  Na+/H+ antiporter                                       653   0.0      Festuca arundinacea [tall fescue]
ref|XP_010069994.1|  PREDICTED: sodium/hydrogen exchanger 1-like        654   0.0      
ref|XP_011082501.1|  PREDICTED: sodium/hydrogen exchanger 2-like        653   0.0      
ref|XP_011033613.1|  PREDICTED: sodium/hydrogen exchanger 1-like        652   0.0      
ref|NP_001291221.1|  uncharacterized protein LOC105132046               652   0.0      
gb|AAK76737.1|  Na+/H+ antiporter                                       651   0.0      Triticum aestivum [Canadian hard winter wheat]
ref|NP_001054650.1|  Os05g0148600                                       650   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ACU01852.1|  Na+/H+ exchanger 1                                      649   0.0      Populus euphratica
ref|XP_009378901.1|  PREDICTED: sodium/hydrogen exchanger 2-like        650   0.0      
ref|XP_006297341.1|  hypothetical protein CARUB_v10013371mg             650   0.0      
emb|CDP03549.1|  unnamed protein product                                649   0.0      
gb|AAF08577.1|AC011623_10  putative sodium proton exchanger             649   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ABN54446.1|  Na+/H+ antiporter                                       649   0.0      
gb|EMS56375.1|  Sodium/hydrogen exchanger 2                             649   0.0      
gb|AAO91943.2|  vacuolar Na+/H+ antiporter                              647   0.0      
gb|ACG58413.1|  Na+/H+ antiporter                                       647   0.0      
ref|XP_008345191.1|  PREDICTED: sodium/hydrogen exchanger 2-like        646   0.0      
ref|NP_001105222.1|  Na+/H+ antiporter NHX3                             645   0.0      
ref|NP_001169551.1|  sodium/hydrogen exchanger                          645   0.0      
ref|XP_009380992.1|  PREDICTED: sodium/hydrogen exchanger 1-like        645   0.0      
gb|EEC82645.1|  hypothetical protein OsI_27250                          640   0.0      
gb|AAQ07963.1|  Na+/H+ antiporter NHX1                                  642   0.0      
gb|AAP55209.1|  Na+/H+ antiporter                                       641   0.0      
gb|ABD62853.1|  Na+/H+ antiporter                                       641   0.0      
ref|XP_009405421.1|  PREDICTED: sodium/hydrogen exchanger 1-like ...    643   0.0      
gb|AAW31851.1|  Na+/H+ antiporter                                       640   0.0      
gb|KCW84937.1|  hypothetical protein EUGRSUZ_B01758                     635   0.0      
ref|XP_004136184.1|  PREDICTED: sodium/hydrogen exchanger 2-like        638   0.0      
ref|XP_010524763.1|  PREDICTED: sodium/hydrogen exchanger 3 isofo...    638   0.0      
ref|XP_006362981.1|  PREDICTED: sodium/hydrogen exchanger 2-like ...    637   0.0      
ref|XP_008451435.1|  PREDICTED: sodium/hydrogen exchanger 2-like        636   0.0      
gb|KHN03007.1|  Sodium/hydrogen exchanger 2                             634   0.0      
ref|XP_004508314.1|  PREDICTED: sodium/hydrogen exchanger 2-like ...    634   0.0      
gb|AEN04067.1|  Na+/H+ antiporter                                       631   0.0      
ref|XP_010321693.1|  PREDICTED: Na+/H+ antiporter, isoform 1 isof...    630   0.0      
ref|XP_010464208.1|  PREDICTED: sodium/hydrogen exchanger 3             629   0.0      
ref|XP_010439182.1|  PREDICTED: sodium/hydrogen exchanger 3-like        628   0.0      
emb|CDY05257.1|  BnaC05g45460D                                          627   0.0      
ref|XP_010486145.1|  PREDICTED: sodium/hydrogen exchanger 3-like        625   0.0      
ref|NP_001233916.1|  Na+/H+ antiporter, isoform 1                       624   0.0      
gb|KCW58550.1|  hypothetical protein EUGRSUZ_H01210                     623   0.0      
ref|XP_009129662.1|  PREDICTED: sodium/hydrogen exchanger 3             624   0.0      
dbj|BAG24501.1|  Na+/H+ antiporter                                      621   0.0      
ref|XP_004309694.1|  PREDICTED: sodium/hydrogen exchanger 2-like        621   0.0      
ref|NP_001105223.1|  Na+/H+ antiporter NHX5                             619   0.0      
gb|KDO75035.1|  hypothetical protein CISIN_1g009116mg                   612   0.0      
ref|XP_006584044.1|  PREDICTED: sodium/hydrogen exchanger 2-like ...    612   0.0      
ref|XP_006584043.1|  PREDICTED: sodium/hydrogen exchanger 2-like ...    612   0.0      
ref|XP_010659997.1|  PREDICTED: sodium/hydrogen exchanger 2 isofo...    608   0.0      
ref|XP_010324163.1|  PREDICTED: (Sodium/potassium)/proton exchang...    598   0.0      
ref|XP_002461168.1|  hypothetical protein SORBIDRAFT_02g042190          598   0.0      
ref|NP_187288.2|  sodium hydrogen exchanger 4                           600   0.0      
gb|AAO41905.1|  putative sodium proton exchanger                        598   0.0      
ref|XP_007030791.1|  Sodium/hydrogen exchanger 1                        598   0.0      
ref|XP_010279028.1|  PREDICTED: sodium/hydrogen exchanger 1-like        596   0.0      
ref|XP_006444229.1|  hypothetical protein CICLE_v10019679mg             592   0.0      
tpg|DAA64030.1|  TPA: hypothetical protein ZEAMMB73_629986              588   0.0      
ref|XP_006479873.1|  PREDICTED: sodium/hydrogen exchanger 2-like ...    590   0.0      
gb|AGR34310.1|  vacuolar sodium hydrogen exchanger                      589   0.0      
ref|XP_004172232.1|  PREDICTED: LOW QUALITY PROTEIN: sodium/hydro...    586   0.0      
ref|XP_010111861.1|  Sodium/hydrogen exchanger 2                        589   0.0      
ref|XP_006419680.1|  hypothetical protein CICLE_v10004687mg             583   0.0      
gb|ABC46405.1|  Na+/H+ antiporter Nhx1                                  587   0.0      
gb|EMT25578.1|  Sodium/hydrogen exchanger 2                             587   0.0      
gb|AFC91768.1|  Na+/H+ antiporter                                       583   0.0      
gb|ACI16351.1|  vacuolar Na+/H+ antiporter                              580   0.0      
ref|XP_002281198.2|  PREDICTED: sodium/hydrogen exchanger 1             581   0.0      
gb|ABS85539.1|  putative Na+/H+ antiporter                              573   0.0      
gb|AAY90136.1|  Na/H vacuolar antiporter                                576   0.0      
ref|XP_002965473.1|  hypothetical protein SELMODRAFT_230648             578   0.0      
ref|XP_002993200.1|  hypothetical protein SELMODRAFT_236689             576   0.0      
gb|AAB61069.1|  Similar to sodium/hydrogen exchanger; coded for b...    570   0.0      
gb|AES61315.2|  Na+/H+ exchanger 1                                      573   0.0      
gb|EPS58707.1|  sodium/hydrogen exchanger                               568   0.0      
ref|XP_004302458.1|  PREDICTED: sodium/hydrogen exchanger 2-like        573   0.0      
gb|EEE69477.1|  hypothetical protein OsJ_28900                          570   0.0      
ref|XP_006375776.1|  hypothetical protein POPTR_0013s02760g             571   0.0      
gb|KDP23553.1|  hypothetical protein JCGZ_23386                         570   0.0      
gb|AHA39266.1|  vacuolar Na+/H+ antiporter protein                      569   0.0      
ref|XP_001769301.1|  predicted protein                                  570   0.0      
gb|EMT26232.1|  Sodium/hydrogen exchanger 2                             567   0.0      
ref|NP_001078110.1|  K+/H+ exchanger                                    563   0.0      
ref|XP_002512334.1|  sodium/hydrogen exchanger, putative                573   0.0      
ref|XP_008246520.1|  PREDICTED: sodium/hydrogen exchanger 1-like        565   0.0      
emb|CDP17968.1|  unnamed protein product                                564   0.0      
ref|XP_009412083.1|  PREDICTED: sodium/hydrogen exchanger 2-like ...    560   0.0      
ref|XP_009604459.1|  PREDICTED: sodium/hydrogen exchanger 2-like ...    560   0.0      
ref|XP_001773932.1|  predicted protein                                  563   0.0      
ref|XP_001758235.1|  predicted protein                                  562   0.0      
ref|XP_008388593.1|  PREDICTED: sodium/hydrogen exchanger 1-like        561   0.0      
gb|KHG11914.1|  Sodium/hydrogen exchanger 2 -like protein               554   0.0      
ref|XP_004496021.1|  PREDICTED: sodium/hydrogen exchanger 1-like        561   0.0      
emb|CAP16138.1|  Na+/H+ antiporter                                      559   0.0      
ref|XP_008370517.1|  PREDICTED: sodium/hydrogen exchanger 1-like        562   0.0      
ref|XP_011023539.1|  PREDICTED: sodium/hydrogen exchanger 1-like ...    557   0.0      
ref|XP_001776536.1|  predicted protein                                  556   0.0      
ref|XP_008776714.1|  PREDICTED: sodium/hydrogen exchanger 2-like        556   0.0      
gb|AIA82923.1|  NHX1                                                    556   0.0      
ref|NP_001291238.1|  uncharacterized protein LOC105124990               556   0.0      
ref|XP_010112737.1|  Sodium/hydrogen exchanger 2                        553   0.0      
ref|XP_004150256.1|  PREDICTED: sodium/hydrogen exchanger 4-like        553   0.0      
ref|XP_010938797.1|  PREDICTED: sodium/hydrogen exchanger 2-like        553   0.0      
ref|XP_008799263.1|  PREDICTED: sodium/hydrogen exchanger 2 isofo...    550   0.0      
ref|XP_003591064.1|  Sodium/hydrogen exchanger                          553   0.0      
ref|XP_008447694.1|  PREDICTED: sodium/hydrogen exchanger 4             551   0.0      
ref|XP_010064303.1|  PREDICTED: sodium/hydrogen exchanger 4             551   0.0      
gb|ADL27439.1|  Na+/H+ antiporter protein                               549   0.0      
gb|AES61316.2|  Na+/H+ exchanger 1                                      547   0.0      
ref|XP_007144758.1|  hypothetical protein PHAVU_007G182200g             546   0.0      
ref|XP_009120057.1|  PREDICTED: sodium/hydrogen exchanger 4             546   0.0      
ref|XP_010675005.1|  PREDICTED: sodium/hydrogen exchanger 1-like        545   0.0      
ref|XP_006474967.1|  PREDICTED: sodium/hydrogen exchanger 4-like ...    543   0.0      
ref|XP_006452489.1|  hypothetical protein CICLE_v10008001mg             542   0.0      
gb|KDO62173.1|  hypothetical protein CISIN_1g010004mg                   542   0.0      
ref|XP_007208456.1|  hypothetical protein PRUPE_ppa003873mg             543   0.0      
ref|XP_009772407.1|  PREDICTED: sodium/hydrogen exchanger 3-like        543   0.0      
ref|NP_200358.1|  sodium/hydrogen exchanger 4                           541   0.0      
ref|XP_002529026.1|  sodium/hydrogen exchanger, putative                541   0.0      
ref|XP_010443172.1|  PREDICTED: sodium/hydrogen exchanger 4-like        541   0.0      
gb|AAM08405.1|AF490588_1  Na+/H+ exchanger 4                            541   0.0      
gb|ABC65850.1|  Na+/H+ antiporter NHEXL1a                               540   0.0      
ref|XP_010270126.1|  PREDICTED: sodium/hydrogen exchanger 4 isofo...    540   0.0      
ref|XP_006850842.1|  hypothetical protein AMTR_s00025p00134170          539   0.0      
ref|XP_006280297.1|  hypothetical protein CARUB_v10026220mg             540   0.0      
ref|XP_010449615.1|  PREDICTED: sodium/hydrogen exchanger 4 isofo...    539   1e-180   
gb|ABC65852.1|  Na+/H+ antiporter NHEXL1b                               538   1e-180   
emb|CDY17324.1|  BnaA10g09580D                                          538   2e-180   
ref|XP_010482991.1|  PREDICTED: LOW QUALITY PROTEIN: sodium/hydro...    537   7e-180   
dbj|BAK07310.1|  predicted protein                                      536   8e-180   
ref|XP_008363990.1|  PREDICTED: sodium/hydrogen exchanger 1-like        541   8e-180   
ref|XP_006401454.1|  hypothetical protein EUTSA_v10015629mg             535   2e-179   
ref|XP_010913183.1|  PREDICTED: sodium/hydrogen exchanger 4 isofo...    535   3e-179   
ref|XP_002866096.1|  ATNHX3                                             535   4e-179   
ref|XP_009594578.1|  PREDICTED: sodium/hydrogen exchanger 4 isofo...    535   4e-179   
ref|XP_009381279.1|  PREDICTED: sodium/hydrogen exchanger 2-like ...    535   4e-179   
ref|XP_004965335.1|  PREDICTED: sodium/hydrogen exchanger 4-like        535   5e-179   
ref|XP_010675850.1|  PREDICTED: sodium/hydrogen exchanger 4             534   6e-179   
gb|EEC78519.1|  hypothetical protein OsI_18459                          533   7e-179   
ref|XP_009399506.1|  PREDICTED: sodium/hydrogen exchanger 4             534   7e-179   
ref|XP_006407955.1|  hypothetical protein EUTSA_v10020600mg             533   7e-179   
gb|AAY42599.1|  NHX1                                                    530   1e-178   
ref|XP_009774260.1|  PREDICTED: sodium/hydrogen exchanger 4 isofo...    533   1e-178   
gb|AES70467.2|  Na+/H+ exchanger 1                                      533   2e-178   
ref|XP_009587285.1|  PREDICTED: sodium/hydrogen exchanger 3-like        531   1e-177   
ref|XP_004495748.1|  PREDICTED: sodium/hydrogen exchanger 1-like        531   4e-177   
ref|XP_010321696.1|  PREDICTED: Na+/H+ antiporter, isoform 1 isof...    526   5e-177   
ref|XP_003560776.1|  PREDICTED: sodium/hydrogen exchanger 4             528   3e-176   
ref|XP_010545261.1|  PREDICTED: sodium/hydrogen exchanger 4             527   4e-176   
ref|XP_007020656.1|  Na+/H+ (sodium hydrogen) exchanger 3               526   6e-176   
gb|KDP39222.1|  hypothetical protein JCGZ_00979                         526   1e-175   
ref|XP_009364633.1|  PREDICTED: sodium/hydrogen exchanger 4-like        524   4e-175   
ref|XP_003530775.1|  PREDICTED: sodium/hydrogen exchanger 4-like ...    523   2e-174   
ref|XP_010036702.1|  PREDICTED: sodium/hydrogen exchanger 2-like ...    518   3e-174   
ref|XP_009339392.1|  PREDICTED: sodium/hydrogen exchanger 4-like ...    520   2e-173   
ref|XP_009339390.1|  PREDICTED: sodium/hydrogen exchanger 4-like ...    520   2e-173   
ref|XP_003600216.1|  Sodium/hydrogen exchanger                          521   3e-173   
ref|XP_003591065.1|  Sodium/hydrogen exchanger                          520   5e-173   
ref|XP_008227059.1|  PREDICTED: sodium/hydrogen exchanger 4             519   7e-173   
ref|XP_001778141.1|  predicted protein                                  519   1e-172   
ref|XP_008659496.1|  PREDICTED: sodium/hydrogen exchanger 4             518   2e-172   
ref|XP_008385813.1|  PREDICTED: sodium/hydrogen exchanger 4             516   5e-172   
emb|CBI26718.3|  unnamed protein product                                514   5e-171   
ref|XP_002276813.1|  PREDICTED: sodium/hydrogen exchanger 4             513   1e-170   
ref|XP_004294053.1|  PREDICTED: sodium/hydrogen exchanger 4-like        513   1e-170   
gb|ACD64982.2|  sodium proton antiporter                                511   3e-170   
gb|AFD97524.1|  Na+/H+ antiporter                                       505   5e-170   
ref|XP_007146551.1|  hypothetical protein PHAVU_006G050200g             511   6e-170   
gb|EYU27401.1|  hypothetical protein MIMGU_mgv1a025551mg                509   3e-169   
ref|XP_008806355.1|  PREDICTED: sodium/hydrogen exchanger 4             507   2e-168   
ref|XP_006352635.1|  PREDICTED: sodium/hydrogen exchanger 4-like        507   2e-168   
ref|XP_010524764.1|  PREDICTED: sodium/hydrogen exchanger 3 isofo...    504   2e-168   
gb|EYU17589.1|  hypothetical protein MIMGU_mgv1a003973mg                506   2e-167   
ref|XP_011095487.1|  PREDICTED: sodium/hydrogen exchanger 4 isofo...    504   3e-167   
ref|XP_010099975.1|  Sodium/hydrogen exchanger 4                        502   5e-166   
ref|XP_010327195.1|  PREDICTED: sodium/hydrogen exchanger 4             503   6e-166   
emb|CDY45655.1|  BnaC09g31970D                                          501   1e-165   
ref|XP_004500130.1|  PREDICTED: LOW QUALITY PROTEIN: sodium/hydro...    500   4e-165   
ref|XP_006433187.1|  hypothetical protein CICLE_v10003335mg             498   6e-165   
gb|KCW84938.1|  hypothetical protein EUGRSUZ_B01758                     493   1e-164   
ref|XP_010025152.1|  PREDICTED: sodium/hydrogen exchanger 1-like        492   4e-163   
gb|KDO75036.1|  hypothetical protein CISIN_1g009116mg                   485   3e-162   
ref|XP_006856848.1|  hypothetical protein AMTR_s00055p00183660          484   8e-161   
ref|XP_009381295.1|  PREDICTED: sodium/hydrogen exchanger 3-like ...    483   3e-160   
ref|XP_002436952.1|  hypothetical protein SORBIDRAFT_10g012140          482   9e-159   
ref|XP_009335439.1|  PREDICTED: sodium/hydrogen exchanger 4-like        479   6e-158   
gb|ABC65851.1|  Na+/H+ antiporter NHEXL1c                               471   2e-155   
ref|XP_010270130.1|  PREDICTED: sodium/hydrogen exchanger 4 isofo...    471   5e-155   
gb|ABU49603.1|  Na+/H+ antiporter                                       464   5e-154   
gb|EPS66202.1|  sodium/hydrogen exchanger                               468   2e-153   
ref|XP_009594580.1|  PREDICTED: sodium/hydrogen exchanger 4 isofo...    464   4e-153   
ref|XP_009381287.1|  PREDICTED: sodium/hydrogen exchanger 3-like ...    466   1e-152   
ref|XP_009774263.1|  PREDICTED: sodium/hydrogen exchanger 4 isofo...    462   1e-152   
ref|XP_007214261.1|  hypothetical protein PRUPE_ppa024846mg             465   3e-152   
ref|XP_006586112.1|  PREDICTED: sodium/hydrogen exchanger 4-like ...    462   1e-151   
gb|KCW61750.1|  hypothetical protein EUGRSUZ_H04454                     458   1e-150   
ref|XP_010913184.1|  PREDICTED: sodium/hydrogen exchanger 4 isofo...    459   2e-150   
emb|CDP13761.1|  unnamed protein product                                459   7e-150   
ref|XP_006656930.1|  PREDICTED: sodium/hydrogen exchanger 4-like        459   7e-150   
ref|XP_006845095.1|  hypothetical protein AMTR_s00005p00139520          462   8e-150   
dbj|BAD61575.1|  putative Na+/H+ exchanger 4                            455   4e-148   
ref|XP_011095488.1|  PREDICTED: sodium/hydrogen exchanger 4 isofo...    451   3e-147   
ref|XP_006586111.1|  PREDICTED: sodium/hydrogen exchanger 4-like ...    448   7e-146   
ref|NP_001174753.1|  Os06g0318500                                       449   2e-144   
gb|KHG12017.1|  Sodium/hydrogen exchanger 4 -like protein               441   2e-143   
ref|XP_010270131.1|  PREDICTED: sodium/hydrogen exchanger 4 isofo...    436   2e-142   
ref|XP_009364649.1|  PREDICTED: sodium/hydrogen exchanger 4-like        435   6e-142   
ref|XP_009774261.1|  PREDICTED: sodium/hydrogen exchanger 4 isofo...    436   8e-142   
ref|XP_009594579.1|  PREDICTED: sodium/hydrogen exchanger 4 isofo...    433   4e-141   
ref|XP_002970472.1|  hypothetical protein SELMODRAFT_231555             436   1e-140   
ref|XP_009774262.1|  PREDICTED: sodium/hydrogen exchanger 4 isofo...    428   4e-139   
ref|XP_002978547.1|  hypothetical protein SELMODRAFT_233139             426   5e-137   
ref|XP_006474968.1|  PREDICTED: sodium/hydrogen exchanger 4-like ...    418   1e-135   
ref|XP_010913185.1|  PREDICTED: sodium/hydrogen exchanger 4 isofo...    418   1e-135   
gb|AFH37921.1|  NHX1                                                    412   7e-135   
gb|EEC80495.1|  hypothetical protein OsI_22740                          415   6e-133   
emb|CAN81668.1|  hypothetical protein VITISV_011218                     410   5e-132   
gb|KDO44979.1|  hypothetical protein CISIN_1g043481mg                   405   2e-131   
ref|XP_004169790.1|  PREDICTED: sodium/hydrogen exchanger 4-like        400   9e-130   
ref|XP_006586113.1|  PREDICTED: sodium/hydrogen exchanger 4-like ...    400   1e-128   
gb|KDO42701.1|  hypothetical protein CISIN_1g023195mg                   394   9e-128   
gb|AFH37919.1|  NHX1                                                    391   8e-127   
gb|EYU40527.1|  hypothetical protein MIMGU_mgv1a026386mg                395   5e-126   
ref|XP_009373962.1|  PREDICTED: sodium/hydrogen exchanger 1-like        391   2e-125   
tpg|DAA64031.1|  TPA: hypothetical protein ZEAMMB73_629986              383   1e-123   
gb|AFH37920.1|  NHX1                                                    363   3e-116   
gb|KCW66881.1|  hypothetical protein EUGRSUZ_F00635                     365   9e-115   
gb|AFH37922.1|  NHX1                                                    358   2e-114   
gb|AFH37923.1|  NHX1                                                    356   1e-113   
gb|EPS59314.1|  sodium/hydrogen exchanger                               354   5e-112   
gb|AHY19034.1|  Na+/H+ antiporter                                       350   4e-111   
gb|EYU40524.1|  hypothetical protein MIMGU_mgv1a026570mg                352   1e-109   
gb|EYU40526.1|  hypothetical protein MIMGU_mgv1a021866mg                354   3e-109   
gb|EMT06440.1|  Sodium/hydrogen exchanger 4                             347   4e-107   



>dbj|BAB16380.1| Na+/H+ exchanger [Ipomoea nil]
 dbj|BAB16381.1| Na+/H+ exchanger [Ipomoea nil]
 dbj|BAB60899.1| Na+/H+ exchanger protein [Ipomoea nil]
Length=542

 Score =   994 bits (2569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/542 (100%), Positives = 542/542 (100%), Gaps = 0/542 (0%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC  1738
             MAFGLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC
Sbjct  1     MAFGLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC  60

Query  1737  TGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGT  1558
             TGVVILLLSGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAIGT
Sbjct  61    TGVVILLLSGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAIGT  120

Query  1557  LISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVF  1378
             LISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVF
Sbjct  121   LISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVF  180

Query  1377  GEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIK  1198
             GEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIK
Sbjct  181   GEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIK  240

Query  1197  KLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT  1018
             KLYFGRHSTDREVALMMLMSYLSYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT
Sbjct  241   KLYFGRHSTDREVALMMLMSYLSYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT  300

Query  1017  TRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVF  838
             TRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVF
Sbjct  301   TRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVF  360

Query  837   PLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMIt  658
             PLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMIT
Sbjct  361   PLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMIT  420

Query  657   stvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDS  478
             STVTVVLFSTVVFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDS
Sbjct  421   STVTVVLFSTVVFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDS  480

Query  477   ESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             ESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS
Sbjct  481   ESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  540

Query  297   PR  292
             PR
Sbjct  541   PR  542



>dbj|BAB60901.1| Na+/H+ exchanger [Ipomoea tricolor]
 dbj|BAP28595.1| NHX1 [Ipomoea tricolor]
Length=542

 Score =   981 bits (2537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/542 (99%), Positives = 537/542 (99%), Gaps = 0/542 (0%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC  1738
             MAFGLSSLLQNS+LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC
Sbjct  1     MAFGLSSLLQNSELFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC  60

Query  1737  TGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGT  1558
             TGVVILLLS GKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAIGT
Sbjct  61    TGVVILLLSRGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAIGT  120

Query  1557  LISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVF  1378
             LISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVF
Sbjct  121   LISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVF  180

Query  1377  GEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIK  1198
             GEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIK
Sbjct  181   GEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIK  240

Query  1197  KLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT  1018
             KLYFGRHSTDREVALMMLMSYLSYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT
Sbjct  241   KLYFGRHSTDREVALMMLMSYLSYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT  300

Query  1017  TRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVF  838
             TRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVF
Sbjct  301   TRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVF  360

Query  837   PLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMIt  658
             PLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMIT
Sbjct  361   PLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMIT  420

Query  657   stvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDS  478
             STVTVVLFSTVVFGLMTKPLINLLLPPHKQ+ SGHSSMTTSEPSSPKHF VPLLDNQ DS
Sbjct  421   STVTVVLFSTVVFGLMTKPLINLLLPPHKQIASGHSSMTTSEPSSPKHFAVPLLDNQHDS  480

Query  477   ESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             ESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSP EQS
Sbjct  481   ESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPAEQS  540

Query  297   PR  292
             PR
Sbjct  541   PR  542



>dbj|BAF75378.1| Na+/H+ antioprter [Ipomoea tricolor]
Length=542

 Score =   977 bits (2525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/542 (99%), Positives = 536/542 (99%), Gaps = 0/542 (0%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC  1738
             MAFGLSSLLQNS+LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC
Sbjct  1     MAFGLSSLLQNSELFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC  60

Query  1737  TGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGT  1558
             TGVVILLLS GKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAIGT
Sbjct  61    TGVVILLLSRGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAIGT  120

Query  1557  LISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVF  1378
             LISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVF
Sbjct  121   LISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVF  180

Query  1377  GEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIK  1198
             GEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIK
Sbjct  181   GEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIK  240

Query  1197  KLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT  1018
             KLYFGRHSTDREVALMMLMSYLSYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESS VT
Sbjct  241   KLYFGRHSTDREVALMMLMSYLSYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSWVT  300

Query  1017  TRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVF  838
             TRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVF
Sbjct  301   TRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVF  360

Query  837   PLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMIt  658
             PLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMIT
Sbjct  361   PLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMIT  420

Query  657   stvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDS  478
             STVTVVLFSTVVFGLMTKPLINLLLPPHKQ+ SGHSSMTTSEPSSPKHF VPLLDNQ DS
Sbjct  421   STVTVVLFSTVVFGLMTKPLINLLLPPHKQIASGHSSMTTSEPSSPKHFAVPLLDNQHDS  480

Query  477   ESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             ESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSP EQS
Sbjct  481   ESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPAEQS  540

Query  297   PR  292
             PR
Sbjct  541   PR  542



>ref|XP_009629497.1| PREDICTED: sodium/hydrogen exchanger 1-like [Nicotiana tomentosiformis]
 ref|XP_009629498.1| PREDICTED: sodium/hydrogen exchanger 1-like [Nicotiana tomentosiformis]
 ref|XP_009629499.1| PREDICTED: sodium/hydrogen exchanger 1-like [Nicotiana tomentosiformis]
 ref|XP_009629501.1| PREDICTED: sodium/hydrogen exchanger 1-like [Nicotiana tomentosiformis]
Length=536

 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/542 (80%), Positives = 477/542 (88%), Gaps = 7/542 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MA  L+S+      L TSDH SVVS+NLFVALLCACIV+GHLLEENRW+NESITALIIGL
Sbjct  1     MASELASMFPKLGSLGTSDHGSVVSINLFVALLCACIVIGHLLEENRWINESITALIIGL  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
               GVVILL+SGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNF+TIMLFGAIG
Sbjct  61    GVGVVILLISGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFITIMLFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLISC+IIS GA+K FK LDI FLD GDYLAIGAIFAATDSVCTLQVL QDETPLLYSLV
Sbjct  121   TLISCAIISLGAIKFFKKLDIGFLDIGDYLAIGAIFAATDSVCTLQVLHQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQ+FD++S +P I LHFIGNFLYLFL+ST LG   GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIQNFDLSSVNPSIALHFIGNFLYLFLASTLLGAATGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TTRH+FATLSF+AETF+FLYVGMDALDIEKWKFV +S GLSVAVSSIL+GLIL+GRAAFV
Sbjct  301   TTRHAFATLSFLAETFLFLYVGMDALDIEKWKFVSDSPGLSVAVSSILMGLILLGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KK+S +KI+FRQQ+IIWWAGLMRGAVS+ALAYNKFT  GHT L +NAIMI
Sbjct  361   FPLSFLSNLMKKSSEEKITFRQQVIIWWAGLMRGAVSMALAYNKFTRLGHTQLQDNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+T+VLFSTVVFGLMTKPLI+LLLPP +Q+     S  +S+ +SPK  T PLL +Q  
Sbjct  421   TSTITIVLFSTVVFGLMTKPLISLLLPPQRQL-----STVSSDANSPKSLTAPLLGSQEG  475

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE D+  G E+  P +LRMLL  PTH VHRYWRKFDDSFMRPVFGGRGF P   GSP EQ
Sbjct  476   SEVDL-NGQELPHPPSLRMLLSAPTHKVHRYWRKFDDSFMRPVFGGRGFTPVAPGSPTEQ  534

Query  300   SP  295
              P
Sbjct  535   EP  536



>gb|AGS56985.1| sodium/hydrogen exchanger 1 [Nicotiana benthamiana]
Length=536

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/542 (79%), Positives = 476/542 (88%), Gaps = 7/542 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MA  L+S+      L TSDH SVVS+NLFVALLCACIV+GHLLEENRW+NESITALIIGL
Sbjct  1     MASELASMFPKLGSLGTSDHGSVVSINLFVALLCACIVIGHLLEENRWINESITALIIGL  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
               GVVILL+S GKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNF+TIMLFGAIG
Sbjct  61    GVGVVILLISRGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFVTIMLFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLISC+IIS GA+K FK LDI+FLD GDYLAIGAIFAATDSVCTLQVL QDETPLLYSLV
Sbjct  121   TLISCAIISLGAIKFFKKLDIEFLDIGDYLAIGAIFAATDSVCTLQVLHQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQ+FD++S +P I LHFIGNFLYLFL+ST LG   GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIQNFDLSSVNPSIALHFIGNFLYLFLASTLLGAATGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TTRH+FATLSF+AETF+FLYVGMDALDIEKWKFV +S GLSVAVSSIL+GLIL+GRAAF+
Sbjct  301   TTRHAFATLSFLAETFLFLYVGMDALDIEKWKFVSDSPGLSVAVSSILMGLILLGRAAFI  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KK+S +KI+FRQQ+IIWWAGLMRGAVS+ALAYNKFT  GHT L +NAIMI
Sbjct  361   FPLSFLSNLMKKSSEEKITFRQQVIIWWAGLMRGAVSMALAYNKFTRLGHTQLQDNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+T+VLFSTVVFGL+TKPLI+LLLPP +Q+     S  +S+ ++PK  T PLL +Q  
Sbjct  421   TSTITIVLFSTVVFGLLTKPLISLLLPPQRQL-----STVSSDANTPKSLTAPLLASQEG  475

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE D+    ++  P +LRMLL  PTH VHRYWRKFDDSFMRPVFGGRGF P   GSP EQ
Sbjct  476   SEVDL-NSQDLPHPPSLRMLLSAPTHKVHRYWRKFDDSFMRPVFGGRGFTPLAPGSPTEQ  534

Query  300   SP  295
              P
Sbjct  535   EP  536



>ref|XP_009759403.1| PREDICTED: sodium/hydrogen exchanger 1-like [Nicotiana sylvestris]
 ref|XP_009759404.1| PREDICTED: sodium/hydrogen exchanger 1-like [Nicotiana sylvestris]
Length=536

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/542 (79%), Positives = 474/542 (87%), Gaps = 7/542 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MA  L+S+      L TSDH SVVS+NLFVALLCACIV+GHLLEENRW+NESITALIIGL
Sbjct  1     MASELASMFPKLGSLGTSDHGSVVSINLFVALLCACIVIGHLLEENRWINESITALIIGL  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
               GVVILL+SGGKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNF+TIMLFGAIG
Sbjct  61    GVGVVILLISGGKSSHVLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFITIMLFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLISC+IIS GA+K FK LDI FLD GDYLAIGAIFAATDSVCTLQVL QDETPLLYSLV
Sbjct  121   TLISCAIISLGAIKFFKKLDIGFLDIGDYLAIGAIFAATDSVCTLQVLHQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQ+FD++S +P I L FIGNFLYLFL+ST LG   GLL AYI+
Sbjct  181   FGEGVVNDATSVVLFNAIQNFDLSSVNPTIALRFIGNFLYLFLASTLLGAATGLLSAYIV  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVALMMLM+YLSY++AELFY SGILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVALMMLMAYLSYMLAELFYFSGILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TTRH+FATLSF+AETF+FLYVGMDALDIEKWKFV +S GLSVAVSSIL+GLIL+GRAAFV
Sbjct  301   TTRHTFATLSFLAETFLFLYVGMDALDIEKWKFVSDSPGLSVAVSSILMGLILLGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KK+S +KI+FRQQ+IIWWAGLMRGAVS+ALAYNKFT  GHT L +NAIMI
Sbjct  361   FPLSFLSNLMKKSSEEKITFRQQVIIWWAGLMRGAVSMALAYNKFTRLGHTQLQDNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+T+VLFSTVVFGLMTKPLI+LLLPP +Q+     S  +S+ ++PK  T PLL +Q  
Sbjct  421   TSTITIVLFSTVVFGLMTKPLISLLLPPQRQL-----STVSSDANTPKSLTAPLLGSQEG  475

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE D+    ++  P +LRMLL  PTH VHRYWRKFDDSFMRPVFGGRGF P   GSP EQ
Sbjct  476   SEVDL-NSQDLPHPPSLRMLLSAPTHKVHRYWRKFDDSFMRPVFGGRGFTPVAPGSPTEQ  534

Query  300   SP  295
              P
Sbjct  535   EP  536



>ref|XP_009352430.1| PREDICTED: sodium/hydrogen exchanger 2-like [Pyrus x bretschneideri]
Length=542

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/533 (80%), Positives = 468/533 (88%), Gaps = 8/533 (2%)
 Frame = -3

Query  1899  SLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIl  1720
             S LQN    TSDH+SVVSMNLFVALL ACIV+GHLLEENRWVNESITAL+IGLCTGVVIL
Sbjct  11    SKLQNVS--TSDHSSVVSMNLFVALLLACIVIGHLLEENRWVNESITALLIGLCTGVVIL  68

Query  1719  llsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSI  1540
             L+S G+SSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTI++FGAIGTL+SC+I
Sbjct  69    LISRGRSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIVMFGAIGTLVSCTI  128

Query  1539  ISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVN  1360
             IS GA + FK LDI  L+ GD+LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVN
Sbjct  129   ISLGATQFFKKLDIGTLELGDFLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVN  188

Query  1359  DATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGR  1180
             DATSVVLFNAIQSFD+T  D  I LHF+GNFLYLF +ST LGV  GLL AYIIKKLYFG 
Sbjct  189   DATSVVLFNAIQSFDLTHIDSSIALHFMGNFLYLFFASTMLGVFAGLLSAYIIKKLYFGS  248

Query  1179  HSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFA  1000
             HSTDREVALMMLM+YLSYI+AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FA
Sbjct  249   HSTDREVALMMLMAYLSYILAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFA  308

Query  999   TLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLS  820
             TLSFVAETFIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAFVFPLSFLS
Sbjct  309   TLSFVAETFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLVMLGRAAFVFPLSFLS  368

Query  819   NLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvv  640
             NL KKN  DKIS RQQ+IIWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST+TVV
Sbjct  369   NLTKKNQRDKISLRQQVIIWWAGLMRGAVSMALAYNQFTRSGHTQLRANAIMITSTITVV  428

Query  639   lfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMIT  460
             L STVVFGLMTKPLI  LLP     P   +SM +SEP+SPK   VPLL    DS  D++ 
Sbjct  429   LVSTVVFGLMTKPLIRFLLP---HSPKQTTSMLSSEPTSPKSVIVPLLGQ--DSVDDLV-  482

Query  459   GPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             G ++ RP +LR LL TPTHTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E+
Sbjct  483   GQDIRRPASLRDLLTTPTHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTER  535



>ref|XP_010041937.1| PREDICTED: sodium/hydrogen exchanger 2 [Eucalyptus grandis]
 gb|KCW84935.1| hypothetical protein EUGRSUZ_B01758 [Eucalyptus grandis]
Length=541

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/527 (79%), Positives = 466/527 (88%), Gaps = 6/527 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDH SVVS+NLFVALL ACIV+GHLLEENRW+NESITAL+IGLCTG+VILL +G KS
Sbjct  15    LSTSDHTSVVSLNLFVALLLACIVIGHLLEENRWMNESITALMIGLCTGIVILLTTGMKS  74

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGAIGTL+SC+IIS GA++
Sbjct  75    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAIGTLVSCTIISLGAIE  134

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK + I+  D GDY+AIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  135   FFKRIGINSFDIGDYIAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  194

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+   DP+I L FIGNF YLF +ST LGV  GLL AYIIKKLYFGRHSTDREV
Sbjct  195   FNAIQSFDLNHIDPRIALQFIGNFFYLFFASTMLGVLTGLLSAYIIKKLYFGRHSTDREV  254

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY+MAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  255   ALMMLMAYLSYMMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAE  314

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDIEKW+FV NS G SVAVSS+L+ L+L GRAAFVFPLS LSNL KKN 
Sbjct  315   TFIFLYVGMDALDIEKWRFVSNSPGTSVAVSSVLLALVLAGRAAFVFPLSLLSNLTKKNP  374

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             +++ISFRQQ+IIWWAGLMRGAVS+ALAYNKFT+SGHT L +NAIMITST+TVVLFSTVVF
Sbjct  375   NERISFRQQVIIWWAGLMRGAVSMALAYNKFTSSGHTHLRDNAIMITSTITVVLFSTVVF  434

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             G +T+PLI LLLP  K     H+SM  S+P++PK FT PLL +  DSE+D++  P++ RP
Sbjct  435   GFLTQPLIRLLLPSPK-----HTSMVVSDPNTPKSFTFPLLRSGQDSEADLVV-PDIGRP  488

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              +LR L  TP HTVH YWRKFDD+FMRPVFGGRGFVP+V GSP E+S
Sbjct  489   GSLRALWTTPAHTVHYYWRKFDDAFMRPVFGGRGFVPYVPGSPTERS  535



>ref|XP_007144782.1| hypothetical protein PHAVU_007G184100g [Phaseolus vulgaris]
 gb|ESW16776.1| hypothetical protein PHAVU_007G184100g [Phaseolus vulgaris]
Length=542

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/541 (78%), Positives = 474/541 (88%), Gaps = 5/541 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLF-TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M F +SS++    +  TSDH+SVVSMNLFVALLC CIVLGHLLEENRW+NESITAL+IG+
Sbjct  1     MVFEISSVVSKLQMLSTSDHSSVVSMNLFVALLCGCIVLGHLLEENRWMNESITALLIGV  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
              TGVVILL SGGKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAIG
Sbjct  61    TTGVVILLFSGGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLISC++I+ GA +IFK LDI  LD GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISCAVITLGATQIFKKLDIGPLDLGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD+   D  I LHF+GNFLYLF++ST LGV  GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLNQIDSSIALHFLGNFLYLFIASTMLGVLTGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLY GRHSTDREVAL+MLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSR+
Sbjct  241   KKLYIGRHSTDREVALVMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRI  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+HSFATLSFVAE FIFLYVGMDALDIEKWKFV +S G S+A SS+L+GLIL+GRAAFV
Sbjct  301   TTKHSFATLSFVAEIFIFLYVGMDALDIEKWKFVSDSPGTSIAASSVLLGLILLGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSF+SNLAKK+ ++KISFRQQ+IIWWAGLMRGAVS+ALAYN+FT SGHTSL  NAIMI
Sbjct  361   FPLSFISNLAKKSPNEKISFRQQVIIWWAGLMRGAVSMALAYNQFTMSGHTSLQSNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVL STVVFGLMTKPLI LLL PH   P   + +  ++PS+PK  TVPLL +  D
Sbjct  421   TSTITVVLVSTVVFGLMTKPLIRLLL-PHTPHPKELNIVIATDPSTPKSATVPLLGSAQD  479

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE D+     + RP+++R LLRTPTHTVHR WRKFDD+FMRPVFGGRGFVP   GSP E+
Sbjct  480   SEVDI---DSIHRPSSIRALLRTPTHTVHRLWRKFDDAFMRPVFGGRGFVPVEPGSPTER  536

Query  300   S  298
             +
Sbjct  537   N  537



>ref|XP_009342012.1| PREDICTED: sodium/hydrogen exchanger 2-like [Pyrus x bretschneideri]
Length=542

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/533 (80%), Positives = 467/533 (88%), Gaps = 8/533 (2%)
 Frame = -3

Query  1899  SLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIl  1720
             S LQN    TSDH+SVVSMNLFVALL ACIV+GHLLEENRWVNESITAL+IGLCTGVVIL
Sbjct  11    SKLQNVS--TSDHSSVVSMNLFVALLLACIVIGHLLEENRWVNESITALLIGLCTGVVIL  68

Query  1719  llsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSI  1540
             L+S G+SSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTI++FGAIGTL+SC+I
Sbjct  69    LISRGRSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIVMFGAIGTLVSCTI  128

Query  1539  ISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVN  1360
             IS GA + FK LDI  L+ GD LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVN
Sbjct  129   ISLGATQFFKKLDIGTLELGDLLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVN  188

Query  1359  DATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGR  1180
             DATSVVLFNAIQSFD+T  D  I LHF+GNFLYLF +ST LGV  GLL AYIIKKLYFG 
Sbjct  189   DATSVVLFNAIQSFDLTHIDSSIALHFMGNFLYLFFASTMLGVFAGLLSAYIIKKLYFGS  248

Query  1179  HSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFA  1000
             HSTDREVALMMLM+YLSYI+AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FA
Sbjct  249   HSTDREVALMMLMAYLSYILAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFA  308

Query  999   TLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLS  820
             TLSFVAETFIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAFVFPLSFLS
Sbjct  309   TLSFVAETFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLVMLGRAAFVFPLSFLS  368

Query  819   NLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvv  640
             NL KKN  DKIS RQQ+IIWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST+TVV
Sbjct  369   NLTKKNQRDKISLRQQVIIWWAGLMRGAVSMALAYNQFTRSGHTQLRANAIMITSTITVV  428

Query  639   lfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMIT  460
             L STVVFGLMTKPLI  LLP     P   +SM +SEP+SPK   VPLL    DS  D++ 
Sbjct  429   LVSTVVFGLMTKPLIRFLLP---HSPKQTTSMLSSEPTSPKSVIVPLLGQ--DSVDDLV-  482

Query  459   GPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             G ++ RP +LR LL TPTHTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E+
Sbjct  483   GQDIRRPASLRDLLTTPTHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTER  535



>ref|XP_008370653.1| PREDICTED: sodium/hydrogen exchanger 2-like [Malus domestica]
Length=542

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/533 (80%), Positives = 468/533 (88%), Gaps = 8/533 (2%)
 Frame = -3

Query  1899  SLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIl  1720
             S LQN  L TSDH+SVVSMNLFVALL ACIV+GHLLEENRWVNESITAL+IG+CTGVVIL
Sbjct  11    SKLQN--LSTSDHSSVVSMNLFVALLLACIVIGHLLEENRWVNESITALLIGVCTGVVIL  68

Query  1719  llsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSI  1540
             L+S GKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTI++FGAIGTL+SC+I
Sbjct  69    LISRGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIVMFGAIGTLVSCTI  128

Query  1539  ISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVN  1360
             IS GA + FK LDI  L+ GD+L IGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVN
Sbjct  129   ISLGATQFFKKLDIGTLELGDFLGIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVN  188

Query  1359  DATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGR  1180
             DATSVVLFNAIQSFD+T  D  I LHF+GNFLYLF +ST LGV  GLL AYIIKKLYFGR
Sbjct  189   DATSVVLFNAIQSFDLTHIDSSIALHFMGNFLYLFFASTMLGVFAGLLSAYIIKKLYFGR  248

Query  1179  HSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFA  1000
             HSTDREVALMMLM+YLSYI+AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FA
Sbjct  249   HSTDREVALMMLMAYLSYILAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFA  308

Query  999   TLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLS  820
             TLSF+AETFIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GLI++GRAAF+FPLSFLS
Sbjct  309   TLSFLAETFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLIMLGRAAFIFPLSFLS  368

Query  819   NLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvv  640
             NL KKN  DKIS RQQ+IIWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST+TVV
Sbjct  369   NLTKKNQHDKISLRQQVIIWWAGLMRGAVSMALAYNQFTRSGHTQLRANAIMITSTITVV  428

Query  639   lfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMIT  460
             L STVVFGLMTKPLI  LLP     P   +SM +SEP+SPK   VPLL    DS  D++ 
Sbjct  429   LVSTVVFGLMTKPLIRFLLP---HSPKQTTSMLSSEPTSPKSVIVPLLGQ--DSVDDLV-  482

Query  459   GPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             G +  RP +LR LL TPTHTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E+
Sbjct  483   GQDFRRPASLRDLLTTPTHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTER  535



>ref|XP_004289614.1| PREDICTED: sodium/hydrogen exchanger 2-like [Fragaria vesca subsp. 
vesca]
Length=543

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/535 (80%), Positives = 473/535 (88%), Gaps = 6/535 (1%)
 Frame = -3

Query  1905  LSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVV  1726
             +S L +  +L  SDH+SVVS+NLFVALLCACIV+GHLLEENRWVNESITAL+IG+ TGVV
Sbjct  9     MSKLPKLQNLSASDHSSVVSLNLFVALLCACIVIGHLLEENRWVNESITALLIGVSTGVV  68

Query  1725  IlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISC  1546
             ILL+SGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNF+TI++FGAIGTL+SC
Sbjct  69    ILLISGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFITIVMFGAIGTLVSC  128

Query  1545  SIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGV  1366
             SII+FGA +IFK LDI  LD GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGV
Sbjct  129   SIIAFGATQIFKKLDIGSLDIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGV  188

Query  1365  VNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYF  1186
             VNDATSVVLFNAIQSFD+T  DP+I L F+GNFLYLF SST LGV  GLL A+IIKKLYF
Sbjct  189   VNDATSVVLFNAIQSFDLTHIDPRIALQFMGNFLYLFFSSTMLGVITGLLSAFIIKKLYF  248

Query  1185  GRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHS  1006
              RHSTDREVALMMLM+YLSYI+AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+
Sbjct  249   ARHSTDREVALMMLMAYLSYILAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHA  308

Query  1005  FATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSF  826
             FATLSFV E FIFLYVGMDALDIEKW+FV +S G SVAVSSIL+ L+++GRAAFVFPLSF
Sbjct  309   FATLSFVCEIFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLSLVMLGRAAFVFPLSF  368

Query  825   LSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvt  646
             LSNL+KKN  +KIS +QQ+IIWWAGLMRGAVSIALAYN+FT SGHT L  NAIMITST++
Sbjct  369   LSNLSKKNDREKISLQQQVIIWWAGLMRGAVSIALAYNQFTRSGHTQLRANAIMITSTIS  428

Query  645   vvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDM  466
             VVL STVVFGLMTKPLI  LL PHKQM S  S    S+P SPK   VPLL    DSE+++
Sbjct  429   VVLVSTVVFGLMTKPLIRFLL-PHKQMTSTTS--IVSDPPSPKSIIVPLLGQ--DSEAEL  483

Query  465   ITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
              +G EV RP ++R LL TPTHTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E+
Sbjct  484   -SGHEVRRPASIRDLLTTPTHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTER  537



>ref|XP_010324152.1| PREDICTED: (Sodium/potassium)/proton exchanger 4 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010324159.1| PREDICTED: (Sodium/potassium)/proton exchanger 4 isoform X1 [Solanum 
lycopersicum]
Length=536

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/542 (78%), Positives = 473/542 (87%), Gaps = 7/542 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MA  L+SL      L TSDHASV S+NLFVALLCACI++GHLLEENRWVNESITALIIGL
Sbjct  1     MASVLASLFPKLGSLGTSDHASVASINLFVALLCACIIIGHLLEENRWVNESITALIIGL  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
              TGVVILL+SGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAIG
Sbjct  61    GTGVVILLVSGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TL+SC+IIS GA++ FK LDI+FLD GDYLAIGAIFAATDSVCTLQVL QDETPLLYSLV
Sbjct  121   TLVSCAIISLGAIQTFKKLDIEFLDIGDYLAIGAIFAATDSVCTLQVLHQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQ+ D+TS +P I L F+GNF YLFL+ST LG G GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIQNVDLTSLNPSIALSFLGNFFYLFLASTLLGAGTGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TTRH+FATLSF+AETF+FLYVGMDALDIEKWKFV +  GLS++ SSIL+GLIL+GRAAFV
Sbjct  301   TTRHTFATLSFLAETFLFLYVGMDALDIEKWKFVGDRPGLSISASSILMGLILLGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLS+LSNL KK+S +KI+FRQQ+IIWWAGLMRGAVS+ALAYNKFT  GHT L +NAIMI
Sbjct  361   FPLSYLSNLMKKSSEEKITFRQQVIIWWAGLMRGAVSMALAYNKFTHGGHTQLQDNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+T+VLFST+VFGLMTKPLI+LLLPP +Q+     S  +S  ++PK  T PLL ++ D
Sbjct  421   TSTITIVLFSTMVFGLMTKPLISLLLPPQRQL-----STVSSGANTPKSLTAPLLGSRED  475

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE D+   P++  P +LRMLL  P+H VHRYWRKFDD+FMRP+FGGRGF P    SP E 
Sbjct  476   SEGDL-NVPDLPHPPSLRMLLTAPSHKVHRYWRKFDDAFMRPMFGGRGFAPPAPRSPTEH  534

Query  300   SP  295
              P
Sbjct  535   GP  536



>gb|AGE13941.1| vacuolar Na+/H+ antiporter [Pyrus betulifolia]
Length=542

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/533 (80%), Positives = 466/533 (87%), Gaps = 8/533 (2%)
 Frame = -3

Query  1899  SLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIl  1720
             S LQN    TSDH+SVVSMNLFVALL ACIV+GHLLEENRWVNESITAL+IGLCTGVVIL
Sbjct  11    SKLQNVS--TSDHSSVVSMNLFVALLLACIVIGHLLEENRWVNESITALLIGLCTGVVIL  68

Query  1719  llsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSI  1540
             L+S G+SSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTI++FGAIGTL+SC+I
Sbjct  69    LISRGRSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIVMFGAIGTLVSCTI  128

Query  1539  ISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVN  1360
             IS G  + FK LDI  L+ GD LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVN
Sbjct  129   ISLGITQFFKKLDIGTLELGDLLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVN  188

Query  1359  DATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGR  1180
             DATSVVLFNAIQSFD+T  D  I LHF+GNFLYLF +ST LGV  GLL AYIIKKLYFG 
Sbjct  189   DATSVVLFNAIQSFDLTHIDSSIALHFMGNFLYLFFASTMLGVFAGLLSAYIIKKLYFGS  248

Query  1179  HSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFA  1000
             HSTDREVALMMLM+YLSYI+AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FA
Sbjct  249   HSTDREVALMMLMAYLSYILAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFA  308

Query  999   TLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLS  820
             TLSFVAETFIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAFVFPLSFLS
Sbjct  309   TLSFVAETFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLVMLGRAAFVFPLSFLS  368

Query  819   NLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvv  640
             NL KKN  DKIS RQQ+IIWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST+TVV
Sbjct  369   NLTKKNQRDKISLRQQVIIWWAGLMRGAVSMALAYNQFTRSGHTQLRANAIMITSTITVV  428

Query  639   lfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMIT  460
             L STVVFGLMTKPLI  LLP     P   +SM +SEP+SPK   VPLL    DS  D++ 
Sbjct  429   LVSTVVFGLMTKPLIRFLLP---HSPKQTTSMLSSEPTSPKSVIVPLLGQ--DSVDDLV-  482

Query  459   GPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             G ++ RP +LR LL TPTHTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E+
Sbjct  483   GQDIRRPASLRDLLTTPTHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTER  535



>ref|XP_007208463.1| hypothetical protein PRUPE_ppa003943mg [Prunus persica]
 gb|EMJ09662.1| hypothetical protein PRUPE_ppa003943mg [Prunus persica]
Length=539

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/541 (79%), Positives = 473/541 (87%), Gaps = 8/541 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MA  LS L+     L TSDH+SVVSMNLFVALL ACIV+GHLLEENRWVNESITAL+IG+
Sbjct  1     MAAHLSYLMSKLQTLSTSDHSSVVSMNLFVALLLACIVIGHLLEENRWVNESITALLIGV  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTG+VILL+S GKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNF+TI++FGAIG
Sbjct  61    CTGIVILLISRGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFITIVMFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS  IIS GA +IFK LDI  LD GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISFCIISLGATQIFKKLDIGSLDIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD+T  D +I LHF+GNFLYLF +ST LGV  GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLTHIDSRIALHFMGNFLYLFFTSTMLGVFAGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVALMMLM+YLSYI+AELFYLSGILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVALMMLMAYLSYILAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSFVAE FIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAFV
Sbjct  301   TTKHAFATLSFVAEIFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLLMLGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNLAKKN ++KIS RQQ+IIWWAGLMRGAVSIALAYN+FT SGHT L  NAI+I
Sbjct  361   FPLSFLSNLAKKNPNEKISLRQQVIIWWAGLMRGAVSIALAYNQFTRSGHTQLRPNAILI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVL STVVFGLMTKPLI  L+P  KQ     +SM  SEP++PK   VPLL    D
Sbjct  421   TSTITVVLVSTVVFGLMTKPLIRFLVPHSKQT----TSMVLSEPTTPKSIIVPLLGQ--D  474

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE D+    EV RP ++R LL TPTHTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E+
Sbjct  475   SEGDL-GSQEVRRPASIRDLLTTPTHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTER  533

Query  300   S  298
             +
Sbjct  534   N  534



>gb|AGF50178.1| vacuolar Na+/H+ antiporter [Rosa rugosa]
Length=543

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/542 (78%), Positives = 478/542 (88%), Gaps = 6/542 (1%)
 Frame = -3

Query  1923  TKMAFGLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             + +A  ++ L +  +L  SDH+SVVS+NLFVALLCACIV+GHLLEENRWVNESITAL+IG
Sbjct  3     SHLAMLMTKLPKLQNLSASDHSSVVSLNLFVALLCACIVIGHLLEENRWVNESITALLIG  62

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             +CTGVVILL+SGGKSSHLLVFSED+FFIYLLPPIIFNAGFQVKKKQFF NF+TI++FGAI
Sbjct  63    VCTGVVILLISGGKSSHLLVFSEDVFFIYLLPPIIFNAGFQVKKKQFFRNFITIVMFGAI  122

Query  1563  GTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSL  1384
             GTL+SC+IISFGA +IFK LDI  LD GDYLAIGAIFAATDSVCTLQVL QDETPLLYSL
Sbjct  123   GTLVSCTIISFGATQIFKKLDIGSLDIGDYLAIGAIFAATDSVCTLQVLHQDETPLLYSL  182

Query  1383  VFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYI  1204
             VFGEGVVNDATSVVLFNAIQSFD+T  D +I L F+GNFLYLF +ST LGV  GLL A+I
Sbjct  183   VFGEGVVNDATSVVLFNAIQSFDLTHLDSRIALKFMGNFLYLFFASTMLGVITGLLSAFI  242

Query  1203  IKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  1024
             IKKLYF RHSTDREVALMMLM+YLSYI+AELFYLSGILTVFFCGIVMSHYTWHNVTESSR
Sbjct  243   IKKLYFARHSTDREVALMMLMAYLSYILAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  302

Query  1023  VTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAF  844
             VTT+H+FATLSFV ETFIFLYVGMDALDIEKW+FV +S G SVAVSSIL+ L+++GRAAF
Sbjct  303   VTTKHAFATLSFVCETFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLSLVMLGRAAF  362

Query  843   VFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIM  664
             VFPLSF SNL KKN S+KIS +QQ++IWWAGLMRGAVSIALAYN+FT SGHT L  NAIM
Sbjct  363   VFPLSFFSNLFKKNQSEKISLQQQVVIWWAGLMRGAVSIALAYNQFTRSGHTQLRPNAIM  422

Query  663   ItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQP  484
             ITST++VVL STVVFGL+TKPLI LLL PHKQ+ S +S M  S+P SPK   VPLL    
Sbjct  423   ITSTISVVLVSTVVFGLLTKPLIRLLL-PHKQLTSTNSIM--SDPPSPKSVIVPLLGQ--  477

Query  483   DSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             DSE+D+ +G EV RP ++R LL TPTHTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E
Sbjct  478   DSEADL-SGHEVRRPASIRDLLTTPTHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTE  536

Query  303   QS  298
             ++
Sbjct  537   RN  538



>gb|AGE13940.1| vacuolar Na+/H+ antiporter [Pyrus betulifolia]
 gb|AGE13942.1| vacuolar Na+/H+ antiporter [Pyrus calleryana]
Length=542

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/533 (80%), Positives = 466/533 (87%), Gaps = 8/533 (2%)
 Frame = -3

Query  1899  SLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIl  1720
             S LQN    TSDH+SVVSMNLFVALL ACIV+GHLLEENRWVNESITAL+IGLCTGVVIL
Sbjct  11    SKLQNVS--TSDHSSVVSMNLFVALLLACIVIGHLLEENRWVNESITALLIGLCTGVVIL  68

Query  1719  llsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSI  1540
             L+S G+SSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTI++FGAIGTL+SC+I
Sbjct  69    LISRGRSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIVMFGAIGTLVSCTI  128

Query  1539  ISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVN  1360
             IS GA + FK LDI  L+ GD LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVN
Sbjct  129   ISLGATQFFKKLDIGTLELGDLLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVN  188

Query  1359  DATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGR  1180
             DATSVVLFNAIQSFD+T  D  I LHF+GNFLYLF +ST LGV  GLL AYIIKKLYFGR
Sbjct  189   DATSVVLFNAIQSFDLTHIDSSIALHFMGNFLYLFFASTMLGVFAGLLSAYIIKKLYFGR  248

Query  1179  HSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFA  1000
             HSTDREVALMMLM+YLSYI+AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FA
Sbjct  249   HSTDREVALMMLMAYLSYILAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFA  308

Query  999   TLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLS  820
             TLSFVAETFIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL++ GRAAFVFPLSFLS
Sbjct  309   TLSFVAETFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLLMPGRAAFVFPLSFLS  368

Query  819   NLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvv  640
             NL KKN  DKIS RQQ+IIWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST TVV
Sbjct  369   NLTKKNQRDKISLRQQVIIWWAGLMRGAVSMALAYNQFTRSGHTQLRANAIMITSTTTVV  428

Query  639   lfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMIT  460
             L STVVFGLMTKPLI  LLP     P   +SM +SEP+SPK   VPLL    DS  D++ 
Sbjct  429   LVSTVVFGLMTKPLIRFLLP---HSPKQTTSMLSSEPTSPKSVIVPLLGQ--DSVDDLV-  482

Query  459   GPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             G ++ RP +LR LL TPTHTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E+
Sbjct  483   GQDIRRPASLRDLLTTPTHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTER  535



>gb|KCW84936.1| hypothetical protein EUGRSUZ_B01758 [Eucalyptus grandis]
Length=540

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/527 (77%), Positives = 459/527 (87%), Gaps = 7/527 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDH SVVS+NLFVALL ACIV+GHLLEENRW+NESITAL+IGLCTG+VILL +G KS
Sbjct  15    LSTSDHTSVVSLNLFVALLLACIVIGHLLEENRWMNESITALMIGLCTGIVILLTTGMKS  74

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGAIGTL+SC+IIS GA++
Sbjct  75    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAIGTLVSCTIISLGAIE  134

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK + I+  D GDY+AIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  135   FFKRIGINSFDIGDYIAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  194

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+   DP+I L FIGNF YLF +ST LGV  GLL AYIIKKLYFGRHSTDREV
Sbjct  195   FNAIQSFDLNHIDPRIALQFIGNFFYLFFASTMLGVLTGLLSAYIIKKLYFGRHSTDREV  254

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY+MAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  255   ALMMLMAYLSYMMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAE  314

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDIEKW+FV NS G SVAVSS+L+ L+L GRAAFVFPLS LSNL KKN 
Sbjct  315   TFIFLYVGMDALDIEKWRFVSNSPGTSVAVSSVLLALVLAGRAAFVFPLSLLSNLTKKNP  374

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             +++ISFRQQ+IIWWAGLMRGAVS+ALAYNKFT+SGHT L +NAIMI ++   V+  + VF
Sbjct  375   NERISFRQQVIIWWAGLMRGAVSMALAYNKFTSSGHTHLRDNAIMI-TSTITVVLFSTVF  433

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             G +T+PLI LLLP  K     H+SM  S+P++PK FT PLL +  DSE+D++  P++ RP
Sbjct  434   GFLTQPLIRLLLPSPK-----HTSMVVSDPNTPKSFTFPLLRSGQDSEADLVV-PDIGRP  487

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              +LR L  TP HTVH YWRKFDD+FMRPVFGGRGFVP+V GSP E+S
Sbjct  488   GSLRALWTTPAHTVHYYWRKFDDAFMRPVFGGRGFVPYVPGSPTERS  534



>ref|NP_001289221.1| sodium/hydrogen exchanger 2-like [Pyrus x bretschneideri]
 gb|AGE13944.1| vacuolar Na+/H+ antiporter [Pyrus x bretschneideri]
Length=542

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/533 (80%), Positives = 465/533 (87%), Gaps = 8/533 (2%)
 Frame = -3

Query  1899  SLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIl  1720
             S LQN    TSDH+SVVSMNLFVALL ACIV+GHLLEENRWVNESITAL+IGLCTGVVIL
Sbjct  11    SKLQNVS--TSDHSSVVSMNLFVALLLACIVIGHLLEENRWVNESITALLIGLCTGVVIL  68

Query  1719  llsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSI  1540
             L+S G+SSH LVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTI++FGAIGTL+SC+I
Sbjct  69    LISRGRSSHPLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIVMFGAIGTLVSCTI  128

Query  1539  ISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVN  1360
             IS GA + FK LDI  L+ GD LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVN
Sbjct  129   ISLGATQFFKKLDIGTLELGDLLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVN  188

Query  1359  DATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGR  1180
             DATSVVLFNAIQ FD+T  D  I LHF+GNFLYLF +ST LGV  GLL AYIIK LYFGR
Sbjct  189   DATSVVLFNAIQGFDLTHIDSSIALHFMGNFLYLFFASTMLGVFAGLLSAYIIKTLYFGR  248

Query  1179  HSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFA  1000
             HSTDREVALMMLM+YLSYI+AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FA
Sbjct  249   HSTDREVALMMLMAYLSYILAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFA  308

Query  999   TLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLS  820
             TLSFVAETFIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAFVFPLSFLS
Sbjct  309   TLSFVAETFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLLMLGRAAFVFPLSFLS  368

Query  819   NLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvv  640
             NL KKN  DKIS RQQ+IIWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST+TVV
Sbjct  369   NLTKKNQRDKISLRQQVIIWWAGLMRGAVSMALAYNQFTRSGHTQLRANAIMITSTITVV  428

Query  639   lfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMIT  460
             L STVVFGLMTKPLI  LLP     P   +SM +SEP+SPK   VPLL    DS  D++ 
Sbjct  429   LVSTVVFGLMTKPLIRFLLP---HSPKQTTSMLSSEPTSPKSVIVPLLGQ--DSVDDLV-  482

Query  459   GPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             G ++ RP +LR LL TPTHTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E+
Sbjct  483   GQDIRRPASLRDLLTTPTHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTER  535



>gb|AGE13943.1| vacuolar Na+/H+ antiporter [Pyrus ussuriensis]
Length=542

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/533 (80%), Positives = 465/533 (87%), Gaps = 8/533 (2%)
 Frame = -3

Query  1899  SLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIl  1720
             S LQN    TSDH+SVVSMNLFVALL ACIV+GHLLEENRWVNESITAL+IGLCTGVVIL
Sbjct  11    SKLQNVS--TSDHSSVVSMNLFVALLLACIVIGHLLEENRWVNESITALLIGLCTGVVIL  68

Query  1719  llsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSI  1540
             L+S G+SSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTI++FGAIGTL+SC+I
Sbjct  69    LISRGRSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIVMFGAIGTLVSCTI  128

Query  1539  ISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVN  1360
             IS GA + FK LDI  L+ GD LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVN
Sbjct  129   ISLGATQFFKKLDIGTLELGDLLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVN  188

Query  1359  DATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGR  1180
             DATSVVLFNAIQSFD+T  D  I LHF+GNFLYLF +ST LGV  GLL AYIIKKLYFGR
Sbjct  189   DATSVVLFNAIQSFDLTHIDSSIALHFMGNFLYLFFASTMLGVFAGLLSAYIIKKLYFGR  248

Query  1179  HSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFA  1000
             HSTDREVALMMLM+YLSYI+AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FA
Sbjct  249   HSTDREVALMMLMAYLSYILAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFA  308

Query  999   TLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLS  820
             TLSFVAETFIFLYV MDALDIEKW+FV +S G SVAVSSIL+GL++ GRAAFVFPLSFLS
Sbjct  309   TLSFVAETFIFLYVSMDALDIEKWRFVSDSPGTSVAVSSILLGLLMPGRAAFVFPLSFLS  368

Query  819   NLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvv  640
             NL KKN  DKIS RQQ+IIWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST TVV
Sbjct  369   NLTKKNQRDKISLRQQVIIWWAGLMRGAVSMALAYNQFTRSGHTQLRANAIMITSTTTVV  428

Query  639   lfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMIT  460
             L STVVFGLMTKPLI  LLP     P   +SM +SEP+SPK   VPLL    DS  D++ 
Sbjct  429   LVSTVVFGLMTKPLIRFLLP---HSPKQTTSMLSSEPTSPKSVIVPLLGQ--DSVDDLV-  482

Query  459   GPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             G ++ RP +LR LL TPTHTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E+
Sbjct  483   GQDIRRPASLRDLLTTPTHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTER  535



>dbj|BAD93487.1| vacuolar Na+/H+ antiporter [Rosa hybrid cultivar]
Length=543

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/542 (78%), Positives = 477/542 (88%), Gaps = 6/542 (1%)
 Frame = -3

Query  1923  TKMAFGLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             + +A  ++ L +  +L  SDH+SVVS+NLFVALLCACIV+GHLLEENRWVNESITAL+IG
Sbjct  3     SHLAMLMTKLPKLQNLSASDHSSVVSLNLFVALLCACIVIGHLLEENRWVNESITALLIG  62

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             + TGV+ILL+SGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI++FGAI
Sbjct  63    VSTGVLILLISGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIVMFGAI  122

Query  1563  GTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSL  1384
             GTL+SC+II+FGA +IFK LDI  LD GDYLAIGAIFAATDSVCTLQVL QDETPLLYSL
Sbjct  123   GTLVSCTIIAFGATQIFKKLDIGSLDIGDYLAIGAIFAATDSVCTLQVLHQDETPLLYSL  182

Query  1383  VFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYI  1204
             VFGEGVVNDATSVVLFNAIQSFD+T  D +I L F+GNFLYLF +ST LGV  GLL A+I
Sbjct  183   VFGEGVVNDATSVVLFNAIQSFDLTHLDSRIALKFMGNFLYLFFASTMLGVITGLLSAFI  242

Query  1203  IKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  1024
             IKKLYF RHSTDREVALMMLM+YLSYI+AELFYLSGILTVFFCGIVMSHYTWHNVTESSR
Sbjct  243   IKKLYFARHSTDREVALMMLMAYLSYILAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  302

Query  1023  VTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAF  844
             VTT+H+FATLSFV ETFIFLYVGMDALDIEKW+FV +S G SVAVSSIL+ L+++GRAAF
Sbjct  303   VTTKHAFATLSFVCETFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLSLVMLGRAAF  362

Query  843   VFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIM  664
             VFPLSF SNL KKN S+KIS +QQ++IWWAGLMRGAVSIALAYN+FT SGHT L  NAIM
Sbjct  363   VFPLSFFSNLFKKNQSEKISLQQQVVIWWAGLMRGAVSIALAYNQFTRSGHTQLRANAIM  422

Query  663   ItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQP  484
             ITST++VVL STVVFGLMTKPLI LLL PHKQ+ S +S M  S+P SPK   VPLL    
Sbjct  423   ITSTISVVLVSTVVFGLMTKPLIRLLL-PHKQLTSTNSIM--SDPPSPKSVIVPLLGQ--  477

Query  483   DSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             DSE+D+ +G EV RP ++R LL TPTHTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E
Sbjct  478   DSEADL-SGHEVRRPASIRDLLTTPTHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTE  536

Query  303   QS  298
             ++
Sbjct  537   RN  538



>gb|AAY43006.1| Na+/H+ antiporter [Glycine max]
 gb|KHN20184.1| Sodium/hydrogen exchanger 2 [Glycine soja]
Length=546

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/546 (79%), Positives = 480/546 (88%), Gaps = 11/546 (2%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M F +S+++     L TSDHASVVSMNLFVALLC CIVLGHLLEENRW+NESITAL+IG+
Sbjct  1     MVFEISTVVSKLQTLSTSDHASVVSMNLFVALLCGCIVLGHLLEENRWMNESITALLIGV  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTG+VILL SGGKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAIG
Sbjct  61    CTGIVILLFSGGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLISC+II+ GA +IFK LD+  L+ GD+LAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISCTIITLGATQIFKRLDVGPLELGDFLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD+   DP I  HF+GNFLYLF++ST LGV  GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLNQIDPSIAGHFLGNFLYLFIASTMLGVLTGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLY GRHSTDREVALMMLM+YLSY++AEL YLSGILTVFFCGIVMSHYTWHNVTESSR+
Sbjct  241   KKLYIGRHSTDREVALMMLMAYLSYMLAELSYLSGILTVFFCGIVMSHYTWHNVTESSRI  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+HSFATLSFVAE FIFLYVGMDALDIEKWKFV +S G SVA SS+L+GLIL+GRAAFV
Sbjct  301   TTKHSFATLSFVAEIFIFLYVGMDALDIEKWKFVSDSPGTSVATSSVLLGLILLGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNLAKK+ ++KISFRQQ+IIWWAGLMRGAVSIALAYN+FT SGHTSL  NAIMI
Sbjct  361   FPLSFLSNLAKKSPNEKISFRQQVIIWWAGLMRGAVSIALAYNQFTMSGHTSLRSNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLP--PHKQMPSGHSSMT-TSEPS--SPKHFTVPLL  496
             TST+TVVLFSTVVFGL+TKPLI LLLP  PH +     SS+T T++PS  SPK  TVPLL
Sbjct  421   TSTITVVLFSTVVFGLLTKPLIRLLLPHTPHHK----ESSITITTDPSTPSPKSVTVPLL  476

Query  495   DNQPDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAG  316
              +  +SE D I G ++ RP+++R LL TPTHTVHR WRKFDD+FMRPVFGGRGFVP   G
Sbjct  477   GSAQESEVD-IDGHDIHRPSSIRALLSTPTHTVHRLWRKFDDAFMRPVFGGRGFVPIEPG  535

Query  315   SPVEQS  298
             SP E++
Sbjct  536   SPTERN  541



>ref|XP_008218158.1| PREDICTED: sodium/hydrogen exchanger 1 [Prunus mume]
Length=539

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/541 (79%), Positives = 472/541 (87%), Gaps = 8/541 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MA  LS L+     L TSDH+SVVSMNLFVALL ACIV+GHLLEENRWVNESITAL+IG+
Sbjct  1     MAAHLSYLMSKLQTLSTSDHSSVVSMNLFVALLLACIVIGHLLEENRWVNESITALLIGV  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTG+VILL+S GKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNF+TI++FGAIG
Sbjct  61    CTGIVILLISRGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFITIVMFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS  IIS GA +IFK LDI  L+ GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISFCIISLGATQIFKKLDIGSLEIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD+T  D +I LHF+GNFLYLF +ST LGV  GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLTHIDSRIALHFMGNFLYLFFTSTMLGVFAGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVALMMLM+YLSYI+AELFYLSGILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVALMMLMAYLSYILAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSFVAE FIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GR+AFV
Sbjct  301   TTKHAFATLSFVAEIFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLLMLGRSAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNLAKK+  +KIS RQQ+IIWWAGLMRGAVSIALAYN+FT SGHT L  NAI+I
Sbjct  361   FPLSFLSNLAKKSPYEKISLRQQVIIWWAGLMRGAVSIALAYNQFTRSGHTQLRPNAILI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVL STVVFGLMTKPLI  L+P  KQ     +SM  SEP++PK   VPLL    D
Sbjct  421   TSTITVVLVSTVVFGLMTKPLIRFLVPHSKQT----TSMVLSEPNTPKSIIVPLLGQ--D  474

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE D+    EV RP ++R LL TPTHTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E+
Sbjct  475   SEGDL-GSQEVRRPASIRDLLTTPTHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTER  533

Query  300   S  298
             +
Sbjct  534   N  534



>ref|NP_001237166.1| sodium/proton antiporter [Glycine max]
 gb|AAR27596.1| sodium/proton antiporter [Glycine max]
Length=546

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/546 (78%), Positives = 479/546 (88%), Gaps = 11/546 (2%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M F +S+++     L TSDHASVVSMNLFVALLC CIVLGHLLEENRW+NESITAL+IG+
Sbjct  1     MGFEISTVVSKLQTLSTSDHASVVSMNLFVALLCGCIVLGHLLEENRWMNESITALLIGV  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTG+VILL SGGKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAIG
Sbjct  61    CTGIVILLFSGGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLISC+II+ GA +IFK LD+  L+ GD+LAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISCTIITLGATQIFKRLDVGPLELGDFLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD+   DP I  HF+GNFLYLF++ST LGV  GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLNQIDPSIAGHFLGNFLYLFIASTMLGVLTGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLY GRHSTDREVALMMLM+YLSY++AEL YLSGILTVFFCGIVMSHYTWHNVTESSR+
Sbjct  241   KKLYIGRHSTDREVALMMLMAYLSYMLAELSYLSGILTVFFCGIVMSHYTWHNVTESSRI  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+HSFATLSFVAE FIFLYVGMDALDIEKWKFV +S G SVA SS+L+GLIL+GRAAFV
Sbjct  301   TTKHSFATLSFVAEIFIFLYVGMDALDIEKWKFVSDSPGTSVATSSVLLGLILLGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNLAKK+ ++KISFRQQ+IIWWAGLMRGAVSIALAYN+FT SGHTSL  NAIMI
Sbjct  361   FPLSFLSNLAKKSPNEKISFRQQVIIWWAGLMRGAVSIALAYNQFTMSGHTSLRSNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLP--PHKQMPSGHSSMT-TSEPSSP--KHFTVPLL  496
             TST+TVVLFSTVVFGL+TKPLI LLLP  PH +     SS+T  ++PS+P  K  T+PLL
Sbjct  421   TSTITVVLFSTVVFGLLTKPLIRLLLPHTPHHK----ESSITIITDPSTPSLKSVTIPLL  476

Query  495   DNQPDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAG  316
              +  +SE D I G ++ RP+++R LL TPTHTVHR WRKFDD+FMRPVFGGRGFVP   G
Sbjct  477   GSAQESEVD-IDGHDIHRPSSIRALLTTPTHTVHRLWRKFDDAFMRPVFGGRGFVPVEPG  535

Query  315   SPVEQS  298
             SP E++
Sbjct  536   SPTERN  541



>gb|AIL23819.1| NHX1 [Morus notabilis]
Length=547

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/530 (79%), Positives = 466/530 (88%), Gaps = 7/530 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDH+S+VSMNLFVALL ACIV+GHLLEENRW+NESITALIIG+CTG+VILL+SGGKS
Sbjct  15    LSTSDHSSIVSMNLFVALLLACIVIGHLLEENRWMNESITALIIGVCTGIVILLISGGKS  74

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNF+TI+LFGA+GTLISC+II+ GA +
Sbjct  75    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFITIVLFGAVGTLISCTIIALGATQ  134

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI  LD GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  135   FFKKLDIGTLDVGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  194

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQ+FD+T  + +I   FIGNFLYLF +ST LGV  GLL AYIIKKLYFGRHSTDREV
Sbjct  195   FNAIQNFDLTRINSQIAFKFIGNFLYLFATSTLLGVFTGLLSAYIIKKLYFGRHSTDREV  254

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSFVAE
Sbjct  255   ALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFVAE  314

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              FIFLYVGMDALDIEKW++V +S G SVAVSSIL+ L+L+GRAAF+FPLSFLSNLAKKN 
Sbjct  315   IFIFLYVGMDALDIEKWRYVSDSPGTSVAVSSILLALVLIGRAAFIFPLSFLSNLAKKNP  374

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
               KIS R+Q+IIWWAGLMRGAVS+ALAYN+FT +GHT L  NAIMITST+TVVL STVVF
Sbjct  375   HKKISLREQVIIWWAGLMRGAVSMALAYNQFTRAGHTQLRANAIMITSTITVVLVSTVVF  434

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGP---EV  448
             GLMTKPLI  LLP     P   +SMT S+PSSPK F  PLL+   DSE+D+  G    +V
Sbjct  435   GLMTKPLIRFLLP----HPKHTTSMTISDPSSPKSFLTPLLETGLDSEADLGLGGHEHDV  490

Query  447   ARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              RP ++R LL TPT +VHRYWRKFDD+FMRPVFGGRGFVPFV GSP E+S
Sbjct  491   PRPNSIRALLTTPTRSVHRYWRKFDDAFMRPVFGGRGFVPFVPGSPTERS  540



>ref|XP_009766186.1| PREDICTED: sodium/hydrogen exchanger 2-like [Nicotiana sylvestris]
 ref|XP_009766192.1| PREDICTED: sodium/hydrogen exchanger 2-like [Nicotiana sylvestris]
Length=538

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/542 (76%), Positives = 468/542 (86%), Gaps = 8/542 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQN--SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             MAF +  LL N  + L TSDH SVVS+NLFVAL+CACIV+GHLLEENRW+NESITAL+IG
Sbjct  1     MAFDIGMLLGNIMNRLSTSDHQSVVSINLFVALICACIVVGHLLEENRWMNESITALVIG  60

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             LCTGVVILL+SGGK+S +LVFSEDLFFIYLLPPIIFNAGFQVKKK FF NF TIMLFGA+
Sbjct  61    LCTGVVILLISGGKNSRILVFSEDLFFIYLLPPIIFNAGFQVKKKSFFRNFSTIMLFGAV  120

Query  1563  GTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSL  1384
             GTLIS  IISFGA+ IFK ++I  LD GDYLAIGAIF+ATDSVCTLQVLSQD+TPLLYSL
Sbjct  121   GTLISFIIISFGAIGIFKKMNIGDLDIGDYLAIGAIFSATDSVCTLQVLSQDDTPLLYSL  180

Query  1383  VFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYI  1204
             VFGEGVVNDATSVVLFNA+Q+FD++  +    L  +GNFLYLF SST LGV  GLL AYI
Sbjct  181   VFGEGVVNDATSVVLFNAVQNFDLSHINTSKALQLVGNFLYLFASSTILGVVAGLLSAYI  240

Query  1203  IKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  1024
             IKKLYFGRHSTDREVA+M+LM+YLSY++AELFYLS ILTVFFCGIVMSHYTWHNVTESSR
Sbjct  241   IKKLYFGRHSTDREVAIMILMAYLSYLLAELFYLSAILTVFFCGIVMSHYTWHNVTESSR  300

Query  1023  VTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAF  844
             VTT+H+FATLSF+AE FIFLYVGMDALDIEKWKFV +S G+SV VSSIL+GL++VGRAAF
Sbjct  301   VTTKHAFATLSFIAEIFIFLYVGMDALDIEKWKFVSDSPGISVQVSSILLGLVMVGRAAF  360

Query  843   VFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIM  664
             VFPLSFLSNL KK+  +KI F +QI+IWWAGLMRGAVS+ALAYN+FT  GHT L  NAIM
Sbjct  361   VFPLSFLSNLTKKSPEEKIGFNKQIVIWWAGLMRGAVSVALAYNQFTRGGHTQLRGNAIM  420

Query  663   ItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQP  484
             ITST+TVVLFST VFGLMTKPLI  +LP  K +    + M +SEP++PK F VPLLD+  
Sbjct  421   ITSTITVVLFSTGVFGLMTKPLIRFMLPSPKHL----TRMISSEPTTPKSFIVPLLDSAQ  476

Query  483   DSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             DSE+D+  G  + RP +LRMLL TP+HTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E
Sbjct  477   DSEADL--GQHIPRPNSLRMLLSTPSHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTE  534

Query  303   QS  298
              S
Sbjct  535   PS  536



>gb|AFO54606.1| vacuolar Na+/H+ antiporter [Malus zumi]
Length=542

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/535 (79%), Positives = 463/535 (87%), Gaps = 8/535 (1%)
 Frame = -3

Query  1905  LSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVV  1726
             L S LQN  L TSDH+SVVSMNLFVALL ACIV+GHLLEENRWVNESITAL+IG+CTGVV
Sbjct  9     LISKLQN--LSTSDHSSVVSMNLFVALLLACIVIGHLLEENRWVNESITALLIGICTGVV  66

Query  1725  IlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISC  1546
             ILL+S GKSSHLLVFSEDLFFI LLPPIIFNAGFQVKKKQFFVNF TI+LFGAIGTL+SC
Sbjct  67    ILLISRGKSSHLLVFSEDLFFICLLPPIIFNAGFQVKKKQFFVNFSTIVLFGAIGTLVSC  126

Query  1545  SIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGV  1366
             +IIS GA + FK LDI  L+ GD+LAIGAIFAATDSVC LQVL+QDETPLLYSLVFGEGV
Sbjct  127   TIISLGATQFFKKLDIGTLELGDFLAIGAIFAATDSVCMLQVLNQDETPLLYSLVFGEGV  186

Query  1365  VNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYF  1186
             VNDATSVVLFN IQSFD+T  D  I LHF+GNF YLF +ST LGV  GLL AYIIKKLYF
Sbjct  187   VNDATSVVLFNTIQSFDLTHLDSGIALHFLGNFFYLFFASTMLGVFAGLLSAYIIKKLYF  246

Query  1185  GRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHS  1006
             GRHSTDREVALMMLM+YLSYI+AELFYLSGILTVFFCGIVMSHYTWHNVTESSR TT+H+
Sbjct  247   GRHSTDREVALMMLMAYLSYILAELFYLSGILTVFFCGIVMSHYTWHNVTESSRATTKHA  306

Query  1005  FATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSF  826
             FATLSFVAE FIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GLI++GRAAFVFPLSF
Sbjct  307   FATLSFVAEIFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLIMLGRAAFVFPLSF  366

Query  825   LSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvt  646
             LSNL KKN  DKIS RQQ+IIWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST+T
Sbjct  367   LSNLTKKNQHDKISLRQQVIIWWAGLMRGAVSMALAYNQFTRSGHTQLRANAIMITSTIT  426

Query  645   vvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDM  466
             VVL STVVFGLMTKPLI  LLP     P   +SM +SEP+SPK   VPLL    DS  D+
Sbjct  427   VVLVSTVVFGLMTKPLIRFLLP---HSPKQTTSMLSSEPTSPKSVIVPLLGQ--DSVDDL  481

Query  465   ITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             + G +  RP +LR LL TPTHTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E+
Sbjct  482   V-GQDFPRPASLRDLLTTPTHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTER  535



>gb|AFD97541.1| vacuolar Na+/H+ antiporter (chloroplast) [Sesuvium portulacastrum]
Length=554

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/547 (77%), Positives = 472/547 (86%), Gaps = 9/547 (2%)
 Frame = -3

Query  1917  MAFGLSSLLQN--SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             M F LSSL+ N    L TSDHASVVSMNLFVALLCACIV+GHLLEENRW+NESITAL+IG
Sbjct  1     MGFELSSLISNKLQMLSTSDHASVVSMNLFVALLCACIVIGHLLEENRWMNESITALMIG  60

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             L TG+VILL+SGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI+LFGA+
Sbjct  61    LATGIVILLVSGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIILFGAL  120

Query  1563  GTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSL  1384
             GTL+S +IIS GA++ FK LDI  LD GDYLAIGA FAATDSVCTLQVL+QDETPLLYSL
Sbjct  121   GTLVSFTIISLGAMEFFKKLDIGSLDLGDYLAIGATFAATDSVCTLQVLNQDETPLLYSL  180

Query  1383  VFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYI  1204
             VFGEGVVNDATSVVLFNAIQ+FD+T  D +I L F GNFLYLF +ST LG   GLL AYI
Sbjct  181   VFGEGVVNDATSVVLFNAIQNFDLTRIDHRIALKFFGNFLYLFFASTLLGAITGLLSAYI  240

Query  1203  IKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  1024
             IKKLYFGRHSTDREVALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSR
Sbjct  241   IKKLYFGRHSTDREVALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  300

Query  1023  VTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAF  844
             VTT+H+FATLSFVAETFIFLYVGMDALDIEKW+FV +S G+SVAVSSI +GL++VGRAAF
Sbjct  301   VTTKHAFATLSFVAETFIFLYVGMDALDIEKWRFVSDSPGISVAVSSISMGLVMVGRAAF  360

Query  843   VFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIM  664
             VFPLSFL N +KK+ S+K+S RQQ+IIWWAGLMRGAVS+ALAYN+FT +GHT L  NAIM
Sbjct  361   VFPLSFLMNFSKKSQSEKVSIRQQVIIWWAGLMRGAVSMALAYNQFTRAGHTQLRGNAIM  420

Query  663   ItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQP  484
             ITST++VVL STVVFGL+TKPLI  LLP  K   S  +S  +S+  SPK  ++PLL +Q 
Sbjct  421   ITSTISVVLSSTVVFGLLTKPLILFLLPQPKHFHS--TSTVSSDLGSPKSLSLPLLGSQQ  478

Query  483   DSESDM-----ITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVA  319
             +SE+D+      T   + RP+ LRMLL  PTHTVH YWRKFDDSFMRPVFGGRGFVP+V 
Sbjct  479   ESETDLGNHQGTTDGGIGRPSRLRMLLNAPTHTVHYYWRKFDDSFMRPVFGGRGFVPYVP  538

Query  318   GSPVEQS  298
             GSP EQS
Sbjct  539   GSPTEQS  545



>ref|XP_009624940.1| PREDICTED: sodium/hydrogen exchanger 2-like [Nicotiana tomentosiformis]
 ref|XP_009624945.1| PREDICTED: sodium/hydrogen exchanger 2-like [Nicotiana tomentosiformis]
Length=538

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/542 (76%), Positives = 468/542 (86%), Gaps = 8/542 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQN--SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             MAF +  LL N  + L TSDH SVVS+NLFVAL+CACIV+GHLLEENRW+NESITAL+IG
Sbjct  1     MAFDVGMLLGNIMNRLSTSDHQSVVSINLFVALICACIVVGHLLEENRWMNESITALLIG  60

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             LCTGVVILL+SGGK+S +LVFSEDLFFIYLLPPIIFNAGFQVKKK FF NF TIMLFGA+
Sbjct  61    LCTGVVILLISGGKNSRILVFSEDLFFIYLLPPIIFNAGFQVKKKSFFRNFSTIMLFGAV  120

Query  1563  GTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSL  1384
             GTLIS  IISFGA+ IFK ++I  LD GDYLAIGAIF+ATDSVCTLQVLSQD+TPLLYSL
Sbjct  121   GTLISFIIISFGAIGIFKKMNIGDLDIGDYLAIGAIFSATDSVCTLQVLSQDDTPLLYSL  180

Query  1383  VFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYI  1204
             VFGEGVVNDATSVVLFNA+Q+FD++  +    L  +GNFLYLF SST LGV  GLL AYI
Sbjct  181   VFGEGVVNDATSVVLFNAVQNFDLSHINTSKALQLVGNFLYLFASSTILGVVAGLLSAYI  240

Query  1203  IKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  1024
             IKKLYFGRHSTDREVA+M+LM+YLSY++AELFYLS ILTVFFCGIVMSHYTWHNVTESSR
Sbjct  241   IKKLYFGRHSTDREVAIMILMAYLSYLLAELFYLSAILTVFFCGIVMSHYTWHNVTESSR  300

Query  1023  VTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAF  844
             VTT+H+FATLSF+AE FIFLYVGMDALDIEKWKFV +S G+SV VSSIL+GL++VGRAAF
Sbjct  301   VTTKHAFATLSFIAEIFIFLYVGMDALDIEKWKFVSDSPGISVQVSSILLGLVMVGRAAF  360

Query  843   VFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIM  664
             VFPLSFLSNL KK+  +KI F +QI+IWWAGLMRGAVS+ALAYN+FT  GHT L  NAIM
Sbjct  361   VFPLSFLSNLTKKSPEEKIGFNKQIVIWWAGLMRGAVSVALAYNQFTRGGHTQLRGNAIM  420

Query  663   ItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQP  484
             ITST+TVVLFST VFGLMTKPLI  +LP  K +    + M +SEP++PK F VPLLD+  
Sbjct  421   ITSTITVVLFSTGVFGLMTKPLIRFMLPSPKHL----TRMISSEPTTPKSFIVPLLDSAQ  476

Query  483   DSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             DSE+D+  G  + RP +LRMLL TP+HTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E
Sbjct  477   DSEADL--GQHIPRPNSLRMLLSTPSHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTE  534

Query  303   QS  298
              S
Sbjct  535   PS  536



>gb|KDO75034.1| hypothetical protein CISIN_1g009116mg [Citrus sinensis]
Length=543

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/541 (76%), Positives = 469/541 (87%), Gaps = 6/541 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNS-DLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MA  LS+L++ S  + +SDH SVVSMNLFVALLCACIV+GHLLEENRW+NESITALIIGL
Sbjct  1     MAIELSNLMERSLSMLSSDHKSVVSMNLFVALLCACIVIGHLLEENRWMNESITALIIGL  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTG+VILL + G SSH+L+FSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+G
Sbjct  61    CTGIVILLTTNGTSSHVLMFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS  IIS GAV  FK ++I  L  GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISFVIISAGAVHFFKQMNIGTLKIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD++  +  I L F+G+F YLF++ST LGV  GLL A+II
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLSHINLSIALKFVGSFFYLFIASTMLGVIAGLLSAFII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLY GRHSTDREVALM+LM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLYMGRHSTDREVALMILMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSFVAE FIFLYVGMDALDIEKW+ V++S G SV VS+IL+GL+L+GRAAFV
Sbjct  301   TTKHAFATLSFVAEIFIFLYVGMDALDIEKWRVVRDSPGKSVGVSAILLGLVLLGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KK+S +KI  +QQ+ IWWAGLMRGAVS+ALAY +FT+SGHT LH NAIMI
Sbjct  361   FPLSFLSNLTKKSSHEKIGLKQQLTIWWAGLMRGAVSMALAYKQFTSSGHTKLHGNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFSTVVFGLMT+PL+ +LLP  K +    S M + E S+PK F VPLL N   
Sbjct  421   TSTITVVLFSTVVFGLMTQPLVRILLPSSKNL----SRMLSDESSTPKSFIVPLLGNGQG  476

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE+D+ T P V RPT+LRMLL TP+HTVH YWRKFDD+FMRPVFGGRGFVP V GSP+EQ
Sbjct  477   SEADLKT-PNVTRPTSLRMLLATPSHTVHHYWRKFDDAFMRPVFGGRGFVPVVPGSPLEQ  535

Query  300   S  298
             S
Sbjct  536   S  536



>emb|CAN99589.1| vacuolar Na+/H+ antiporter [Mesembryanthemum crystallinum]
Length=556

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/547 (77%), Positives = 471/547 (86%), Gaps = 9/547 (2%)
 Frame = -3

Query  1917  MAFGLSSLLQN--SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             MAF LS+L+      L TSDHASVVSMNLFVALLC CIV+GHLLEENRW+NESITAL IG
Sbjct  1     MAFDLSNLVSTKLQMLSTSDHASVVSMNLFVALLCGCIVIGHLLEENRWMNESITALAIG  60

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             L TGVVILL SGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI++FGA+
Sbjct  61    LATGVVILLFSGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIIVFGAL  120

Query  1563  GTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSL  1384
             GTL+S +IIS GA++ FK LDI  L+ GDYLAIGAIFAATDSVCTLQVL QDETPLLYSL
Sbjct  121   GTLVSFTIISLGAMEFFKKLDIGSLELGDYLAIGAIFAATDSVCTLQVLHQDETPLLYSL  180

Query  1383  VFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYI  1204
             VFGEGVVNDATSVVLFNAIQ+FD+T  D +I   F GNFLYLF +ST LG   GLL AYI
Sbjct  181   VFGEGVVNDATSVVLFNAIQNFDLTHIDHRIAFKFAGNFLYLFFTSTLLGAITGLLSAYI  240

Query  1203  IKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  1024
             IKKLYFGRHSTDREVALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSR
Sbjct  241   IKKLYFGRHSTDREVALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  300

Query  1023  VTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAF  844
             VTT+H+FATLSFVAETFIFLYVGMDALDIEKW+FV +S G+SVAVS+IL+GL+++GRAAF
Sbjct  301   VTTKHAFATLSFVAETFIFLYVGMDALDIEKWRFVSDSPGISVAVSAILLGLLMLGRAAF  360

Query  843   VFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIM  664
             VFPLSFL N +KK+ S+K+SFRQQ+IIWWAGLMRGAVS+ALAYN+FT +GHT L  NAIM
Sbjct  361   VFPLSFLMNFSKKSQSEKVSFRQQVIIWWAGLMRGAVSMALAYNQFTRAGHTQLRGNAIM  420

Query  663   ItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQP  484
             ITST++VVL STVVFGL+TKPLI  LLP  K   S  +S  +++  SPK FT+PLL +  
Sbjct  421   ITSTISVVLVSTVVFGLLTKPLILFLLPQPKHFNS--TSTVSTDLGSPKSFTLPLLGDHQ  478

Query  483   DSESDM-----ITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVA  319
             DSE+D+      T   + RPT+LRMLL  PTHTVH YWRKFDDSFMRPVFGGRGFVPFV 
Sbjct  479   DSETDLGNHQDSTDRHIGRPTSLRMLLNAPTHTVHYYWRKFDDSFMRPVFGGRGFVPFVP  538

Query  318   GSPVEQS  298
             GSP EQS
Sbjct  539   GSPTEQS  545



>gb|AEO50758.1| vacuolar sodium proton antiporter [Vigna radiata]
Length=542

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/544 (78%), Positives = 477/544 (88%), Gaps = 11/544 (2%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLF-TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M F +SS++    +  TSDHASVVSMNLFVALLCACIV+GHLLEENRW+NESITAL+IG+
Sbjct  1     MVFEISSVVSKLQMVSTSDHASVVSMNLFVALLCACIVIGHLLEENRWMNESITALLIGI  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
              TGVVILLLSGGKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTI+LFGAIG
Sbjct  61    STGVVILLLSGGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIILFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLISC++I+ GA +IF+ LDI  L+ GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISCAVITLGASQIFEKLDIGPLELGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD+   D  I LHF+GNFLYLF++ST LGV  GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLDHIDSSIALHFLGNFLYLFVASTMLGVLTGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLY GRHSTDREVALMMLM+YLSY++AEL YLSGILTVFFCGIVMSHYTWHNVTESSR+
Sbjct  241   KKLYIGRHSTDREVALMMLMAYLSYMLAELCYLSGILTVFFCGIVMSHYTWHNVTESSRI  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+HSFATLSFVAE FIFLYVGMDALDIEKWKFV +S G S+A SS+L+GL+LVGRAAFV
Sbjct  301   TTKHSFATLSFVAEIFIFLYVGMDALDIEKWKFVSDSPGTSIAASSVLLGLVLVGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNLAKK+ ++KISFRQQ+IIWWAGLMRGAVS+ALAYN+FT SGHTSL  NA+MI
Sbjct  361   FPLSFLSNLAKKSPNEKISFRQQVIIWWAGLMRGAVSMALAYNQFTMSGHTSLRSNAVMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLL---PPHKQMPSGHSSMTTSEPSSPKHFTVPLLDN  490
             TST+TVVLFSTVVFGLMTKPLI LLL   P HK++    + +  ++ S+PK  TVPLL +
Sbjct  421   TSTITVVLFSTVVFGLMTKPLIRLLLPHTPKHKEI----NIVIATDASTPKSATVPLLGS  476

Query  489   QPDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSP  310
               DSE D+     + RP+++R LLRTPTHTVHR WRKFDD+FMRPVFGGRGFVP   GSP
Sbjct  477   AQDSEVDI---DSIHRPSSIRALLRTPTHTVHRLWRKFDDAFMRPVFGGRGFVPVEPGSP  533

Query  309   VEQS  298
              E++
Sbjct  534   SERN  537



>gb|AEO72079.2| vacuolar sodium proton antiporter [Vigna unguiculata]
Length=542

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/544 (77%), Positives = 475/544 (87%), Gaps = 11/544 (2%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLF-TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M F +SS++    +  TSDHASVVSMNLFVALLCACIV+GHLLEENRW+NESITAL+IG+
Sbjct  1     MVFEISSVVSKLQMVSTSDHASVVSMNLFVALLCACIVIGHLLEENRWMNESITALMIGI  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
              TGV+ILL SGGKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAIG
Sbjct  61    STGVIILLFSGGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLISC++I+ GA +IF+ LDI  L+ GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISCAVITLGASQIFEKLDIGPLELGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD+   DP I LHF+GNFL LF++ST LGV  GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLNHIDPSIALHFLGNFLCLFVASTMLGVLTGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLY GRHSTDREVALMMLM+YLSY++AEL YLSGILTVFFCGIVMSHYTWHNVTESSR+
Sbjct  241   KKLYIGRHSTDREVALMMLMAYLSYMLAELCYLSGILTVFFCGIVMSHYTWHNVTESSRI  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+HSFATLSFVAE FIFLYVGMDALDIEKWKFV +S G S+A SS+L+GLILVGRAAFV
Sbjct  301   TTKHSFATLSFVAEIFIFLYVGMDALDIEKWKFVSDSPGTSIAASSVLLGLILVGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSF+SNLAKK+ ++KISFRQQ+IIWWAGLMRGAVS+ALAYN+FT SGHTSL  NAIMI
Sbjct  361   FPLSFISNLAKKSPNEKISFRQQVIIWWAGLMRGAVSMALAYNQFTMSGHTSLRSNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLL---PPHKQMPSGHSSMTTSEPSSPKHFTVPLLDN  490
             TST+TVVL STVVFGLMTKPLI LLL   P HK++    + +  ++ S+PK  TVPLL +
Sbjct  421   TSTITVVLVSTVVFGLMTKPLIRLLLPHTPNHKEI----NIVIATDTSTPKSATVPLLGS  476

Query  489   QPDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSP  310
               DSE D+     + RP+++R LLRTPTHTVHR WRKFDD+FMRPVFGGRGFVP   GSP
Sbjct  477   AQDSEVDI---DPIHRPSSIRALLRTPTHTVHRLWRKFDDAFMRPVFGGRGFVPVEPGSP  533

Query  309   VEQS  298
              E++
Sbjct  534   SERN  537



>ref|XP_002307194.2| Na+/H+ antiporter family protein [Populus trichocarpa]
 gb|EEE94190.2| Na+/H+ antiporter family protein [Populus trichocarpa]
Length=544

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/527 (79%), Positives = 468/527 (89%), Gaps = 3/527 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVSMNLFVALLCACIV+GHLLEENRW+NESITALIIGLCTGVVILL+SGGKS
Sbjct  15    LTTSDHASVVSMNLFVALLCACIVIGHLLEENRWMNESITALIIGLCTGVVILLISGGKS  74

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+GTLISC +IS GA++
Sbjct  75    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVGTLISCFVISLGAMQ  134

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI  LD GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  135   FFKKLDIGPLDIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  194

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T+ +  I   F+ NF YLFL+ST LGV  GL+ AYII++LYFGRHSTDREV
Sbjct  195   FNAIQSFDLTNINAAIAWDFVRNFFYLFLASTLLGVLTGLVSAYIIRRLYFGRHSTDREV  254

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALM+LM+YLSY+MAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  255   ALMILMAYLSYMMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAE  314

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL++VGRAAFVFPLSFLSNL KK+ 
Sbjct  315   TFIFLYVGMDALDIEKWRFVSHSPGTSVAVSSILLGLLMVGRAAFVFPLSFLSNLTKKSP  374

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             ++KISF+QQ IIWWAGLMRGAVS+ALAYNKFT++GHT L  NAIMITST+TVVLFSTVVF
Sbjct  375   NEKISFKQQFIIWWAGLMRGAVSMALAYNKFTSAGHTHLRGNAIMITSTITVVLFSTVVF  434

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             GLMT+PLI +LLP  K      S   +S+P++PK FT+PLL    DS  D+  G ++  P
Sbjct  435   GLMTQPLIKILLPHPKH--QSRSMTISSDPTTPKSFTIPLLGEGQDSLDDL-GGHDIDHP  491

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             +++R LL TPTHTVH YWRKFDD+FMRP+FGGRGFVPFV GSP E++
Sbjct  492   SSIRSLLTTPTHTVHHYWRKFDDAFMRPMFGGRGFVPFVPGSPTERN  538



>ref|XP_010649604.1| PREDICTED: nhx1 antiporter isoform X1 [Vitis vinifera]
 emb|CAN61480.1| hypothetical protein VITISV_010931 [Vitis vinifera]
 emb|CBI26120.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/539 (76%), Positives = 465/539 (86%), Gaps = 6/539 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLF-TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M F L S++    +  TSDH+SVVSMNLFVALLCACIV+GHLLEE RW+NESITAL +GL
Sbjct  1     MGFELGSVVMKLGMVSTSDHSSVVSMNLFVALLCACIVVGHLLEEYRWMNESITALALGL  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTG++ILL + GKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGAIG
Sbjct  61    CTGIIILLTTRGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS  IIS GA+  FK + I  LD GDYLA+GAIF+ATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISFGIISLGAIHFFKKMKIGSLDIGDYLALGAIFSATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD++  D  I L FIGNFLYLF++ST LGV  GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLSHIDSSIALQFIGNFLYLFITSTMLGVFAGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVA+M+LM+YLSY++AELFYLS ILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVAIMILMAYLSYMLAELFYLSAILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSFVAE FIFLYVGMDALDIEKW+FV +S G S+ VSSIL+GL+LVGRAAFV
Sbjct  301   TTKHAFATLSFVAEIFIFLYVGMDALDIEKWRFVSDSPGKSIGVSSILLGLVLVGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KK+SS+KI  +QQ+ IWWAGLMRGAVS+ALAYN+FT +GHT L  NAIMI
Sbjct  361   FPLSFLSNLTKKSSSEKIHIKQQVTIWWAGLMRGAVSMALAYNQFTRAGHTQLRGNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST++VVLFSTVVFGLMTKPL+ LLLP     P   +SM +SEPSSPK+  VPL+ N  +
Sbjct  421   TSTISVVLFSTVVFGLMTKPLVRLLLPS----PKPFTSMISSEPSSPKYLVVPLIGNGEE  476

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             +E+D  +   V RPT+LRMLL TP+HTVH YWRKFDDSFMRPVFGGRGF PF+ GSP E
Sbjct  477   TETDQAS-QNVPRPTSLRMLLSTPSHTVHHYWRKFDDSFMRPVFGGRGFTPFIPGSPTE  534



>ref|XP_006489167.1| PREDICTED: sodium/hydrogen exchanger 2-like [Citrus sinensis]
Length=543

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/541 (76%), Positives = 468/541 (87%), Gaps = 6/541 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNS-DLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MA  LS+L++ S  + +SDH SVVSMNLFVALLCACIV+GHLLEENRW+NESITALIIGL
Sbjct  1     MAIELSNLMERSLSMLSSDHKSVVSMNLFVALLCACIVIGHLLEENRWMNESITALIIGL  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTG+VILL + G SSH+L+FSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+G
Sbjct  61    CTGIVILLTTNGTSSHVLMFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS  IIS GAV  FK ++I  L  GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISFVIISAGAVHFFKQMNIGTLKIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD++  +  I L F+G+F YLF++ST LGV  GLL A+II
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLSHINLSIALKFVGSFFYLFIASTMLGVIAGLLSAFII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLY GRHSTDREVALM+LM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLYMGRHSTDREVALMILMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSFVAE FIFLYVGMDALDIEKW+ V++S G SV VS+IL+GL+L+GRAAFV
Sbjct  301   TTKHAFATLSFVAEIFIFLYVGMDALDIEKWRVVRDSPGKSVGVSAILLGLVLLGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
              PLSFLSNL KK+S +KI  +QQ+ IWWAGLMRGAVS+ALAY +FT+SGHT LH NAIMI
Sbjct  361   LPLSFLSNLTKKSSHEKIGLKQQLTIWWAGLMRGAVSMALAYKQFTSSGHTKLHGNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFSTVVFGLMT+PL+ +LLP  K +    S M + E S+PK F VPLL N   
Sbjct  421   TSTITVVLFSTVVFGLMTQPLVRILLPSSKNL----SRMLSDESSTPKSFIVPLLGNGQG  476

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE+D+ T P V RPT+LRMLL TP+HTVH YWRKFDD+FMRPVFGGRGFVP V GSP+EQ
Sbjct  477   SEADLKT-PNVTRPTSLRMLLATPSHTVHHYWRKFDDAFMRPVFGGRGFVPVVPGSPLEQ  535

Query  300   S  298
             S
Sbjct  536   S  536



>gb|ADK74832.1| Na+/H+ antiporter [Arachis hypogaea]
Length=539

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/543 (77%), Positives = 472/543 (87%), Gaps = 12/543 (2%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M F L +++    +L TSDH+SVVSMN+FVALLCACIV+GHLLEENRW+NESITAL+IG+
Sbjct  1     MGFELDAVVSKLQNLATSDHSSVVSMNIFVALLCACIVIGHLLEENRWMNESITALLIGV  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTGV ILL SGG  SH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNF+TIM+FGA+G
Sbjct  61    CTGVFILLASGGTHSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFITIMMFGAVG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLISC+II+FG  +IFK +DI  ++ GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISCTIITFGVTQIFKRMDIGPMEIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD+   DP I L FIGNFLYLFL+ST LGVG GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLEQIDPSIALQFIGNFLYLFLTSTLLGVGAGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLY GRHSTDREVALMMLM+YLSY++AEL YLSGILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLYIGRHSTDREVALMMLMAYLSYMVAELCYLSGILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FAT+SFVAE F+FLYVGMDALDIEKW FV +  G SVAVS++L+GL+LVGRAAFV
Sbjct  301   TTKHAFATISFVAEIFLFLYVGMDALDIEKWSFVSDRPGTSVAVSAVLMGLVLVGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNLAKK+SS+KI+FRQQ+IIWWAGLMRGAVS+ALAYN+FT SGHT    NAIMI
Sbjct  361   FPLSFLSNLAKKSSSEKITFRQQVIIWWAGLMRGAVSMALAYNQFTMSGHTQQQSNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLP--PHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQ  487
             TST+TVVLFSTVVFGLMTKPLI LLLP  PHK   S +S +      SPK  TVPLL  +
Sbjct  421   TSTITVVLFSTVVFGLMTKPLIMLLLPPDPHKGTSSTNSIL------SPKSVTVPLLAQE  474

Query  486   PDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPV  307
               SE+D+  G EV+RP+++R LL  PTHTVHR WRKFDDSFMRPVFGGRGFVP   GSP 
Sbjct  475   --SEADL-EGHEVSRPSSIRNLLTRPTHTVHRLWRKFDDSFMRPVFGGRGFVPVEPGSPT  531

Query  306   EQS  298
             E++
Sbjct  532   ERN  534



>ref|XP_010672472.1| PREDICTED: sodium/hydrogen exchanger 1-like [Beta vulgaris subsp. 
vulgaris]
Length=552

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/534 (78%), Positives = 467/534 (87%), Gaps = 8/534 (1%)
 Frame = -3

Query  1884  SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsgg  1705
             + L TSDHAS+VSMNLFVALLC CIVLGHLLEENRW+NESITAL+IGL TGVVILL+SGG
Sbjct  14    NSLSTSDHASIVSMNLFVALLCGCIVLGHLLEENRWMNESITALLIGLSTGVVILLISGG  73

Query  1704  ksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGA  1525
             KSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI++FGAIGTLIS +IIS GA
Sbjct  74    KSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIIMFGAIGTLISFTIISLGA  133

Query  1524  VKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSV  1345
             + IFK +DI  L+ GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSV
Sbjct  134   MTIFKEMDIGSLELGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSV  193

Query  1344  VLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDR  1165
             VLFNAIQSFD+T  D +I L F GNFLYLF +ST LG   GLL AYIIKKLYFGRHSTDR
Sbjct  194   VLFNAIQSFDLTHIDHRIALQFSGNFLYLFFASTLLGAMTGLLSAYIIKKLYFGRHSTDR  253

Query  1164  EVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFV  985
             EVALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFV
Sbjct  254   EVALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFV  313

Query  984   AETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKK  805
             AE F+FLYVGMDALDIEKW+FV +S G S+AVSSIL+GL++VGRAAFVFPLS L NL+KK
Sbjct  314   AEIFLFLYVGMDALDIEKWRFVSDSPGTSIAVSSILIGLVMVGRAAFVFPLSLLMNLSKK  373

Query  804   NSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstv  625
             + S+K++F QQ++IWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST++VVLFST+
Sbjct  374   SHSEKVTFNQQVVIWWAGLMRGAVSMALAYNQFTRSGHTQLRGNAIMITSTISVVLFSTM  433

Query  624   vFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDM-----IT  460
             VFGL+TKPLI+ LLP  K   S     T S+  SPK F++PLL+++ DSE+DM      T
Sbjct  434   VFGLLTKPLISFLLPHPKHFTSAS---TVSDMGSPKSFSLPLLEDRQDSEADMGNYEEST  490

Query  459   GPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
                + RP +LRMLL  PTHTVH YWRKFDDSFMRPVFGGRGFVP+V GSP+EQS
Sbjct  491   NRSIPRPGSLRMLLNAPTHTVHFYWRKFDDSFMRPVFGGRGFVPYVPGSPIEQS  544



>gb|ADB92598.1| vacuolar Na+/H+ antiporter [Malus domestica]
Length=544

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/538 (78%), Positives = 467/538 (87%), Gaps = 10/538 (2%)
 Frame = -3

Query  1905  LSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVV  1726
             L S LQN  L TSDH+SVVSMNLFVALL ACIV+GHLLEENRWVNESITAL+IG+CTGVV
Sbjct  9     LISKLQN--LSTSDHSSVVSMNLFVALLLACIVIGHLLEENRWVNESITALLIGICTGVV  66

Query  1725  IlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISC  1546
             ILL+S GKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNF TI+LFGAIGTL+SC
Sbjct  67    ILLISRGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFSTIVLFGAIGTLVSC  126

Query  1545  SIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGV  1366
             +IIS GA + FK LDI  L+ GD+LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGV
Sbjct  127   TIISLGATQFFKKLDIGTLELGDFLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGV  186

Query  1365  VNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYF  1186
             VNDATSVVLFNAIQSFD+T  D  I LHF+GNF YLF +ST LGV  GLL AYIIKKLYF
Sbjct  187   VNDATSVVLFNAIQSFDLTHLDSSIALHFLGNFFYLFFASTMLGVFAGLLSAYIIKKLYF  246

Query  1185  GRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHS  1006
              RHSTDREVALMMLM+YLSYI+AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+
Sbjct  247   ARHSTDREVALMMLMAYLSYILAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHA  306

Query  1005  FATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSF  826
             FATLSFVAE FIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAF+FPLSF
Sbjct  307   FATLSFVAEIFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLLMLGRAAFIFPLSF  366

Query  825   LSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvt  646
             LSNLAKKN  +KIS RQQ+IIWWAGLMRGAVSIALAYN+FT SGHT L  NAIMITST+T
Sbjct  367   LSNLAKKNQHEKISLRQQVIIWWAGLMRGAVSIALAYNQFTRSGHTQLRANAIMITSTIT  426

Query  645   vvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDM  466
             VVL STVVFGLMTKPLI  LLP   +     +SM +SEP++PK   +PLL    DS  D+
Sbjct  427   VVLVSTVVFGLMTKPLIRFLLPHSSKQT---TSMLSSEPTTPKSIIIPLLGQ--DSVDDL  481

Query  465   ITGPEVARPTALRMLLRTP--THTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             +   ++ RP ++R LL TP   HTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E++
Sbjct  482   VI-QDIRRPASIRDLLTTPFNRHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTERN  538



>ref|XP_008359889.1| PREDICTED: LOW QUALITY PROTEIN: sodium/hydrogen exchanger 2-like 
[Malus domestica]
Length=544

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/538 (78%), Positives = 467/538 (87%), Gaps = 10/538 (2%)
 Frame = -3

Query  1905  LSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVV  1726
             L S LQN  L TSDH+SVVSMNLFVALL ACIV+GHLLEENRWVNESITAL+IG+CTGVV
Sbjct  9     LISKLQN--LSTSDHSSVVSMNLFVALLLACIVIGHLLEENRWVNESITALLIGICTGVV  66

Query  1725  IlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISC  1546
             ILL+S GKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNF TI+LFGAIGTL+SC
Sbjct  67    ILLISRGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFSTIVLFGAIGTLVSC  126

Query  1545  SIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGV  1366
             +IIS GA + FK LDI  L+ GD+LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGV
Sbjct  127   TIISLGATQFFKKLDIGTLELGDFLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGV  186

Query  1365  VNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYF  1186
             VNDATSVVLFNAIQSFD+T  D  I LHF+GNF YLF +ST LGV  GLL AYIIKKLYF
Sbjct  187   VNDATSVVLFNAIQSFDLTHLDSGIALHFLGNFFYLFFASTMLGVFAGLLSAYIIKKLYF  246

Query  1185  GRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHS  1006
              RHSTDREVALMMLM+YLSYI+AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+
Sbjct  247   ARHSTDREVALMMLMAYLSYILAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHA  306

Query  1005  FATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSF  826
             FATLSFVAE FIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAF+FPLSF
Sbjct  307   FATLSFVAEIFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLLMLGRAAFIFPLSF  366

Query  825   LSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvt  646
             LSNLAKKN  +KIS RQQ+IIWWAGLMRGAVSIALAYN+FT SGHT L  NAIMITST+T
Sbjct  367   LSNLAKKNQHEKISLRQQVIIWWAGLMRGAVSIALAYNQFTRSGHTQLRANAIMITSTIT  426

Query  645   vvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDM  466
             VVL STVVFGLMTKPLI  LLP   +     +SM +SEP++PK   +PLL    DS  D+
Sbjct  427   VVLVSTVVFGLMTKPLIRFLLPHSSKQT---TSMLSSEPTTPKSIIIPLLGQ--DSVDDL  481

Query  465   ITGPEVARPTALRMLLRTP--THTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             +   ++ RP ++R LL TP   HTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E++
Sbjct  482   VX-QDIRRPASIRDLLTTPFNRHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTERN  538



>ref|XP_002266345.3| PREDICTED: sodium/hydrogen exchanger 2 isoform X1 [Vitis vinifera]
 ref|XP_010659994.1| PREDICTED: sodium/hydrogen exchanger 2 isoform X1 [Vitis vinifera]
 ref|XP_010659995.1| PREDICTED: sodium/hydrogen exchanger 2 isoform X1 [Vitis vinifera]
 ref|XP_010659996.1| PREDICTED: sodium/hydrogen exchanger 2 isoform X1 [Vitis vinifera]
 emb|CBI34292.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/535 (78%), Positives = 464/535 (87%), Gaps = 5/535 (1%)
 Frame = -3

Query  1902  SSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVI  1723
             S L +  +L TSDHASVVS+NLFVALLC CIV+GHLLEENRWVNESITAL+IG+CTGVVI
Sbjct  8     SMLTRLGNLSTSDHASVVSINLFVALLCGCIVIGHLLEENRWVNESITALVIGVCTGVVI  67

Query  1722  lllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCS  1543
             LL SGG+SSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA+GTLISC 
Sbjct  68    LLTSGGRSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIMLFGAVGTLISCG  127

Query  1542  IISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVV  1363
             II+ G ++ F  LDI   D GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVV
Sbjct  128   IITSGVMQFFSKLDIGSFDIGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVV  187

Query  1362  NDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFG  1183
             NDA SVVLFNAIQSFD+T  + +I L FIGNF YLF +ST LGV  GLL AYIIK LYFG
Sbjct  188   NDAASVVLFNAIQSFDLTHTNLRIALQFIGNFFYLFFTSTMLGVVAGLLSAYIIKTLYFG  247

Query  1182  RHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSF  1003
             RHSTDREVALMMLM+YLSYI+AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+F
Sbjct  248   RHSTDREVALMMLMAYLSYILAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAF  307

Query  1002  ATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFL  823
             ATLSFVAE FIFLYVGMDALDIEKW+FV  + G SVAVSSIL+GL+LVGRAAFVFPLSFL
Sbjct  308   ATLSFVAEIFIFLYVGMDALDIEKWRFVSKTPGTSVAVSSILIGLVLVGRAAFVFPLSFL  367

Query  822   SNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtv  643
             SNLAKKN ++KI+FRQQ+IIWWAGLMRGAVS+ALAYN+F  SGHT L  NAIMITST+TV
Sbjct  368   SNLAKKNPTEKITFRQQVIIWWAGLMRGAVSVALAYNQFARSGHTQLRSNAIMITSTITV  427

Query  642   vlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMI  463
             VLFSTVVFGLMT+PLI  LLP  K      +SM  S+ S+PK F VPLL++  +S++DM 
Sbjct  428   VLFSTVVFGLMTQPLIRFLLPHSKNT----TSMVYSDSSTPKSFAVPLLESAQNSDADM-  482

Query  462   TGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              G    RP++LRMLL TP+ +VH YWRKFDD+ MRP+FGGRGFVPFV GSP E+S
Sbjct  483   GGHGFPRPSSLRMLLTTPSRSVHHYWRKFDDAIMRPMFGGRGFVPFVPGSPTERS  537



>gb|ADB80440.1| NHX1 [Malus zumi]
Length=544

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/536 (78%), Positives = 466/536 (87%), Gaps = 10/536 (2%)
 Frame = -3

Query  1899  SLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIl  1720
             S LQN  L TSDH+SVVSMNLFVALL ACIV+GHLLEENRWVNESITAL+IG+CTGVVIL
Sbjct  11    SKLQN--LSTSDHSSVVSMNLFVALLLACIVIGHLLEENRWVNESITALLIGICTGVVIL  68

Query  1719  llsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSI  1540
             L+S GKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNF TI+LFGAIGTL+SC+I
Sbjct  69    LISRGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFSTIVLFGAIGTLVSCTI  128

Query  1539  ISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVN  1360
             IS GA + FK LDI  L+ GD+LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVN
Sbjct  129   ISLGATQFFKKLDIGTLELGDFLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVN  188

Query  1359  DATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGR  1180
             DATSVVLFNAIQSFD+T  D  I LHF+GNF YLF +ST LGV  GLL AYIIKKLYF R
Sbjct  189   DATSVVLFNAIQSFDLTHLDSGIALHFLGNFFYLFFASTMLGVFAGLLSAYIIKKLYFAR  248

Query  1179  HSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFA  1000
             HSTDREVALMMLM+YLSYI+AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FA
Sbjct  249   HSTDREVALMMLMAYLSYILAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFA  308

Query  999   TLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLS  820
             TLSFVAE FIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAF+FPLSFLS
Sbjct  309   TLSFVAEIFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLLMLGRAAFIFPLSFLS  368

Query  819   NLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvv  640
             NLAKKN  +KIS RQQ+IIWWAGLMRGAVSIALAYN+FT SGHT L  NAIMITST+TVV
Sbjct  369   NLAKKNQHEKISLRQQVIIWWAGLMRGAVSIALAYNQFTRSGHTQLRANAIMITSTITVV  428

Query  639   lfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMIT  460
             L STVVFGLMTKPLI  LLP   +     +SM +SEP++PK   +PLL    DS  D++ 
Sbjct  429   LVSTVVFGLMTKPLIRFLLPHSSKQT---TSMLSSEPTTPKSIIIPLLGQ--DSVDDLVI  483

Query  459   GPEVARPTALRMLLRTP--THTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
               ++ RP ++R LL TP   HTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E++
Sbjct  484   -QDIRRPASIRDLLTTPFNRHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTERN  538



>ref|XP_006419681.1| hypothetical protein CICLE_v10004687mg [Citrus clementina]
 gb|ESR32921.1| hypothetical protein CICLE_v10004687mg [Citrus clementina]
Length=543

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/541 (76%), Positives = 467/541 (86%), Gaps = 6/541 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNS-DLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MA  LS+L++ S  + +SDH SVVSMNLFVALLCACIV+GHLLEENRW+NESITALIIGL
Sbjct  1     MAIELSNLMERSLSMLSSDHKSVVSMNLFVALLCACIVIGHLLEENRWMNESITALIIGL  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTG+VILL + G SSH+L+FSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+G
Sbjct  61    CTGIVILLTTNGTSSHVLMFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS  IIS GAV  FK ++I  L  GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISFVIISAGAVHFFKQMNIGTLKIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD++  +  I L F+G+F YLF++ST LGV  GLL A+II
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLSHINLSIALKFVGSFFYLFIASTMLGVIAGLLSAFII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLY GRHSTDREVALM+LM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLYMGRHSTDREVALMILMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSFVAE FIFLYVGMDALDIEKW+ V++S G SV VS+IL+GL+L+GRAAFV
Sbjct  301   TTKHAFATLSFVAEIFIFLYVGMDALDIEKWRVVRDSPGKSVGVSAILLGLVLLGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
              PLSFLSNL KK+S +KI  +QQ+ IWWAGLMRGAVS+ALAY +FT+SGHT LH NAIMI
Sbjct  361   LPLSFLSNLTKKSSHEKIGLKQQLTIWWAGLMRGAVSMALAYKQFTSSGHTKLHGNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFSTVVFGLMT+PL+ +LLP  K +    S M + E S+PK F VPLL N   
Sbjct  421   TSTITVVLFSTVVFGLMTQPLVRILLPSSKNL----SRMLSDESSTPKSFIVPLLGNGQG  476

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE+D+ T P V  PT+LRMLL TP+HTVH YWRKFDD+FMRPVFGGRGFVP V GSP+EQ
Sbjct  477   SEADLKT-PNVTHPTSLRMLLATPSHTVHHYWRKFDDAFMRPVFGGRGFVPVVPGSPLEQ  535

Query  300   S  298
             S
Sbjct  536   S  536



>gb|AAQ08988.1| Na/H antiporter Nhx1 [Tetragonia tetragonioides]
Length=554

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/547 (77%), Positives = 471/547 (86%), Gaps = 8/547 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNS--DLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             MAF LS  + N    L TSDHASVVSMNLFVALLC CIVLGHLLEENRW+NESITALIIG
Sbjct  1     MAFDLSYFVSNKLGMLATSDHASVVSMNLFVALLCGCIVLGHLLEENRWMNESITALIIG  60

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             L TGVVILL+SGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI+LFGA+
Sbjct  61    LGTGVVILLISGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIILFGAV  120

Query  1563  GTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSL  1384
             GTLIS +IIS GA++ FK LDI  LD GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSL
Sbjct  121   GTLISFTIISLGAMEFFKKLDIGSLDLGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSL  180

Query  1383  VFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYI  1204
             VFGEGVVNDATSVVLFNAIQ+FD+T  D +I L F GNFLYLF +ST LG   GLL AYI
Sbjct  181   VFGEGVVNDATSVVLFNAIQNFDLTHIDHRIALQFAGNFLYLFFTSTLLGAMTGLLSAYI  240

Query  1203  IKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  1024
             IKKLYFGRHSTDREVALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSR
Sbjct  241   IKKLYFGRHSTDREVALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  300

Query  1023  VTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAF  844
             VTT+H+FATLSFVAETFIFLYVGMDALDIEKW+FV +S G+SVAVSSIL+GL+++GRAAF
Sbjct  301   VTTKHAFATLSFVAETFIFLYVGMDALDIEKWRFVSDSPGISVAVSSILLGLLMLGRAAF  360

Query  843   VFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIM  664
             V PLSFL N  KK+ ++K+S RQQ+IIWWAGLMRGAVS+ALAYN+FT SGHT L  NAIM
Sbjct  361   VSPLSFLMNFFKKSQAEKVSLRQQVIIWWAGLMRGAVSMALAYNQFTRSGHTQLRGNAIM  420

Query  663   ItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQP  484
             ITST++VVL STVVFG++TKPLI  LLP  K   S  S++++    SPK FT+PLL N  
Sbjct  421   ITSTISVVLVSTVVFGILTKPLILFLLPQPKHFNST-STVSSENLGSPKSFTLPLLGNHQ  479

Query  483   DSESDM-----ITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVA  319
             DSE+D+      T   + RP++LRMLL  P+HTVH YWRKFD++FMRPVFGGRGFVP+V 
Sbjct  480   DSETDIGNHQDSTDRGLGRPSSLRMLLNAPSHTVHHYWRKFDNAFMRPVFGGRGFVPYVP  539

Query  318   GSPVEQS  298
             GSP EQS
Sbjct  540   GSPTEQS  546



>ref|XP_009364578.1| PREDICTED: sodium/hydrogen exchanger 2-like [Pyrus x bretschneideri]
Length=544

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/538 (78%), Positives = 466/538 (87%), Gaps = 10/538 (2%)
 Frame = -3

Query  1905  LSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVV  1726
             L S LQN  L TSDH+SVVSMNLFV LL ACIV+GHLLEENRWVNESITAL+IG+CTGVV
Sbjct  9     LISKLQN--LSTSDHSSVVSMNLFVVLLLACIVIGHLLEENRWVNESITALLIGVCTGVV  66

Query  1725  IlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISC  1546
             ILL+S GKSS LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNF TI+LFGAIGTL+SC
Sbjct  67    ILLISRGKSSRLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFSTIVLFGAIGTLVSC  126

Query  1545  SIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGV  1366
             +II+ GA + FK LDI  L+ GD+LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGV
Sbjct  127   TIIALGATQFFKKLDIGTLELGDFLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGV  186

Query  1365  VNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYF  1186
             VNDATSVVLFNAIQSFD+T  D  I LHF+GNFLYLF +ST LGV  GLL AYIIKKLYF
Sbjct  187   VNDATSVVLFNAIQSFDLTHLDSGIALHFLGNFLYLFFASTMLGVFAGLLSAYIIKKLYF  246

Query  1185  GRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHS  1006
             GRHSTDREVALMMLM+YLSYI+AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+
Sbjct  247   GRHSTDREVALMMLMAYLSYILAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHA  306

Query  1005  FATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSF  826
             FATLSFVAE FIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAFVFPLSF
Sbjct  307   FATLSFVAEIFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLLMLGRAAFVFPLSF  366

Query  825   LSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvt  646
             LSNLAKKN  +KIS +QQ+IIWWAGLMRGAVSIALAYN+FT  GHT L  NAIMITST+T
Sbjct  367   LSNLAKKNQHEKISLQQQVIIWWAGLMRGAVSIALAYNQFTRLGHTQLRANAIMITSTIT  426

Query  645   vvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDM  466
             VVL STVVFGLMTKPLI  LLP   +     +SM +SEP++PK   +PLL    DS  D+
Sbjct  427   VVLVSTVVFGLMTKPLIRFLLPHSSKQT---TSMLSSEPTTPKSIIIPLLGQ--DSVDDL  481

Query  465   ITGPEVARPTALRMLLRTP--THTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
               G ++ RP ++R LL TP   HTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E+S
Sbjct  482   -AGHDIRRPASIRDLLTTPFNRHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTERS  538



>ref|XP_007035466.1| Sodium/hydrogen exchanger [Theobroma cacao]
 gb|EOY06392.1| Sodium/hydrogen exchanger [Theobroma cacao]
Length=543

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/543 (77%), Positives = 470/543 (87%), Gaps = 8/543 (1%)
 Frame = -3

Query  1917  MAFG-LSSLLQNS-DLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             MA G +SSLL  S  +  SDH+SVVSMNLFVALLCACIV+GHLLEE+RW+NESITAL IG
Sbjct  1     MAIGIMSSLLAKSGTILASDHSSVVSMNLFVALLCACIVIGHLLEESRWMNESITALAIG  60

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             LCTG+VILL +GGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+
Sbjct  61    LCTGIVILLTTGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAV  120

Query  1563  GTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSL  1384
             GTLIS  IIS GA++ FK ++I  L  GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSL
Sbjct  121   GTLISFGIISLGAIQFFKKMNIGTLQIGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSL  180

Query  1383  VFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYI  1204
             VFGEGVVNDATSVVLFNAIQSFD++  +  I L F+GNFLYLF+ ST LGV  GLL AYI
Sbjct  181   VFGEGVVNDATSVVLFNAIQSFDLSHINSTIALQFVGNFLYLFILSTLLGVLAGLLSAYI  240

Query  1203  IKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  1024
             IKKLYFGRHSTDREVALMMLM+YLSY++AELFYLS ILTVFFCGIVMSHYTWHNVTESSR
Sbjct  241   IKKLYFGRHSTDREVALMMLMAYLSYMLAELFYLSAILTVFFCGIVMSHYTWHNVTESSR  300

Query  1023  VTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFV-KNSQGLSVAVSSILVGLILVGRAA  847
             VTT+H+FATLSFVAE FIFLYVGMDALDIEKW+ V ++S G SV VS+IL+GLILVGRAA
Sbjct  301   VTTKHAFATLSFVAEIFIFLYVGMDALDIEKWRVVIRDSPGKSVGVSAILLGLILVGRAA  360

Query  846   FVFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAI  667
             FVFPLSF+SNL KK S +KI F+QQ+ IWWAGLMRGAVS+ALAYN+FT+ GHT L  NA+
Sbjct  361   FVFPLSFISNLTKKASYEKIGFKQQVTIWWAGLMRGAVSMALAYNQFTSLGHTQLRGNAM  420

Query  666   MItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQ  487
             MITST+TVVLFSTVVFGLMTKPL+ +LLP  KQ+      M +SEPS+PK F VPLL N 
Sbjct  421   MITSTITVVLFSTVVFGLMTKPLVRILLPSPKQL----MRMISSEPSTPKSFIVPLLGNG  476

Query  486   PDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPV  307
              ++E D  +   V RPT+LRMLL TP+HTVH YWRKFDD+FMRPVFGGRGFVPFV GSP 
Sbjct  477   HETEGDQ-SNRNVTRPTSLRMLLSTPSHTVHYYWRKFDDAFMRPVFGGRGFVPFVPGSPT  535

Query  306   EQS  298
             EQ+
Sbjct  536   EQN  538



>ref|NP_001291231.1| uncharacterized protein LOC105124949 [Populus euphratica]
 gb|ACU01854.1| Na+/H+ exchanger 3 [Populus euphratica]
Length=545

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/528 (79%), Positives = 471/528 (89%), Gaps = 3/528 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVSMNLFVALLCACIV+GHLLEE RW+NESITALIIG+ TG+VILL+SGGKS
Sbjct  15    LSTSDHASVVSMNLFVALLCACIVIGHLLEETRWMNESITALIIGVGTGIVILLISGGKS  74

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             S LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI+LFGA+GTLI C+IIS GA++
Sbjct  75    SRLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIILFGAVGTLICCAIISIGAMQ  134

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
             IF+ +DI  LD GDYLAIGAIFAATDSVCTLQVLSQD+TPLLYSLVFGEGVVNDATSVVL
Sbjct  135   IFEKMDIGPLDIGDYLAIGAIFAATDSVCTLQVLSQDDTPLLYSLVFGEGVVNDATSVVL  194

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T+ +  I   F+ NFLYLFL+ST LGV  GL+ AYIIKKLYFGRHSTDREV
Sbjct  195   FNAIQSFDLTNINAVIAWEFVRNFLYLFLTSTMLGVLTGLVSAYIIKKLYFGRHSTDREV  254

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALM+LM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  255   ALMILMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAE  314

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              FIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL++VGRAAFVFPLSF+SNL+KK+ 
Sbjct  315   IFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLVMVGRAAFVFPLSFVSNLSKKSP  374

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
              +KI FRQQ IIWWAGLMRGAVS+ALAYNKFT++GHT+L  NAIMITST+TVVLFSTVVF
Sbjct  375   HEKIGFRQQFIIWWAGLMRGAVSMALAYNKFTSAGHTNLRANAIMITSTITVVLFSTVVF  434

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             GLMTKPLI++LL PH +  S   S  +S+P++PK FTVPLL    DS  D+  G ++ RP
Sbjct  435   GLMTKPLISILL-PHPKYQSRSLSF-SSDPATPKSFTVPLLGEGQDSLDDL-GGRDIPRP  491

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
             ++LR LL TPTHTVH YWRKFD++FMRP+FGGRGFVPFV GSP E++P
Sbjct  492   SSLRALLTTPTHTVHYYWRKFDNAFMRPMFGGRGFVPFVPGSPTERNP  539



>ref|XP_011023477.1| PREDICTED: sodium/hydrogen exchanger 1-like [Populus euphratica]
 ref|XP_011023478.1| PREDICTED: sodium/hydrogen exchanger 1-like [Populus euphratica]
Length=545

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/528 (79%), Positives = 471/528 (89%), Gaps = 3/528 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVSMNLFVALLCACIV+GHLLEE RW+NESITALIIG+ TG+VILL+SGGKS
Sbjct  15    LSTSDHASVVSMNLFVALLCACIVIGHLLEETRWMNESITALIIGVGTGIVILLISGGKS  74

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             S LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI+LFGA+GTLI C+IIS GA++
Sbjct  75    SRLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIILFGAVGTLICCAIISIGAMQ  134

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
             IF+ +DI  LD GDYLAIGAIFAATDSVCTLQVLSQD+TPLLYSLVFGEGVVNDATSVVL
Sbjct  135   IFEKMDIGPLDIGDYLAIGAIFAATDSVCTLQVLSQDDTPLLYSLVFGEGVVNDATSVVL  194

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T+ +  I   F+ NFLYLFL+ST LGV  GL+ AYIIKKLYFGRHSTDREV
Sbjct  195   FNAIQSFDLTNINAVIAWEFVRNFLYLFLTSTMLGVLTGLVSAYIIKKLYFGRHSTDREV  254

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALM+LM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  255   ALMILMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAE  314

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              FIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL++VGRAAFVFPLSF+SNL+KK+ 
Sbjct  315   IFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLVMVGRAAFVFPLSFVSNLSKKSP  374

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
              +KI FRQQ IIWWAGLMRGAVS+ALAYNKFT++GHT+L  NAIMITST+TVVLFSTVVF
Sbjct  375   HEKIGFRQQFIIWWAGLMRGAVSMALAYNKFTSAGHTNLRANAIMITSTITVVLFSTVVF  434

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             GLMTKPLI++LL PH +  S   S  +S+P++PK FTVPLL    DS  D+  G ++ RP
Sbjct  435   GLMTKPLISILL-PHPKYQSRSLSF-SSDPATPKSFTVPLLGEGQDSLDDL-GGRDIPRP  491

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
             ++LR LL TPTHTVH YWRKFD++FMRP+FGGRGFVPFV GSP E++P
Sbjct  492   SSLRALLTTPTHTVHYYWRKFDNAFMRPMFGGRGFVPFVPGSPTERNP  539



>gb|KDP23597.1| hypothetical protein JCGZ_23430 [Jatropha curcas]
Length=544

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/535 (77%), Positives = 470/535 (88%), Gaps = 3/535 (1%)
 Frame = -3

Query  1902  SSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVI  1723
             S + +   L TSDHASV+SMNLFV LLCACIV+GHLLEENRW+NESITAL+IGLCTGVVI
Sbjct  7     SVMSKYQSLSTSDHASVISMNLFVTLLCACIVIGHLLEENRWMNESITALLIGLCTGVVI  66

Query  1722  lllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCS  1543
             LL+SGG+SSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGAIGTLISC 
Sbjct  67    LLISGGRSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIMLFGAIGTLISCF  126

Query  1542  IISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVV  1363
             IIS GA +IFK +DI  LD GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVV
Sbjct  127   IISLGATQIFKRMDIGQLDIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVV  186

Query  1362  NDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFG  1183
             NDATSVVLFNAIQSFD+T+ + +I   F+ NFLYLF++ST LGV  GLL AYIIKKLYFG
Sbjct  187   NDATSVVLFNAIQSFDLTNINSRIAWQFLCNFLYLFVTSTMLGVFTGLLSAYIIKKLYFG  246

Query  1182  RHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSF  1003
             RHSTDRE ALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+F
Sbjct  247   RHSTDREFALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAF  306

Query  1002  ATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFL  823
             AT+SFVAE FIFLYVGMDALDIEKW+FV +S G SVAVSS+L+ L+++GRAAFVFPLSF+
Sbjct  307   ATMSFVAEIFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSVLLALVMIGRAAFVFPLSFI  366

Query  822   SNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtv  643
             SNL++K+ ++KISF+QQI+IWWAGLMRGAVS+ALAYNKFT+ GHT L  NAIMITST+TV
Sbjct  367   SNLSRKSQTEKISFKQQIVIWWAGLMRGAVSMALAYNKFTSLGHTHLRGNAIMITSTITV  426

Query  642   vlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMI  463
             VLFSTVVFG+MTKPLI  LLP  K   +  S+  +S+ ++PK FT+PLL    DS  D+ 
Sbjct  427   VLFSTVVFGMMTKPLIRFLLPHPKHQQT--STAISSDSNTPKSFTLPLLGETQDSLDDL-  483

Query  462   TGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              G ++ RP+++R LL TP HTVH YWRKFDD+FMRPVFGGRGFVPFV GSP +QS
Sbjct  484   GGHDIPRPSSIRALLTTPAHTVHYYWRKFDDAFMRPVFGGRGFVPFVPGSPTDQS  538



>ref|XP_011032540.1| PREDICTED: sodium/hydrogen exchanger 1-like [Populus euphratica]
Length=544

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/528 (79%), Positives = 466/528 (88%), Gaps = 3/528 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVSMNLFVALLCACIV+GHLLEENRW+NESITALIIGLCTGVVILL+SGGKS
Sbjct  15    LTTSDHASVVSMNLFVALLCACIVIGHLLEENRWMNESITALIIGLCTGVVILLISGGKS  74

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+GTLISC IIS GA++
Sbjct  75    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVGTLISCFIISVGAMQ  134

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI  LD GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  135   FFKKLDIGPLDIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  194

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T+ +      F+ NF YLFL+ST LGV  GL+ AYII++LYFGRHSTDREV
Sbjct  195   FNAIQSFDLTNINAATAWDFVRNFFYLFLASTLLGVITGLISAYIIRRLYFGRHSTDREV  254

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  255   ALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAE  314

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDIEKW+FV +S G SVAVSSIL+ L++VGRAAFVFPLSFLSNLAKK+ 
Sbjct  315   TFIFLYVGMDALDIEKWRFVSHSPGTSVAVSSILLCLVMVGRAAFVFPLSFLSNLAKKSP  374

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             ++KISF+QQ IIWWAGLMRGAVS+ALAYNKFT++GHT L  NAIMITST+TVVLFSTV+F
Sbjct  375   NEKISFKQQFIIWWAGLMRGAVSMALAYNKFTSAGHTHLRGNAIMITSTITVVLFSTVLF  434

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             GLMTKP I +LLP  K      S   +S+P++PK FT+PLL    DS  D+  G ++   
Sbjct  435   GLMTKPFIKILLPNPKH--QSRSMTISSDPTTPKSFTIPLLGEGQDSLDDL-GGHDIDHR  491

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
             +++R LL TPTHTVH YWRKFDD+FMRP+FGGRGFVPFV GSP E++P
Sbjct  492   SSIRALLTTPTHTVHHYWRKFDDAFMRPMFGGRGFVPFVPGSPTERNP  539



>ref|XP_010320629.1| PREDICTED: (Sodium/potassium)/proton exchanger 3 isoform X1 [Solanum 
lycopersicum]
Length=537

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/541 (76%), Positives = 466/541 (86%), Gaps = 7/541 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M F   +L+ + + L TSDH SVVS+NLFVAL+CACI++GHLLEENRW+NESITAL+IGL
Sbjct  1     MVFDFGTLVASLNRLSTSDHQSVVSINLFVALICACIIIGHLLEENRWMNESITALVIGL  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTGVVILL+SGGK+SH+LVFSEDLFFIYLLPPIIFNAGFQVKKK FF NF TIMLFGA+G
Sbjct  61    CTGVVILLISGGKNSHILVFSEDLFFIYLLPPIIFNAGFQVKKKSFFRNFSTIMLFGAVG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS  IISFGA  IFK  +I  L+ GDYLAIGAIF+ATDSVCTLQVLSQDETPLLYSLV
Sbjct  121   TLISFIIISFGATSIFKKWNIGHLEIGDYLAIGAIFSATDSVCTLQVLSQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNA+Q+FD++  +    L  +GNFLYLF SST LGV  GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAVQNFDLSHINTSKALELVGNFLYLFASSTILGVVAGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVA+++LM+YLSY++AELFYLS ILTVFF GIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVAIVILMAYLSYMLAELFYLSAILTVFFSGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSF+AE FIFLYVGMDALDIEKW+FV +S  LSV VSSIL+GL+LVGRAAFV
Sbjct  301   TTKHAFATLSFIAEIFIFLYVGMDALDIEKWRFVSDSPQLSVQVSSILLGLVLVGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KK+  ++ISF QQIIIWWAGLMRGAVS+ALAYN+FT  GHT L  NAIMI
Sbjct  361   FPLSFLSNLMKKSPEERISFNQQIIIWWAGLMRGAVSVALAYNQFTRGGHTQLRANAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFST VFGLMTKPLI LL P  K +    + M +SEP++PK F VPLL++  D
Sbjct  421   TSTITVVLFSTGVFGLMTKPLIRLLQPSPKHL----TRMISSEPTTPKSFIVPLLESTQD  476

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE+D+  GP V RP +LRMLL TP+HTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E 
Sbjct  477   SEADL--GPNVPRPHSLRMLLSTPSHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTEP  534

Query  300   S  298
             S
Sbjct  535   S  535



>ref|NP_001265892.1| uncharacterized protein LOC101515538 [Cicer arietinum]
 gb|ADL28385.1| Na+/H+ antiporter [Cicer arietinum]
Length=542

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/542 (78%), Positives = 471/542 (87%), Gaps = 7/542 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQN--SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             MA  ++S + N    L TSDHASVVSMNLFVALLCACIVLGHLLEENRW+NESITAL+IG
Sbjct  1     MAIEIASFVSNKLQMLATSDHASVVSMNLFVALLCACIVLGHLLEENRWMNESITALLIG  60

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             +CTGVVILL SGGKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI  FGA+
Sbjct  61    ICTGVVILLFSGGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITSFGAV  120

Query  1563  GTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSL  1384
             GTLISC II+ GA + FK +DI  L+ GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSL
Sbjct  121   GTLISCCIITLGATQAFKRMDIGPLELGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSL  180

Query  1383  VFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYI  1204
             VFGEGVVNDATSVVLFNAIQSFD+   +P I LHF+GNFLYLF++ST LGV  GLL AY+
Sbjct  181   VFGEGVVNDATSVVLFNAIQSFDLNRLNPSIALHFLGNFLYLFVASTLLGVLTGLLSAYV  240

Query  1203  IKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  1024
             IKKLY GRHSTDREVALMMLM+YLSY++AEL YLSGILTVFFCGIV SHYTWHNVTESSR
Sbjct  241   IKKLYIGRHSTDREVALMMLMAYLSYMLAELSYLSGILTVFFCGIVTSHYTWHNVTESSR  300

Query  1023  VTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAF  844
             VTT+H+FATLSFVAE FIFLYVGMDALDIEKWKFV +S G SVA SS+L+GLIL+GRAAF
Sbjct  301   VTTKHAFATLSFVAEIFIFLYVGMDALDIEKWKFVSDSPGTSVAASSVLLGLILLGRAAF  360

Query  843   VFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIM  664
             VFPLSFLSNL KK+  +KISFRQQ+IIWWAGLMRGAVS+ALAYN+FT SG+T L  NAIM
Sbjct  361   VFPLSFLSNLTKKSPYEKISFRQQVIIWWAGLMRGAVSMALAYNQFTMSGYTQLRSNAIM  420

Query  663   ItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQP  484
             ITST+TVVLFSTVVFGL+TKPLI LLLP     P   +SMTT+EPS+PK F VPLL N  
Sbjct  421   ITSTITVVLFSTVVFGLLTKPLIRLLLP----HPKVTTSMTTTEPSTPKSFIVPLLGNAQ  476

Query  483   DSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             DSE+D+  G ++ RP ++R LL TPTHTVHR WRKFDDSFMRPVFGGRGFVP   GSP E
Sbjct  477   DSEADL-EGHQIYRPNSIRALLATPTHTVHRLWRKFDDSFMRPVFGGRGFVPVEPGSPSE  535

Query  303   QS  298
             ++
Sbjct  536   RN  537



>ref|XP_006342736.1| PREDICTED: sodium/hydrogen exchanger 2-like [Solanum tuberosum]
Length=537

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/541 (76%), Positives = 466/541 (86%), Gaps = 7/541 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M F   +L+ + + L TSDH SVVS+NLFVAL+CACI++GHLLEENRW+NESITAL+IGL
Sbjct  1     MVFDFGTLVASLNRLSTSDHQSVVSINLFVALICACIIIGHLLEENRWMNESITALVIGL  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTGVVILL+SGGK+SH+LVFSEDLFFIYLLPPIIFNAGFQVKKK FF NF TIMLFGA+G
Sbjct  61    CTGVVILLISGGKNSHILVFSEDLFFIYLLPPIIFNAGFQVKKKSFFRNFSTIMLFGAVG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS  IISFGA  IFK  +I  L+ GDYLAIGAIF+ATDSVCTLQVLSQDETPLLYSLV
Sbjct  121   TLISFIIISFGATSIFKKWNIGNLEIGDYLAIGAIFSATDSVCTLQVLSQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNA+Q+FD++  +    L  +GNFLYLF SST LGV  GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAVQNFDLSHINTSKALELVGNFLYLFASSTILGVATGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVA+++LM+YLSY++AELFYLS ILTVFF GIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVAIVILMAYLSYMLAELFYLSAILTVFFSGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSF+AE FIFLYVGMDALD+EKW+FV +S  LS+ VSSIL+GL+LVGRAAFV
Sbjct  301   TTKHAFATLSFIAEIFIFLYVGMDALDMEKWRFVSDSPQLSLQVSSILLGLVLVGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KK+  ++ISF QQIIIWWAGLMRGAVS+ALAYN+FT  GHT L  NAIMI
Sbjct  361   FPLSFLSNLMKKSPEERISFNQQIIIWWAGLMRGAVSMALAYNQFTRGGHTQLRANAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFST VFGLMTKPLI LL P  K +    S M +SEP++PK F VPLL++  D
Sbjct  421   TSTITVVLFSTGVFGLMTKPLIRLLQPSPKHL----SRMISSEPTTPKSFIVPLLESTQD  476

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE+D+  GP V RP +LRMLL TP+HTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E 
Sbjct  477   SEADL--GPNVPRPHSLRMLLSTPSHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTEP  534

Query  300   S  298
             S
Sbjct  535   S  535



>dbj|BAB11940.1| Na/H antiporter Nhx1 [Atriplex gmelini]
 gb|AGX13726.1| Na+/H+ antiporter [synthetic construct]
Length=555

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/546 (77%), Positives = 468/546 (86%), Gaps = 13/546 (2%)
 Frame = -3

Query  1905  LSSLLQNS--DLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTG  1732
             LSSLL      L TSDHASVVSMNLFVALLC CIV+GHLLEENRW+NESITAL+IGL TG
Sbjct  5     LSSLLSGKMDALTTSDHASVVSMNLFVALLCGCIVIGHLLEENRWMNESITALLIGLATG  64

Query  1731  VVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLI  1552
             VVILL+SGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI+LFGA+GTL+
Sbjct  65    VVILLISGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIVLFGAVGTLV  124

Query  1551  SCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGE  1372
             S +IIS GA+ IFK LDI  L+  DYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGE
Sbjct  125   SFTIISLGALSIFKKLDIGTLELADYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGE  184

Query  1371  GVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKL  1192
             GVVNDATSVVLFNAIQSFD+T  D +I L F+GNFLYLF++ST LG   GLL AYIIKKL
Sbjct  185   GVVNDATSVVLFNAIQSFDLTRIDHRIALQFMGNFLYLFIASTILGAFTGLLSAYIIKKL  244

Query  1191  YFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTR  1012
             YFGRHSTDREVALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+
Sbjct  245   YFGRHSTDREVALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTK  304

Query  1011  HSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPL  832
             H+FATLSFVAE F+FLYVGMDALDIEKW+FV +S G+SVAVSSIL+GL++VGRAAFVFPL
Sbjct  305   HAFATLSFVAEVFLFLYVGMDALDIEKWRFVSDSPGISVAVSSILLGLVMVGRAAFVFPL  364

Query  831   SFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItst  652
             S+L N AKK+ S+K++F QQI+IWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST
Sbjct  365   SWLMNFAKKSQSEKVTFNQQIVIWWAGLMRGAVSMALAYNQFTRSGHTQLRGNAIMITST  424

Query  651   vtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSES  472
             ++VVLFST+VFGL+TKPLI  LLP  K      S  T S+  SPK +++PLL+   D E 
Sbjct  425   ISVVLFSTMVFGLLTKPLIMFLLPQPKHFT---SCSTVSDVGSPKSYSLPLLEGNQDYEV  481

Query  471   DMITGPE--------VARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAG  316
             D+  G          + RP++LRMLL  PTHTVH YWRKFDDSFMRPVFGGRGFVPFV G
Sbjct  482   DVGNGNHEDTTEPRTIVRPSSLRMLLNAPTHTVHHYWRKFDDSFMRPVFGGRGFVPFVPG  541

Query  315   SPVEQS  298
             SP EQS
Sbjct  542   SPTEQS  547



>gb|ABY86892.1| Na+/H+ antiporter [Populus euphratica]
Length=545

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/528 (79%), Positives = 470/528 (89%), Gaps = 3/528 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVSMNLFVALLCACIV+GHLLEE RW+NESITALIIG+ TG+VILL+SGGKS
Sbjct  15    LSTSDHASVVSMNLFVALLCACIVIGHLLEETRWMNESITALIIGVGTGIVILLISGGKS  74

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             S LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI+LFGA GTLI C+IIS GA++
Sbjct  75    SRLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIILFGAAGTLICCAIISIGAMQ  134

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
             IF+ +DI  LD GDYLAIGAIFAATDSVCTLQVLSQD+TPLLYSLVFGEGVVNDATSVVL
Sbjct  135   IFEKMDIGPLDIGDYLAIGAIFAATDSVCTLQVLSQDDTPLLYSLVFGEGVVNDATSVVL  194

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T+ +  I   F+ NFLYLFL+ST LGV  GL+ AYIIKKLYFGRHSTDREV
Sbjct  195   FNAIQSFDLTNINAVIAWEFVRNFLYLFLTSTMLGVLTGLVSAYIIKKLYFGRHSTDREV  254

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALM+LM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  255   ALMILMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAE  314

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              FIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL++VGRAAFVFPLSF+SNL+KK+ 
Sbjct  315   IFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLVMVGRAAFVFPLSFVSNLSKKSP  374

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
              +KI FRQQ IIWWAGLMRGAVS+ALAYNKFT++GHT+L  NAIMITST+TVVLFSTVVF
Sbjct  375   HEKIGFRQQFIIWWAGLMRGAVSMALAYNKFTSAGHTNLRANAIMITSTITVVLFSTVVF  434

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             GLMTKPLI++LL PH +  S   S  +S+P++PK FTVPLL    DS  D+  G ++ RP
Sbjct  435   GLMTKPLISILL-PHPKYQSRSLSF-SSDPATPKSFTVPLLGEGQDSLDDL-GGRDIPRP  491

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
             ++LR LL TPTHTVH YWRKFD++FMRP+FGGRGFVPFV GSP E++P
Sbjct  492   SSLRALLTTPTHTVHYYWRKFDNAFMRPMFGGRGFVPFVPGSPTERNP  539



>gb|AAT36679.1| NHX1 [Citrus reticulata]
Length=542

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/530 (77%), Positives = 464/530 (88%), Gaps = 6/530 (1%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDH SVVS+N+FVALLCA IV+GHLLEE+RW+NESITAL+IG+C GV+ILL +GGKSSH
Sbjct  17    TSDHNSVVSINIFVALLCASIVIGHLLEESRWMNESITALLIGVCAGVIILLTTGGKSSH  76

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             L VFSEDLFFIY+LPPIIFNAGFQVKKKQFF NF+TIMLFGAIGTL+SC+IIS G ++ F
Sbjct  77    LFVFSEDLFFIYVLPPIIFNAGFQVKKKQFFRNFITIMLFGAIGTLVSCTIISLGVIQFF  136

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             K LDI  LD GDYLAIGAIFAATDSVCTLQVL+QD+TPLLYSLVFGEGVVNDATSVVLFN
Sbjct  137   KKLDIGTLDIGDYLAIGAIFAATDSVCTLQVLNQDDTPLLYSLVFGEGVVNDATSVVLFN  196

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQSFD+T  + +    FIGNFLYLF +ST LGV  GLL AY+IKKLYFGRHSTDREVA+
Sbjct  197   AIQSFDLTHINTRSAFQFIGNFLYLFFTSTLLGVIGGLLSAYVIKKLYFGRHSTDREVAI  256

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             M+LM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE F
Sbjct  257   MVLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHTFATLSFVAEIF  316

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALDIEKW+FVK S G SVA S++L+GLI+ GRAAFVFPLSFL+NLAKK+ ++
Sbjct  317   IFLYVGMDALDIEKWRFVKGSPGTSVAASAMLMGLIMAGRAAFVFPLSFLTNLAKKSPTE  376

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KIS +QQ+IIWWAGLMRGAVS+ALAYN+FT SGHT L ENAIMITST+TVVLFSTVVFGL
Sbjct  377   KISIKQQVIIWWAGLMRGAVSMALAYNQFTRSGHTQLRENAIMITSTITVVLFSTVVFGL  436

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDN-QPDSESDMITGPEVARPT  436
             MTKPLI LLL PH +  + H     S+PS+PK  + PLL+  Q DS +D++ GP V RP 
Sbjct  437   MTKPLIRLLL-PHPKHTTNH---ILSDPSTPKSLSQPLLEEGQQDSYADLV-GPTVPRPG  491

Query  435   ALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSPR*G  286
             +LR LL TPTHTVH YWRKFDD+FMRPVFGGRGF PFV GSP E+S R G
Sbjct  492   SLRALLTTPTHTVHYYWRKFDDAFMRPVFGGRGFAPFVPGSPTERSVRGG  541



>gb|AAN08157.1| Na+/H+ antiporter Nhx1 [Salicornia europaea]
Length=560

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/540 (76%), Positives = 466/540 (86%), Gaps = 16/540 (3%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVSMNLFVALLC CIV+GHLLEENRW+NESITAL+IGLCTGVVILL+SGGKS
Sbjct  16    LSTSDHASVVSMNLFVALLCGCIVIGHLLEENRWMNESITALLIGLCTGVVILLISGGKS  75

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI++FGAIGTL+S S+IS GA+ 
Sbjct  76    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIIMFGAIGTLVSFSVISLGAMT  135

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
             IFK +DI  L+ GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  136   IFKKMDIGSLELGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  195

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQ+FD+T+ D +I + F GNFLYLF +ST LG   GLL AY+IKKLYFGRHSTDREV
Sbjct  196   FNAIQNFDLTNIDHRIAIQFSGNFLYLFFASTMLGAMTGLLSAYVIKKLYFGRHSTDREV  255

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  256   ALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAE  315

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              F+FLYVGMDALDIEKW+FV +S G SVAVSSIL+GL++VGRAAFVFPLS L N +KK+ 
Sbjct  316   IFLFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLLMVGRAAFVFPLSLLINFSKKSH  375

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KI+F QQI+IWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST+T+VLFST+VF
Sbjct  376   SEKITFNQQIVIWWAGLMRGAVSMALAYNQFTRSGHTQLRGNAIMITSTITIVLFSTMVF  435

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPE----  451
             GL+TKPLI  LLP  K     +S+ T S+  SPK  ++PLLD   DSE+DM    E    
Sbjct  436   GLLTKPLILFLLPHSKHF---NSASTVSDLGSPKSLSLPLLDGGQDSEADMDNQDEAVNN  492

Query  450   ---------VARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
                      +ARP +LRMLL  PTHTVH YWRKFDDSFMRPVFGGRGFVP+V GSP+EQ+
Sbjct  493   RYEGTHNRTIARPGSLRMLLNAPTHTVHYYWRKFDDSFMRPVFGGRGFVPYVPGSPIEQN  552



>ref|XP_006433113.1| hypothetical protein CICLE_v10000781mg [Citrus clementina]
 ref|XP_006433114.1| hypothetical protein CICLE_v10000781mg [Citrus clementina]
 ref|XP_006471798.1| PREDICTED: sodium/hydrogen exchanger 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006471799.1| PREDICTED: sodium/hydrogen exchanger 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006471800.1| PREDICTED: sodium/hydrogen exchanger 2-like isoform X3 [Citrus 
sinensis]
 gb|ESR46353.1| hypothetical protein CICLE_v10000781mg [Citrus clementina]
 gb|ESR46354.1| hypothetical protein CICLE_v10000781mg [Citrus clementina]
Length=542

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/530 (77%), Positives = 463/530 (87%), Gaps = 6/530 (1%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDH SVVS+N+FVALLCA IV+GHLLEE+RW+NESITAL+IG+C GV+ILL +GGKSSH
Sbjct  17    TSDHNSVVSINIFVALLCASIVIGHLLEESRWMNESITALLIGVCAGVIILLTTGGKSSH  76

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             L VFSEDLFFIY+LPPIIFNAGFQVKKKQFF NF+TIMLFGAIGTL+SC+IIS G ++ F
Sbjct  77    LFVFSEDLFFIYVLPPIIFNAGFQVKKKQFFRNFITIMLFGAIGTLVSCTIISLGVIQFF  136

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             K LDI  LD GDYLAIGAIFAATDSVCTLQVL+QD+TPLLYSLVFGEGVVNDATSVVLFN
Sbjct  137   KKLDIGTLDIGDYLAIGAIFAATDSVCTLQVLNQDDTPLLYSLVFGEGVVNDATSVVLFN  196

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQSFD+T  + +    FIGNFLYLF +ST LGV  GLL AYIIKKLYFGRHSTDREVA+
Sbjct  197   AIQSFDLTHINTRSAFQFIGNFLYLFFTSTLLGVIAGLLSAYIIKKLYFGRHSTDREVAI  256

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             M+LM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE F
Sbjct  257   MVLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHTFATLSFVAEIF  316

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALDIEKW+FVK S G SVA S++L+GLI+ GRAAFVFPLSFL+NLAKK+ ++
Sbjct  317   IFLYVGMDALDIEKWRFVKGSPGTSVAASAMLMGLIMAGRAAFVFPLSFLTNLAKKSPTE  376

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KIS +QQ+IIWWAGLMRGAVS+ALAYN+FT SGHT L ENAIMITST+TVVLFSTVVFGL
Sbjct  377   KISIKQQVIIWWAGLMRGAVSMALAYNQFTRSGHTQLRENAIMITSTITVVLFSTVVFGL  436

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDN-QPDSESDMITGPEVARPT  436
             MTKPLI LLL PH +  + H     S+PS+PK  + PLL+  Q DS +D+  GP V RP 
Sbjct  437   MTKPLIRLLL-PHAKHTTNH---ILSDPSTPKSLSQPLLEEGQQDSYADL-GGPTVPRPG  491

Query  435   ALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSPR*G  286
             +LR LL TPTHTVH YWRKFDD+FMRPVFGGRGF PFV GSP E+S R G
Sbjct  492   SLRALLTTPTHTVHYYWRKFDDAFMRPVFGGRGFAPFVPGSPTERSVRGG  541



>ref|XP_010324162.1| PREDICTED: (Sodium/potassium)/proton exchanger 4 isoform X2 [Solanum 
lycopersicum]
Length=526

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/542 (77%), Positives = 467/542 (86%), Gaps = 17/542 (3%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MA  L+SL      L TSDHASV S+NLFVALLCACI++GHLLEENRWVNESITALIIGL
Sbjct  1     MASVLASLFPKLGSLGTSDHASVASINLFVALLCACIIIGHLLEENRWVNESITALIIGL  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
              TGVVILL+SGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAIG
Sbjct  61    GTGVVILLVSGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TL+SC+IIS GA++ FK LDI+FLD GDYLAIGAIFAATDSVCTLQVL QDETPLLYSLV
Sbjct  121   TLVSCAIISLGAIQTFKKLDIEFLDIGDYLAIGAIFAATDSVCTLQVLHQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQ+ D+TS +P I L F+GNF YLFL+ST LG G GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIQNVDLTSLNPSIALSFLGNFFYLFLASTLLGAGTGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TTRH+FATLSF+AETF+FLYVGMDALDIEKWKFV +  GLS++ SSIL+GLIL+GRAAFV
Sbjct  301   TTRHTFATLSFLAETFLFLYVGMDALDIEKWKFVGDRPGLSISASSILMGLILLGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLS+LSNL KK+S +KI+FRQQ+IIWWAGLMRGAVS+ALAYNK          +NAIMI
Sbjct  361   FPLSYLSNLMKKSSEEKITFRQQVIIWWAGLMRGAVSMALAYNK----------DNAIMI  410

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+T+VLFST+VFGLMTKPLI+LLLPP +Q+     S  +S  ++PK  T PLL ++ D
Sbjct  411   TSTITIVLFSTMVFGLMTKPLISLLLPPQRQL-----STVSSGANTPKSLTAPLLGSRED  465

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE D+   P++  P +LRMLL  P+H VHRYWRKFDD+FMRP+FGGRGF P    SP E 
Sbjct  466   SEGDL-NVPDLPHPPSLRMLLTAPSHKVHRYWRKFDDAFMRPMFGGRGFAPPAPRSPTEH  524

Query  300   SP  295
              P
Sbjct  525   GP  526



>ref|XP_007223073.1| hypothetical protein PRUPE_ppa003745mg [Prunus persica]
 gb|EMJ24272.1| hypothetical protein PRUPE_ppa003745mg [Prunus persica]
Length=551

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/550 (76%), Positives = 469/550 (85%), Gaps = 14/550 (3%)
 Frame = -3

Query  1917  MAFGLSSLLQNSD--LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             MA  +SSL + S   L TSDH SVVSMNLFVALLCACI+LGHLLEE+RW+NESITAL IG
Sbjct  1     MAVDVSSLSERSVEMLMTSDHTSVVSMNLFVALLCACILLGHLLEESRWMNESITALAIG  60

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             LCTGV+ILL +GGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIM FGA+
Sbjct  61    LCTGVIILLTTGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMTFGAV  120

Query  1563  GTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSL  1384
             GTLIS +IIS GA+  F   +I  L  GDYLA+GAIF+ATDSVCTLQVL+QDETPLLYSL
Sbjct  121   GTLISFAIISLGAMHFFHKFNIGSLKIGDYLALGAIFSATDSVCTLQVLNQDETPLLYSL  180

Query  1383  VFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYI  1204
             VFGEGVVNDATSVVLFNAIQSFD++  +    L FIGNFLYLF +ST LGV  GLL AY+
Sbjct  181   VFGEGVVNDATSVVLFNAIQSFDLSHINTSTALQFIGNFLYLFAASTILGVVAGLLSAYV  240

Query  1203  IKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  1024
             IKKLYFGRHSTDREVALM+LM+YLSYI++ELFYLS ILTVFFCGIVMSHYTWHNVTESSR
Sbjct  241   IKKLYFGRHSTDREVALMILMAYLSYILSELFYLSAILTVFFCGIVMSHYTWHNVTESSR  300

Query  1023  VTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAF  844
             VTT+H+FATLSFVAE FIFLYVGMDALDIEKW+FV +S G S+AVSSIL+ L+LVGRAAF
Sbjct  301   VTTKHTFATLSFVAEIFIFLYVGMDALDIEKWRFVSDSPGKSIAVSSILLALVLVGRAAF  360

Query  843   VFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIM  664
             VFPLSFL+NL KK+ SDKIS +QQ+ IWWAGLMRG+VS+ALAYN+FT SGHT L  NAIM
Sbjct  361   VFPLSFLTNLTKKSPSDKISLKQQVTIWWAGLMRGSVSMALAYNQFTRSGHTDLRANAIM  420

Query  663   ItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQP  484
             ITST+TVVLFSTVVFGLMTKPL+ +LLP  K +     SM +SEPSSPK  TVPLL N  
Sbjct  421   ITSTITVVLFSTVVFGLMTKPLVRILLPSSKHI----GSMISSEPSSPKSITVPLLSNGQ  476

Query  483   DSE-------SDMITGP-EVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVP  328
             DSE       S+   GP  + RPT+LRMLL +P+HTVH YWRKFD++FMRPVFGGRGFVP
Sbjct  477   DSEVSLGVQDSEANHGPVNIPRPTSLRMLLSSPSHTVHHYWRKFDNAFMRPVFGGRGFVP  536

Query  327   FVAGSPVEQS  298
             +V GSPVEQ+
Sbjct  537   YVPGSPVEQN  546



>gb|AAR19085.1| Na+/H+ antiporter [Medicago sativa]
 gb|ABY83098.1| Na+/H+ antiporter [Medicago sativa subsp. x varia]
Length=541

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/541 (79%), Positives = 471/541 (87%), Gaps = 6/541 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MA  +SS++   S L TSDHASVVSMNLFVALLCACIVLGHLLEENRW+NESITAL+IG+
Sbjct  1     MAIEMSSIVSKLSMLSTSDHASVVSMNLFVALLCACIVLGHLLEENRWMNESITALLIGI  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTGVVILL SGGKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTI  FGAIG
Sbjct  61    CTGVVILLFSGGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTITSFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLISC II+ GA   FK +DI  L+ GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISCVIITTGATFAFKRMDIGPLEIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD+   +P I LHF+GNFLYLF++ST LGV  GLL AY+I
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLNQLNPSIALHFLGNFLYLFVASTLLGVVTGLLSAYVI  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLY GRHSTDREVALMMLM+YLSY++AEL YLSGILTVFFCGIVMSHYTWHNVT+SSR+
Sbjct  241   KKLYIGRHSTDREVALMMLMAYLSYMLAELTYLSGILTVFFCGIVMSHYTWHNVTQSSRI  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+HSFATLSFVAE FIFLYVGMDALDIEKWKFV +S G S+A SS+L+GLIL+GRAAFV
Sbjct  301   TTKHSFATLSFVAEIFIFLYVGMDALDIEKWKFVSDSPGTSIAASSVLLGLILLGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KK+   KISFRQQ+IIWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMI
Sbjct  361   FPLSFLSNLTKKSQHQKISFRQQVIIWWAGLMRGAVSMALAYNQFTMSGHTQLRSNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFSTVVFGL+TKPLI LLLP     P   SSMTT+E ++PK F VPLL +  D
Sbjct  421   TSTITVVLFSTVVFGLLTKPLIRLLLP----HPKITSSMTTTESTTPKSFIVPLLGDSRD  476

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE+D+  G E+ RP +LR LL TPTHTVHR WRKFDDSFMRPVFGGRGFVP   GSP E+
Sbjct  477   SEADL-EGHEIHRPNSLRALLSTPTHTVHRLWRKFDDSFMRPVFGGRGFVPVEPGSPSER  535

Query  300   S  298
             +
Sbjct  536   N  536



>ref|NP_001234255.1| (Sodium/potassium)/proton exchanger 3 [Solanum lycopersicum]
 emb|CAK12754.1| (Sodium/potassium)/proton exchanger 3 [Solanum lycopersicum]
Length=537

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/541 (76%), Positives = 465/541 (86%), Gaps = 7/541 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M F   +L+ + + L TSDH SVVS+NLFVAL+CACI++GHLLEENRW+NESITAL+IGL
Sbjct  1     MVFDFGTLVASLNRLSTSDHQSVVSINLFVALICACIIIGHLLEENRWMNESITALVIGL  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTGVVILL+SGGK+SH+LVFSEDLFFIYLLPPIIFNAGFQVKKK FF NF TIMLFGA+G
Sbjct  61    CTGVVILLISGGKNSHILVFSEDLFFIYLLPPIIFNAGFQVKKKSFFRNFSTIMLFGAVG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS  IISFGA  IFK  +I +L+ GDYLAIGAIF+ATDSVCTLQVLSQDETPLLYSLV
Sbjct  121   TLISFIIISFGATSIFKKWNIGYLEIGDYLAIGAIFSATDSVCTLQVLSQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNA+Q+FD++  +    L  +GNFLYLF SST LGV  GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAVQNFDLSHINTSKALELVGNFLYLFASSTILGVVAGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVA+++LM+YLSY++AELFYLS ILTVFF GIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVAIVILMAYLSYMLAELFYLSAILTVFFSGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSF+AE FIFLYVGMDALDIEKW+FV +S  LSV VS IL+GL+LVGRAAFV
Sbjct  301   TTKHAFATLSFIAEIFIFLYVGMDALDIEKWRFVSDSPQLSVQVSPILLGLVLVGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KK+  ++ISF QQIIIWWAGLMRGAVS+ LAYN+FT  GHT L  NAIMI
Sbjct  361   FPLSFLSNLMKKSPEERISFNQQIIIWWAGLMRGAVSVGLAYNQFTRGGHTQLRANAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFST VFGLMTKPLI LL P  K +    + M +SEP++PK F VPLL++  D
Sbjct  421   TSTITVVLFSTGVFGLMTKPLIRLLQPSPKHL----TRMISSEPTTPKSFIVPLLESTQD  476

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE+D+  GP V RP +LRMLL TP+HTVHRYWRKFD++FMRPVFGGRGFVPFV GSP E 
Sbjct  477   SEADL--GPNVPRPHSLRMLLSTPSHTVHRYWRKFDNAFMRPVFGGRGFVPFVPGSPTEP  534

Query  300   S  298
             S
Sbjct  535   S  535



>gb|KEH43058.1| Na+/H+ exchanger 1 [Medicago truncatula]
Length=541

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/541 (79%), Positives = 471/541 (87%), Gaps = 6/541 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MA  ++S++   S L TSDHASVVSMNLFVALLCACIVLGHLLEENRW+NESITAL+IG+
Sbjct  1     MAIEITSIVSKLSMLSTSDHASVVSMNLFVALLCACIVLGHLLEENRWMNESITALLIGI  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTGVVILL SGGKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTI  FGAIG
Sbjct  61    CTGVVILLFSGGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTITSFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLISC II+ GA   FK +DI  L+ GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISCVIITTGATFAFKRMDIGTLEIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD+   +P I LHF+GNFLYLF++ST LGV  GLL AY+I
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLNQLNPSIALHFLGNFLYLFVASTLLGVVTGLLSAYVI  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLY GRHSTDREVALMMLM+YLSY++AEL YLSGILTVFFCGIVMSHYTWHNVT+SSR+
Sbjct  241   KKLYIGRHSTDREVALMMLMAYLSYMLAELSYLSGILTVFFCGIVMSHYTWHNVTQSSRI  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+HSFATLSFVAE FIFLYVGMDALDIEKWKFV +S G S+A SS+L+GLIL+GRAAFV
Sbjct  301   TTKHSFATLSFVAEIFIFLYVGMDALDIEKWKFVSDSPGTSIAASSVLLGLILLGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KK+   KISFRQQ+IIWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMI
Sbjct  361   FPLSFLSNLTKKSQHQKISFRQQVIIWWAGLMRGAVSMALAYNQFTMSGHTQLRSNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFSTVVFGL+TKPLI LLLP     P   SSMTT+E ++PK F VPLL +  D
Sbjct  421   TSTITVVLFSTVVFGLLTKPLIRLLLP----HPKITSSMTTTESTTPKSFIVPLLGDSRD  476

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE+D+  G E+ RP +LR LL TPTHTVHR WRKFDDSFMRPVFGGRGFVP   GSP E+
Sbjct  477   SEADL-EGHEIHRPNSLRALLSTPTHTVHRLWRKFDDSFMRPVFGGRGFVPVEPGSPSER  535

Query  300   S  298
             +
Sbjct  536   N  536



>dbj|BAB56105.1| Na H-antiportor [Petunia x hybrida]
Length=540

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/539 (76%), Positives = 463/539 (86%), Gaps = 7/539 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNSD-LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MAF   +LL N D L TSDH SVVS+NLFVAL+CACIV+GHLLEENRW+NESITAL+IG 
Sbjct  1     MAFDFGTLLGNVDRLSTSDHQSVVSINLFVALICACIVIGHLLEENRWMNESITALVIGS  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTG+VILL+SGGK+SH+LVFSEDLFFIYLLPPIIFNAGFQVKKK FF NF TIMLFGA+G
Sbjct  61    CTGIVILLISGGKNSHILVFSEDLFFIYLLPPIIFNAGFQVKKKSFFRNFSTIMLFGALG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS  IIS GA+ IFK ++I  L+ GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISFIIISLGAIGIFKKMNIGSLEIGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQ+FD++  D    +  +GNFLYLF SST LGV  GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIQNFDLSHIDTGKAMELVGNFLYLFASSTALGVAAGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVA+M+LM+YLSY++AELFYLS ILTVFF GIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVAIMILMAYLSYMLAELFYLSAILTVFFSGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSF+AE FIFLYVGMDALDIEKWKFV +S G+SV VSSIL+GL+LVGRAAFV
Sbjct  301   TTKHTFATLSFIAEIFIFLYVGMDALDIEKWKFVSDSPGISVQVSSILLGLVLVGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KK    KISF QQ+ IWWAGLMRGAVS+ALAYN+FT  GHT L  NAIMI
Sbjct  361   FPLSFLSNLTKKTPEAKISFNQQVTIWWAGLMRGAVSMALAYNQFTRGGHTQLRANAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFSTVVFGLMTKPLI +LLP HK +    S M +SEP++PK F VPLLD+  D
Sbjct  421   TSTITVVLFSTVVFGLMTKPLIRILLPSHKHL----SRMISSEPTTPKSFIVPLLDSTQD  476

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             SE+D+     V RP +LRMLL TP+HTVH YWRKFD++FMRPVFGGRGFVPF  GSP +
Sbjct  477   SEADL--ERHVPRPHSLRMLLSTPSHTVHYYWRKFDNAFMRPVFGGRGFVPFAPGSPTD  533



>gb|ABN71591.2| Na+/H+ antiporter [Chrysanthemum x morifolium]
Length=550

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/532 (74%), Positives = 465/532 (87%), Gaps = 6/532 (1%)
 Frame = -3

Query  1893  LQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlll  1714
             L ++ L TS+++S+VSMNLFVALLCACIV+GHLLEENRW+NESITAL+IG+CTGV+ILL+
Sbjct  12    LGSTSLGTSEYSSIVSMNLFVALLCACIVIGHLLEENRWMNESITALVIGICTGVIILLI  71

Query  1713  sggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIIS  1534
             SGG +SH+LVFSEDLFFIYLLPPIIFNAGFQVKKK FF NFMTIMLFGA+GT+IS +IIS
Sbjct  72    SGGTNSHILVFSEDLFFIYLLPPIIFNAGFQVKKKHFFRNFMTIMLFGAVGTMISFTIIS  131

Query  1533  FGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDA  1354
              GA+ IF  ++I  L+ GDYLAIGAIF+ATDSV TLQVL+QD+TPLLYSLVFGEGVVNDA
Sbjct  132   IGAINIFSRMNIGSLELGDYLAIGAIFSATDSVYTLQVLNQDQTPLLYSLVFGEGVVNDA  191

Query  1353  TSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHS  1174
             TSVV+FNA+Q+FD++ F+  +    IGNF YLFL+ST LG G GLL AY+IKKLYFGRHS
Sbjct  192   TSVVIFNAVQNFDLSQFNTTVVFQLIGNFFYLFLTSTLLGAGAGLLSAYVIKKLYFGRHS  251

Query  1173  TDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATL  994
             TDREVA+M+LM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTE SRVTT+H+FATL
Sbjct  252   TDREVAIMILMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTEKSRVTTKHAFATL  311

Query  993   SFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNL  814
             SF+AE FIFLYVGMDALDIEKW++VK+S G SV VS+IL+G++LVGR AFVFPLSFLSNL
Sbjct  312   SFIAELFIFLYVGMDALDIEKWRYVKDSPGTSVEVSAILLGMVLVGRVAFVFPLSFLSNL  371

Query  813   AKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlf  634
              KK   +KI FRQQ++IWWAGLMRGAVS+ALAYN+FT  GHT+L  NA MITST+TVVLF
Sbjct  372   TKKGHQEKIDFRQQVLIWWAGLMRGAVSMALAYNQFTKEGHTTLQGNAYMITSTITVVLF  431

Query  633   stvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGP  454
             ST+VFGL+T+PL+ LLLP     P G + M +SEP++PK F VP L N  DSE+D+  G 
Sbjct  432   STMVFGLITQPLVRLLLPA----PKGLNRMISSEPTTPKSFLVPFLGNGQDSEADL--GH  485

Query  453   EVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              +ARPT+LRMLL TP+HTVH YWRKFD++FMRPVFGGRGFVPFV GSP EQS
Sbjct  486   HIARPTSLRMLLSTPSHTVHHYWRKFDNAFMRPVFGGRGFVPFVPGSPTEQS  537



>gb|AAS84487.1| Na+/H+ antiporter [Medicago sativa]
Length=541

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/541 (79%), Positives = 471/541 (87%), Gaps = 6/541 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MA  ++S++   S L TSDHASVVSMNLFVALLCACIVLGHLLEENRW+NESITAL+IG+
Sbjct  1     MAIEMTSIVSKLSMLSTSDHASVVSMNLFVALLCACIVLGHLLEENRWMNESITALLIGI  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTGVVILL SGGKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTI  FGAIG
Sbjct  61    CTGVVILLFSGGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTITSFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLISC II+ GA   FK +DI  L+ GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISCVIITTGATFAFKRMDIGPLEIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD+   +P I LHF+GNFLYLF++ST LGV  GLL AY+I
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLNQLNPSIALHFLGNFLYLFVASTLLGVVTGLLSAYVI  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLY GRHSTDREVALMMLM+YLSY++AEL YLSGILTVFFCGIVMSHYTWHNVT+SSR+
Sbjct  241   KKLYIGRHSTDREVALMMLMAYLSYMLAELTYLSGILTVFFCGIVMSHYTWHNVTQSSRI  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+HSFATLSFVAE FIFLYVGMDALDIEKWKFV +S G S+A SS+L+GLIL+GRAAFV
Sbjct  301   TTKHSFATLSFVAEIFIFLYVGMDALDIEKWKFVSDSPGTSIAASSVLLGLILLGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KK+   KISFRQQ+IIWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMI
Sbjct  361   FPLSFLSNLTKKSQHQKISFRQQVIIWWAGLMRGAVSMALAYNQFTMSGHTQLRSNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFSTVVFGL+TKPLI LLLP     P   SSMTT+E ++PK F VPLL +  D
Sbjct  421   TSTITVVLFSTVVFGLLTKPLIRLLLP----HPKITSSMTTTESTTPKSFIVPLLGDSRD  476

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE+D+  G E+ RP +LR LL TPTHTVHR WRKFDDSFMRPVFGGRGFVP   GSP E+
Sbjct  477   SEADL-EGHEIHRPNSLRALLSTPTHTVHRLWRKFDDSFMRPVFGGRGFVPVEPGSPSER  535

Query  300   S  298
             +
Sbjct  536   N  536



>gb|ABD66754.1| Na+/H+ antiporter [Populus euphratica]
Length=545

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/528 (78%), Positives = 470/528 (89%), Gaps = 3/528 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVSMNLFVALLCACIV+GHLLEE RW+NESITALIIG+ TG+VILL+SGGKS
Sbjct  15    LSTSDHASVVSMNLFVALLCACIVIGHLLEETRWMNESITALIIGVGTGIVILLISGGKS  74

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             S LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI+LFGA GTLI C+IIS GA++
Sbjct  75    SRLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIILFGAAGTLICCAIISIGAMQ  134

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
             IF+ +DI  LD GDYLAIGAIFAATDSVCTLQVLSQD+TPLLYSLVFGEGVVNDATSVVL
Sbjct  135   IFEKMDIGPLDIGDYLAIGAIFAATDSVCTLQVLSQDDTPLLYSLVFGEGVVNDATSVVL  194

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T+ +  I   F+ NFLYLFL+ST LGV  GL+ AYIIKKLYFGRHSTDREV
Sbjct  195   FNAIQSFDLTNINAVIAWEFVRNFLYLFLTSTMLGVLTGLVSAYIIKKLYFGRHSTDREV  254

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALM+LM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  255   ALMILMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAE  314

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              FIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL++VGRAAFVFPLSF+SNL+KK+ 
Sbjct  315   IFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLVMVGRAAFVFPLSFVSNLSKKSP  374

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
              +KI FRQQ IIWWAGLMRGAVS+ALAYNKFT++GHT+L  NAIMITST+TVVLFSTVVF
Sbjct  375   HEKIGFRQQFIIWWAGLMRGAVSMALAYNKFTSAGHTNLRANAIMITSTITVVLFSTVVF  434

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             G++TKPLI++LL PH +  S   S  +S+P++PK FTVPLL    DS  D+  G ++ RP
Sbjct  435   GMLTKPLISILL-PHPKYQSRSLSF-SSDPATPKSFTVPLLGEGQDSLDDL-GGRDIPRP  491

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
             ++LR LL TPTHTVH YWRKFD++FMRP+FGGRGFVPFV GSP E++P
Sbjct  492   SSLRALLTTPTHTVHYYWRKFDNAFMRPMFGGRGFVPFVPGSPTERNP  539



>gb|AHC54576.1| Na+/H+ antiporter 1 [Atriplex patens]
Length=555

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/546 (76%), Positives = 467/546 (86%), Gaps = 13/546 (2%)
 Frame = -3

Query  1905  LSSLLQNS--DLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTG  1732
             LSSLL      L TSDHASVVSMNLFVALLC CIV+GHLLEENRW+NESITAL+IGL TG
Sbjct  5     LSSLLSGKMDALATSDHASVVSMNLFVALLCGCIVIGHLLEENRWMNESITALLIGLATG  64

Query  1731  VVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLI  1552
             VVILL+SGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI+LFGA+GTL+
Sbjct  65    VVILLISGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIVLFGAVGTLV  124

Query  1551  SCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGE  1372
             S +IIS GA+ IFK LDI  L+  DYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGE
Sbjct  125   SFTIISLGALSIFKKLDIGTLELADYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGE  184

Query  1371  GVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKL  1192
             GVVNDATSVVLFNAIQSFD+T  D +I L F+GNFLYLF++ST LG   GLL AYIIKKL
Sbjct  185   GVVNDATSVVLFNAIQSFDLTRIDHRIALQFMGNFLYLFIASTILGAFTGLLSAYIIKKL  244

Query  1191  YFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTR  1012
             YFGRHSTDREVALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHN TESSRVTT+
Sbjct  245   YFGRHSTDREVALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNETESSRVTTK  304

Query  1011  HSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPL  832
             H+FATLSFVAE F+FLYVGMDALDIEKW+FV +S G+SVAVSSIL+GL++VGRAAFVFPL
Sbjct  305   HAFATLSFVAEVFLFLYVGMDALDIEKWRFVSDSPGISVAVSSILLGLVMVGRAAFVFPL  364

Query  831   SFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItst  652
             S+L N AKK+ S+K++F QQI+IWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST
Sbjct  365   SWLMNFAKKSQSEKVTFNQQIVIWWAGLMRGAVSMALAYNQFTRSGHTQLRGNAIMITST  424

Query  651   vtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSES  472
             ++VVLFST+VFGL+TKPLI  LLP  K      S  T S+  SPK +++PLL+   D E 
Sbjct  425   ISVVLFSTMVFGLLTKPLIMFLLPQPKHFT---SCSTVSDVGSPKSYSLPLLEGNQDYEV  481

Query  471   DMITGPE--------VARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAG  316
             D+  G          + RP++LRMLL  PTHTVH YWRKFDDSFMRPVFGGRGFVPFV G
Sbjct  482   DVGNGNHEETTEPRTIVRPSSLRMLLNAPTHTVHHYWRKFDDSFMRPVFGGRGFVPFVPG  541

Query  315   SPVEQS  298
             SP EQS
Sbjct  542   SPTEQS  547



>gb|AHY19032.1| Na+/H+ antiporter [Atriplex halimus]
Length=555

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/546 (76%), Positives = 467/546 (86%), Gaps = 13/546 (2%)
 Frame = -3

Query  1905  LSSLLQNS--DLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTG  1732
             LSSLL      L TSDHASVVSMNLFVALLC CIV+GHLLEENRW+NESITAL+IGL TG
Sbjct  5     LSSLLSEKMDALATSDHASVVSMNLFVALLCGCIVIGHLLEENRWMNESITALLIGLSTG  64

Query  1731  VVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLI  1552
             VVILL+SGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI+LFGA+GTL+
Sbjct  65    VVILLISGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIVLFGAVGTLV  124

Query  1551  SCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGE  1372
             S +IIS GA+ IFK LDI  L+  DYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGE
Sbjct  125   SFTIISLGALSIFKKLDIGTLELADYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGE  184

Query  1371  GVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKL  1192
             GVVNDATSVVLFNAIQSFD+T  D +I L F+GNFLYLF++ST LG   GLL AYIIKKL
Sbjct  185   GVVNDATSVVLFNAIQSFDLTRIDHRIALQFMGNFLYLFIASTILGAFTGLLSAYIIKKL  244

Query  1191  YFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTR  1012
             YFGRHSTDREVALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+
Sbjct  245   YFGRHSTDREVALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTK  304

Query  1011  HSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPL  832
             H+FATLSFVAE F+FLYVGMDALDIEKW+FV +S G+SVAVSSIL+GL++VGRAAFVFPL
Sbjct  305   HAFATLSFVAEVFLFLYVGMDALDIEKWRFVSDSPGISVAVSSILLGLVMVGRAAFVFPL  364

Query  831   SFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItst  652
             S+L N AKK+ S+K++F QQI+IWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST
Sbjct  365   SWLMNFAKKSQSEKVTFNQQIVIWWAGLMRGAVSMALAYNQFTRSGHTQLRGNAIMITST  424

Query  651   vtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSES  472
             ++VVLFST+VFGL+TKPLI  LLP  K      S  T S+  SPK +++PLL+   D E 
Sbjct  425   ISVVLFSTMVFGLLTKPLIMFLLPHPKHFT---SCSTVSDVGSPKSYSLPLLEGNQDYEV  481

Query  471   DMITGPE--------VARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAG  316
             D+  G          + RP++LRMLL  PTHTVH YWRK +DSFMRPVFGGRGFVPFV G
Sbjct  482   DVGNGNHEDTTEQRTIVRPSSLRMLLNAPTHTVHHYWRKLEDSFMRPVFGGRGFVPFVPG  541

Query  315   SPVEQS  298
             SP EQS
Sbjct  542   SPTEQS  547



>gb|ADB27460.1| Na+/H+ antiporter NHX1 [Medicago falcata]
Length=541

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/541 (79%), Positives = 470/541 (87%), Gaps = 6/541 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MA  +SS++   S L TSDHASVVSMNLFVALLC CIVLGHLLEENRW+NESITAL+IG+
Sbjct  1     MAIEMSSIVSKLSMLSTSDHASVVSMNLFVALLCTCIVLGHLLEENRWMNESITALLIGI  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTGVV+LL SGGKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTI  FGAIG
Sbjct  61    CTGVVVLLFSGGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTITSFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLISC II+ GA   FK +DI  L+ GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISCVIITTGATFAFKRMDIGPLEIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD+   +P I LHF+GNFLYLF++ST LGV  GLL AY+I
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLNQLNPSIALHFLGNFLYLFVASTLLGVVTGLLSAYVI  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLY GRHSTDREVALMMLM+YLSY++AEL YLSGILTVFFCGIVMSHYTWHNVT+SSR+
Sbjct  241   KKLYIGRHSTDREVALMMLMAYLSYMLAELTYLSGILTVFFCGIVMSHYTWHNVTQSSRI  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+HSFATLSFVAE FIFLYVGMDALDIEKWKFV +S G S+A SS+L+GLIL+GRAAFV
Sbjct  301   TTKHSFATLSFVAEIFIFLYVGMDALDIEKWKFVSDSPGTSIAASSVLLGLILLGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KK+   KISFRQQ+IIWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMI
Sbjct  361   FPLSFLSNLTKKSQHQKISFRQQVIIWWAGLMRGAVSMALAYNQFTVSGHTQLRSNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFSTVVFGL+TKPLI LLLP     P   SSMTT+E ++PK F VPLL +  D
Sbjct  421   TSTITVVLFSTVVFGLLTKPLIRLLLP----HPKITSSMTTTESTTPKSFIVPLLGDSRD  476

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE+D+  G E+ RP +LR LL TPTHTVHR WRKFDDSFMRPVFGGRGFVP   GSP E+
Sbjct  477   SEADL-EGHEIHRPNSLRALLSTPTHTVHRLWRKFDDSFMRPVFGGRGFVPVEPGSPSER  535

Query  300   S  298
             +
Sbjct  536   N  536



>gb|AAZ82019.1| Na+/H+ antiporter [Salicornia bigelovii]
Length=560

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/554 (75%), Positives = 470/554 (85%), Gaps = 24/554 (4%)
 Frame = -3

Query  1896  LLQNSDLF--------TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             L Q+S LF        TSDHASVVSMNLFVALLC CIV+GHLLEENRW+NESITAL+IGL
Sbjct  2     LSQSSSLFYSKMDMLSTSDHASVVSMNLFVALLCGCIVIGHLLEENRWMNESITALLIGL  61

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTGVVILL+SGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI++FGAIG
Sbjct  62    CTGVVILLISGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIIMFGAIG  121

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TL S S++S GA+ IFK +DI  L+ GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  122   TLGSFSVVSLGAMTIFKKMDIGSLELGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  181

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQ+FD+T+ D +I + F GNFLYLF +ST LG   GLL AY+I
Sbjct  182   FGEGVVNDATSVVLFNAIQNFDLTNIDHRIAIQFSGNFLYLFFASTMLGAMTGLLSAYVI  241

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  242   KKLYFGRHSTDREVALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  301

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSFVAE F+FLYVGMDALDIEKW+FV +S G SVAVSSIL+GL++VGRAAFV
Sbjct  302   TTKHAFATLSFVAEIFLFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLLMVGRAAFV  361

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLS L N +KK+ S+KI+F QQI+IWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMI
Sbjct  362   FPLSLLINFSKKSHSEKITFNQQIVIWWAGLMRGAVSMALAYNQFTRSGHTQLRGNAIMI  421

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+T+VLFST+VFGL+TKPLI  LLP  K     +S+ T S+  SPK  ++PLLD   D
Sbjct  422   TSTITIVLFSTMVFGLLTKPLILFLLPHSKHF---NSASTVSDLGSPKSLSLPLLDGGQD  478

Query  480   SESDMITGPE-------------VARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGR  340
             SE+DM    E             +ARP +LRMLL  PTHTVH YWRKFDDSFMRPVFGGR
Sbjct  479   SEADMDNQDEAVNNRYEGTHNRTIARPGSLRMLLNAPTHTVHYYWRKFDDSFMRPVFGGR  538

Query  339   GFVPFVAGSPVEQS  298
             GFVP+V GSP+EQ+
Sbjct  539   GFVPYVPGSPIEQN  552



>ref|XP_002512282.1| sodium/hydrogen exchanger, putative [Ricinus communis]
 gb|EEF49734.1| sodium/hydrogen exchanger, putative [Ricinus communis]
Length=544

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/527 (79%), Positives = 467/527 (89%), Gaps = 3/527 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVSM+LFV LLCACIV+GHLLEENRW+NESITAL+IGL TG+VILL+SGGKS
Sbjct  15    LSTSDHASVVSMSLFVTLLCACIVIGHLLEENRWMNESITALVIGLGTGIVILLISGGKS  74

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGAIGTLISC +IS GAV+
Sbjct  75    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIMLFGAIGTLISCCVISIGAVQ  134

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI  LD GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  135   FFKKLDIGQLDIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  194

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T+ +P+IG  FI NF YLFL+ST LGV  GLL AYIIKKLYFGRHSTDRE 
Sbjct  195   FNAIQSFDLTNINPRIGWQFICNFFYLFLTSTMLGVLTGLLSAYIIKKLYFGRHSTDREF  254

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             +LMMLM+YLSY++AELF+LSGILTVFFCGIVMSHYTWHNVTESSRVT++H+FAT+SFVAE
Sbjct  255   SLMMLMAYLSYMLAELFFLSGILTVFFCGIVMSHYTWHNVTESSRVTSKHAFATMSFVAE  314

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              FIFLYVGMDALDIEKW+FV +S G SVAVSSIL+ L++VGRAAFVFPLSF+SN  KK+ 
Sbjct  315   IFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLALVMVGRAAFVFPLSFVSNFFKKSP  374

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             ++KI  +QQ +IWWAGLMRGAVS+ALAYNKFT+ GHT L  NAIMITST+TVVLFSTVVF
Sbjct  375   TEKIGIKQQFVIWWAGLMRGAVSMALAYNKFTSLGHTHLRGNAIMITSTITVVLFSTVVF  434

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             GLMTKPLI LLL PH ++ S   S+ +SEP++PK  TVPLL +  DS  D+  G +V RP
Sbjct  435   GLMTKPLIRLLL-PHPKITSRSMSI-SSEPTTPKSVTVPLLGDNQDSLDDL-GGNDVPRP  491

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             +++R LL TPTHTVH YWRKFDDSFMRPVFGGRGFVPFV GSP E+S
Sbjct  492   SSIRALLTTPTHTVHYYWRKFDDSFMRPVFGGRGFVPFVPGSPTERS  538



>ref|NP_001291226.1| uncharacterized protein LOC105131313 [Populus euphratica]
 gb|ACU01853.1| Na+/H+ exchanger 2 [Populus euphratica]
Length=544

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/528 (78%), Positives = 463/528 (88%), Gaps = 3/528 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVSMNLFVALLCACIV+GHLLEENRW+NESITALIIGLCTGVVILL+S GKS
Sbjct  15    LTTSDHASVVSMNLFVALLCACIVIGHLLEENRWMNESITALIIGLCTGVVILLISRGKS  74

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+GTLISC IIS GA++
Sbjct  75    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVGTLISCFIISLGAMQ  134

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI  LD GDYLAI AIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  135   FFKKLDIGPLDIGDYLAISAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  194

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T+ +      F+ NF YLFL+ST LGV  GL+ AYII++ YFGRHSTDREV
Sbjct  195   FNAIQSFDLTNINAATAWDFVRNFFYLFLASTLLGVITGLISAYIIRRPYFGRHSTDREV  254

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  255   ALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAE  314

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDIEKW+FV +S G SVAVSSIL+ L++VGRAAFVFPLSFLSNLAKK+ 
Sbjct  315   TFIFLYVGMDALDIEKWRFVSHSPGTSVAVSSILLCLVMVGRAAFVFPLSFLSNLAKKSP  374

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             ++KISF+QQ IIWWAGLMRGAVS+ALAYNKFT++GHT L  NAIMITST+TVVLFSTV+F
Sbjct  375   NEKISFKQQFIIWWAGLMRGAVSMALAYNKFTSAGHTHLRGNAIMITSTITVVLFSTVLF  434

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             GLMTKP I +LLP  K      S   +S+P++PK FT+PLL    DS  D+  G ++   
Sbjct  435   GLMTKPFIKILLPNPKH--QSRSMTISSDPTTPKSFTIPLLGEGQDSLDDL-GGHDIDHR  491

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
             +++R LL TPTHTVH YWRKFDD+FMRP+FGGRGFVPFV GSP E++P
Sbjct  492   SSIRALLTTPTHTVHHYWRKFDDAFMRPMFGGRGFVPFVPGSPTERNP  539



>gb|AAV84586.1| Na+/H+ antiporter [Populus tomentosa]
Length=544

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/529 (78%), Positives = 464/529 (88%), Gaps = 5/529 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVSMNLFVALLC CIV+GHLLEENRW+NESITALIIGLCTGVVILL+SGGKS
Sbjct  15    LTTSDHASVVSMNLFVALLCVCIVIGHLLEENRWMNESITALIIGLCTGVVILLISGGKS  74

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLL FSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+GTLISC IIS GA++
Sbjct  75    SHLLAFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVGTLISCFIISVGAMQ  134

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI  LD GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  135   FFKKLDIGPLDIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  194

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T+ +  I   F  NF YLFL+ST  GV  GL+ AYII++LYFGRHSTDREV
Sbjct  195   FNAIQSFDLTNINAAIAWDFARNFFYLFLASTLPGVVTGLISAYIIRRLYFGRHSTDREV  254

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELFYLSGILTVFFCGIV SHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  255   ALMMLMAYLSYMLAELFYLSGILTVFFCGIVTSHYTWHNVTESSRVTTKHAFATLSFVAE  314

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL++VGRAAFVFPLSFLSNLAKK+ 
Sbjct  315   TFIFLYVGMDALDIEKWRFVSHSPGTSVAVSSILLGLVMVGRAAFVFPLSFLSNLAKKSP  374

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             ++KISF+QQ IIWWAGLMRGAVS+ALAYNKFT++GHT L  NAIMITST+TVVLFSTV+F
Sbjct  375   NEKISFKQQFIIWWAGLMRGAVSMALAYNKFTSAGHTHLRGNAIMITSTITVVLFSTVLF  434

Query  618   GLMTKPLINLLLP-PHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVAR  442
             GLMTKP I +LLP P +Q     S   +S+P++PK FT+PLL    DS  D+  G ++  
Sbjct  435   GLMTKPFIKILLPHPKRQ---SRSMAISSDPTTPKSFTIPLLGEGQDSLDDL-GGHDIDH  490

Query  441   PTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
             P+++R LL TPTH VH YWR+FDD+FMRP+FGGRGFVPFV GSP E +P
Sbjct  491   PSSIRALLTTPTHNVHHYWRQFDDAFMRPMFGGRGFVPFVPGSPTEHNP  539



>ref|XP_002319592.1| Na+/H+ antiporter family protein [Populus trichocarpa]
 gb|EEE95515.1| Na+/H+ antiporter family protein [Populus trichocarpa]
Length=545

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/528 (78%), Positives = 469/528 (89%), Gaps = 3/528 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L+TSDHASVVSMNLFVALLCACIV+GHLLEE RW+NESITAL IG+ TG+VILL+SGGKS
Sbjct  15    LYTSDHASVVSMNLFVALLCACIVIGHLLEETRWMNESITALTIGVGTGIVILLISGGKS  74

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             S LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+GTLI C+IIS GA++
Sbjct  75    SRLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVGTLICCAIISIGAMQ  134

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
             IF+ +DI  LD GDYLAIGAIFAATDSVCTLQVL QD+TPLLYSLVFGEGVVNDATSVVL
Sbjct  135   IFEKMDIGPLDIGDYLAIGAIFAATDSVCTLQVLGQDDTPLLYSLVFGEGVVNDATSVVL  194

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T+ +  I   F+ NFLYLFL+ST LGV  GL+ AYIIKKLYFGRHSTDREV
Sbjct  195   FNAIQSFDLTNINAVIAWEFVRNFLYLFLTSTMLGVLTGLVSAYIIKKLYFGRHSTDREV  254

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALM+LM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  255   ALMILMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAE  314

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              FIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL++VGRAAFVFPLSF+SNL+KK+ 
Sbjct  315   IFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLVMVGRAAFVFPLSFVSNLSKKSP  374

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             ++KI FRQQ IIWWAGLMRGAVS+ALAYNKFT++GHT+L  NAIMITST+TVVLFSTVVF
Sbjct  375   NEKIGFRQQFIIWWAGLMRGAVSMALAYNKFTSAGHTNLRANAIMITSTITVVLFSTVVF  434

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             GLMTKPLI++LL PH +  S   S  +S+ ++PK  TVPLL    DS  D+  G ++ RP
Sbjct  435   GLMTKPLISILL-PHPKYQSRSLSF-SSDAATPKSVTVPLLGEGQDSLDDL-GGHDIPRP  491

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
             ++LR LL TPTHTVH YWRKFD++FMRP+FGGRGFVP+V GSP E++P
Sbjct  492   SSLRALLTTPTHTVHYYWRKFDNAFMRPMFGGRGFVPYVPGSPTERNP  539



>ref|XP_010245360.1| PREDICTED: sodium/hydrogen exchanger 2 [Nelumbo nucifera]
Length=541

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/535 (79%), Positives = 467/535 (87%), Gaps = 5/535 (1%)
 Frame = -3

Query  1902  SSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVI  1723
             S L++   L TSDHASVVSMNLFVALLCACIV+GHLLEE+RW+NESITAL+IGLCTGVVI
Sbjct  7     SGLMRPGVLSTSDHASVVSMNLFVALLCACIVIGHLLEESRWMNESITALVIGLCTGVVI  66

Query  1722  lllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCS  1543
             LL +GGKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF TI+LFGA+GTLIS S
Sbjct  67    LLTTGGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFTTIILFGAVGTLISFS  126

Query  1542  IISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVV  1363
             II+ GA + FK LD+  LD GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVV
Sbjct  127   IIATGATEFFKRLDMGSLDIGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVV  186

Query  1362  NDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFG  1183
             NDATSVVLFNAIQSFD+T+ +  I LHFIGNF YLFL+ST LGV  GLL A+IIKKLYFG
Sbjct  187   NDATSVVLFNAIQSFDLTNINFTIALHFIGNFFYLFLTSTMLGVITGLLSAFIIKKLYFG  246

Query  1182  RHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSF  1003
             RHSTDREVALM+LM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+F
Sbjct  247   RHSTDREVALMILMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAF  306

Query  1002  ATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFL  823
             AT SFV ETFIFLYVGMDALDIEKW+FV NS G S+ VSSIL+ LILVGRAAFVFPLSFL
Sbjct  307   ATFSFVTETFIFLYVGMDALDIEKWRFVSNSPGKSILVSSILLSLILVGRAAFVFPLSFL  366

Query  822   SNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtv  643
             SNL KK  ++KI  +QQI IWWAGLMRGAVSIALAYN+FT SGHT L  NAIMITST+TV
Sbjct  367   SNLTKKYPNEKIHIKQQITIWWAGLMRGAVSIALAYNQFTRSGHTQLRGNAIMITSTITV  426

Query  642   vlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMI  463
             VLFSTVVFGL+TKPLI LLLP  K      SSM +S+ SSPK F +PLL+N  DSE+DM+
Sbjct  427   VLFSTVVFGLLTKPLIRLLLPATKHS----SSMVSSDASSPKSFILPLLENGHDSEADMV  482

Query  462   TGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
                    P++LRMLL +PTHTVH YWRKFDDSFMRPVFGGRGFVPFV GSP EQS
Sbjct  483   -HQGATPPSSLRMLLTSPTHTVHSYWRKFDDSFMRPVFGGRGFVPFVPGSPTEQS  536



>gb|AAQ72785.1| Na+/H+ antiporter [Oxybasis glauca]
Length=551

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/543 (77%), Positives = 466/543 (86%), Gaps = 11/543 (2%)
 Frame = -3

Query  1905  LSSLLQNS--DLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTG  1732
             LSSLL      L TSDHASVVSMN+FVALLC CIV+GHLLEENRW+NESITAL+IGL TG
Sbjct  5     LSSLLSGKMDALATSDHASVVSMNMFVALLCGCIVIGHLLEENRWMNESITALLIGLATG  64

Query  1731  VVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLI  1552
             VVILL+SGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI+LFGA+GTL+
Sbjct  65    VVILLISGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIILFGAVGTLV  124

Query  1551  SCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGE  1372
             S +IISFGA+ IFK LDI  LD  DYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGE
Sbjct  125   SFTIISFGALSIFKKLDIGSLDLADYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGE  184

Query  1371  GVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKL  1192
             GVVNDATSVVLFNAIQSFD+T+ D +I L F+GNFLYLF++ST LG   GLL AYIIKKL
Sbjct  185   GVVNDATSVVLFNAIQSFDLTTIDHRIALQFMGNFLYLFIASTILGAFTGLLSAYIIKKL  244

Query  1191  YFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTR  1012
             YFGRHSTDREVALMMLM+YLSY++AELFYLSGILTV FCGIVMSHYTWHNVTESSRVTT+
Sbjct  245   YFGRHSTDREVALMMLMAYLSYMLAELFYLSGILTVLFCGIVMSHYTWHNVTESSRVTTK  304

Query  1011  HSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPL  832
             H+FATLSFVAE F+FLYVGMDALDIEKW+FV +S G SVAVSSIL+GLI+VGRAAFVFPL
Sbjct  305   HAFATLSFVAEVFLFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLIMVGRAAFVFPL  364

Query  831   SFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItst  652
             S+L N AKK+ S+K+S  QQ++IWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST
Sbjct  365   SWLMNFAKKSHSEKVSLNQQVVIWWAGLMRGAVSMALAYNQFTRSGHTQLRGNAIMITST  424

Query  651   vtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSES  472
              TVVLFST+VFGL+ KPLI  LLP  K      S  T S+  SPK + +PLL+   D E 
Sbjct  425   TTVVLFSTMVFGLLAKPLIMFLLPQPKHFT---SCSTVSDLGSPKAY-LPLLEGHQDYEV  480

Query  471   DM-----ITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPV  307
             D+      T P +ARP++LRMLL  PTHTVH YWRKFDDSFMRPVFGGRGFVPFV GSP 
Sbjct  481   DVGNHDDGTEPTIARPSSLRMLLNAPTHTVHHYWRKFDDSFMRPVFGGRGFVPFVPGSPT  540

Query  306   EQS  298
             EQS
Sbjct  541   EQS  543



>gb|AHY19033.1| Na+/H+ antiporter [Suaeda pruinosa]
Length=553

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/533 (77%), Positives = 462/533 (87%), Gaps = 9/533 (2%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVSMNLFVALLC CIV+GHLLEENRW+NESITAL+IGL TGVVILL+SGGKS
Sbjct  16    LSTSDHASVVSMNLFVALLCGCIVIGHLLEENRWMNESITALLIGLSTGVVILLISGGKS  75

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHL+VFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI++FGA+GTL+S SII+ GA+ 
Sbjct  76    SHLMVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIIMFGALGTLVSFSIIALGAMA  135

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
             IF+ +DI  L+ GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  136   IFRKMDIGSLELGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  195

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQ+FD+T  D +I L F GNFLYLF +ST LG   GLL AY+IKKLYFGRHSTDREV
Sbjct  196   FNAIQNFDLTHIDHRIALQFGGNFLYLFFASTLLGAMTGLLSAYVIKKLYFGRHSTDREV  255

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  256   ALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAE  315

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              FIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL++VGRAAFVFPLS L N +KK  
Sbjct  316   IFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLLMVGRAAFVFPLSLLMNFSKKTH  375

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+K++F QQI+IWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST+TVVLFST+VF
Sbjct  376   SEKVTFNQQIVIWWAGLMRGAVSMALAYNQFTRSGHTQLRGNAIMITSTITVVLFSTMVF  435

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPE----  451
             GL+TKPLI  LLP  K   S     T S+  SPK F++PLL+++ DSE D     E    
Sbjct  436   GLLTKPLILFLLPQPKHFTSAS---TVSDLGSPKSFSLPLLEDRQDSEVDWGNDEEETNH  492

Query  450   --VARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
               +ARP +LRMLL +PTHTVH YWRKFDDSFMRPVFGGRGFVPFV GSP EQS
Sbjct  493   RTLARPGSLRMLLNSPTHTVHYYWRKFDDSFMRPVFGGRGFVPFVPGSPTEQS  545



>gb|AAM54141.2|AF515632_1 Na/H antiporter [Gossypium hirsutum]
 gb|KHG29048.1| Sodium/hydrogen exchanger 2 -like protein [Gossypium arboreum]
Length=543

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/527 (78%), Positives = 463/527 (88%), Gaps = 7/527 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVSMN+FVALLCACIV+GHLLEENRW+NESITALIIG+ TGV+ILL SGGKS
Sbjct  16    LSTSDHASVVSMNIFVALLCACIVIGHLLEENRWMNESITALIIGVFTGVIILLTSGGKS  75

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA+GTLISC+IIS G + 
Sbjct  76    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIMLFGAVGTLISCTIISLGVIN  135

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK +DI  LD GD+LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  136   FFKEMDIGSLDIGDFLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  195

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+ +  P+I L FIG+FLYLFL+ST LGV +GL+ AYIIKKLYFGRHSTDRE 
Sbjct  196   FNAIQSFDLVNTSPRILLEFIGSFLYLFLASTMLGVIVGLVSAYIIKKLYFGRHSTDREF  255

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  256   ALMMLMAYLSYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAE  315

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TF+FLYVGMDALD+EKW+FV +S G SVAVS++L+GL++VGRAAFVFPLSFLSNLAKK++
Sbjct  316   TFLFLYVGMDALDMEKWRFVSDSPGTSVAVSAVLMGLVMVGRAAFVFPLSFLSNLAKKST  375

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KISFR+QIIIWWAGLMRGAVS+ALAYN+FT  GHT L  NAIMITST+T+VLFSTVVF
Sbjct  376   SEKISFREQIIIWWAGLMRGAVSMALAYNQFTRGGHTQLRGNAIMITSTITIVLFSTVVF  435

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             GLMTKPLI  LLP     P   +SM  S+ S+PK    P L +  DS  D + G  V RP
Sbjct  436   GLMTKPLIRFLLP----HPKPTASM-LSDQSTPKSMEAPFLGSGQDSFDDSLIG--VHRP  488

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              ++R LL TP HTVH YWRKFD++FMRP+FGGRGFVPFV GSP E+S
Sbjct  489   NSIRALLTTPAHTVHYYWRKFDNAFMRPMFGGRGFVPFVPGSPTERS  535



>gb|AAO48271.1| Na/H antiporter Nhx1 [Atriplex dimorphostegia]
Length=555

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/546 (76%), Positives = 466/546 (85%), Gaps = 13/546 (2%)
 Frame = -3

Query  1905  LSSLLQNS--DLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTG  1732
             LSSLL      L TSDHASVVSMNLFVALLC CIV+GHLLEENRW+NESITAL+IGL TG
Sbjct  5     LSSLLSEKMDALATSDHASVVSMNLFVALLCGCIVIGHLLEENRWMNESITALLIGLSTG  64

Query  1731  VVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLI  1552
             VVILL+SGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI+LFGA+GTL+
Sbjct  65    VVILLISGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIVLFGAVGTLV  124

Query  1551  SCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGE  1372
             S +IIS GA+ IFK LDI  L+  DYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGE
Sbjct  125   SFTIISLGALSIFKKLDIGTLELADYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGE  184

Query  1371  GVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKL  1192
             GV NDATSVVLFNAIQSFD+T  D +I L F+GNF YLF++ST LG   GLL AY+IKKL
Sbjct  185   GVANDATSVVLFNAIQSFDLTRIDHRIALQFMGNFSYLFIASTILGAFTGLLSAYVIKKL  244

Query  1191  YFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTR  1012
             YFGRHSTDREVALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+
Sbjct  245   YFGRHSTDREVALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTK  304

Query  1011  HSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPL  832
             H+FATLSFVAE F+FLYVGMDALDIEKW+FV +S G+SVAVSSIL+GL++VGRAAFVFPL
Sbjct  305   HAFATLSFVAEVFLFLYVGMDALDIEKWRFVSDSPGISVAVSSILLGLVMVGRAAFVFPL  364

Query  831   SFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItst  652
             S+L NLAKK+  +K++F QQI+IWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST
Sbjct  365   SWLMNLAKKSHGEKVTFNQQIVIWWAGLMRGAVSMALAYNQFTRSGHTQLRGNAIMITST  424

Query  651   vtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSES  472
             ++VVLFST+VFGL+TKPLI  LLP  K      S  T S+  SPK +++PLL+   D E 
Sbjct  425   ISVVLFSTMVFGLLTKPLIMFLLPHPKHFT---SCSTVSDVGSPKSYSLPLLEGNQDYEV  481

Query  471   DMITGPE--------VARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAG  316
             D+  G          + RP++LRMLL  PTHTVH YWRKFDDSFMRPVFGGRGFVPFV G
Sbjct  482   DVGNGNHEETTEQRTIVRPSSLRMLLNAPTHTVHHYWRKFDDSFMRPVFGGRGFVPFVPG  541

Query  315   SPVEQS  298
             SP EQS
Sbjct  542   SPTEQS  547



>gb|AID55215.1| Na+/H+ antiporter [Nitraria tangutorum]
Length=544

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/530 (77%), Positives = 459/530 (87%), Gaps = 7/530 (1%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSD++SVVSMNLFVALLCACIV+GHLLEENRW+NESITAL+IG+CTGV+ILL+SGGKSSH
Sbjct  16    TSDYSSVVSMNLFVALLCACIVIGHLLEENRWMNESITALVIGVCTGVIILLVSGGKSSH  75

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGAIGTLISC+IIS GA++ F
Sbjct  76    LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIMLFGAIGTLISCTIISLGAMQAF  135

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             K LDI  LD GD+LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  136   KRLDIGSLDLGDFLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  195

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQSFD+++ +       +GNFLYLF +ST LGV  GLL AYIIKKLYF RHSTDREVAL
Sbjct  196   AIQSFDLSNLNTSSAFQLLGNFLYLFFASTMLGVITGLLSAYIIKKLYFARHSTDREVAL  255

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AELF +SGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSFVAE F
Sbjct  256   MMLMAYLSYMLAELFDMSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATLSFVAEIF  315

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAFVFPLSF+SNL KK+ +D
Sbjct  316   LFLYVGMDALDIEKWRFVSDSPGTSVAVSSILMGLVMLGRAAFVFPLSFVSNLMKKSPTD  375

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             K+ F+QQI+IWWAGLMRGAVS  LAYN+FT SGHT L  NA+MITST+TVVLFSTVVFGL
Sbjct  376   KVGFKQQIVIWWAGLMRGAVSTVLAYNQFTRSGHTQLRGNAVMITSTITVVLFSTVVFGL  435

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGP---EVAR  442
             MTKPLI LLLP  K       SM  S+P + K  T PLL+   DSE+D+ + P    + R
Sbjct  436   MTKPLIRLLLPQQK----AAISMVLSDPPTQKSVTTPLLEQSQDSEADLGSTPLGNGIHR  491

Query  441   PTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSPR  292
             P +LR LL  PTHTVH YWRKFDD FMRPVFGGRGFVPFV GSP E+S R
Sbjct  492   PGSLRALLNAPTHTVHYYWRKFDDGFMRPVFGGRGFVPFVPGSPTERSVR  541



>ref|XP_003554675.1| PREDICTED: sodium/hydrogen exchanger 2-like isoform 1 [Glycine 
max]
 gb|KHN43237.1| Sodium/hydrogen exchanger 2 [Glycine soja]
Length=547

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/543 (76%), Positives = 462/543 (85%), Gaps = 5/543 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC  1738
             M   LS +L  + + TSDHASVVSMN+FVALLCACIV+GHLLEENRWVNESITAL+IG+C
Sbjct  1     MGGELSYVLLKTQMLTSDHASVVSMNIFVALLCACIVIGHLLEENRWVNESITALLIGIC  60

Query  1737  TGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGT  1558
             TG+VILLLS GKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNF+TI LFG +GT
Sbjct  61    TGIVILLLSRGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFITITLFGVVGT  120

Query  1557  LISCSIISFGAVKIFKHLDI-DFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             LISCSII+FG  +IFK +     LD GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   LISCSIITFGVTQIFKRMGFGKSLDMGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAI+SFD+   DP+IGLHFIGNFLYLF +ST LGV  GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIKSFDLNKIDPRIGLHFIGNFLYLFTASTLLGVLAGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             K LY GRHSTDREVALMMLM+YLSYI+AEL+YLSGILTVFFCGIVMSHYTWHNVTESSR+
Sbjct  241   KTLYIGRHSTDREVALMMLMAYLSYILAELWYLSGILTVFFCGIVMSHYTWHNVTESSRI  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSFV ETFIFLYVGMDALDIEKW+FV +    SVAVSS+L+GL+L GRAAFV
Sbjct  301   TTKHAFATLSFVLETFIFLYVGMDALDIEKWRFVSDRPKTSVAVSSVLLGLVLAGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KK  S+KISFR+Q+IIWWAGLMRGAVS+ALAYN+FT SGHT    NAIMI
Sbjct  361   FPLSFLSNLTKKTQSEKISFREQVIIWWAGLMRGAVSMALAYNQFTLSGHTEQRTNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTT--SEPSSPKHFTVPLLDNQ  487
             TST+TVVL ST+VFGLMTKPLI  LLP +  +P   +SM    S  +SPK  TVP L   
Sbjct  421   TSTITVVLVSTMVFGLMTKPLIRFLLPVNP-LPKRKNSMANIDSSNNSPKSITVPFLGGS  479

Query  486   PDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPV  307
              DSE++   G E+ RP+++R LL TPTHTVH+ WRKFD+SFMRPVFGGRGFVP    SP 
Sbjct  480   QDSENEF-DGSEIHRPSSIRALLTTPTHTVHQLWRKFDNSFMRPVFGGRGFVPVAPNSPT  538

Query  306   EQS  298
              ++
Sbjct  539   ARN  541



>dbj|BAE95195.1| putative Na+/H+ antiporter [Suaeda japonica]
Length=554

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/532 (77%), Positives = 463/532 (87%), Gaps = 10/532 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVSMNLFVALLC CIV+GHLLEENRW+NESITAL+IGL TG++ILL+SGGKSSH
Sbjct  18    TSDHASVVSMNLFVALLCGCIVIGHLLEENRWMNESITALLIGLSTGIIILLISGGKSSH  77

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI+LFGA+GTL+S  IIS G++ IF
Sbjct  78    LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIILFGAVGTLVSFIIISLGSIAIF  137

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             + +DI  L+ GD LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  138   QKMDIGSLELGDLLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  197

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQ+FD+T  D +I   F GNFLYLF +ST LG   GLL AY+IKKLYFGRHSTDREVAL
Sbjct  198   AIQNFDLTHIDHRIAFQFGGNFLYLFFASTLLGAVTGLLSAYVIKKLYFGRHSTDREVAL  257

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE F
Sbjct  258   MMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAEIF  317

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL++VGRAAFVFPLSFL NL+KK++S+
Sbjct  318   IFLYVGMDALDIEKWRFVSDSPGTSVAVSSILIGLLMVGRAAFVFPLSFLMNLSKKSNSE  377

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             K++F QQI+IWWAGLMRGAVS+ALAYN+F+ SGHT L  NAIMITST+TVVLFST+VFGL
Sbjct  378   KVTFNQQIVIWWAGLMRGAVSVALAYNQFSRSGHTQLRGNAIMITSTITVVLFSTMVFGL  437

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPE------  451
             +TKPLI  +LP  K   S     T S+  SPK F++PLL+++ DSE+D+    E      
Sbjct  438   LTKPLILFMLPQPKHFTSAS---TVSDLGSPKSFSLPLLEDRQDSEADLGNDDEEAYPRG  494

Query  450   -VARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              +ARPT+LRMLL  PTHTVH YWR+FDD FMRPVFGGRGFVPFV GSP EQS
Sbjct  495   TIARPTSLRMLLNAPTHTVHHYWRRFDDYFMRPVFGGRGFVPFVPGSPTEQS  546



>gb|ACF05807.1| Na+/H+ antiporter protein [Limonium gmelinii]
Length=551

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/543 (76%), Positives = 468/543 (86%), Gaps = 8/543 (1%)
 Frame = -3

Query  1908  GLSSLLQNSDLF-TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTG  1732
              LSS+L   ++  TSDHASV SMNLFVALLCACIV+GHLLEE +W+NESITAL+IGLCTG
Sbjct  2     ALSSILPKMNMLSTSDHASVFSMNLFVALLCACIVIGHLLEETQWMNESITALLIGLCTG  61

Query  1731  VVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLI  1552
             V ILL SGGKSSHLLVFSE+LFFIYLLPPI+FNAGFQVKKKQFF NF+TIM+FGA+GTL+
Sbjct  62    VFILLFSGGKSSHLLVFSEELFFIYLLPPILFNAGFQVKKKQFFRNFITIMMFGAVGTLV  121

Query  1551  SCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGE  1372
             SC+IIS GA++  K LDI  LD  DYLAIGAIFAATDSVCTLQ+L+QDETPLLYSLVFGE
Sbjct  122   SCTIISLGAMEFLKKLDIGTLDLNDYLAIGAIFAATDSVCTLQILNQDETPLLYSLVFGE  181

Query  1371  GVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKL  1192
             GVVNDATSVVLFNAIQSFD+T FD +IG  F+GNF+YLF +ST LG   GLL AYIIKKL
Sbjct  182   GVVNDATSVVLFNAIQSFDLTRFDHRIGFKFLGNFMYLFAASTLLGAAAGLLSAYIIKKL  241

Query  1191  YFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTR  1012
             YFGRHSTDREVALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+
Sbjct  242   YFGRHSTDREVALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTK  301

Query  1011  HSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPL  832
             H+FATLSFVAETFIFLYVGMDALDIEKW+ V +S G SVAVSSIL+GL++VGRAAFVFPL
Sbjct  302   HAFATLSFVAETFIFLYVGMDALDIEKWRSVSDSPGTSVAVSSILMGLVMVGRAAFVFPL  361

Query  831   SFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItst  652
             SFL+NL KK+SS+K++  QQ++IWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST
Sbjct  362   SFLTNLFKKSSSEKVTLNQQVVIWWAGLMRGAVSMALAYNQFTRSGHTHLRANAIMITST  421

Query  651   vtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPK-HFTVPLLDNQPDSE  475
             +TVVLFSTVVFG++TKPLI  LLPP K   S  SS  +++  SPK    +PL+D + DSE
Sbjct  422   ITVVLFSTVVFGILTKPLIRFLLPPPKHFLS--SSTISTDLGSPKTSLQMPLMDGRRDSE  479

Query  474   ----SDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPV  307
                 S      ++  P +LRMLL  PTHTVHRYWRKFDD+FMRPVFGGRGFVPFV GSP 
Sbjct  480   GIFGSSQDFSGQINAPGSLRMLLNAPTHTVHRYWRKFDDAFMRPVFGGRGFVPFVPGSPT  539

Query  306   EQS  298
             E+S
Sbjct  540   ERS  542



>ref|XP_010921731.1| PREDICTED: sodium/hydrogen exchanger 2-like [Elaeis guineensis]
Length=541

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/542 (76%), Positives = 462/542 (85%), Gaps = 8/542 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLF--TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             MAF L + L    +   TSDH SVVS+NLFVALLC CI++GHLLEENRW+NESITAL+IG
Sbjct  1     MAFDLGAHLVRLGILSSTSDHTSVVSINLFVALLCTCIIIGHLLEENRWMNESITALVIG  60

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             LCTGVVILL + GKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI+LFGA+
Sbjct  61    LCTGVVILLTTKGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIILFGAV  120

Query  1563  GTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSL  1384
             GTLIS SIIS GAV+ F+ +DI  LD GD+LAIGAIF+ATDSVCTLQVL+QDETPLLYSL
Sbjct  121   GTLISFSIISLGAVEFFRRMDIGSLDIGDFLAIGAIFSATDSVCTLQVLNQDETPLLYSL  180

Query  1383  VFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYI  1204
             VFGEGVVNDATSVVLFNAIQ+FD+   D  I L F+GNF YLF SSTFLG   GLL AYI
Sbjct  181   VFGEGVVNDATSVVLFNAIQNFDVGHIDAIIVLKFVGNFFYLFFSSTFLGAFTGLLSAYI  240

Query  1203  IKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  1024
             IKKLYFGRHSTDREVALMMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSR
Sbjct  241   IKKLYFGRHSTDREVALMMLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSR  300

Query  1023  VTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAF  844
             VTT+H+FATLSF++E F+FLYVGMDALDIEKWKFV +S G S+ VSSIL+GL+LVGRAAF
Sbjct  301   VTTKHAFATLSFISEIFLFLYVGMDALDIEKWKFVSDSPGKSIGVSSILLGLVLVGRAAF  360

Query  843   VFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIM  664
             VFPLSFLSNL KK+  +KISF++QI IWWAGLMRGAVSIALAYN+FT SGHT L  NA+M
Sbjct  361   VFPLSFLSNLTKKSPDEKISFKKQITIWWAGLMRGAVSIALAYNQFTRSGHTQLRGNAMM  420

Query  663   ItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQP  484
             ITST+TVVLFSTVVFG+MTKPLI +LLPP  +    H    +SEPS+PK     LL N  
Sbjct  421   ITSTITVVLFSTVVFGMMTKPLIRVLLPPGAK----HYGSMSSEPSTPKSLLAALLPNGQ  476

Query  483   DSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             +SE +   G ++ RP++LRMLL  PTHTVH YWRKFDDSFMRPVFGGRGFVPFV GSP E
Sbjct  477   ESEVE--AGGQIERPSSLRMLLSKPTHTVHYYWRKFDDSFMRPVFGGRGFVPFVPGSPTE  534

Query  303   QS  298
             QS
Sbjct  535   QS  536



>gb|ABV00895.1| Na+/H+ antiporter [Trifolium repens]
Length=541

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/541 (78%), Positives = 468/541 (87%), Gaps = 6/541 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLF-TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MA  ++S++    +  TSDH+SVVSMNLFVALLCACIVLGHLLEENRW+NESITAL+IG+
Sbjct  1     MAIEIASVVSKLQMLSTSDHSSVVSMNLFVALLCACIVLGHLLEENRWMNESITALLIGI  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
              TGVVILLLSGGKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFM I  FGAIG
Sbjct  61    ATGVVILLLSGGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMIIASFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLISC +I+FGA + FK +DI  LD GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISCVVITFGATQAFKMMDIGPLDIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD+   +P I +H +GNFLYLF++ST LGV  GLL AY+I
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLDRLNPSIAVHLLGNFLYLFIASTLLGVLTGLLSAYVI  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLY GRHSTDREVALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLYIGRHSTDREVALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+HSFATLSFVAE FIFLYVGMDALDIEKWKFV +S G S+A S++L+GLIL+GRAAFV
Sbjct  301   TTKHSFATLSFVAEIFIFLYVGMDALDIEKWKFVSDSPGTSIATSAVLLGLILLGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KK+   KISFRQQ+IIWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMI
Sbjct  361   FPLSFLSNLTKKSQHQKISFRQQVIIWWAGLMRGAVSMALAYNQFTRSGHTQLRSNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFSTVVFGL+ KPLI LLLP  K      +SMTT+E S+PK   VPLL    D
Sbjct  421   TSTITVVLFSTVVFGLLAKPLIRLLLPHQK----ATNSMTTTESSTPKSVIVPLLGEPRD  476

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE+D+  G E+ RP ++R LL TPTHTVHR WRKFDDSFMRPVFGGRGFVP   GSP E+
Sbjct  477   SEADL-EGHEIHRPNSIRALLSTPTHTVHRLWRKFDDSFMRPVFGGRGFVPVEPGSPTER  535

Query  300   S  298
             +
Sbjct  536   N  536



>ref|NP_001240203.1| uncharacterized protein LOC100816746 [Glycine max]
 gb|AEA07714.1| Na+/H+ antiporter [Glycine max]
Length=546

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/546 (78%), Positives = 478/546 (88%), Gaps = 11/546 (2%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M F +SS++     L TSDHASVVSMNLFVALLC CIVLGHLLEENRW+NESITAL+IG+
Sbjct  1     MVFEISSVVSKLQTLSTSDHASVVSMNLFVALLCGCIVLGHLLEENRWMNESITALLIGV  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTGVVILL SGGKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAIG
Sbjct  61    CTGVVILLFSGGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLISC+II+ GA +IFK LD+  L+ GD+LAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISCTIITLGATQIFKRLDVGPLELGDFLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD+   D  I +HF+GNFLYLF++ST LGV  GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLNQIDSSIAVHFLGNFLYLFIASTMLGVLTGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLY GRHSTDREVALMMLM+YLSY++AEL YLSGILTVFFCGIVMSHYTWHNVTESSR+
Sbjct  241   KKLYIGRHSTDREVALMMLMAYLSYMLAELCYLSGILTVFFCGIVMSHYTWHNVTESSRI  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+HSFATLSFVAE FIFLYVGMDALDIEKWKFV +S G SVA S +L+GLIL+GRAAFV
Sbjct  301   TTKHSFATLSFVAEIFIFLYVGMDALDIEKWKFVSDSPGTSVATSGVLLGLILLGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSF+SNLAKK+ ++KISFRQQ+IIWWAGLMRGAVSIALAYN+FT SGHTSL  NAIMI
Sbjct  361   FPLSFISNLAKKSPNEKISFRQQVIIWWAGLMRGAVSIALAYNQFTMSGHTSLRSNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLP--PHKQMPSGHSSMT-TSEPS--SPKHFTVPLL  496
             TST+TVVLFSTVVFGL+TKPLI LLLP  PH +     SS+T  ++PS  SPK  T+PLL
Sbjct  421   TSTITVVLFSTVVFGLLTKPLIRLLLPHTPHHK----ESSITIITDPSTPSPKSVTIPLL  476

Query  495   DNQPDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAG  316
              +  +SE D I G ++ RP+++R LL TPTHTVHR WRKFDD+FMRPVFGGRGFVP   G
Sbjct  477   GSAQESEVD-IDGHDIHRPSSIRALLTTPTHTVHRLWRKFDDAFMRPVFGGRGFVPVEPG  535

Query  315   SPVEQS  298
             SP E++
Sbjct  536   SPTERN  541



>gb|AAK27314.2| sodium/proton exchanger [Citrus x paradisi]
Length=542

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/530 (77%), Positives = 462/530 (87%), Gaps = 6/530 (1%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDH SVVS+N+FVAL CA IV+GHLLEE+RW+NESITAL+IG+C GV+ILL +GGKSSH
Sbjct  17    TSDHNSVVSINIFVALPCASIVIGHLLEESRWMNESITALLIGVCAGVIILLTTGGKSSH  76

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             L VFSEDLFFIY+LPPIIFNAGFQVKKKQFF NF+TIMLFGAIGTL+SC+IIS G ++ F
Sbjct  77    LFVFSEDLFFIYVLPPIIFNAGFQVKKKQFFRNFITIMLFGAIGTLVSCTIISLGVIQFF  136

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             K LDI  LD GDYLAIGAIFAATDSVCTLQVL+QD+TPLLYSLVFGEGVVNDATSVVLFN
Sbjct  137   KKLDIGTLDIGDYLAIGAIFAATDSVCTLQVLNQDDTPLLYSLVFGEGVVNDATSVVLFN  196

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQSFD+T  + +    FIGNFLYLF +ST LGV  GLL AY+IKKLYFGRHSTDREVA+
Sbjct  197   AIQSFDLTHINTRSAFQFIGNFLYLFFTSTLLGVIGGLLSAYVIKKLYFGRHSTDREVAI  256

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             M+LM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE F
Sbjct  257   MVLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHTFATLSFVAEIF  316

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
              FLYVGMDALDIEKW+FVK S G SVA S++L+GLI+ GRAAFVFPLSFL+NLAKK+ ++
Sbjct  317   TFLYVGMDALDIEKWRFVKGSPGTSVAASAMLMGLIMAGRAAFVFPLSFLTNLAKKSPTE  376

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KIS +QQ+IIWWAGLMRGAVS+ALAYN+FT SGHT L ENAIMITST+TVVLFSTVVFGL
Sbjct  377   KISIKQQVIIWWAGLMRGAVSMALAYNQFTRSGHTQLRENAIMITSTITVVLFSTVVFGL  436

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDN-QPDSESDMITGPEVARPT  436
             MT+PLI LLL PH +  + H     S+PS+PK  + PLL+  Q DS +D++ GP V RP 
Sbjct  437   MTEPLIRLLL-PHPKHTTNH---ILSDPSTPKSLSQPLLEEGQQDSYADLV-GPTVPRPG  491

Query  435   ALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSPR*G  286
             +LR LL TPTHTVH YWRKFDD+FMRPVFGGRGF PFV GSP E+S R G
Sbjct  492   SLRALLTTPTHTVHYYWRKFDDAFMRPVFGGRGFAPFVPGSPTERSVRGG  541



>dbj|BAB56106.1| Na H-antiportor [Nierembergia caerulea]
Length=553

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/539 (77%), Positives = 466/539 (86%), Gaps = 7/539 (1%)
 Frame = -3

Query  1917  MAFGLSSLL-QNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MAF   +LL + ++L TSDH SVVS+NLFVAL+CACIV+GHLLEENRW+NESITAL+IG 
Sbjct  1     MAFDFGTLLGKMNNLTTSDHQSVVSVNLFVALICACIVIGHLLEENRWMNESITALVIGS  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTGV+ILL+SGGK+SH+LVFSEDLFFIYLLPPIIFNAGFQVKKK FF NF TIMLFGA+G
Sbjct  61    CTGVIILLISGGKNSHILVFSEDLFFIYLLPPIIFNAGFQVKKKSFFRNFSTIMLFGAVG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS  IIS GA+ IFK +DI  L+ GDYLAIGAIFAATDSVCTLQVL+Q+ETPLLYSLV
Sbjct  121   TLISFIIISAGAIGIFKKMDIGHLEIGDYLAIGAIFAATDSVCTLQVLNQEETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNA+Q+FD++       L  IGNFLYLF SSTFLGV +GLL A+II
Sbjct  181   FGEGVVNDATSVVLFNAVQNFDLSHISTGKALQLIGNFLYLFASSTFLGVAVGLLSAFII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVA+M+LM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVAIMILMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSF+AE FIFLYVGMDALDIEKWKFV +S G S+ VSSIL+GL+LVGR AFV
Sbjct  301   TTKHTFATLSFIAEIFIFLYVGMDALDIEKWKFVSDSPGTSIKVSSILLGLVLVGRGAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KKN  DKISF QQ+ IWWAGLMRGAVS+ALAYN+FT  GHT L  NAIMI
Sbjct  361   FPLSFLSNLTKKNPEDKISFNQQVTIWWAGLMRGAVSMALAYNQFTRGGHTQLRANAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFSTVVFGLMTKPLI LLLP  K +      M +SEP +PK F VPLLD+  D
Sbjct  421   TSTITVVLFSTVVFGLMTKPLILLLLPSQKHL----IRMISSEPMTPKSFIVPLLDSTQD  476

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             SE+D+  G  V RP +LRMLL TP+HTVH YWRKFD++FMRPVFGGRGFVPFV GSP E
Sbjct  477   SEADL--GRHVPRPHSLRMLLSTPSHTVHYYWRKFDNAFMRPVFGGRGFVPFVPGSPTE  533



>ref|XP_004296789.1| PREDICTED: sodium/hydrogen exchanger 2-like [Fragaria vesca subsp. 
vesca]
Length=542

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/542 (75%), Positives = 462/542 (85%), Gaps = 7/542 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNS--DLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             MA  LSS+   S   + TSDHASVVSMNLFVALLCACI+LGHLLEE+RW+NESITAL IG
Sbjct  1     MALDLSSMALESVGMVNTSDHASVVSMNLFVALLCACILLGHLLEESRWMNESITALAIG  60

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             LCTG+VILL + GKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIM+FGA+
Sbjct  61    LCTGIVILLTTKGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMMFGAV  120

Query  1563  GTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSL  1384
             GTLIS + IS GA+  F+   I  L  GDYLA+GAIF+ATDSVCTLQVL+QDETPLLYSL
Sbjct  121   GTLISFATISLGAMHFFRQFSIGTLKIGDYLALGAIFSATDSVCTLQVLNQDETPLLYSL  180

Query  1383  VFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYI  1204
             VFGEGVVNDATSVVLFNAIQSFD++  +    + FIGNFLYLF +ST LGV  GLL AY+
Sbjct  181   VFGEGVVNDATSVVLFNAIQSFDLSHINTSTIMQFIGNFLYLFATSTLLGVVAGLLSAYV  240

Query  1203  IKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  1024
             I+KLYFGRHSTDREVALM+LM+YLSY++AELFYLS ILTVFFCGIVMSHYTWHNVTESSR
Sbjct  241   IRKLYFGRHSTDREVALMILMAYLSYMLAELFYLSAILTVFFCGIVMSHYTWHNVTESSR  300

Query  1023  VTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAF  844
             VTT+H+FATLSFVAE FIFLYVGMDALDI+KW+FV +S   S+ VSSIL+ L++VGRAAF
Sbjct  301   VTTKHTFATLSFVAEIFIFLYVGMDALDIDKWRFVSDSPAKSLKVSSILLALVMVGRAAF  360

Query  843   VFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIM  664
             VFPLSFLSNL KK+  DKI  +QQ+ IWWAGLMRGAVS+ALAYN+F  +GH  L  NA M
Sbjct  361   VFPLSFLSNLTKKSPQDKIHLKQQVTIWWAGLMRGAVSMALAYNQFNRTGHNDLRANAYM  420

Query  663   ItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQP  484
             ITST+TVVLFSTVVFGLMTKPL+ +LLP  K      +SMT+SEPSSPK F VPLL N  
Sbjct  421   ITSTITVVLFSTVVFGLMTKPLVRILLPTSKHF----TSMTSSEPSSPKSFIVPLLTNGQ  476

Query  483   DSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             DSE++ I   ++ RPT+LRMLL TP+HTVH YWRKFD++FMRPVFGGRGFVPFV GSPVE
Sbjct  477   DSEAN-IRSVDIPRPTSLRMLLSTPSHTVHHYWRKFDNAFMRPVFGGRGFVPFVPGSPVE  535

Query  303   QS  298
             Q+
Sbjct  536   QN  537



>ref|XP_010241138.1| PREDICTED: sodium/hydrogen exchanger 2-like [Nelumbo nucifera]
Length=538

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/540 (77%), Positives = 468/540 (87%), Gaps = 6/540 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC  1738
             MA G S L++   L TSDHASVVSMNLFVALLCACIV+GHLLEENRW+NESITAL IG+C
Sbjct  1     MALG-SVLVKLGMLSTSDHASVVSMNLFVALLCACIVIGHLLEENRWMNESITALAIGVC  59

Query  1737  TGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGT  1558
             TGVVILL + GKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF TI+LFGA+GT
Sbjct  60    TGVVILLTTRGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFTTIVLFGAVGT  119

Query  1557  LISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVF  1378
             LIS  II+ GA + FK L++  LD GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLVF
Sbjct  120   LISFGIIATGAKQFFKRLNMVSLDIGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVF  179

Query  1377  GEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIK  1198
             GEGVVNDATSVVLFNAIQSFD++  +  I L FIGNF YLF+SST LGV  GLL AYIIK
Sbjct  180   GEGVVNDATSVVLFNAIQSFDLSHINSSIALQFIGNFFYLFVSSTMLGVVTGLLSAYIIK  239

Query  1197  KLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT  1018
             KLYFGRHSTDREVALM+LM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT
Sbjct  240   KLYFGRHSTDREVALMILMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT  299

Query  1017  TRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVF  838
             T+H+FATLSF+AE FIFLYVGMDALDIEKW+FV +S G S+AVSS+LV LILVGRAAFVF
Sbjct  300   TKHAFATLSFIAEIFIFLYVGMDALDIEKWRFVSDSPGTSIAVSSVLVSLILVGRAAFVF  359

Query  837   PLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMIt  658
             PLSFL+NL KK+ +DKI  +QQ+ IWWAGLMRGAVSIALAYN+FT SGHT LH NAIMIT
Sbjct  360   PLSFLTNLTKKSPNDKIGIKQQVTIWWAGLMRGAVSIALAYNQFTRSGHTQLHGNAIMIT  419

Query  657   stvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDS  478
             ST+T+VLFSTVVFGLMTKPL+ +LLP  K +    SS+ +SEPSSPK F  PLL+N   S
Sbjct  420   STITIVLFSTVVFGLMTKPLVRILLPSPKHL----SSIVSSEPSSPKSFFAPLLENGQGS  475

Query  477   ESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             E DM     + RP++LRML  +PTHTVH YWRKFDD+FMRPVFGGRGFVPFV GSP E+S
Sbjct  476   EVDM-ACTSIPRPSSLRMLFTSPTHTVHYYWRKFDDAFMRPVFGGRGFVPFVPGSPTERS  534



>gb|ACA33931.1| Na+/H+ antiporter [Salicornia brachiata]
Length=560

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/540 (76%), Positives = 463/540 (86%), Gaps = 16/540 (3%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVSMNLFVALLC CIV+GHLLEENRW+NESITAL+IGLCTGVVILL+SGGKS
Sbjct  16    LSTSDHASVVSMNLFVALLCGCIVIGHLLEENRWMNESITALLIGLCTGVVILLISGGKS  75

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI++FGAIGTL+S S+IS GA+ 
Sbjct  76    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIIMFGAIGTLVSFSVISLGAMT  135

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
             IFK +DI  L+ GDYLAI AIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  136   IFKKMDIGSLELGDYLAICAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  195

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQ+FD+T+ D +I + F GNFLYLF +ST LG   GLL AY+IKKLYFGRHSTDREV
Sbjct  196   FNAIQNFDLTNIDHRIAIQFSGNFLYLFFASTMLGAMTGLLSAYVIKKLYFGRHSTDREV  255

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATL FVAE
Sbjct  256   ALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLPFVAE  315

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              F+FLYVGMDALDIEKW+FV +S G SVAVSSIL+GL++VGRAAFVFPLS L N +KK+ 
Sbjct  316   IFLFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLLMVGRAAFVFPLSLLINFSKKSH  375

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KI+F QQI+IWWAGLMRGAVS+ALAYN+FT  GHT L  NAIMITST+T+VLFST+VF
Sbjct  376   SEKITFNQQIVIWWAGLMRGAVSMALAYNQFTRPGHTQLRGNAIMITSTITIVLFSTMVF  435

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPE----  451
             GL+TKPLI  LLP  K     +S+ T S+  SPK  ++PLLD   DSE+DM    E    
Sbjct  436   GLLTKPLILFLLPHSKHF---NSASTVSDLGSPKSLSLPLLDGGQDSEADMDNQDEAVNN  492

Query  450   ---------VARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
                      +ARP +LRMLL  PTHTVH YWRKFDDSFMRPVFGGRGFVP+V GSP+EQ+
Sbjct  493   RYEGIHNRTIARPGSLRMLLNAPTHTVHYYWRKFDDSFMRPVFGGRGFVPYVPGSPIEQN  552



>emb|CDP18377.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/523 (79%), Positives = 466/523 (89%), Gaps = 5/523 (1%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHAS+VS+NLFVALLC CIV+GHLLE+NRW+NES TALIIGLCTGVVILLLS G+SSH
Sbjct  9     TSDHASIVSINLFVALLCGCIVIGHLLEDNRWMNESTTALIIGLCTGVVILLLSKGRSSH  68

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA+GTL+S +IIS GA++IF
Sbjct  69    LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIMLFGAVGTLVSWAIISLGAIQIF  128

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
               +D    D GDYLAIGAIFAATDSVCTLQVL QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  129   SRMDFGDFDIGDYLAIGAIFAATDSVCTLQVLHQDETPLLYSLVFGEGVVNDATSVVLFN  188

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQSFDM+  DPKI LHFIGNFLYLF +ST LGV  GLLCAYIIKKLYFGRHSTDREVAL
Sbjct  189   AIQSFDMSKIDPKIALHFIGNFLYLFFTSTVLGVIAGLLCAYIIKKLYFGRHSTDREVAL  248

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSFVAETF
Sbjct  249   MMLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFVAETF  308

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALDIEKW+F+ +S G SVAVSSIL+GL+L+GRAAFVFPLSFLSNLAKK++S+
Sbjct  309   IFLYVGMDALDIEKWRFISDSPGTSVAVSSILLGLVLLGRAAFVFPLSFLSNLAKKSTSE  368

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KISF+QQ+IIWWAGL+RGAVS+ALAYNKFT+ GHT+L  NAIMITST+T+VLFSTVVFGL
Sbjct  369   KISFKQQVIIWWAGLIRGAVSMALAYNKFTSLGHTNLRGNAIMITSTITLVLFSTVVFGL  428

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             +TKPLI LLLPP K   S  S    S+P+SP    VPL+ +  DS+S  ++G ++ RP++
Sbjct  429   LTKPLIRLLLPPLKHATSAAS----SDPNSPNSLGVPLISHSQDSDS-FLSGHDIPRPSS  483

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             +RMLL TPT+TVHR WR+FDD FMRPVFGGRGFVP V GSP E
Sbjct  484   IRMLLTTPTYTVHRLWRRFDDRFMRPVFGGRGFVPVVPGSPTE  526



>ref|XP_007030156.1| Sodium/hydrogen exchanger [Theobroma cacao]
 gb|EOY10658.1| Sodium/hydrogen exchanger [Theobroma cacao]
Length=543

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/532 (77%), Positives = 462/532 (87%), Gaps = 17/532 (3%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVS+N+FVALLC CIV+GHLLEENRW+NESITAL+IGLCTGV+ILL SGGKS
Sbjct  16    LSTSDHASVVSLNIFVALLCTCIVIGHLLEENRWMNESITALVIGLCTGVIILLTSGGKS  75

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA+GTLISC++IS G ++
Sbjct  76    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIMLFGAVGTLISCTVISLGVIQ  135

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK +DI  LD GD+LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  136   FFKEMDIGSLDIGDFLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  195

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T+ +P+I L FIG+F YLFL+STFLGV +GL+ AYIIK LYFGRHSTDRE 
Sbjct  196   FNAIQSFDLTNINPRIALEFIGSFFYLFLASTFLGVIVGLVSAYIIKTLYFGRHSTDREF  255

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  256   ALMMLMAYLSYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAE  315

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDIEKW+FV +S G SVAVSS+L+ L++ GRAAFVFPLSFLSNLA+K++
Sbjct  316   TFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSVLLALVMAGRAAFVFPLSFLSNLARKSA  375

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KISFRQQIIIWWAGLMRGAVS+ALAYN+FT  GHT L  NAIMITST+T+VLFSTVV 
Sbjct  376   SEKISFRQQIIIWWAGLMRGAVSMALAYNQFTRLGHTQLRANAIMITSTITIVLFSTVVL  435

Query  618   GLMTKPLINL-----LLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGP  454
               +  P  N+     L+P +  M         S+PS+PK  TVPLL +  DS  D + G 
Sbjct  436   LHINAP--NMFGSCCLIPKYTSM--------LSDPSTPKSVTVPLLGSGQDSFEDGLGG-  484

Query  453   EVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              + RP+++R LL TPTHTVH YWRKFDD+FMRPVFGGRGFVPFV GSP E+S
Sbjct  485   -IPRPSSIRALLTTPTHTVHHYWRKFDDAFMRPVFGGRGFVPFVPGSPTERS  535



>gb|AAV73803.1| Na+/H+ antiporter NHX [Kalidium foliatum]
Length=560

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/540 (76%), Positives = 459/540 (85%), Gaps = 16/540 (3%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVSMNLFVALLC CIV+GHLLEENRW+NESITAL+IGL TGVVILL+SGGKS
Sbjct  16    LSTSDHASVVSMNLFVALLCGCIVIGHLLEENRWMNESITALLIGLSTGVVILLISGGKS  75

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI++FGA+GTL+S SIIS GA+ 
Sbjct  76    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIIMFGALGTLVSFSIISLGAMT  135

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK +DI  L+ GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  136   TFKRMDIGSLELGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  195

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQ+FD+T  D +I L F GNFLYLF +ST LG   GLL AY+IKKLYFGRHSTDREV
Sbjct  196   FNAIQNFDLTHIDHRIALQFSGNFLYLFFASTLLGAMTGLLSAYVIKKLYFGRHSTDREV  255

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  256   ALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAE  315

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              F+FLYVGMDALDIEKW+FV +S G SVAVSSIL+GL++VGRAAFVFPLSFL N +KK  
Sbjct  316   IFLFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLLMVGRAAFVFPLSFLMNFSKKTH  375

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+K++F QQI+IWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST++VV FST+VF
Sbjct  376   SEKVTFNQQIVIWWAGLMRGAVSMALAYNQFTRSGHTQLRGNAIMITSTISVVPFSTMVF  435

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPE----  451
             GL+TKPLI  LLP  K   S     T S+  SPK F++PLL+   DSE D+    E    
Sbjct  436   GLLTKPLILFLLPHPKHFTSAS---TVSDLGSPKSFSMPLLEGVQDSEVDVDNQDEGTNN  492

Query  450   ---------VARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
                      +ARP +LRMLL  PTHTVH YWRKFDDSFMRPV GGRGFVP+V GSP+EQ+
Sbjct  493   HVEGTNNRTIARPGSLRMLLNAPTHTVHYYWRKFDDSFMRPVLGGRGFVPYVPGSPIEQT  552



>gb|ADK62565.1| Na+/H+ antiporter [Halostachys caspica]
Length=551

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/533 (77%), Positives = 462/533 (87%), Gaps = 9/533 (2%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVSMNLFVALLC CIV+GHLLEENRW+NESITAL+IGL TGVVILL+SGGKS
Sbjct  16    LSTSDHASVVSMNLFVALLCGCIVIGHLLEENRWMNESITALLIGLSTGVVILLISGGKS  75

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI++FGA+GTL+S SIIS GA+ 
Sbjct  76    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIIMFGALGTLVSFSIISLGAMT  135

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
             IFK +DI  L+ GDYLAIGAIFAATDSVCTLQVL+QDETP LYSLVFGEGVVNDATSVVL
Sbjct  136   IFKKMDIGSLELGDYLAIGAIFAATDSVCTLQVLNQDETPPLYSLVFGEGVVNDATSVVL  195

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQ+FD+T  D +I L F GNFLYLF +ST LG   GLL AY+IKKLYFGRHSTDREV
Sbjct  196   FNAIQNFDLTHIDHRIALQFSGNFLYLFFASTLLGAMTGLLSAYVIKKLYFGRHSTDREV  255

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  256   ALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAE  315

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              F+FLYVGMDALDIEKW+FV +S G+SVAVSSIL+GL++VGRAAFVFPLSFL N +KK+ 
Sbjct  316   IFLFLYVGMDALDIEKWRFVNDSPGISVAVSSILLGLLMVGRAAFVFPLSFLMNFSKKSH  375

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
              +K++F QQI+IWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST+TVVLFST+VF
Sbjct  376   GEKVTFNQQIVIWWAGLMRGAVSMALAYNQFTMSGHTQLRGNAIMITSTITVVLFSTMVF  435

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPE----  451
             GL+TKPLI  LLP  K   S     T S+  SP+  ++PLL+   DSE D+    E    
Sbjct  436   GLLTKPLILFLLPHPKHFTSAS---TVSDLGSPRSLSLPLLEGGLDSEVDVGNHDEGTNS  492

Query  450   --VARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
               +ARP++LRMLL  PTHTVH YWRKFDDSFMRP+FGGRGFVP+V GSP+EQ+
Sbjct  493   RPIARPSSLRMLLNAPTHTVHYYWRKFDDSFMRPMFGGRGFVPYVPGSPIEQT  545



>gb|AAT36678.1| NHX1 [Citrus trifoliata]
Length=541

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/530 (76%), Positives = 461/530 (87%), Gaps = 7/530 (1%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDH SVVS+N+FVALLCA IV+GHLLEE+RW+NESITAL+IG+C GV+ILL +GGKSSH
Sbjct  17    TSDHNSVVSINIFVALLCASIVIGHLLEESRWMNESITALLIGVCAGVIILLTTGGKSSH  76

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             L VFSEDLFFIY+LPPIIFNAGFQVKKKQFF NF+TIMLFGAIGTL+SC+IIS G ++ F
Sbjct  77    LFVFSEDLFFIYVLPPIIFNAGFQVKKKQFFRNFITIMLFGAIGTLVSCTIISLGVIQFF  136

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             K LDI  LD GDYLAIGAIFAATDSVCTLQVL+QD+TPLLYSLVFGEGVVNDATSVVLFN
Sbjct  137   KKLDIGTLDIGDYLAIGAIFAATDSVCTLQVLNQDDTPLLYSLVFGEGVVNDATSVVLFN  196

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQSFD+   + +    FIGNFLYLF +ST LGV IGLL AY+IKKLYFGRHSTDREVA+
Sbjct  197   AIQSFDLNHINTRSAFQFIGNFLYLFFTSTLLGV-IGLLSAYVIKKLYFGRHSTDREVAI  255

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             M+LM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE F
Sbjct  256   MVLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHTFATLSFVAEIF  315

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALDIEKW+FVK S G SVA S++L+GLI+ GRAAFVFPLSFL+NLAKK+ ++
Sbjct  316   IFLYVGMDALDIEKWRFVKGSPGTSVAASAMLMGLIMAGRAAFVFPLSFLTNLAKKSPTE  375

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KIS +QQ+IIWWA LMR + S+ALAYN+FT SGHT L ENAIMITST+TVVLFSTVVFGL
Sbjct  376   KISIKQQVIIWWARLMRESNSMALAYNQFTRSGHTQLRENAIMITSTITVVLFSTVVFGL  435

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDN-QPDSESDMITGPEVARPT  436
             MTKPLI LLL PH +  + H     S+PS+PK  + PLL+  Q DS +D++ GP V RP 
Sbjct  436   MTKPLIRLLL-PHPKHTTNH---ILSDPSTPKSLSQPLLEEGQQDSYADLV-GPTVPRPG  490

Query  435   ALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSPR*G  286
             +LR LL TPTHTVH YWRKFDD+FMRPVFGGRGF PFV GSP E+S R G
Sbjct  491   SLRALLTTPTHTVHYYWRKFDDAFMRPVFGGRGFAPFVPGSPTERSVRGG  540



>gb|ADD70241.1| Na/H antiporter [Bruguiera gymnorhiza]
Length=541

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/527 (79%), Positives = 465/527 (88%), Gaps = 6/527 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L+TSDH+SVVSMNLFVALLCACIV+ HLLEENRW+NESITALIIGLCTGVVILL+SGG+S
Sbjct  15    LYTSDHSSVVSMNLFVALLCACIVISHLLEENRWMNESITALIIGLCTGVVILLVSGGRS  74

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIML+GA+GTLISC IIS GA  
Sbjct  75    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLYGAVGTLISCCIISVGATL  134

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK +DI  LD GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  135   AFKKMDIGSLDVGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  194

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD++ F P I   F+G+FLYLF +ST LGV  GLL A+IIKKLYFGRHSTDREV
Sbjct  195   FNAIQSFDLSHFSPSIAGQFVGSFLYLFFTSTVLGVFTGLLSAFIIKKLYFGRHSTDREV  254

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALM+LM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  255   ALMILMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAE  314

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              FIFLYVGMDALDIEKW+FV +S G S+AVSS+L+ L+L+GRAAFVFPLSF+SNL+KK++
Sbjct  315   IFIFLYVGMDALDIEKWRFVSDSPGTSIAVSSVLLALVLIGRAAFVFPLSFISNLSKKST  374

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             ++KI  +QQIIIWWAGLMRGAVS+ALAYNKFT+ GHT++ +NAIMITST+TVVLFSTVVF
Sbjct  375   NEKIGIKQQIIIWWAGLMRGAVSMALAYNKFTSLGHTNVRDNAIMITSTITVVLFSTVVF  434

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             GL+TKPLI LLLP  KQ P G       +P+SPK  TVPLL    DS  D I G +  RP
Sbjct  435   GLLTKPLIRLLLPHTKQKPKG-----ILDPTSPKSNTVPLLGEGQDSLDD-IGGQDGLRP  488

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              +LR LL TPTHTVH YWRKFD++FMRPVFGGRGFVPFV GSP E+S
Sbjct  489   NSLRALLTTPTHTVHYYWRKFDNAFMRPVFGGRGFVPFVPGSPTERS  535



>gb|ABM17091.1| antiporter protein [Helianthus tuberosus]
Length=549

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/532 (75%), Positives = 460/532 (86%), Gaps = 10/532 (2%)
 Frame = -3

Query  1893  LQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlll  1714
             + +S L TS+++SVVSMNLFVALLC CIVLGHLLEENRW+NESITAL+IGLCTGVVILL+
Sbjct  12    MGSSTLATSEYSSVVSMNLFVALLCGCIVLGHLLEENRWMNESITALLIGLCTGVVILLI  71

Query  1713  sggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIIS  1534
             SGG SSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI+LFGA+GT+IS +IIS
Sbjct  72    SGGTSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIVLFGAVGTMISFTIIS  131

Query  1533  FGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDA  1354
             F A+KIFK ++I  L+ GDYLAIGAIF+ATDSVCTLQVL+QD+TPLLYSLVFGEGVVNDA
Sbjct  132   FAAIKIFKKMNIGELELGDYLAIGAIFSATDSVCTLQVLNQDQTPLLYSLVFGEGVVNDA  191

Query  1353  TSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHS  1174
             TSVV+FNA+Q+FD++     I    +GNF YLF++ST LG G GLL AYIIKKLYFGRHS
Sbjct  192   TSVVIFNAVQNFDLSRITTAIAFQLLGNFFYLFITSTLLGAGAGLLSAYIIKKLYFGRHS  251

Query  1173  TDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATL  994
             TDREVA+M+LM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTE SRVTT+H+FAT 
Sbjct  252   TDREVAIMILMAYLSYMLAELFSLSGILTVFFCGIVMSHYTWHNVTEKSRVTTKHAFATF  311

Query  993   SFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNL  814
             SF+AE FIFLYVGMDALDIEKW FVK+S G S  VS+IL+GL+LVGRAAFVFPLSFLSNL
Sbjct  312   SFIAELFIFLYVGMDALDIEKWSFVKDSPGTSAEVSAILLGLVLVGRAAFVFPLSFLSNL  371

Query  813   AKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlf  634
              KK   +KI FRQQ++IWWAGLMRGAVS+ALAYN+FT  GHT++  NAIMITST+TVVLF
Sbjct  372   TKKAQHEKIDFRQQVLIWWAGLMRGAVSMALAYNQFTKEGHTTMPGNAIMITSTITVVLF  431

Query  633   stvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGP  454
             ST+VFGL+T+PL+ LLLP  K +    + M +SEPSSPK F VPLL N  DS  +M    
Sbjct  432   STMVFGLITQPLVRLLLPAPKNL----NRMISSEPSSPKSFIVPLLGNGQDSIDNM----  483

Query  453   EVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
                RP++LRMLL TP+HTVH YWRKFD++FMRPVFGGRGFVPF+ GSP EQS
Sbjct  484   --PRPSSLRMLLATPSHTVHYYWRKFDNAFMRPVFGGRGFVPFIPGSPTEQS  533



>ref|XP_009384394.1| PREDICTED: sodium/hydrogen exchanger 2-like [Musa acuminata subsp. 
malaccensis]
Length=537

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/524 (77%), Positives = 452/524 (86%), Gaps = 5/524 (1%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDH SVVS+NLFVALLC CIV+GHLLEENRW+NESITALIIGLCTG+VILL + GKSSH
Sbjct  15    TSDHTSVVSINLFVALLCGCIVIGHLLEENRWMNESITALIIGLCTGIVILLTTKGKSSH  74

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             +LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+GTLIS  IISFGA+ +F
Sbjct  75    VLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVGTLISFFIISFGAIALF  134

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             + +DI  LD GD+LAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  135   RKMDIGSLDIGDFLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  194

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQ+FD+   D  I   F+ NF YLF++STFLG   GLL AYIIKKLYFGRHSTDREVAL
Sbjct  195   AIQNFDLVHIDAIIVFKFLSNFCYLFITSTFLGAFSGLLSAYIIKKLYFGRHSTDREVAL  254

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             M+LM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+HSFATLSF+AETF
Sbjct  255   MILMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHSFATLSFIAETF  314

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDIEKWKFV  S G SV VSSIL+GL+L+GRAAFVFPLSFLSNL KK+  +
Sbjct  315   LFLYVGMDALDIEKWKFVSGSPGKSVGVSSILIGLVLIGRAAFVFPLSFLSNLTKKSPDE  374

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI F+QQI IWWAGLMRGAVS+ALAYN+F  SGHT L  NAIMITST+TVVLFSTVVFGL
Sbjct  375   KIIFKQQITIWWAGLMRGAVSMALAYNQFARSGHTQLRGNAIMITSTITVVLFSTVVFGL  434

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             MTKPL+ LLLP   +    H S   SEPS+PK  + PLL+N+  SE +M  G  + RPT 
Sbjct  435   MTKPLVRLLLPHSAK----HLSSILSEPSTPKALSCPLLENRHGSEGEM-GGQLIPRPTR  489

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             L MLL  PTHTVH YWRKFDD+FMRP+FGGRGFVPFV GSP+EQ
Sbjct  490   LGMLLSKPTHTVHHYWRKFDDAFMRPMFGGRGFVPFVPGSPIEQ  533



>gb|ABG89337.1| Na+/H+ antiporter [Caragana korshinskii]
Length=538

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/540 (78%), Positives = 471/540 (87%), Gaps = 7/540 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC  1738
             MAF + S LQN  L TSDHASVVSMNLFVALLCACIV+GHLLEENRW+NESITAL+IGLC
Sbjct  1     MAFEIVSKLQN--LSTSDHASVVSMNLFVALLCACIVVGHLLEENRWMNESITALLIGLC  58

Query  1737  TGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGT  1558
             TG++ILL SGGKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNF+TI+ FGAIGT
Sbjct  59    TGIIILLFSGGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFITIVSFGAIGT  118

Query  1557  LISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVF  1378
             L+SC II+ G +  FK +DI  L+ GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVF
Sbjct  119   LVSCVIITLGVMYAFKRMDIGPLELGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVF  178

Query  1377  GEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIK  1198
             GEGVVNDATSVVLFNAIQSFD+   +  I LHF+GNFLYLF++ST LGV  GL  AY+IK
Sbjct  179   GEGVVNDATSVVLFNAIQSFDLNRLNSLIALHFLGNFLYLFIASTLLGVLTGLFSAYVIK  238

Query  1197  KLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT  1018
             KLY GRHSTDREVALMMLM+YLSY++AEL YLSGILTVFFCGIVMSHYTWHNVTESSR+T
Sbjct  239   KLYIGRHSTDREVALMMLMAYLSYMLAELSYLSGILTVFFCGIVMSHYTWHNVTESSRIT  298

Query  1017  TRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVF  838
             T+H+FATLSFVAE FIFLYVGMDALDIEKWKFV +S G SVA SS+L+GL+L+GRAAFVF
Sbjct  299   TKHAFATLSFVAEIFIFLYVGMDALDIEKWKFVSDSPGTSVAASSVLLGLVLLGRAAFVF  358

Query  837   PLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMIt  658
             PLSFLSNL KK+  +KISFRQQ+IIWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMIT
Sbjct  359   PLSFLSNLTKKSPYEKISFRQQVIIWWAGLMRGAVSMALAYNQFTMSGHTQLRCNAIMIT  418

Query  657   stvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDS  478
             ST+TVVLFSTVVFGLMTKPLI LLLP     P   +SMTT+E S+PK   VPLL +  DS
Sbjct  419   STITVVLFSTVVFGLMTKPLIRLLLP----HPKATNSMTTTESSTPKSAIVPLLGSAQDS  474

Query  477   ESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             E+D+  G E+ RP+++R LL TPTHTVHR WR+FDDSFMRPVFGGRGFVP   GSP E++
Sbjct  475   EADL-DGHEIHRPSSIRALLSTPTHTVHRLWRRFDDSFMRPVFGGRGFVPVEPGSPSERN  533



>ref|XP_004135647.1| PREDICTED: sodium/hydrogen exchanger 2-like [Cucumis sativus]
 ref|XP_004157275.1| PREDICTED: sodium/hydrogen exchanger 2-like [Cucumis sativus]
 gb|KGN66142.1| Sodium/hydrogen exchanger [Cucumis sativus]
Length=532

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/526 (76%), Positives = 465/526 (88%), Gaps = 11/526 (2%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVS+NLFVALLCACIV+GHLLEE RW+NESITAL IGL TG++ILL+SGGKS
Sbjct  15    LSTSDHASVVSINLFVALLCACIVIGHLLEETRWMNESITALFIGLFTGIIILLVSGGKS  74

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLL+FSED FFIYLLPPIIFNAGFQVKKKQFFVNFMTIM+FGAIGTL+SCS+IS GA +
Sbjct  75    SHLLLFSEDTFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMMFGAIGTLVSCSVISLGAFQ  134

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
             +FK +D+  L+  D LAIGAIFAATDSVCTLQ+L+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  135   LFKKMDVGSLEIADILAIGAIFAATDSVCTLQILNQDETPLLYSLVFGEGVVNDATSVVL  194

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQS D++  D  +GLHFIG+F YLF +ST LGV +GLL AY+IKKLYFGRHSTDREV
Sbjct  195   FNAIQSLDLSKVDATVGLHFIGSFFYLFSTSTLLGVFVGLLSAYVIKKLYFGRHSTDREV  254

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALM+LM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF++E
Sbjct  255   ALMILMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFISE  314

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIF+YVGMDALDIEKW FV +S G SVAVS+IL+GL++VGRAAFVFPLSF+SNLAKK++
Sbjct  315   TFIFVYVGMDALDIEKWSFVSDSPGTSVAVSAILLGLVMVGRAAFVFPLSFISNLAKKSA  374

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KI+FR+Q+IIWWAGLMRGAVSIALAY++FT +GHT L  NA+MITST+TVVLFST+VF
Sbjct  375   SEKITFREQVIIWWAGLMRGAVSIALAYHQFTRAGHTQLRGNAMMITSTITVVLFSTMVF  434

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             GL+TKPLIN L+P  K     H++   S+P +PK F+VPLL +  +SE D+       RP
Sbjct  435   GLLTKPLINCLIPQPK-----HTTSMLSDPGTPKSFSVPLLGSAQESELDL------PRP  483

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             +++R LL TPTHTVHRYWRKFDD+FMRP+FGGRGFVPFV GSP E+
Sbjct  484   SSIRALLATPTHTVHRYWRKFDDAFMRPMFGGRGFVPFVPGSPTER  529



>dbj|BAD95562.1| putative Na+/H+ antiporter [Phragmites australis]
Length=538

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/525 (77%), Positives = 451/525 (86%), Gaps = 9/525 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS+NLFVALLCACIVLGHLLEENRWVNESITALI+GLCTGVVILL + GKSSH
Sbjct  18    TSDHASVVSINLFVALLCACIVLGHLLEENRWVNESITALIVGLCTGVVILLTTKGKSSH  77

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             +LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GT+IS   ISFGA+ IF
Sbjct  78    ILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTMISFFTISFGAIAIF  137

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
               ++I  LD GD+LAIGAIF+AT SVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  138   GRMNIGTLDVGDFLAIGAIFSATASVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  197

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+++FD+   D  + L F+GN  YLF+SSTFLGV  GLLCAYIIKKLY GRHSTDREVAL
Sbjct  198   ALENFDLNKIDVAVVLKFLGNVCYLFVSSTFLGVFTGLLCAYIIKKLYIGRHSTDREVAL  257

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF
Sbjct  258   MMLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETF  317

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDIEKWKF  +S G S+ +SSIL+GL+LVGRAAFVFPLSFLSNL KK   +
Sbjct  318   LFLYVGMDALDIEKWKFASDSPGKSIGISSILLGLVLVGRAAFVFPLSFLSNLTKKTPFE  377

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI++RQQI+IWWAGLMRGAVSIALAYNKFT SGHT LH NAIMITST+TVVLFST+VFG+
Sbjct  378   KITWRQQIVIWWAGLMRGAVSIALAYNKFTRSGHTQLHGNAIMITSTITVVLFSTMVFGM  437

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             MTKPLI  LLP         SS  TSEPSSPK    PLL +     SD+ T   + RP++
Sbjct  438   MTKPLIRFLLP-------ASSSTVTSEPSSPKSLHSPLLTSLQG--SDLETATHIVRPSS  488

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             LRMLL  PTHTVH YWRKFDD+ MRP+FGGRGFVPF  GSP+EQS
Sbjct  489   LRMLLSKPTHTVHYYWRKFDDALMRPMFGGRGFVPFSPGSPIEQS  533



>ref|XP_004958612.1| PREDICTED: sodium/hydrogen exchanger 2-like [Setaria italica]
Length=539

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/525 (77%), Positives = 451/525 (86%), Gaps = 8/525 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS+NLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILL + GKSSH
Sbjct  18    TSDHASVVSINLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILLTTKGKSSH  77

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             +LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GT+IS   IS GA+ IF
Sbjct  78    ILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTMISFFTISLGAIAIF  137

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
               ++I  LD GD+LAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  138   SRMNIGTLDVGDFLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  197

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+Q+FD+   D  + L F+GNF YLFLSSTFLGV +GLL AY+IKKLY GRHSTDREVAL
Sbjct  198   ALQNFDLNHIDVAVVLKFLGNFCYLFLSSTFLGVFVGLLSAYMIKKLYIGRHSTDREVAL  257

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF
Sbjct  258   MMLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETF  317

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDIEKW+F  +S G S+ +SSIL+GL+LVGRAAFVFPLSFLSNL KK   +
Sbjct  318   LFLYVGMDALDIEKWEFASDSPGKSIGISSILLGLVLVGRAAFVFPLSFLSNLTKKTPLE  377

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI++RQQI+IWWAGLMRGAVSIALAYNKFT SGHT LH NAIMITST+TVVLFST+VFG+
Sbjct  378   KITWRQQIVIWWAGLMRGAVSIALAYNKFTRSGHTQLHGNAIMITSTITVVLFSTMVFGM  437

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             MTKPLI  LLP         S+  TSEPSSPK    PLL +   S+ +  T   + RP++
Sbjct  438   MTKPLIRFLLP-------ASSNTVTSEPSSPKSLHSPLLTSMQGSDLETATA-NIVRPSS  489

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             LRMLL  PTHTVH YWRKFDD+ MRP+FGGRGFVPF  GSP EQS
Sbjct  490   LRMLLSKPTHTVHYYWRKFDDALMRPMFGGRGFVPFSPGSPTEQS  534



>ref|XP_009414185.1| PREDICTED: sodium/hydrogen exchanger 2-like [Musa acuminata subsp. 
malaccensis]
Length=542

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/542 (75%), Positives = 463/542 (85%), Gaps = 7/542 (1%)
 Frame = -3

Query  1917  MAFGL--SSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             MAFGL    L++   L TSDHASVVS+NLFVALLC CIV+GHLLEE+RW+NESITAL+IG
Sbjct  1     MAFGLVAQQLVRLGILSTSDHASVVSINLFVALLCGCIVIGHLLEESRWINESITALVIG  60

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             +CTGVVILL + GKSSH+ VFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+
Sbjct  61    VCTGVVILLTTKGKSSHIFVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAV  120

Query  1563  GTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSL  1384
             GTLIS  IISFGA+++F+ +DI  LD GD+LAIGAIF+ATDSVCTLQVL+QDETPLLYSL
Sbjct  121   GTLISFFIISFGAIELFRKMDIGSLDIGDFLAIGAIFSATDSVCTLQVLNQDETPLLYSL  180

Query  1383  VFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYI  1204
             VFGEGVVNDATSVVLFNAIQ+FD+   D  I L F+GNF YLFLSST LG   GLL AYI
Sbjct  181   VFGEGVVNDATSVVLFNAIQNFDLVHIDAIIILKFVGNFGYLFLSSTLLGAFGGLLSAYI  240

Query  1203  IKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  1024
             IKKLY GRHSTDREVALM+LM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSR
Sbjct  241   IKKLYIGRHSTDREVALMILMAYLSYMLAELLNLSGILTVFFCGIVMSHYTWHNVTESSR  300

Query  1023  VTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAF  844
             VTT+H+FATLSF+AETF+FLYVGMDALDIEKW+FV +S G S+ VSSIL+GL+LVGRAAF
Sbjct  301   VTTKHAFATLSFIAETFLFLYVGMDALDIEKWRFVSDSPGKSLRVSSILLGLVLVGRAAF  360

Query  843   VFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIM  664
             VFPLSFLSNL KK++ +KI F+QQ+ IWWAGLMRGAVSIALAYN+FT SGHT L  NA +
Sbjct  361   VFPLSFLSNLTKKSTDEKIIFKQQVTIWWAGLMRGAVSIALAYNQFTRSGHTQLRGNAFL  420

Query  663   ItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQP  484
             ITST+TVVLFSTVVFGLMTKPLI  LLP + +    H S  +SEPS+PK    P L+N  
Sbjct  421   ITSTITVVLFSTVVFGLMTKPLIRFLLPHNAK----HLSSMSSEPSTPKSLLSPFLENGQ  476

Query  483   DSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
              SE + + G   +RP++LRMLL  PTHTVH YWRKFD++FMRP+FGGRGFVPF  GSP E
Sbjct  477   GSEVE-VGGEFASRPSSLRMLLSKPTHTVHYYWRKFDNAFMRPMFGGRGFVPFFPGSPTE  535

Query  303   QS  298
             QS
Sbjct  536   QS  537



>gb|AAU81619.1| Na+/H+ antiporter [Iris lactea]
Length=546

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/525 (76%), Positives = 457/525 (87%), Gaps = 1/525 (0%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS+NLFVALLCACIV+GHLLEENRW+NESITAL IGLCTGVVILL + GKSSH
Sbjct  18    TSDHASVVSINLFVALLCACIVIGHLLEENRWMNESITALAIGLCTGVVILLTTNGKSSH  77

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             + VFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+GTLIS  IIS GA+ +F
Sbjct  78    IFVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVGTLISFVIISLGAIGLF  137

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             + ++I  L+ GD+LAIGAIF+ATDSVCTLQ+L+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  138   RKMNIGPLEIGDFLAIGAIFSATDSVCTLQILNQDETPLLYSLVFGEGVVNDATSVVLFN  197

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQ+FD+   D  I   FIGNF YLF+SSTFLG   GLL AYIIKKLY+GRHSTDREVAL
Sbjct  198   AIQNFDLEHIDAGIAAKFIGNFFYLFVSSTFLGAFAGLLSAYIIKKLYYGRHSTDREVAL  257

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF++E F
Sbjct  258   MMLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFISEIF  317

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDIEKW+FV +S G S+ VS+I++GL+L+GRAAFVFPLSFLSNLAKK+ ++
Sbjct  318   LFLYVGMDALDIEKWRFVSDSPGKSIGVSAIIIGLVLIGRAAFVFPLSFLSNLAKKSPNE  377

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI+F QQ+ IWWAGLMRGAVSIALAYN+FT +GHT L  NA+MITST+TVVLFSTVVFGL
Sbjct  378   KITFNQQVTIWWAGLMRGAVSIALAYNQFTRAGHTQLPGNAMMITSTITVVLFSTVVFGL  437

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             +TKPLI LLLPP  +  +G  S   SEPS+PK  +  LL+N P  E++  T    ARP++
Sbjct  438   LTKPLIRLLLPPSTKHLTGSCSF-NSEPSTPKFLSAALLENIPGFEAEGGTTNLGARPSS  496

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             LRMLL  PTHTVH YWRKFDD+FMRP+FGGRGFVPFV GSP EQS
Sbjct  497   LRMLLMKPTHTVHYYWRKFDDAFMRPMFGGRGFVPFVPGSPTEQS  541



>dbj|BAP90754.1| vacuolar Na+/H+ antiporter [Nelumbo nucifera]
Length=538

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/540 (77%), Positives = 465/540 (86%), Gaps = 6/540 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC  1738
             MA G S L++   L TSDHASVVSMNLFVALLCACIV+GHLLEENRW+NESITAL IG+C
Sbjct  1     MALG-SVLVKLGMLSTSDHASVVSMNLFVALLCACIVIGHLLEENRWMNESITALAIGVC  59

Query  1737  TGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGT  1558
             TGVVILL + GKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF TI+LFGA+GT
Sbjct  60    TGVVILLTTRGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFTTIVLFGAVGT  119

Query  1557  LISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVF  1378
             LIS SII+ GA + FK LD+  LD GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLVF
Sbjct  120   LISFSIIATGATEFFKRLDMGSLDIGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVF  179

Query  1377  GEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIK  1198
             GEGVVNDATSVVLFNAIQSFD++  +  I L FIGNF YLF+SST LGV  GLL AYIIK
Sbjct  180   GEGVVNDATSVVLFNAIQSFDLSHINSSIALQFIGNFFYLFVSSTMLGVVTGLLSAYIIK  239

Query  1197  KLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT  1018
             KLYFGRHSTDREVALM+LM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT
Sbjct  240   KLYFGRHSTDREVALMILMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT  299

Query  1017  TRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVF  838
             T+H+FATLSF+AE FIFLYVGMDALDIEKW+FV +S G S+AVSS+LV LILVGRAAFVF
Sbjct  300   TKHAFATLSFIAEIFIFLYVGMDALDIEKWRFVSDSPGTSIAVSSVLVSLILVGRAAFVF  359

Query  837   PLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMIt  658
             PLSFL+NL KK+ +DKI  +QQ+ IWWAGLMRGAVSIALAYN+FT SGHT LH NAIMIT
Sbjct  360   PLSFLTNLTKKSPNDKIGIKQQVTIWWAGLMRGAVSIALAYNQFTRSGHTQLHGNAIMIT  419

Query  657   stvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDS  478
             ST+T+VLFSTVVFGLMTKPL+ +LLP  K +    SS+ +SEPSSPK F  PLL+N   S
Sbjct  420   STITIVLFSTVVFGLMTKPLVRILLPSPKHL----SSIVSSEPSSPKSFFAPLLENGRGS  475

Query  477   ESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             E DM     + RP++LRML   PTHTVH YW K DD+FMRPVFGG GFVPFV GSP E+S
Sbjct  476   EVDM-ACTSIPRPSSLRMLFTFPTHTVHYYWGKLDDAFMRPVFGGGGFVPFVPGSPTERS  534



>gb|ABF68604.1| putative vacuolar Na+/H+ antiporter [Suaeda corniculata]
Length=554

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/532 (76%), Positives = 461/532 (87%), Gaps = 10/532 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDH+SVVSMNLFVALLC CIV+GHLLE+NRW+NESITAL+IGL TG++ILL+SGGKSSH
Sbjct  18    TSDHSSVVSMNLFVALLCGCIVIGHLLEKNRWMNESITALLIGLSTGIIILLISGGKSSH  77

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI+LFGA+GTL+S  IIS G++ IF
Sbjct  78    LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIILFGAVGTLVSFIIISLGSIAIF  137

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             + +DI  L+ GD LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  138   QKMDIGSLELGDLLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  197

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQ+FD+T  D +I   F GNFLYLF +ST LG   GLL AY+IKKLYFGRHSTDREVAL
Sbjct  198   AIQNFDLTHIDHRIAFQFGGNFLYLFFASTLLGAVTGLLSAYVIKKLYFGRHSTDREVAL  257

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE F
Sbjct  258   MMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAEIF  317

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL++VGRAAFVFPLSFL NL+KK++S+
Sbjct  318   IFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLLMVGRAAFVFPLSFLMNLSKKSNSE  377

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             K++F QQI+IWWAGLMRGAVS+ALAYN+F+ SGHT L  NAIMITST+TVVLFST+VFGL
Sbjct  378   KVTFNQQIVIWWAGLMRGAVSVALAYNQFSRSGHTQLRGNAIMITSTITVVLFSTMVFGL  437

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPE------  451
             + KPLI  +LP  K   S     T S+  SPK F++PLL+++ DSE+D+    +      
Sbjct  438   LAKPLILFMLPQPKHFTSAS---TVSDLGSPKSFSLPLLEDRQDSEADLGNDDKEAYPRG  494

Query  450   -VARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              +ARPT+LRMLL  PTHTVH YWR+FDD FMRPVFGG GFVPFV GSP EQS
Sbjct  495   TIARPTSLRMLLNAPTHTVHHYWRRFDDYFMRPVFGGPGFVPFVPGSPTEQS  546



>gb|ACZ97405.1| putative vacuolar Na+/H+ antiporter [Aeluropus lagopoides]
Length=540

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/525 (77%), Positives = 451/525 (86%), Gaps = 7/525 (1%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS+NLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILL + GKSSH
Sbjct  18    TSDHASVVSINLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILLTTKGKSSH  77

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             +LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GT+IS   IS GA+ IF
Sbjct  78    ILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTMISFFTISIGAIAIF  137

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
               ++I  L+ GD+LAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  138   SRMNIGTLEVGDFLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  197

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+Q+FD+   D  + L F+GNF YLFLSSTFLGV  GLL AYIIKKLY GRHSTDREVAL
Sbjct  198   ALQNFDLNKIDVAVVLKFLGNFCYLFLSSTFLGVFAGLLSAYIIKKLYIGRHSTDREVAL  257

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF
Sbjct  258   MMLMAYLSYMLAELSDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETF  317

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDIEKWKF  +S G S+ +SSIL+GL+LVGRAAFVFPLSFLSNL KK   +
Sbjct  318   LFLYVGMDALDIEKWKFASDSPGKSIGISSILLGLVLVGRAAFVFPLSFLSNLTKKADFE  377

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI++RQQI+IWWAGLMRGAVSIALAYNKFT SGHT LH NAIMITST+TVVLFST+VFG+
Sbjct  378   KITWRQQIVIWWAGLMRGAVSIALAYNKFTRSGHTQLHGNAIMITSTITVVLFSTMVFGM  437

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             MTKPLI  LLP      S H+   TSEPSSPK    PLL +   S+ +  +   + RP++
Sbjct  438   MTKPLIQFLLP-----ASSHT--VTSEPSSPKSLHSPLLTSMQGSDLETASHSHIVRPSS  490

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             LRMLL  PTHTVH YWRKFDD+ MRP+FGGRGFVPF  GSP EQS
Sbjct  491   LRMLLSKPTHTVHYYWRKFDDALMRPMFGGRGFVPFSPGSPTEQS  535



>ref|NP_001233885.1| (Sodium/potassium)/proton exchanger 4 [Solanum lycopersicum]
 emb|CAK12755.2| (Sodium/potassium)/proton exchanger 4 [Solanum lycopersicum]
Length=536

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/542 (75%), Positives = 458/542 (85%), Gaps = 7/542 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MA  L+SL      L TSDHASV S+NLFVALLCACI++GHLLEENRWVNESITALIIGL
Sbjct  1     MASVLASLFPKLGSLGTSDHASVASINLFVALLCACIIIGHLLEENRWVNESITALIIGL  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
              TGVVILL+SGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQ FVNFMTIMLFGAIG
Sbjct  61    GTGVVILLVSGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQSFVNFMTIMLFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TL+SC+IIS GA++ FK LDI+FLD GDYLAIGAIFAATDSVCTLQVL QDETPLLYSLV
Sbjct  121   TLVSCAIISLGAIQTFKKLDIEFLDIGDYLAIGAIFAATDSVCTLQVLHQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQ+ D+TS +P I L F+GNF YLFL+ST LG G GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIQNVDLTSLNPSIALSFLGNFFYLFLASTLLGAGTGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TTRH+FATLSF+AETF+FLYVGMDALD EKWKFV +  GLS++ SSIL+GLIL G + F 
Sbjct  301   TTRHTFATLSFLAETFLFLYVGMDALDTEKWKFVGDRPGLSISASSILMGLILSGESCFC  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             F +  L  L ++    K +FRQQ+IIWWAGLMRGAVS+ALAYNKFT  GHT L +NAIMI
Sbjct  361   FSIIILIQLNEEILGRKNTFRQQVIIWWAGLMRGAVSMALAYNKFTHGGHTQLQDNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+T+VLFST+VFGLMTKPLI+LLLPP +Q+     S  +S  ++PK  T PLL ++ D
Sbjct  421   TSTITIVLFSTMVFGLMTKPLISLLLPPQRQL-----STVSSGANTPKSLTAPLLGSRED  475

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE D+   P++  P +LRMLL  P+H VHRYWRKFDD+FMRP+FGGRGF P    SP E 
Sbjct  476   SEGDL-NVPDLPHPPSLRMLLTAPSHKVHRYWRKFDDAFMRPMFGGRGFAPPAPRSPTEH  534

Query  300   SP  295
              P
Sbjct  535   GP  536



>ref|XP_003520827.1| PREDICTED: sodium/hydrogen exchanger 2-like [Glycine max]
 gb|KHN04040.1| Sodium/hydrogen exchanger 2 [Glycine soja]
Length=547

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/543 (76%), Positives = 461/543 (85%), Gaps = 5/543 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC  1738
             M   LS +L   ++ TSDHASVVSMN+FVALLCACIV+GHLLEENRW+NESITAL+IG+C
Sbjct  1     MGGELSYVLSKMEMLTSDHASVVSMNIFVALLCACIVIGHLLEENRWLNESITALLIGIC  60

Query  1737  TGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGT  1558
             TGVVILLLS GKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNF+TI LFGA+GT
Sbjct  61    TGVVILLLSRGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFITITLFGAVGT  120

Query  1557  LISCSIISFGAVKIFKHLDI-DFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             LISCSII+FG  +IFK + +   LD GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   LISCSIITFGVTQIFKRMGVGKSLDMGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAI+SFD+   D +IGLHF GNFLYLF +ST LGV  GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIKSFDLNKIDHRIGLHFFGNFLYLFTTSTLLGVLAGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             K LY GRHSTDREVALMMLM+YLSYI+AEL+YLSGILTVFFCGIVMSHYTWHNVTESSR+
Sbjct  241   KTLYIGRHSTDREVALMMLMAYLSYILAELWYLSGILTVFFCGIVMSHYTWHNVTESSRI  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSFV ETFIFLYVGMDALDIEKW+FV +    SVAVSS+L+GL+L GRAAFV
Sbjct  301   TTKHAFATLSFVLETFIFLYVGMDALDIEKWRFVSDRPKTSVAVSSVLLGLVLAGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KK  S+KISFR+Q+IIWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMI
Sbjct  361   FPLSFLSNLTKKTQSEKISFREQVIIWWAGLMRGAVSMALAYNQFTLSGHTELRTNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTT--SEPSSPKHFTVPLLDNQ  487
             TST+TVVL ST+VFGLMTKPLI  LLP +   P   +SM+   S  +SPK  T+P L   
Sbjct  421   TSTITVVLVSTMVFGLMTKPLIRFLLPINPP-PKRKNSMSDIGSFNNSPKSITMPFLGGS  479

Query  486   PDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPV  307
              DSE++   G E  RP+++R LL TPTHTVH+ WR FD+SFMRPVFGGRGFVP V  S  
Sbjct  480   QDSENEF-DGSENQRPSSIRALLTTPTHTVHQLWRNFDNSFMRPVFGGRGFVPVVPTSTT  538

Query  306   EQS  298
              ++
Sbjct  539   ART  541



>ref|XP_002884487.1| hypothetical protein ARALYDRAFT_477785 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60746.1| hypothetical protein ARALYDRAFT_477785 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/528 (76%), Positives = 455/528 (86%), Gaps = 6/528 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVS+NLFVALLCACIV+GHLLEENRW+NESITAL+IGLCTGVVILL+S GK+
Sbjct  14    LSTSDHASVVSLNLFVALLCACIVIGHLLEENRWMNESITALLIGLCTGVVILLISRGKN  73

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIM FGAIGT++SC+IIS GA++
Sbjct  74    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMAFGAIGTIVSCTIISLGAIQ  133

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI   D GD+LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  134   FFKKLDIGTFDLGDFLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  193

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T  + +    F+GNF YLFL ST LGV  GL+ AY+IKKLYFGRHSTDREV
Sbjct  194   FNAIQSFDLTHLNHEAAFQFLGNFFYLFLLSTVLGVATGLISAYVIKKLYFGRHSTDREV  253

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AE
Sbjct  254   ALMMLMAYLSYMLAELFALSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATLSFLAE  313

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAFVFPLSFLSNLAKKN 
Sbjct  314   TFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILMGLVMLGRAAFVFPLSFLSNLAKKNQ  373

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KI+ +QQ++IWWAGLMRGAVS+ALAYNKFT SGHT L  NAIMITST+TV LFST+VF
Sbjct  374   SEKINIKQQVVIWWAGLMRGAVSMALAYNKFTRSGHTELRGNAIMITSTITVCLFSTMVF  433

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLD-NQPDSESDMITGPEVAR  442
             G++TKPLI  L+P  K   S       S+ ++PK   +PLLD  Q DS     +  +V R
Sbjct  434   GMLTKPLIRYLMPHQKATTS-----MLSDDNTPKSIHIPLLDGEQLDSFELPGSHQDVPR  488

Query  441   PTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             P +LR  L  PT TVH YWR+FDD+FMRPVFGGRGFVPFV GSP E+S
Sbjct  489   PNSLRGFLMRPTRTVHHYWRQFDDAFMRPVFGGRGFVPFVPGSPTERS  536



>ref|XP_011009463.1| PREDICTED: sodium/hydrogen exchanger 2-like [Populus euphratica]
Length=534

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/527 (77%), Positives = 453/527 (86%), Gaps = 6/527 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             + +SDH+SVV +NLFVALLCACIV+GHLLEE RW+NESITAL +GLCTG+VILL +GGKS
Sbjct  11    MLSSDHSSVVPINLFVALLCACIVIGHLLEEQRWMNESITALAVGLCTGIVILLTTGGKS  70

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+GTLIS +IIS GA  
Sbjct  71    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVGTLISTAIISIGATH  130

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK ++I  L  GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  131   FFKKMNISSLRIGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  190

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             F+AIQS D++  +  I   F+GNFLYLF+SST LGV  GLL AYIIKKLYFGRHSTDREV
Sbjct  191   FHAIQSIDLSHINSSIAAEFLGNFLYLFISSTILGVLTGLLSAYIIKKLYFGRHSTDREV  250

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALM+LM+YLSY++AELFYLS ILTVFFCGIVMSHYTWHNVTESSR+TT+H+FAT SFVAE
Sbjct  251   ALMILMAYLSYMLAELFYLSAILTVFFCGIVMSHYTWHNVTESSRITTKHAFATWSFVAE  310

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              FIFLYVGMDALDIEKWK V +S G SV VSSIL+GL+LVGRAAFVFPLSFLSNL KK  
Sbjct  311   IFIFLYVGMDALDIEKWKVVSDSPGTSVMVSSILLGLVLVGRAAFVFPLSFLSNLTKKFP  370

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
              +KI  +QQ+ IWWAGLMRGAVS+ALAYN+FT SGHT LH NAIMITST+TVVLFSTVVF
Sbjct  371   YEKIDIKQQVTIWWAGLMRGAVSMALAYNQFTRSGHTHLHGNAIMITSTITVVLFSTVVF  430

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             GLMTKPL+ +LLP  K      +SM +SEPSSPK F VPLL+ Q DSE D  T   V R 
Sbjct  431   GLMTKPLVRILLPSQKHT----ASMLSSEPSSPKSFAVPLLNRQ-DSE-DNQTSHNVPRR  484

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             T+LRMLL TP+HTVH YWRKFD+SFMRPVFGGRGFVPFV  SP + S
Sbjct  485   TSLRMLLSTPSHTVHHYWRKFDNSFMRPVFGGRGFVPFVPCSPTDHS  531



>ref|XP_008653443.1| PREDICTED: sodium/hydrogen exchanger 2-like [Zea mays]
 tpg|DAA64029.1| TPA: sodium/hydrogen exchanger [Zea mays]
Length=539

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/526 (77%), Positives = 452/526 (86%), Gaps = 10/526 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS+NLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILL + GKSSH
Sbjct  18    TSDHASVVSINLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILLTTKGKSSH  77

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             +LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GT+IS   IS GA+ IF
Sbjct  78    ILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTMISFFTISLGAIAIF  137

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
               ++I  LD GD+LAIGAIF+ATDSVCTLQVL QDETP LYSLVFGEGVVNDATSVVLFN
Sbjct  138   SRMNIGTLDVGDFLAIGAIFSATDSVCTLQVLHQDETPFLYSLVFGEGVVNDATSVVLFN  197

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+Q+FD+   D  + L+F+GNF YLF+SST LGV  GLL AYIIKKLY GRHSTDREVAL
Sbjct  198   ALQNFDLNHIDVAVVLNFLGNFCYLFVSSTLLGVFTGLLSAYIIKKLYIGRHSTDREVAL  257

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF
Sbjct  258   MMLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETF  317

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDIEKW+F  +S G S+ +SSIL+GL+LVGRAAFVFPLSFLSNL KK+  +
Sbjct  318   LFLYVGMDALDIEKWEFASDSPGKSIGISSILLGLVLVGRAAFVFPLSFLSNLTKKSPLE  377

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI+FRQQI+IWWAGLMRGAVSIALAYNKFT SGHT LH NAIMITST+TVVLFST+VFG+
Sbjct  378   KITFRQQIVIWWAGLMRGAVSIALAYNKFTRSGHTELHGNAIMITSTITVVLFSTMVFGM  437

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITG-PEVARPT  436
             MTKPLI LLLP         S+  TSEPSSPK    PLL +     SD+ TG  ++ RP+
Sbjct  438   MTKPLIRLLLP-------ACSNTATSEPSSPKSLHSPLLTSMQG--SDIETGSAQIVRPS  488

Query  435   ALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             +LRMLL  PTHTVH YWRKFDD+ MRP+FGGRGFVPF  GSP EQS
Sbjct  489   SLRMLLSKPTHTVHYYWRKFDDALMRPMFGGRGFVPFSPGSPTEQS  534



>ref|XP_006855405.1| hypothetical protein AMTR_s00057p00151470 [Amborella trichopoda]
 gb|ERN16872.1| hypothetical protein AMTR_s00057p00151470 [Amborella trichopoda]
Length=537

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/536 (74%), Positives = 454/536 (85%), Gaps = 6/536 (1%)
 Frame = -3

Query  1905  LSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVV  1726
             L S L    + TSDHAS+VS+NLFVALLC CIV+GHLLEENRW+NESITALIIGLC+GV+
Sbjct  4     LQSFLMKMGVNTSDHASIVSINLFVALLCMCIVIGHLLEENRWMNESITALIIGLCSGVI  63

Query  1725  IlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISC  1546
             ILL +GGKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GTLIS 
Sbjct  64    ILLTTGGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTLISF  123

Query  1545  SIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGV  1366
              IIS G + +FK  D+  LD GDYLAIGAIF+ATDSVCTLQVLSQD+TPLLYSLVFGEGV
Sbjct  124   VIISLGVILLFKKFDMALLDLGDYLAIGAIFSATDSVCTLQVLSQDDTPLLYSLVFGEGV  183

Query  1365  VNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYF  1186
             VNDATSVVLFNAIQ+FD+   D +     IGNF+YLF +ST LG   GLL AYIIKKLYF
Sbjct  184   VNDATSVVLFNAIQNFDLNHIDLRTAFQLIGNFVYLFFTSTLLGAVAGLLSAYIIKKLYF  243

Query  1185  GRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHS  1006
             GRHSTDREVALM+LM+YLSY +AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+
Sbjct  244   GRHSTDREVALMILMAYLSYALAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHA  303

Query  1005  FATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSF  826
             FATLSF+AETFIFLYVGMDALDI+KW+ VK+S G S+ +SS+LVGL+L+GRAAFVFPLSF
Sbjct  304   FATLSFIAETFIFLYVGMDALDIDKWRVVKSSAGKSIGLSSMLVGLVLLGRAAFVFPLSF  363

Query  825   LSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvt  646
             +SNL +K   +KI+FRQQ+IIWWAGLMRGAVS+ALAYN+FT  G+T L  NA+MIT T+T
Sbjct  364   ISNLTRKTPEEKITFRQQVIIWWAGLMRGAVSMALAYNQFTRVGYTQLPGNAVMITCTIT  423

Query  645   vvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDM  466
             VVLFSTV+FG+MT+PLI L+LP H +   G     +SEPSSPK F VP L+N      D 
Sbjct  424   VVLFSTVLFGMMTQPLIRLILPHHSKPAHG----VSSEPSSPKSFLVPFLENGSGEGPD-  478

Query  465   ITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              +   VARP++LRMLLR PTHTVH YWRKFD++FMRP+FGGRGF PF+ GSP E S
Sbjct  479   -SARSVARPSSLRMLLRAPTHTVHYYWRKFDNAFMRPMFGGRGFTPFIPGSPTESS  533



>ref|XP_002315532.2| Na+/H+ antiporter family protein [Populus trichocarpa]
 gb|EEF01703.2| Na+/H+ antiporter family protein [Populus trichocarpa]
Length=529

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/527 (77%), Positives = 453/527 (86%), Gaps = 6/527 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             + +SDH+SVV +NLFVALLCACIV+GHLLEE RW+NESITAL +GLCTGVVILL +GGKS
Sbjct  4     MLSSDHSSVVPINLFVALLCACIVIGHLLEEQRWMNESITALAVGLCTGVVILLTTGGKS  63

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI+LFGA+GTLIS +IIS GA  
Sbjct  64    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIILFGAVGTLISTAIISIGATH  123

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK ++I  L  GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  124   FFKKMNISSLRIGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  183

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             F+AIQS D++  +  I   F+GNFLYLF+SST LGV  GLL AYIIKKLYFGRHSTDREV
Sbjct  184   FHAIQSIDLSHINSSIAAEFLGNFLYLFISSTILGVLTGLLSAYIIKKLYFGRHSTDREV  243

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALM+LM+YLSY++AELFYLS ILTVFFCGIVMSHYTWHNVTESSR+TT+H+FAT SFVAE
Sbjct  244   ALMILMAYLSYMLAELFYLSAILTVFFCGIVMSHYTWHNVTESSRITTKHAFATWSFVAE  303

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              FIFLYVGMDALDIEKWK V +S G SV VSSIL+GL+LVGRAAFVFPLSFLSNL KK  
Sbjct  304   IFIFLYVGMDALDIEKWKVVSDSPGTSVMVSSILLGLVLVGRAAFVFPLSFLSNLTKKFP  363

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
              +KI  +QQ+ IWWAGLMRGAVS+ALAYN+FT SGHT LH NAIMITST+TVVLFSTVVF
Sbjct  364   YEKIDIKQQVTIWWAGLMRGAVSMALAYNQFTRSGHTHLHGNAIMITSTITVVLFSTVVF  423

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             GLMTKPL+ +LLP  K      +SM +SEPSSPK F VPLL+ Q DSE D      V R 
Sbjct  424   GLMTKPLVRILLPSQKHT----ASMLSSEPSSPKSFAVPLLNRQ-DSE-DNQASHNVPRR  477

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             T+LRMLL TP+HTVH YWRKFD+SFMRPVFGGRGFVPFV  SP +QS
Sbjct  478   TSLRMLLSTPSHTVHHYWRKFDNSFMRPVFGGRGFVPFVPCSPTDQS  524



>gb|ABY59540.1| Na+/H+ antiporter [Galega orientalis]
Length=541

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/546 (77%), Positives = 470/546 (86%), Gaps = 10/546 (2%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MAF ++S++    +L TSDHASVVSMNLFVALLCACIV+GHLLEENRW+NESIT L+IG+
Sbjct  1     MAFEMTSVVSKLQNLSTSDHASVVSMNLFVALLCACIVIGHLLEENRWMNESITTLLIGV  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTGVVILL SGGKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFM IM FGAIG
Sbjct  61    CTGVVILLFSGGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFKNFMIIMSFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLISC II+FGA + FK +DI  L+ GDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV
Sbjct  121   TLISCCIITFGATQAFKRMDIGPLEIGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD+   +P I + F+GNF YLF++ST LGV  GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLNRLNPSIAMQFLGNFFYLFIASTLLGVLTGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLY GRHSTDREVALMMLM+YLSY++AEL YLSGILTVFFCGIVMSHYTWHNVT+SSRV
Sbjct  241   KKLYIGRHSTDREVALMMLMAYLSYMLAELAYLSGILTVFFCGIVMSHYTWHNVTQSSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+HSFATLSFV E FIFLYVGMDA+DI+KWKFV +S+G S+A S+IL+GLIL+GRAAFV
Sbjct  301   TTKHSFATLSFVCEIFIFLYVGMDAMDIDKWKFVSDSRGTSIATSAILLGLILLGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KK+   KISFRQQ+IIWWAGLMRGAVS+ALAY +FT SGHT L  NAIMI
Sbjct  361   FPLSFLSNLTKKSQHQKISFRQQVIIWWAGLMRGAVSMALAYKQFTRSGHTQLRSNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFSTV+FGL+TKPLI LLLP     P   SSMTT+EPS+PK   VPLL +  D
Sbjct  421   TSTITVVLFSTVLFGLLTKPLIRLLLP----HPKHTSSMTTTEPSTPKSVIVPLLGDHRD  476

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE-  304
             SE+D+  G E+ RP +LR LL TPTHTVHR WRKFDDSFMRPVFGGRGFVP   GSP E 
Sbjct  477   SEADL-EGHEIHRPNSLRALLSTPTHTVHRLWRKFDDSFMRPVFGGRGFVPVEPGSPSER  535

Query  303   ---QSP  295
                QSP
Sbjct  536   NGHQSP  541



>gb|AEN03787.1| Na/H antiporter [Diplachne fusca]
Length=540

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/525 (77%), Positives = 451/525 (86%), Gaps = 7/525 (1%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS+NLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILL + GKSSH
Sbjct  18    TSDHASVVSINLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILLTTKGKSSH  77

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             +LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GT+IS   IS GA+ IF
Sbjct  78    ILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTMISFFTISIGAIAIF  137

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
               ++I  LD GD+LAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  138   SRMNIGTLDVGDFLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  197

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+Q+FD+   D  + L F+GNF YLFLSSTFLGV  GLL AYIIKKLY GRHSTDREVAL
Sbjct  198   ALQNFDLNKIDVAVVLKFLGNFCYLFLSSTFLGVFPGLLSAYIIKKLYIGRHSTDREVAL  257

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF
Sbjct  258   MMLMAYLSYMLAELSDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETF  317

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDIEKWKF  +S G S+ +SSIL+GL+LVGRAAFVFPLSFLSNL KK   +
Sbjct  318   LFLYVGMDALDIEKWKFASDSPGKSIGISSILLGLVLVGRAAFVFPLSFLSNLTKKAPFE  377

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI++RQQ++IWWAGLMRGAVSIALAYNKFT SGHT LH NAIMITST+TVVLFST+VFG+
Sbjct  378   KITWRQQVVIWWAGLMRGAVSIALAYNKFTRSGHTQLHGNAIMITSTITVVLFSTMVFGM  437

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             MTKPLI  LLP      S HS   TSEP+SPK    PLL +   S+ +  +   + RP++
Sbjct  438   MTKPLIRFLLP-----ASSHS--VTSEPNSPKSLHSPLLTSMQGSDLETASHSHIVRPSS  490

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             LRMLL  PTHTVH YWRKFD++ MRP+FGGRGFVPF  GSP EQS
Sbjct  491   LRMLLSKPTHTVHYYWRKFDNALMRPMFGGRGFVPFSPGSPTEQS  535



>ref|XP_010485901.1| PREDICTED: sodium/hydrogen exchanger 2 [Camelina sativa]
Length=543

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/526 (76%), Positives = 454/526 (86%), Gaps = 6/526 (1%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS+NLFVALLCACIV+GHLLEENRW+NESITAL+IGLCTGVVILL+S GK+SH
Sbjct  16    TSDHASVVSLNLFVALLCACIVIGHLLEENRWMNESITALLIGLCTGVVILLISRGKNSH  75

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIM FGAIGT++SC+IIS GA++ F
Sbjct  76    LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMAFGAIGTVVSCTIISLGAIQFF  135

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             K LDI   D GD+LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  136   KKLDIGTFDLGDFLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  195

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQSFD+T  + +    F+GNF YLF+ STFLGV  GL+ AY+IKKLYFGRHSTDREVAL
Sbjct  196   AIQSFDLTHLNHEAAFKFLGNFFYLFILSTFLGVATGLISAYVIKKLYFGRHSTDREVAL  255

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AETF
Sbjct  256   MMLMAYLSYMLAELFTLSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATLSFLAETF  315

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAFVFPLSFLSNL+KKN S+
Sbjct  316   IFLYVGMDALDIEKWRFVSDSPGTSVAVSSILMGLVMLGRAAFVFPLSFLSNLSKKNQSE  375

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI  +QQ++IWWAGLMRGAVS+ALAYNKFT SGHT L  NAIMITST+TV LFST+VFG+
Sbjct  376   KIDIKQQVVIWWAGLMRGAVSMALAYNKFTRSGHTELRGNAIMITSTITVCLFSTMVFGM  435

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLD-NQPDSESDMITGPEVARPT  436
             +TKPLI  L+P  K   S       S+ ++PK   +PLLD  Q DS     +  +V RP 
Sbjct  436   LTKPLIRYLMPHQKATTS-----MLSDDNTPKSIQIPLLDGEQQDSFELPGSHHDVPRPD  490

Query  435   ALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             +LR  L  PT TVH YWR+FDD+FMRPVFGGRGFVPFV GSP E+S
Sbjct  491   SLRGFLMRPTRTVHHYWRQFDDAFMRPVFGGRGFVPFVPGSPTERS  536



>ref|XP_008450735.1| PREDICTED: LOW QUALITY PROTEIN: sodium/hydrogen exchanger 2 [Cucumis 
melo]
Length=537

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/526 (76%), Positives = 461/526 (88%), Gaps = 6/526 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVS+NLFVALLCACIV+GHLLEE RW+NESITAL IGL TGV+ILL+SGGKS
Sbjct  15    LSTSDHASVVSINLFVALLCACIVIGHLLEETRWMNESITALFIGLFTGVIILLVSGGKS  74

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLL+FSED FFIYLLPPIIFNAGFQVKKKQFFVNFMTIM+FGAIGTL+SC IIS GA +
Sbjct  75    SHLLLFSEDTFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMMFGAIGTLVSCLIISLGAFQ  134

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK +D+  LD  D LAIGAIFAATDSVCTLQ+L+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  135   FFKKMDVGSLDIADILAIGAIFAATDSVCTLQILNQDETPLLYSLVFGEGVVNDATSVVL  194

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQS D++  D  + L+FIG+F YLF +ST LGV +GLL AY+IKKLYFGRHSTDREV
Sbjct  195   FNAIQSLDLSKVDATVALNFIGSFFYLFSTSTLLGVFVGLLSAYVIKKLYFGRHSTDREV  254

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALM+LM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF++E
Sbjct  255   ALMILMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFISE  314

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIF+YVGMDALDIEKW FV +S G SVAVS+IL+GL++VGRAAFVFPLSF+SNLAKK+S
Sbjct  315   TFIFVYVGMDALDIEKWSFVSDSPGTSVAVSAILLGLVMVGRAAFVFPLSFISNLAKKSS  374

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
              +KI+FR+Q+IIWWAGLMRGAVSIALAY++FT +GHT L  NA+MITST+TVVLFST+VF
Sbjct  375   GEKITFREQVIIWWAGLMRGAVSIALAYHQFTRAGHTQLRGNAMMITSTITVVLFSTMVF  434

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             GL+TKPLIN L+P  K     H++   S+P +PK F+VPLL +  DSE D+   P V RP
Sbjct  435   GLLTKPLINCLIPQPK-----HTTSMLSDPGTPKSFSVPLLGSAQDSELDL-DSPHVPRP  488

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             +++R LL TPTHTVHRYWRKFDD+FMRP+F G GFVPFV GSP E+
Sbjct  489   SSIRALLATPTHTVHRYWRKFDDAFMRPMFXGSGFVPFVPGSPTER  534



>gb|AAK53432.1| Na+/H+ antiporter [Suaeda salsa]
Length=556

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/532 (76%), Positives = 459/532 (86%), Gaps = 10/532 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVSMNLFVALL  CIV+GHLLEENRW+NESITAL+IGL TG++ILL+SGGKSSH
Sbjct  18    TSDHASVVSMNLFVALLRGCIVIGHLLEENRWMNESITALLIGLSTGIIILLISGGKSSH  77

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI+LFGA+GTL+S  IIS G++ IF
Sbjct  78    LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIILFGAVGTLVSFIIISLGSIAIF  137

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             + +DI  L+ GD LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  138   QKMDIGSLELGDLLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  197

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQ+FD+T  D +I   F GNFLYLF +ST LG   GLL AY+IKKLYFGRHSTDREVAL
Sbjct  198   AIQNFDLTHIDHRIAFQFGGNFLYLFFASTLLGAVTGLLSAYVIKKLYFGRHSTDREVAL  257

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE F
Sbjct  258   MMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAEIF  317

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL +VGRAAFVFP +FL NL+KK++S+
Sbjct  318   IFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLHMVGRAAFVFPFAFLMNLSKKSNSE  377

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             K++F QQI+IWWAGLM+ AVS+ALAYN+F+ SGHT L  NAIMITST+TVVLFST+VFGL
Sbjct  378   KVTFNQQIVIWWAGLMKSAVSVALAYNQFSRSGHTQLRGNAIMITSTITVVLFSTMVFGL  437

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPE------  451
             +TKPLI  +LP  K   S     T S+  SPK F++PLL+++ DSE+D+    E      
Sbjct  438   LTKPLILFMLPQPKHFTSAS---TVSDLGSPKSFSLPLLEDRQDSEADLGNDDEEAYPRG  494

Query  450   -VARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              +ARPT+LRMLL  PTHTVH YWR+FDD FMRPVFGGRGFVPFV GSP EQS
Sbjct  495   TIARPTSLRMLLNAPTHTVHHYWRRFDDYFMRPVFGGRGFVPFVPGSPTEQS  546



>ref|NP_187154.1| K+/H+ exchanger [Arabidopsis thaliana]
 sp|Q56XP4.2|NHX2_ARATH RecName: Full=Sodium/hydrogen exchanger 2; AltName: Full=Na(+)/H(+) 
exchanger 2; Short=NHE-2 [Arabidopsis thaliana]
 gb|AAG51408.1|AC009465_8 putative sodium proton exchanger; 8161-11489 [Arabidopsis thaliana]
 gb|AAM08403.1|AF490586_1 Na+/H+ exchanger 2 [Arabidopsis thaliana]
 gb|AEE74177.1| K+/H+ exchanger [Arabidopsis thaliana]
Length=546

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/526 (76%), Positives = 458/526 (87%), Gaps = 3/526 (1%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS+NLFVALLCACIV+GHLLEENRW+NESITAL+IGL TGVVILL+S GK+SH
Sbjct  16    TSDHASVVSLNLFVALLCACIVIGHLLEENRWMNESITALLIGLGTGVVILLISRGKNSH  75

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIM FGAIGT++SC+IIS GA++ F
Sbjct  76    LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMAFGAIGTVVSCTIISLGAIQFF  135

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             K LDI   D GD+LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  136   KKLDIGTFDLGDFLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  195

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQSFD+T  + +    F+GNF YLFL ST LGV  GL+ AY+IKKLYFGRHSTDREVAL
Sbjct  196   AIQSFDLTHLNHEAAFQFLGNFFYLFLLSTGLGVATGLISAYVIKKLYFGRHSTDREVAL  255

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AETF
Sbjct  256   MMLMAYLSYMLAELFALSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATLSFLAETF  315

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAFVFPLSFLSNLAKK+ S+
Sbjct  316   IFLYVGMDALDIEKWRFVSDSPGTSVAVSSILMGLVMLGRAAFVFPLSFLSNLAKKHQSE  375

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KIS +QQ++IWWAGLMRGAVS+ALAYNKFT SGHT L  NAIMITST+TV LFST+VFG+
Sbjct  376   KISIKQQVVIWWAGLMRGAVSMALAYNKFTRSGHTELRGNAIMITSTITVCLFSTMVFGM  435

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLD-NQPDSESDMITGPEVARPT  436
             +TKPLI  L+ PH++  +  +SM  S+ S+PK   +PLLD  Q DS     +  +V RP 
Sbjct  436   LTKPLIRYLM-PHQKATTSTTSM-LSDDSTPKSIHIPLLDGEQLDSFELPGSHQDVPRPN  493

Query  435   ALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             +LR  L  PT TVH YWR+FDD+FMRPVFGGRGFVPFV GSP E+S
Sbjct  494   SLRGFLMRPTRTVHYYWRQFDDAFMRPVFGGRGFVPFVPGSPTERS  539



>ref|XP_003562486.1| PREDICTED: sodium/hydrogen exchanger 2 [Brachypodium distachyon]
Length=543

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/525 (77%), Positives = 449/525 (86%), Gaps = 9/525 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS+NLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILL + GKSSH
Sbjct  23    TSDHASVVSINLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILLTTKGKSSH  82

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             +LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GT+IS   IS  A+ IF
Sbjct  83    VLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTMISFFTISLAAIAIF  142

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
               ++I  LD GD+LAIGAIF+ATDSVCTLQVL+QDETP LYSLVFGEGVVNDATSVVLFN
Sbjct  143   SKMNIGTLDVGDFLAIGAIFSATDSVCTLQVLNQDETPFLYSLVFGEGVVNDATSVVLFN  202

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+Q+FD+   D  + L F+GNFLYLF+SSTFLGV  GLL AY+IKKLY GRHSTDREVAL
Sbjct  203   ALQNFDLNQIDAMVVLKFLGNFLYLFVSSTFLGVFAGLLSAYVIKKLYIGRHSTDREVAL  262

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF
Sbjct  263   MMLMAYLSYMLAELLELSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETF  322

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDIEKWKF  +S G S+ VSSIL+GL+L+GRAAFVFPLSFLSNL KK   +
Sbjct  323   LFLYVGMDALDIEKWKFASDSPGKSIGVSSILLGLVLLGRAAFVFPLSFLSNLTKKTHLE  382

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KIS+RQQI+IWWAGLMRGAVSIALAYNKFT SGHT LH NAIMITST+TVVLFST++FG+
Sbjct  383   KISWRQQIVIWWAGLMRGAVSIALAYNKFTRSGHTQLHGNAIMITSTITVVLFSTMLFGM  442

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             MTKPLI  LLP         S+   SEPSSPK    PLL +   S+ +  T P V RP++
Sbjct  443   MTKPLIRFLLP-------ASSNSAVSEPSSPKSLHSPLLTSMQGSDLEA-TVPMV-RPSS  493

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             LRMLL  PTHTVH YWRKFDD+ MRP+FGGRGFVP+  GSP EQS
Sbjct  494   LRMLLTKPTHTVHFYWRKFDDALMRPMFGGRGFVPYAPGSPTEQS  538



>gb|AAV80466.1| Na+/H+ antiporter [Aeluropus littoralis]
Length=540

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/525 (77%), Positives = 449/525 (86%), Gaps = 7/525 (1%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TS HASVVS+NLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILL + GKSSH
Sbjct  18    TSGHASVVSINLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILLTTKGKSSH  77

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             +LVFSEDLFFIYLLPPIIFNAGFQVKKK+FF NFMTI LFGA+GT+IS   IS GA+ IF
Sbjct  78    ILVFSEDLFFIYLLPPIIFNAGFQVKKKRFFRNFMTITLFGAVGTMISFFTISIGAIAIF  137

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
               ++I  L+ GD+LAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  138   SRMNIGTLEVGDFLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  197

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+Q FD+   D  + L F+GNF YLFLSSTFLGV  GLL AYIIKKLY GRHSTDREVAL
Sbjct  198   ALQHFDLNKIDVAVVLKFLGNFCYLFLSSTFLGVFAGLLSAYIIKKLYIGRHSTDREVAL  257

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF
Sbjct  258   MMLMAYLSYMLAELSDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETF  317

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDIEKWKF  +S G S+ +SSIL+GL+LVGRAAFVFPLSFLSNL KK   +
Sbjct  318   LFLYVGMDALDIEKWKFASDSPGKSIGISSILLGLVLVGRAAFVFPLSFLSNLTKKADFE  377

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI++RQQI+IWWAGLMRGAVSIALAYNKFT SGHT LH NAIMITST+TVVLFST+VFG+
Sbjct  378   KITWRQQIVIWWAGLMRGAVSIALAYNKFTRSGHTQLHGNAIMITSTITVVLFSTMVFGM  437

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             MTKPLI  LLP      S H+   TSEPSSPK    PLL +   S+ +  +   + RP++
Sbjct  438   MTKPLIQFLLP-----ASSHT--VTSEPSSPKSLHSPLLASMQGSDLETASHSHIVRPSS  490

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             LRMLL  PTHTVH YWRKFDD+ MRP+FGGRGFVPF  GSP EQS
Sbjct  491   LRMLLSKPTHTVHYYWRKFDDALMRPMFGGRGFVPFSPGSPTEQS  535



>ref|XP_010422043.1| PREDICTED: sodium/hydrogen exchanger 2-like [Camelina sativa]
 ref|XP_010422107.1| PREDICTED: sodium/hydrogen exchanger 2-like [Camelina sativa]
 ref|XP_010422180.1| PREDICTED: sodium/hydrogen exchanger 2-like [Camelina sativa]
Length=548

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/526 (76%), Positives = 453/526 (86%), Gaps = 6/526 (1%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS+NLFVALLCACIV+GHLLEENRW+NESITAL+IGLCTGVVILL+S GK+SH
Sbjct  21    TSDHASVVSLNLFVALLCACIVIGHLLEENRWMNESITALLIGLCTGVVILLISRGKNSH  80

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIM FGAIGT++SC+IIS GA++ F
Sbjct  81    LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMAFGAIGTVVSCTIISLGAIQFF  140

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             K LDI   D GD+LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  141   KKLDIGTFDLGDFLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  200

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQSFD+T  + +    F+GNF YLF+ ST LGV  GL+ AY+IKKLYFGRHSTDREVAL
Sbjct  201   AIQSFDLTHLNHEAAFKFLGNFFYLFILSTLLGVATGLISAYVIKKLYFGRHSTDREVAL  260

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AETF
Sbjct  261   MMLMAYLSYMLAELFTLSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATLSFLAETF  320

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAFVFPLSFLSNL+KKN S+
Sbjct  321   IFLYVGMDALDIEKWRFVSDSPGTSVAVSSILMGLVMLGRAAFVFPLSFLSNLSKKNQSE  380

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI  +QQ++IWWAGLMRGAVS+ALAYNKFT SGHT L  NAIMITST+TV LFST+VFG+
Sbjct  381   KIDIKQQVVIWWAGLMRGAVSMALAYNKFTRSGHTELRGNAIMITSTITVCLFSTMVFGM  440

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLD-NQPDSESDMITGPEVARPT  436
             +TKPLI  L+P  K   S       S+ ++PK   +PLLD  Q DS     +  +V RP 
Sbjct  441   LTKPLIRYLMPHQKATTS-----MLSDDNTPKSIQIPLLDGEQQDSFELPGSHHDVPRPD  495

Query  435   ALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             +LR  L  PT TVH YWR+FDD+FMRPVFGGRGFVPFV GSP E+S
Sbjct  496   SLRGFLMRPTRTVHHYWRQFDDAFMRPVFGGRGFVPFVPGSPTERS  541



>dbj|BAA83337.1| OsNHX1 [Oryza sativa Japonica Group]
 dbj|BAC20076.1| putative sodium/proton antiporter [Oryza sativa Japonica Group]
 dbj|BAG88958.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AIQ86570.1| vacuolar sodium hydrogen antiporter [Oryza sativa Indica Group]
Length=535

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/525 (76%), Positives = 450/525 (86%), Gaps = 9/525 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSD+ASVVS+NLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILL++ GKSSH
Sbjct  16    TSDYASVVSINLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILLMTKGKSSH  75

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             L VFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GT+IS   IS  A+ IF
Sbjct  76    LFVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTMISFFTISIAAIAIF  135

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
               ++I  LD GD+LAIGAIF+ATDSVCTLQVL+QDETP LYSLVFGEGVVNDATS+VLFN
Sbjct  136   SRMNIGTLDVGDFLAIGAIFSATDSVCTLQVLNQDETPFLYSLVFGEGVVNDATSIVLFN  195

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+Q+FD+   D  + L F+GNF YLFLSSTFLGV  GLL AYIIKKLY GRHSTDREVAL
Sbjct  196   ALQNFDLVHIDAAVVLKFLGNFFYLFLSSTFLGVFAGLLSAYIIKKLYIGRHSTDREVAL  255

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF
Sbjct  256   MMLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETF  315

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDIEKW+F  +  G S+ +SSIL+GL+L+GRAAFVFPLSFLSNL KK  ++
Sbjct  316   LFLYVGMDALDIEKWEFASDRPGKSIGISSILLGLVLIGRAAFVFPLSFLSNLTKKAPNE  375

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI++RQQ++IWWAGLMRGAVSIALAYNKFT SGHT LH NAIMITST+TVVLFST+VFG+
Sbjct  376   KITWRQQVVIWWAGLMRGAVSIALAYNKFTRSGHTQLHGNAIMITSTITVVLFSTMVFGM  435

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             MTKPLI LLLP      SGH    TSEPSSPK    PLL +     SD+ +   + RP++
Sbjct  436   MTKPLIRLLLP-----ASGHP--VTSEPSSPKSLHSPLLTSMQG--SDLESTTNIVRPSS  486

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             LRMLL  PTHTVH YWRKFDD+ MRP+FGGRGFVPF  GSP EQS
Sbjct  487   LRMLLTKPTHTVHYYWRKFDDALMRPMFGGRGFVPFSPGSPTEQS  531



>ref|NP_001060571.2| Os07g0666900 [Oryza sativa Japonica Group]
 dbj|BAF22485.2| Os07g0666900, partial [Oryza sativa Japonica Group]
Length=536

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/525 (76%), Positives = 450/525 (86%), Gaps = 9/525 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSD+ASVVS+NLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILL++ GKSSH
Sbjct  17    TSDYASVVSINLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILLMTKGKSSH  76

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             L VFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GT+IS   IS  A+ IF
Sbjct  77    LFVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTMISFFTISIAAIAIF  136

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
               ++I  LD GD+LAIGAIF+ATDSVCTLQVL+QDETP LYSLVFGEGVVNDATS+VLFN
Sbjct  137   SRMNIGTLDVGDFLAIGAIFSATDSVCTLQVLNQDETPFLYSLVFGEGVVNDATSIVLFN  196

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+Q+FD+   D  + L F+GNF YLFLSSTFLGV  GLL AYIIKKLY GRHSTDREVAL
Sbjct  197   ALQNFDLVHIDAAVVLKFLGNFFYLFLSSTFLGVFAGLLSAYIIKKLYIGRHSTDREVAL  256

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF
Sbjct  257   MMLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETF  316

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDIEKW+F  +  G S+ +SSIL+GL+L+GRAAFVFPLSFLSNL KK  ++
Sbjct  317   LFLYVGMDALDIEKWEFASDRPGKSIGISSILLGLVLIGRAAFVFPLSFLSNLTKKAPNE  376

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI++RQQ++IWWAGLMRGAVSIALAYNKFT SGHT LH NAIMITST+TVVLFST+VFG+
Sbjct  377   KITWRQQVVIWWAGLMRGAVSIALAYNKFTRSGHTQLHGNAIMITSTITVVLFSTMVFGM  436

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             MTKPLI LLLP      SGH    TSEPSSPK    PLL +     SD+ +   + RP++
Sbjct  437   MTKPLIRLLLP-----ASGHP--VTSEPSSPKSLHSPLLTSMQG--SDLESTTNIVRPSS  487

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             LRMLL  PTHTVH YWRKFDD+ MRP+FGGRGFVPF  GSP EQS
Sbjct  488   LRMLLTKPTHTVHYYWRKFDDALMRPMFGGRGFVPFSPGSPTEQS  532



>gb|ABU92562.1| vacuolar Na+/H+ antiporter [Zygophyllum xanthoxylum]
Length=532

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/527 (76%), Positives = 461/527 (87%), Gaps = 8/527 (2%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDH+SVVSMNLFVALLC CIV+GHLLEE RW+NESITAL+IG+CTGVVILL+SGGKS
Sbjct  9     LATSDHSSVVSMNLFVALLCGCIVIGHLLEETRWMNESITALVIGVCTGVVILLISGGKS  68

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI+LFGA+GTLISC+IIS G ++
Sbjct  69    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIVLFGAVGTLISCTIISLGVIQ  128

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK +D+   D GDYLAIGAIFAATDSVCTLQVL QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  129   FFKGIDVGPFDIGDYLAIGAIFAATDSVCTLQVLHQDETPLLYSLVFGEGVVNDATSVVL  188

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T+ + +   HF+G FLYLFL+ST LG   GLL AYIIKKLYFGRHSTDREV
Sbjct  189   FNAIQSFDLTNINTQSAFHFLGQFLYLFLTSTLLGAFTGLLSAYIIKKLYFGRHSTDREV  248

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSFVAE
Sbjct  249   ALMMLMAYLSYMLAELTNLSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATLSFVAE  308

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              F+FLYVGMDALDIEKW+FV +S   SVAVSS+L+ L++ GRAAFVFPLSFLSNLAKK+ 
Sbjct  309   IFLFLYVGMDALDIEKWRFVSDSPKTSVAVSSVLMALVMAGRAAFVFPLSFLSNLAKKSP  368

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             +DKI+FR+QI+IWWAGLMRGAVS+ALAYNKFTTSGHT++  NAIMITST++VVLFSTVVF
Sbjct  369   NDKITFREQIVIWWAGLMRGAVSMALAYNKFTTSGHTNVRGNAIMITSTISVVLFSTVVF  428

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             GL+TKPLI+ LLP  K     H++   S+  +PK   +PLL+   DSE+D+  G EV RP
Sbjct  429   GLLTKPLISCLLPHPK-----HTTSMLSDNGTPKSMNMPLLEQ--DSEADL-GGREVPRP  480

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              ++R LL TPTHTVH YWRKFD++FMRPVFGGRGFVPFV  SP E++
Sbjct  481   RSIRDLLSTPTHTVHYYWRKFDNAFMRPVFGGRGFVPFVPASPTERN  527



>ref|XP_006408118.1| hypothetical protein EUTSA_v10020432mg [Eutrema salsugineum]
 dbj|BAJ34595.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ49571.1| hypothetical protein EUTSA_v10020432mg [Eutrema salsugineum]
Length=554

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/528 (76%), Positives = 453/528 (86%), Gaps = 8/528 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS+NLFVALLCACIV+GHLLEENRW+NESITAL+IGLCTGVVILL++ GK+SH
Sbjct  20    TSDHASVVSLNLFVALLCACIVIGHLLEENRWMNESITALLIGLCTGVVILLITRGKNSH  79

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGAIGTLISC+IIS G ++  
Sbjct  80    LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGAIGTLISCTIISLGVIQFV  139

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             K LDI   D GD+LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  140   KKLDIGTFDLGDFLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  199

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQSFD+T  + +    F+GNFLYLF  ST LGV  GL+ AY+IKKLYFGRHSTDREVAL
Sbjct  200   AIQSFDLTHLNHEAAFLFLGNFLYLFFLSTLLGVATGLISAYVIKKLYFGRHSTDREVAL  259

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AETF
Sbjct  260   MMLMAYLSYMLAELFALSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATLSFLAETF  319

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAFVFPLSFLSNL+KKN S+
Sbjct  320   IFLYVGMDALDIEKWRFVSDSPGTSVAVSSILMGLVMLGRAAFVFPLSFLSNLSKKNQSE  379

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI  +QQ++IWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST+TV LFSTVVFG+
Sbjct  380   KIDIKQQVVIWWAGLMRGAVSMALAYNQFTRSGHTELRGNAIMITSTITVCLFSTVVFGM  439

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMI---TGPEVAR  442
             +TKPLI  LLP  K   S       S+ ++PK   +PLLD +   +S +    T  +V R
Sbjct  440   LTKPLIRYLLPHQKATTS-----MLSDDNTPKSIHIPLLDGEQHDDSFVEFSGTHQDVPR  494

Query  441   PTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             P +LR  L  PT TVH YWR+FDD+FMRPVFGGRGFVPFV GSP E+S
Sbjct  495   PDSLRGFLLRPTRTVHHYWRQFDDAFMRPVFGGRGFVPFVPGSPTERS  542



>ref|XP_010105014.1| Sodium/hydrogen exchanger 2 [Morus notabilis]
 gb|EXC03123.1| Sodium/hydrogen exchanger 2 [Morus notabilis]
Length=533

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/526 (76%), Positives = 450/526 (86%), Gaps = 7/526 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L T DHASVVSMNLFVALLCACI++GHLLEENRW+NESITAL IGLCTGVVILL SGGKS
Sbjct  14    LTTHDHASVVSMNLFVALLCACIIIGHLLEENRWMNESITALAIGLCTGVVILLTSGGKS  73

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             S LLVFSE+LFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA+GTLIS  IIS GA+ 
Sbjct  74    SRLLVFSEELFFIYLLPPIIFNAGFQVKKKQFFRNFITIMLFGAVGTLISFGIISLGAIH  133

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              F+ +++  L  GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  134   FFQKMNVGTLKLGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  193

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQ+FD++  +  + L  IGNFLYLF++ST LGV  GLL AYIIKKLYFGRHSTDREV
Sbjct  194   FNAIQNFDLSHINSGVALELIGNFLYLFVASTLLGVVAGLLSAYIIKKLYFGRHSTDREV  253

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALM+LM+YLSY++AELFYLS ILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  254   ALMILMAYLSYMLAELFYLSAILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAE  313

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              FIFLYVGMDALDIEKWK V  S G S+ VSSI++GL+LVGRAAFVFPLSFLSNL K + 
Sbjct  314   IFIFLYVGMDALDIEKWKIVSGSPGTSIGVSSIILGLVLVGRAAFVFPLSFLSNLTKNSP  373

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
              +K+  +QQI IWWAGLMRGAVS+ALAYN+FT  GHT L  NA+MITST+TVVLFSTVVF
Sbjct  374   YEKVDLKQQITIWWAGLMRGAVSVALAYNQFTRLGHTHLQGNAVMITSTITVVLFSTVVF  433

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDN-QPDSESDMITGPEVAR  442
             GLMTKP++ + LP  KQ+     +  +SEPS+PK  T PLL N Q D+E++  +   V R
Sbjct  434   GLMTKPIVRIFLPSSKQI-----NTLSSEPSTPKSLTTPLLGNGQEDTEANA-SFNNVTR  487

Query  441   PTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             PT+LRMLL  P+HTVH YWRKFDD FMRPVFGGRGFVPFV GSP E
Sbjct  488   PTSLRMLLSIPSHTVHHYWRKFDDGFMRPVFGGRGFVPFVPGSPTE  533



>ref|XP_008812301.1| PREDICTED: sodium/hydrogen exchanger 2-like [Phoenix dactylifera]
Length=542

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/542 (76%), Positives = 457/542 (84%), Gaps = 7/542 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLF--TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             MAF L + L    +   TSDH SVVS+NLFVALLC CIV+GHLLEENRW+NESITAL IG
Sbjct  1     MAFDLGAHLVRLGILSSTSDHTSVVSINLFVALLCTCIVIGHLLEENRWMNESITALGIG  60

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             LCTGVVILL + GKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI+LFGA+
Sbjct  61    LCTGVVILLTTKGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIILFGAV  120

Query  1563  GTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSL  1384
             GTLIS SIIS GAV  F+ +DI  LD GD+LAIGAIF+ATDSVCTLQVL+QDETPLLYSL
Sbjct  121   GTLISFSIISLGAVGFFRRMDIGSLDIGDFLAIGAIFSATDSVCTLQVLNQDETPLLYSL  180

Query  1383  VFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYI  1204
             VFGEGVVNDATSVVLFNAIQ+FD+   D  I L F+GNF YLFL STFLG   GLL AYI
Sbjct  181   VFGEGVVNDATSVVLFNAIQNFDLVHIDAIIVLKFVGNFFYLFLFSTFLGAFTGLLSAYI  240

Query  1203  IKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  1024
             IKKLY GRHSTDREV+LMMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSR
Sbjct  241   IKKLYMGRHSTDREVSLMMLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSR  300

Query  1023  VTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAF  844
             VTT+H+FATLSF++E F+FLYVGMDALDIEKWK V +S G S+ VSSIL+GL+LVGRAAF
Sbjct  301   VTTKHAFATLSFISEIFLFLYVGMDALDIEKWKCVSDSPGKSIGVSSILLGLVLVGRAAF  360

Query  843   VFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIM  664
             VFPLSFLSNL KK+  +KISF+QQI IWWAGLMRGAVSIALAYN+FT SGHT L  NA+M
Sbjct  361   VFPLSFLSNLTKKSPIEKISFKQQITIWWAGLMRGAVSIALAYNQFTRSGHTQLRGNAMM  420

Query  663   ItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQP  484
             ITST++VVLFSTVVFGLMTKPLI LLLP   +    HS   +SEPS+PK     LL N  
Sbjct  421   ITSTISVVLFSTVVFGLMTKPLIRLLLPSGGK----HSGSMSSEPSTPKSLLSALLPNGQ  476

Query  483   DSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             +S+ +   G  V RP++LRMLL  P+HTVH YWRKFDD+FMRPVFGGRGFVPFV GSP E
Sbjct  477   ESQLEA-GGLIVERPSSLRMLLSKPSHTVHYYWRKFDDAFMRPVFGGRGFVPFVPGSPTE  535

Query  303   QS  298
             QS
Sbjct  536   QS  537



>gb|ADB54780.1| Na+/H+ exchanger [Phyllostachys edulis]
Length=545

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/533 (75%), Positives = 453/533 (85%), Gaps = 10/533 (2%)
 Frame = -3

Query  1896  LLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIll  1717
             +L+++ L  SD+ASVVS+NLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILL
Sbjct  9     VLKSAGLSVSDYASVVSINLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILL  68

Query  1716  lsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSII  1537
              + GKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GT+IS   I
Sbjct  69    TTKGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTMISFFTI  128

Query  1536  SFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVND  1357
             S  A+ IF  ++I  LD GD+LAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVVND
Sbjct  129   SLAAIAIFSRMNIGTLDVGDFLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVVND  188

Query  1356  ATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRH  1177
             ATSVVLFNA+Q+FD+   D  + L F+GNF+YLFLSSTFLG   GLL AYIIKKLY GRH
Sbjct  189   ATSVVLFNALQNFDLVHIDVAVVLKFLGNFIYLFLSSTFLGAFTGLLSAYIIKKLYIGRH  248

Query  1176  STDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFAT  997
             STDREVALMMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FAT
Sbjct  249   STDREVALMMLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFAT  308

Query  996   LSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSN  817
             LSF+AETF+FLYVGMDALDIEKWKF  +S G S+ +SSIL+GL+LVGRAAFVFPLSFLSN
Sbjct  309   LSFIAETFLFLYVGMDALDIEKWKFASDSPGKSIGISSILLGLVLVGRAAFVFPLSFLSN  368

Query  816   LAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvl  637
             L KK   +KI++RQQI+IWWAGLMRGAVSIALAYNKF  SGHT LH NA+MITST+TVV 
Sbjct  369   LTKKTPYEKITWRQQIVIWWAGLMRGAVSIALAYNKFARSGHTQLHGNALMITSTITVVP  428

Query  636   fstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITG  457
             FST+VFG+MTKPLI LLLP         S+  TSEPSSP   + PLL +     SD+ T 
Sbjct  429   FSTMVFGMMTKPLIRLLLP-------ASSNAVTSEPSSPSLHS-PLLTSMQG--SDLETA  478

Query  456   PEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
               + RP++LRMLL  PTHTVH YWRKFD++ MRP+FGGRGFVPF  GSP EQS
Sbjct  479   AHIVRPSSLRMLLTKPTHTVHYYWRKFDNALMRPMFGGRGFVPFSPGSPAEQS  531



>ref|XP_010464004.1| PREDICTED: sodium/hydrogen exchanger 2-like [Camelina sativa]
 ref|XP_010464005.1| PREDICTED: sodium/hydrogen exchanger 2-like [Camelina sativa]
 ref|XP_010464006.1| PREDICTED: sodium/hydrogen exchanger 2-like [Camelina sativa]
 ref|XP_010464007.1| PREDICTED: sodium/hydrogen exchanger 2-like [Camelina sativa]
Length=543

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/526 (75%), Positives = 451/526 (86%), Gaps = 6/526 (1%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS+NLFVALLCACIV+GHLLEENRW+NESITAL+IGLCTGVVILL+S GK+SH
Sbjct  16    TSDHASVVSLNLFVALLCACIVIGHLLEENRWMNESITALLIGLCTGVVILLISRGKNSH  75

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIM FGAIGT++SC+IIS GA++ F
Sbjct  76    LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMAFGAIGTVVSCTIISLGAIQFF  135

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             K LDI   D GD+LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  136   KKLDIGTFDLGDFLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  195

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQSFD+T  + +    F+GNF YLF+ ST LGV  GL+ AY+IKKLYFGRHSTDREVAL
Sbjct  196   AIQSFDLTHLNHEAAFKFLGNFFYLFILSTLLGVATGLISAYVIKKLYFGRHSTDREVAL  255

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AETF
Sbjct  256   MMLMAYLSYMLAELFTLSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATLSFLAETF  315

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAFVFPLSFLSNL+KK   +
Sbjct  316   IFLYVGMDALDIEKWRFVSDSPGTSVAVSSILMGLVMLGRAAFVFPLSFLSNLSKKTEGE  375

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI  +QQ++IWWAGLMRGAVS+ALAYNKFT SGHT L  NAIMITST+TV LFST+VFG+
Sbjct  376   KIDIKQQVVIWWAGLMRGAVSMALAYNKFTRSGHTELRGNAIMITSTITVCLFSTMVFGM  435

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLD-NQPDSESDMITGPEVARPT  436
             +TKPLI  L+P  K   S       S+ ++PK   +PLLD  Q DS     +  +V RP 
Sbjct  436   LTKPLIRYLMPHQKATTS-----MLSDDNTPKSIQIPLLDGEQQDSFELPESHHDVPRPD  490

Query  435   ALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             +LR  L  PT TVH YWR+FDD+FMRPVFGGRGFVPFV GSP E+S
Sbjct  491   SLRGFLMRPTRTVHHYWRQFDDAFMRPVFGGRGFVPFVPGSPTERS  536



>dbj|BAD91200.1| sodium proton antiporter [Ipomoea nil]
 dbj|BAD91201.1| sodium proton antiporter [Ipomoea nil]
Length=536

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/541 (73%), Positives = 460/541 (85%), Gaps = 11/541 (2%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLFT-SDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M   + +LL   ++ T SDH SVVS+N+FVAL+CACI++GHLLEE+RW+NESITAL+IG+
Sbjct  1     MGVDVGTLLSKMNMLTTSDHGSVVSINIFVALICACIIIGHLLEESRWMNESITALMIGI  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTGVVILL SGG SSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF N  TIMLFGA+G
Sbjct  61    CTGVVILLTSGGTSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNISTIMLFGALG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS  IIS GA+ IFK ++I  L+ GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISFIIISLGAIGIFKKMNIGSLELGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATS+VLFNA+Q+FD+++ +  + L   GNFLYLF+ ST LGV  GLL AY+I
Sbjct  181   FGEGVVNDATSIVLFNAVQNFDLSNINSLVVLQLFGNFLYLFILSTLLGVVAGLLSAYVI  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVA+M+ M+YLSY+++ELF LS ILTVFF GIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVAIMICMAYLSYMLSELFSLSAILTVFFSGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSF+AE FIFLYVGMDALDIEKWKFV +S G SV VSSIL+GL+LVGRAAFV
Sbjct  301   TTKHAFATLSFIAEIFIFLYVGMDALDIEKWKFVSDSPGTSVEVSSILLGLVLVGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KK+  +KI FRQQ IIWWAGLMRGAVS+ALAYN+FT SG+T L ENAIMI
Sbjct  361   FPLSFLSNLIKKSRGEKIGFRQQFIIWWAGLMRGAVSMALAYNQFTRSGYTQLRENAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFSTVVFGL+TKPLI +LLP  K +    + M +SEP +PK FTVPLLD++ D
Sbjct  421   TSTITVVLFSTVVFGLITKPLIRVLLPTPKHL----NRMVSSEPVTPKSFTVPLLDSEAD  476

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
              +        V RP +LRMLL TP+HT H YWRKFDD+FMRPVFGGRGFVP+V GSP EQ
Sbjct  477   LDG------HVPRPNSLRMLLTTPSHTAHYYWRKFDDAFMRPVFGGRGFVPYVPGSPTEQ  530

Query  300   S  298
             +
Sbjct  531   N  531



>ref|XP_009129852.1| PREDICTED: sodium/hydrogen exchanger 1 [Brassica rapa]
 emb|CDY25045.1| BnaC02g39630D [Brassica napus]
Length=544

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/544 (74%), Positives = 457/544 (84%), Gaps = 8/544 (1%)
 Frame = -3

Query  1923  TKMAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALII  1747
             T MA  L SL+     L TSDHASVVS+NLFVALLCACIVLGHLLEENRW+NESITAL+I
Sbjct  2     TMMASFLDSLVSKMPSLSTSDHASVVSLNLFVALLCACIVLGHLLEENRWMNESITALMI  61

Query  1746  GLCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGA  1567
             GL TGVVILL+S GKSS LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA
Sbjct  62    GLATGVVILLISNGKSSRLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGA  121

Query  1566  IGTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYS  1387
             IGT+ISC++I+ G  + FK LDI   D GDYLAIGAIFAATDSVCTLQVL+QDETPLLYS
Sbjct  122   IGTVISCTVITLGVTQFFKKLDIGTFDLGDYLAIGAIFAATDSVCTLQVLNQDETPLLYS  181

Query  1386  LVFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAY  1207
             LVFGEGVVNDATSVV+FNAIQSFD+T  + +     +GNF+YLFL ST LGV  GL+ AY
Sbjct  182   LVFGEGVVNDATSVVVFNAIQSFDLTHLNHEAAFQLLGNFMYLFLLSTLLGVATGLISAY  241

Query  1206  IIKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESS  1027
             +IKKLYFGRHSTDREVALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESS
Sbjct  242   VIKKLYFGRHSTDREVALMMLMAYLSYMLAELFDLSGILTVFFCGIVMSHYTWHNVTESS  301

Query  1026  RVTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAA  847
             R+TT+H+FATLSF+AETFIFLYVGMDALDI+KW+ V +S G SVAVSSIL+GL+++GRAA
Sbjct  302   RITTKHTFATLSFLAETFIFLYVGMDALDIDKWRSVSDSPGTSVAVSSILIGLLMLGRAA  361

Query  846   FVFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAI  667
             FVFPLSFLSNLAKKN S+KI+F+ Q++IWW+GLMRGAVS+ALAYNKFT++GHT L  NAI
Sbjct  362   FVFPLSFLSNLAKKNESEKINFKMQVVIWWSGLMRGAVSMALAYNKFTSAGHTDLRGNAI  421

Query  666   MItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQ  487
             MITST+TV LFSTVVFG++TKPLI  LLP  K   S       S+ ++PK   +PLLD  
Sbjct  422   MITSTITVCLFSTVVFGMLTKPLIRFLLPHQKATTS-----FLSDGNTPKSIQIPLLDQ-  475

Query  486   PDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPV  307
              DS  +      V RP ++R  L  PT TVH YWRKFDDSFMRPVFGGRGFVPFV GSP 
Sbjct  476   -DSFIEFTGNHNVPRPDSIRGFLTRPTRTVHYYWRKFDDSFMRPVFGGRGFVPFVPGSPT  534

Query  306   EQSP  295
             E+ P
Sbjct  535   ERDP  538



>ref|XP_009147289.1| PREDICTED: sodium/hydrogen exchanger 2 [Brassica rapa]
Length=548

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/530 (75%), Positives = 453/530 (85%), Gaps = 13/530 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS+NLFVALLCACIV+GHLLEE+RW+NESITAL+IGL TGVVILL+S GKSSH
Sbjct  20    TSDHASVVSLNLFVALLCACIVIGHLLEEHRWINESITALLIGLGTGVVILLMSRGKSSH  79

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIM FGAIGT+ISC++IS GA+  F
Sbjct  80    LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMAFGAIGTIISCTVISLGAIHFF  139

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             K LDI   D GD LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  140   KKLDIATFDLGDILAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  199

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQSFD+T  + +   HF+GNFLYLFL ST LGV  GL+ AY+IKKLYFGRHSTDREVAL
Sbjct  200   AIQSFDLTHLNHEAAFHFLGNFLYLFLLSTVLGVATGLVSAYVIKKLYFGRHSTDREVAL  259

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF
Sbjct  260   MMLMAYLSYMLAELFALSGILTVFFCGIVMSHYTWHNVTESSRVTTKHTFATLSFLAETF  319

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAFVFPLSFLSNL+KKN S+
Sbjct  320   IFLYVGMDALDIEKWRFVSDSPGTSVAVSSILMGLVMLGRAAFVFPLSFLSNLSKKNQSE  379

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI  +QQ++IWWAGLMRGAVS+ALAYNKFT SGHT L  NAIMITST+TV LFST+VFG+
Sbjct  380   KIDIKQQVVIWWAGLMRGAVSMALAYNKFTRSGHTELRGNAIMITSTITVCLFSTMVFGM  439

Query  612   MTKPLINLLLPPHKQMPSGHSSMTT---SEPSSPKHFTVPLLDNQPDSESDMITGP--EV  448
             +TKPLI  L+P        H S TT   S+ ++PK   +PLLD +        +G   +V
Sbjct  440   LTKPLIRHLMP--------HQSTTTSMLSDDNTPKSLHMPLLDGEQQDSFVEFSGSHHDV  491

Query  447   ARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              RP +LR  L  P  TVH YWR+FDD+FMRPVFGGRGFVPFV GSP+E+S
Sbjct  492   PRPDSLRGFLMRPARTVHHYWRQFDDAFMRPVFGGRGFVPFVPGSPIERS  541



>dbj|BAJ06110.1| sodium/proton antiporter [Salsola komarovii]
Length=559

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/539 (77%), Positives = 462/539 (86%), Gaps = 15/539 (3%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVSMN+FVALLC CIV+GHLLEENRW+NESITAL+IGL TGVVILL+SGGKS
Sbjct  16    LSTSDHASVVSMNMFVALLCGCIVIGHLLEENRWMNESITALLIGLATGVVILLISGGKS  75

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI++FGA+GTL+S SIIS GA+ 
Sbjct  76    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIIMFGALGTLVSFSIISLGAMT  135

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
             IFK +DI  L+ GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  136   IFKKMDIGSLELGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  195

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQ+FD+T  D +I L F GNFLYLF +ST LG   GLL AY+IKKLYFGRHSTDREV
Sbjct  196   FNAIQNFDLTHIDHRIALQFSGNFLYLFFASTLLGAMTGLLSAYVIKKLYFGRHSTDREV  255

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  256   ALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAE  315

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              F+FLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAFVFPLS L N +KK+S
Sbjct  316   IFLFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLLMLGRAAFVFPLSLLMNFSKKSS  375

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KISF QQI+IWWAGLMRGAVS+ALAYN+FT +GHT L  NAIMITST+TVVLFST+VF
Sbjct  376   SEKISFNQQIVIWWAGLMRGAVSMALAYNQFTRAGHTQLRGNAIMITSTITVVLFSTMVF  435

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPE----  451
             GL+TKPLI  LLP  K      S+ T S+  SPK F  PLL+   D+E D+    E    
Sbjct  436   GLLTKPLILFLLPHPKHFS---STSTVSDLGSPKAFFAPLLEGTQDTEVDVGNHDEETHH  492

Query  450   --------VARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
                     +ARP++LRMLL  PTHTVH YWRKFDDSFMRPVFGGRGFVPFV GSP EQS
Sbjct  493   DEETNYRPIARPSSLRMLLNAPTHTVHHYWRKFDDSFMRPVFGGRGFVPFVPGSPTEQS  551



>ref|NP_001291254.1| uncharacterized protein LOC105114582 [Populus euphratica]
 gb|ACU01855.1| Na+/H+ exchanger 4 [Populus euphratica]
Length=536

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/527 (77%), Positives = 451/527 (86%), Gaps = 6/527 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             + +SDH+SVV +NLFVALLCACIV+GHLLEE RW++ESITAL +GLCTG+VILL +GGKS
Sbjct  11    MLSSDHSSVVPINLFVALLCACIVIGHLLEEQRWMSESITALAVGLCTGIVILLTTGGKS  70

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+GTLIS +IIS GA  
Sbjct  71    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVGTLISTAIISIGAAH  130

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
               K ++I  L  GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  131   FSKKMNISSLRIGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  190

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             F+AIQS D++  +  I   F+GNFLYLF+SST LGV  GLL AYIIKKLYFGRHSTDREV
Sbjct  191   FHAIQSIDLSHINSSIAAEFLGNFLYLFISSTILGVLTGLLSAYIIKKLYFGRHSTDREV  250

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALM+LM+YLSY++AELFYLS ILTVFFCGIVMSHYTWHNVTESSR+TT+H+FAT SFVAE
Sbjct  251   ALMILMAYLSYMLAELFYLSAILTVFFCGIVMSHYTWHNVTESSRITTKHAFATWSFVAE  310

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              FIFLYVGMDALDIEKWK V +S G SV VSSIL+GL+LVGRAAFVFPLSFLSNL KK  
Sbjct  311   IFIFLYVGMDALDIEKWKVVSDSPGTSVMVSSILLGLVLVGRAAFVFPLSFLSNLTKKFP  370

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
              +KI  +QQ+ IWWAGLMR AVS+ALAYN+FT SGHT LH NAIMITST+TVVLFSTVVF
Sbjct  371   YEKIDIKQQVTIWWAGLMRSAVSMALAYNQFTRSGHTHLHGNAIMITSTITVVLFSTVVF  430

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             GLMTKPL+ +LLP  K      +SM +SEPSSPK F VPLL+ Q DSE D  T   V R 
Sbjct  431   GLMTKPLVRILLPSQKHT----ASMLSSEPSSPKSFAVPLLNRQ-DSE-DNQTSHNVPRR  484

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             T+LRMLL TP+HTVH YWRKFD+SFMRPVFGGRGFVPFV  SP + S
Sbjct  485   TSLRMLLSTPSHTVHHYWRKFDNSFMRPVFGGRGFVPFVPCSPTDHS  531



>emb|CDY27804.1| BnaA05g32130D [Brassica napus]
Length=546

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/530 (75%), Positives = 453/530 (85%), Gaps = 13/530 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS+NLFVALLCACIV+GHLLEE+RW+NESITAL+IGL TGVVILL+S GKSSH
Sbjct  18    TSDHASVVSLNLFVALLCACIVVGHLLEEHRWINESITALLIGLGTGVVILLMSRGKSSH  77

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIM FGAIGT+ISC++IS GA+  F
Sbjct  78    LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMAFGAIGTIISCTVISLGAIHFF  137

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             K LDI   D GD LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  138   KKLDIATFDLGDILAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  197

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQSFD+T  + +   HF+GNFLYLFL ST LGV  GL+ AY+IKKLYFGRHSTDREVAL
Sbjct  198   AIQSFDLTHLNHEAAFHFLGNFLYLFLLSTVLGVATGLVSAYVIKKLYFGRHSTDREVAL  257

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF
Sbjct  258   MMLMAYLSYMLAELFALSGILTVFFCGIVMSHYTWHNVTESSRVTTKHTFATLSFLAETF  317

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAFVFPLSFLSNL+KKN S+
Sbjct  318   IFLYVGMDALDIEKWRFVSDSPGTSVAVSSILMGLVMLGRAAFVFPLSFLSNLSKKNQSE  377

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI  +QQ++IWWAGLMRGAVS+ALAYNKFT SGHT L  NAIMITST+TV LFST+VFG+
Sbjct  378   KIDIKQQVVIWWAGLMRGAVSMALAYNKFTRSGHTELRGNAIMITSTITVCLFSTMVFGM  437

Query  612   MTKPLINLLLPPHKQMPSGHSSMTT---SEPSSPKHFTVPLLDNQPDSESDMITGP--EV  448
             +TKPLI  L+P        H S TT   S+ ++PK   +PLLD +        +G   +V
Sbjct  438   LTKPLIRHLMP--------HQSTTTSMLSDDNTPKSLHMPLLDGEQQDSFVEFSGSHHDV  489

Query  447   ARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              RP +LR  L  P  TVH YWR+FDD+FMRPVFGGRGFVPFV GSP+E+S
Sbjct  490   PRPDSLRGFLMRPARTVHHYWRQFDDAFMRPVFGGRGFVPFVPGSPIERS  539



>ref|XP_008799262.1| PREDICTED: sodium/hydrogen exchanger 2 isoform X1 [Phoenix dactylifera]
Length=543

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/541 (74%), Positives = 457/541 (84%), Gaps = 4/541 (1%)
 Frame = -3

Query  1917  MAFGLSS-LLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MA  L S L++   L  SDH SVVS+NLFVALLCACIV+GHLLEENRW+NESITAL+IGL
Sbjct  1     MAMDLGSVLIKMGILSASDHMSVVSINLFVALLCACIVIGHLLEENRWMNESITALLIGL  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTGVVILL + G+SSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI+LFGA+G
Sbjct  61    CTGVVILLTTKGRSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIILFGAVG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS  IIS GA+ I + + +  L+ GDYLAIGAIF+ATDSVCTLQVLSQDETPLLYSLV
Sbjct  121   TLISFIIISLGAIGIIEKMGLGSLEIGDYLAIGAIFSATDSVCTLQVLSQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATS+VLFNAIQ+FD+   D    L F+ +F YLF +STFLG   GLL AY+I
Sbjct  181   FGEGVVNDATSIVLFNAIQNFDLGHIDAVTILKFVADFFYLFFTSTFLGAFAGLLSAYVI  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVALM+LM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVALMILMAYLSYMLAELSNLSGILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSF+AETF+FLYVGMDALDIEKWKFV NS   S+ VSSIL+G++L+GRAAFV
Sbjct  301   TTKHAFATLSFIAETFLFLYVGMDALDIEKWKFVSNSPRKSIGVSSILLGMVLIGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KK+ ++KI+FRQQ+I+WWAGLMRGAVSIALAYN+F  +GHT +  NA MI
Sbjct  361   FPLSFLSNLTKKHPNEKITFRQQVIVWWAGLMRGAVSIALAYNQFARTGHTQMRGNAFMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFST+VFGLMTKPLI LLLPP  +  S   SM +SEP SPK+   PLL N   
Sbjct  421   TSTITVVLFSTMVFGLMTKPLIRLLLPPSIRQLSRDLSM-SSEPPSPKYLHSPLLGNGQG  479

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE +   G  + RPT+LRMLL  P+ +VH YWRKFDD+FMRPVFGGRGF P+V GSP E+
Sbjct  480   SEVE--AGQNIPRPTSLRMLLTAPSRSVHHYWRKFDDAFMRPVFGGRGFAPYVPGSPTER  537

Query  300   S  298
             S
Sbjct  538   S  538



>gb|AAP15178.1| Na+/H+ antiporter [Suaeda salsa]
Length=557

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/536 (75%), Positives = 459/536 (86%), Gaps = 15/536 (3%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVSMNLFVALLC CIV+GHLLEENRW+NESITAL+IGL TG++ILL+SGGKSSH
Sbjct  18    TSDHASVVSMNLFVALLCGCIVIGHLLEENRWMNESITALLIGLSTGIIILLISGGKSSH  77

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI+LFGA+GTL+S  IIS G++ IF
Sbjct  78    LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIILFGAVGTLVSFIIISLGSIAIF  137

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             + +DI  L+ GD LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  138   QKMDIGSLELGDLLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  197

Query  1332  AIQSFDMTSFDP----KIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDR  1165
             AIQ+FD+T  D     +I   F GNFLYLF +ST LG   GLL AY+IKKLYFGRHSTDR
Sbjct  198   AIQNFDLTHIDHRIAYRIAFQFGGNFLYLFFASTLLGAVTGLLSAYVIKKLYFGRHSTDR  257

Query  1164  EVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFV  985
             EVALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFV
Sbjct  258   EVALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFV  317

Query  984   AETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKK  805
             AE FIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL++VGR A +F L FL NL+KK
Sbjct  318   AEIFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLLMVGR-ALLFSLVFLMNLSKK  376

Query  804   NSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstv  625
             ++S+K++F QQI+IWWAGLMRGAVS+ALAYN+F+ SGHT L  NAIMITST+TVVLFST+
Sbjct  377   SNSEKVTFNQQIVIWWAGLMRGAVSVALAYNQFSRSGHTQLRGNAIMITSTITVVLFSTM  436

Query  624   vFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPE--  451
             VFGL+TKPLI  +LP  K   S     T S+  SPK F++PLL+++ DSE+D+    E  
Sbjct  437   VFGLLTKPLILFMLPQPKHFTSAS---TVSDLGSPKSFSLPLLEDRQDSEADLGNDDEEA  493

Query  450   -----VARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
                  +ARPT+LRMLL  PTHTVH YWR+FDD FMRPVFGGRGFVPFV GSP EQS
Sbjct  494   YPRGTIARPTSLRMLLNAPTHTVHHYWRRFDDYFMRPVFGGRGFVPFVPGSPTEQS  549



>emb|CDY41925.1| BnaC05g46790D [Brassica napus]
Length=549

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/530 (75%), Positives = 453/530 (85%), Gaps = 13/530 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS+NLFVALLCACIV+GHLLEE+RW+NESITAL+IGL TGVVILL+S GK+SH
Sbjct  21    TSDHASVVSLNLFVALLCACIVIGHLLEEHRWINESITALLIGLATGVVILLISRGKNSH  80

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIM FGAIGT+ISC++IS GA+  F
Sbjct  81    LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMAFGAIGTIISCTVISLGAIHFF  140

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             K LDI   D GD LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  141   KKLDIATFDLGDILAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  200

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQSFD+T  + +   HF+GNFLYLF+ ST LGV  GL+ AY+IKKLYFGRHSTDREVAL
Sbjct  201   AIQSFDLTHLNHEAAFHFLGNFLYLFILSTVLGVATGLISAYVIKKLYFGRHSTDREVAL  260

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF
Sbjct  261   MMLMAYLSYMLAELFALSGILTVFFCGIVMSHYTWHNVTESSRVTTKHTFATLSFLAETF  320

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAFVFPLSFLSNL+KKN S+
Sbjct  321   IFLYVGMDALDIEKWRFVSDSPGTSVAVSSILMGLVMLGRAAFVFPLSFLSNLSKKNQSE  380

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI  +QQ++IWWAGLMRGAVS+ALAYNKFT SGHT L  NAIMITST+TV LFST+VFG+
Sbjct  381   KIDIKQQVVIWWAGLMRGAVSMALAYNKFTRSGHTELRGNAIMITSTITVCLFSTMVFGM  440

Query  612   MTKPLINLLLPPHKQMPSGHSSMTT---SEPSSPKHFTVPLLDNQPDSESDMITGP--EV  448
             +TKPLI  L+P        H S TT   S+ ++PK   +PLLD +        +G   +V
Sbjct  441   LTKPLIRHLMP--------HQSTTTSMLSDDNTPKSMHMPLLDGEQQDSFVEFSGSHHDV  492

Query  447   ARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              RP +LR  L  P  TVH YWR+FDD+FMRPVFGGRGFVPFV GSP+++S
Sbjct  493   PRPDSLRGFLMRPARTVHHYWRQFDDAFMRPVFGGRGFVPFVPGSPIDRS  542



>gb|ACE78322.1| NHX1-like protein [Lotus tenuis]
Length=543

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/541 (77%), Positives = 468/541 (87%), Gaps = 5/541 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLF-TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M  GL S +    +  TSDHAS+VSMNLFVALLCACIVLGHLLEENRW+NESITAL+IG+
Sbjct  1     MGLGLISAVSKLQMVSTSDHASIVSMNLFVALLCACIVLGHLLEENRWMNESITALVIGV  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             C GVVILL SGG SSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTI +FGAIG
Sbjct  61    CVGVVILLFSGGTSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTITMFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLISC+II+ GA + FK +D+  L+ GD LAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISCTIITLGATQAFKWMDVGPLEVGDLLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD+   +  I LHF+GNFLYLF++ST LGV  GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLNQINSSIALHFLGNFLYLFIASTLLGVLTGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLY GRHSTDREVALMMLM+YLSY++AEL YLSGILTVFFCGIVMSHYTWHNVTESSR+
Sbjct  241   KKLYIGRHSTDREVALMMLMAYLSYMLAELAYLSGILTVFFCGIVMSHYTWHNVTESSRI  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSFVAETFIFLYVGMDALDIEKWKFV +S G SVAVSS+L+GLIL+GRAAFV
Sbjct  301   TTKHAFATLSFVAETFIFLYVGMDALDIEKWKFVSDSPGTSVAVSSVLLGLILLGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNLAKK+ +DKISFRQQ+IIWWAGLMRGAVS+ALAYN+FT SGHTSL  NAIMI
Sbjct  361   FPLSFLSNLAKKSQNDKISFRQQVIIWWAGLMRGAVSMALAYNQFTMSGHTSLRSNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVL STVVFG++TKPLI LLLP      +   SM + +PS+PK FTVPLL +  D
Sbjct  421   TSTITVVLVSTVVFGMLTKPLIRLLLP---HTDTKTDSMASLDPSTPKSFTVPLLGSAQD  477

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             S  D     E+ RP+++R LL TPTHTVHR WRKFD+SFMRPVFGGRGFVP   GSP ++
Sbjct  478   SVGDF-DAHEIRRPSSIRALLSTPTHTVHRLWRKFDNSFMRPVFGGRGFVPVEPGSPSDR  536

Query  300   S  298
             S
Sbjct  537   S  537



>gb|AID51453.1| vacuolar Na+/H+ reverse transporter [Glehnia littoralis]
Length=541

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/539 (74%), Positives = 458/539 (85%), Gaps = 7/539 (1%)
 Frame = -3

Query  1914  AFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC  1738
              FGL  +    + L  SDHASVVS+NLFVALLCACIV+GHLLEE+RW+NESITAL IG+C
Sbjct  3     GFGLGVVFSKMNSLSASDHASVVSVNLFVALLCACIVVGHLLEESRWINESITALAIGIC  62

Query  1737  TGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGT  1558
             TGVVILL SGGK+SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI LFGA+GT
Sbjct  63    TGVVILLSSGGKNSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFLTITLFGAVGT  122

Query  1557  LISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVF  1378
             LIS SIIS GA+ IFK ++I  L+ GD+LAIGAIF+ATDSVCTLQVL+QDETPLLYSLVF
Sbjct  123   LISFSIISLGAMNIFKKMNIGSLEIGDFLAIGAIFSATDSVCTLQVLNQDETPLLYSLVF  182

Query  1377  GEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIK  1198
             GEGVVNDATSVVLFNA+++FD++  D    L  IGNF+YLF+SST LGV  GLL A+IIK
Sbjct  183   GEGVVNDATSVVLFNAVRNFDLSHIDAVTALQLIGNFIYLFISSTLLGVFAGLLSAFIIK  242

Query  1197  KLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT  1018
             KLYFGRHSTDREVA+M+LM+YLSY+++EL  LS ILTVFFCGIVMSHYTWHNVTESSRVT
Sbjct  243   KLYFGRHSTDREVAIMILMAYLSYMLSELLDLSAILTVFFCGIVMSHYTWHNVTESSRVT  302

Query  1017  TRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVF  838
             T+H+FATLSF+AE FIFLYVGMDALDIEKW++V +S G S+ VSSIL+GLILVGRAAFVF
Sbjct  303   TKHTFATLSFIAEIFIFLYVGMDALDIEKWRYVSDSPGTSIGVSSILLGLILVGRAAFVF  362

Query  837   PLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMIt  658
             PLSFLSNL KK++ +KI  +QQ+ IWWAGLMRGAVS+ALAYN+FT  GHT L  NAIMIT
Sbjct  363   PLSFLSNLTKKSTENKIELKQQVTIWWAGLMRGAVSMALAYNQFTRGGHTQLRGNAIMIT  422

Query  657   stvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDS  478
             ST+TVVLFSTVVFGL+TKPL+N LLP    +    S M +SEP +P  F VPLL N  DS
Sbjct  423   STITVVLFSTVVFGLLTKPLVNHLLPSRTHL----SRMISSEPVTPNSFFVPLLTNGQDS  478

Query  477   ESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             E+D+  G  + RP +LRM+L  P+ +VH YWRKFD++FMRPVFGGRGFVPFV GSP EQ
Sbjct  479   EADL--GSTILRPPSLRMILTAPSRSVHHYWRKFDNAFMRPVFGGRGFVPFVPGSPTEQ  535



>ref|XP_007147113.1| hypothetical protein PHAVU_006G097100g [Phaseolus vulgaris]
 gb|ESW19107.1| hypothetical protein PHAVU_006G097100g [Phaseolus vulgaris]
Length=549

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/546 (75%), Positives = 462/546 (85%), Gaps = 10/546 (2%)
 Frame = -3

Query  1923  TKMAFGLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             T++++ LS L     L TSD+ASVVSMN+FVALLCACIV+GHLLEENRWVNESITAL+IG
Sbjct  3     TELSYALSKLHM---LSTSDYASVVSMNIFVALLCACIVIGHLLEENRWVNESITALLIG  59

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             +CTGVVILLLS GKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGA+
Sbjct  60    ICTGVVILLLSRGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFMTIMLFGAV  119

Query  1563  GTLISCSIISFGAVKIFKHLDI-DFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYS  1387
             GTLI+CSII+FG ++IFK + + + L+ GDYLAIGAIFAATDSVCTLQVL+QDETPLLYS
Sbjct  120   GTLINCSIITFGVIQIFKRMGVGNSLEIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYS  179

Query  1386  LVFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAY  1207
             LVFGEGVVNDATSVVLFNAI+SFD+   D +IGLHF GNF YLF++ST LGV  GLL AY
Sbjct  180   LVFGEGVVNDATSVVLFNAIKSFDLNIIDHRIGLHFFGNFFYLFIASTLLGVLAGLLSAY  239

Query  1206  IIKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESS  1027
             IIK LY GRHSTDREVALMMLM+YLSYI+AEL+YLSGILTVFFCGIVMSHYTWHNVTESS
Sbjct  240   IIKTLYIGRHSTDREVALMMLMAYLSYILAELWYLSGILTVFFCGIVMSHYTWHNVTESS  299

Query  1026  RVTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAA  847
             R+TT+H+FATLSFV ETFIFLYVGMDALDIEKW+FV +    SVAVSS+L+GL+L GRAA
Sbjct  300   RITTKHAFATLSFVLETFIFLYVGMDALDIEKWRFVSDRPKTSVAVSSVLLGLVLAGRAA  359

Query  846   FVFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAI  667
             FVFPLSFLSNL KK+ S+KISF +Q+IIWWAGLMRGAVS+ALAYN+FT SGHT L  NAI
Sbjct  360   FVFPLSFLSNLTKKSESEKISFSEQVIIWWAGLMRGAVSMALAYNQFTLSGHTELRTNAI  419

Query  666   MItstvtvvlfstvvFGLMTKPLINLLL---PPHKQMPSGHSSMTTSEPSSPKHFTVPLL  496
             MITST+TVVL ST+VFGLMTKPLI  LL   PP K+  S  +  +++ P  PK  TVP L
Sbjct  420   MITSTITVVLVSTMVFGLMTKPLIRFLLPVSPPPKRKNSLANMESSNNP--PKSITVPFL  477

Query  495   DNQPDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAG  316
                 DSE+++ +  E  RP  +R LL T TH VHR WR FD+S MRPVFGGRGFVP    
Sbjct  478   GGSHDSENELDSN-EDHRPRTIRALLSTSTHNVHRLWRTFDNSIMRPVFGGRGFVPVAPT  536

Query  315   SPVEQS  298
             SP E S
Sbjct  537   SPTEGS  542



>dbj|BAK23261.1| Na+/H+ exchanger [Puccinellia tenuiflora]
Length=538

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/525 (76%), Positives = 450/525 (86%), Gaps = 10/525 (2%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVS+NLFVALLCACIVLGHLLEENRW+NESITALIIGLCTGVVILL + GKS
Sbjct  17    LTTSDHASVVSINLFVALLCACIVLGHLLEENRWLNESITALIIGLCTGVVILLTTKGKS  76

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GT+IS   IS  A+ 
Sbjct  77    SHVLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTMISFFTISLAAIA  136

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
             IF  ++I  LD  D+LAIGAIF+ATDSVCTLQVL+QDETP LYSLVFGEGVVNDATSVVL
Sbjct  137   IFSKMNIGTLDVSDFLAIGAIFSATDSVCTLQVLNQDETPFLYSLVFGEGVVNDATSVVL  196

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNA+Q+FD+   D  + L F+GNFLYLF+SSTFLGV  GLL AYIIKKLY GRHSTDREV
Sbjct  197   FNALQNFDLNHIDTMVILKFLGNFLYLFVSSTFLGVFSGLLSAYIIKKLYIGRHSTDREV  256

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AE
Sbjct  257   ALMMLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATLSFIAE  316

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TF+FLYVGMDALDIEKWKF  +S G S+ VSSIL+GL+LVGRAAFVFPLSFLSNL KK  
Sbjct  317   TFLFLYVGMDALDIEKWKFASDSPGKSIGVSSILLGLVLVGRAAFVFPLSFLSNLTKKTP  376

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             ++KIS+RQQI+IWWAGLMRGAVSIALAYNKFT SGHT LH NAIMITST+TVVLFST++F
Sbjct  377   AEKISWRQQIVIWWAGLMRGAVSIALAYNKFTRSGHTQLHGNAIMITSTITVVLFSTMLF  436

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             G+MTKPLI  LLP      SG++   TSEPSSPK    PLL +     SD+ T   + RP
Sbjct  437   GMMTKPLIRFLLP-----ASGNA---TSEPSSPKSLHSPLLTSLLG--SDLETAVPIIRP  486

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             ++LRMLL  PTHTVH YWR+FDD+ MRP+FGGRGFVP+  GSP +
Sbjct  487   SSLRMLLTKPTHTVHYYWRRFDDALMRPMFGGRGFVPYSPGSPTD  531



>gb|AAQ74383.1| putative Na/H antiporter [Oryza sativa Japonica Group]
Length=535

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/525 (76%), Positives = 446/525 (85%), Gaps = 9/525 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSD+ASVVS+NLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILL++ GKSSH
Sbjct  16    TSDYASVVSINLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILLMTKGKSSH  75

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             L VFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GT+IS   IS  A+ IF
Sbjct  76    LFVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTMISFFTISIAAIAIF  135

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
               ++I  LD GD+LAI AIF ATDSVCTLQVL+QDETP LYSLVFGEGVVNDATS+VLFN
Sbjct  136   SRMNIGTLDVGDFLAIRAIFPATDSVCTLQVLNQDETPFLYSLVFGEGVVNDATSIVLFN  195

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+Q+FD+   D  + L F+GNF YLFLSSTFLGV  GLL AYIIKKLY GRHSTDREVAL
Sbjct  196   ALQNFDLVHIDAAVVLKFLGNFFYLFLSSTFLGVFAGLLSAYIIKKLYIGRHSTDREVAL  255

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF
Sbjct  256   MMLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETF  315

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDIEKW+F  +  G S+ +SSIL+GL+L+GRAAFVFPLSFLSNL KK  ++
Sbjct  316   LFLYVGMDALDIEKWEFASDRPGKSIGISSILLGLVLIGRAAFVFPLSFLSNLTKKAPNE  375

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             K ++RQQ++IWWAGLMRGAVSIALAYNKFT SGHT LH NAIMITST+TVVL+ST+VFG+
Sbjct  376   KRTWRQQVVIWWAGLMRGAVSIALAYNKFTRSGHTQLHGNAIMITSTITVVLWSTMVFGM  435

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             MTKPLI LLLP      SGH    TSEPSSPK    PLL       SD+ +   + RP++
Sbjct  436   MTKPLIRLLLP-----ASGHP--VTSEPSSPKSLHSPLLTRM--QGSDLESTTNIVRPSS  486

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             LRMLL  PTHTVH YWRKFDD+ MRP+FGGRGFVPF  GSP EQS
Sbjct  487   LRMLLTKPTHTVHYYWRKFDDALMRPMFGGRGFVPFSPGSPTEQS  531



>gb|ABY19311.2| Na+/H+ antiporter [Zoysia japonica]
Length=540

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/525 (76%), Positives = 448/525 (85%), Gaps = 7/525 (1%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS+NLFV LLCACIVLGHLLEENRWVNESITALIIGLCTGVVILL + GKSSH
Sbjct  18    TSDHASVVSINLFVTLLCACIVLGHLLEENRWVNESITALIIGLCTGVVILLTTKGKSSH  77

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             +LVFSED FFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GT+IS   IS GA+ IF
Sbjct  78    ILVFSEDFFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTMISFFTISAGAIAIF  137

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
               ++I  LD GD+LAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  138   SRMNIGTLDVGDFLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  197

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+Q+FD+   D  + L F+GNF YLFL+STFLGV  GLL AYIIKKLY GRHSTDREVAL
Sbjct  198   ALQNFDLNKIDVAVVLKFLGNFCYLFLTSTFLGVFSGLLSAYIIKKLYIGRHSTDREVAL  257

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF++ETF
Sbjct  258   MMLMAYLSYMLAELSDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFISETF  317

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDIEKWKF  +S G S+ +SSIL+GL+LVGRAAFVFPLSFLSNL KK  S+
Sbjct  318   LFLYVGMDALDIEKWKFASDSPGKSIGISSILLGLVLVGRAAFVFPLSFLSNLTKKEPSE  377

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI++RQQI+IWWAGLMRGAVSIALAYN+FT   HT LH NAIMITST+TVVLFST+VFG+
Sbjct  378   KITWRQQIVIWWAGLMRGAVSIALAYNQFTRFRHTQLHGNAIMITSTITVVLFSTMVFGM  437

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             MTKPLI LLLP      S H+    SEPSSPK    PLL +   S+ +  +   + RP++
Sbjct  438   MTKPLIRLLLP-----ASSHT--VHSEPSSPKSLHSPLLTSMQGSDLETASHSHIVRPSS  490

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             LRMLL  PTHTVH YWRKFD++ MRP+FGGRGFVPF  GSP EQS
Sbjct  491   LRMLLSKPTHTVHYYWRKFDNALMRPMFGGRGFVPFSPGSPTEQS  535



>gb|AES82581.2| cation/H+ exchanger 3 [Medicago truncatula]
Length=544

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/532 (75%), Positives = 453/532 (85%), Gaps = 11/532 (2%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSD+AS++SMNLFVALLCACIV+GHLLEENRWVNESITAL++GLCTGVVIL +SGGKS
Sbjct  9     LTTSDYASIISMNLFVALLCACIVIGHLLEENRWVNESITALLLGLCTGVVILWISGGKS  68

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKK+FFVNF+TIM FGA+GTLISCSII+FG  +
Sbjct  69    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKRFFVNFITIMSFGAVGTLISCSIITFGVSQ  128

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
             IFK + I  LD G+ +AIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  129   IFKRMGIGTLDLGEAVAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  188

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAI+SFD+   D  I L F GNFLYLF++ST LGV  GLL AYIIKKLY GRHSTDREV
Sbjct  189   FNAIKSFDLEQLDHGIALQFFGNFLYLFIASTMLGVLGGLLSAYIIKKLYIGRHSTDREV  248

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YL+YI+AEL+YLSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSFVAE
Sbjct  249   ALMMLMAYLTYILAELWYLSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATLSFVAE  308

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TF+FLYVGMDALDIEKW+FV +  G SV VSS+L+ L+L+GRAAFVFPLSFLSNL KK+ 
Sbjct  309   TFLFLYVGMDALDIEKWRFVSDRPGTSVIVSSVLLALVLIGRAAFVFPLSFLSNLTKKSQ  368

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             ++KISFR+Q+IIWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST+TVVL ST+VF
Sbjct  369   NEKISFRKQVIIWWAGLMRGAVSMALAYNEFTMSGHTQLQFNAIMITSTITVVLVSTMVF  428

Query  618   GLMTKPLINLLLP---PHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEV  448
             G+MTKPLI  L+P   P KQ     +S+   E SSPK  TVP L  + DSE         
Sbjct  429   GMMTKPLIRFLIPLGHPPKQ----KNSLANLEESSPKSITVPFLGGRQDSEEVDNDNDND  484

Query  447   A----RPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             A    RP+++R LL TPTHTVHR WRKFDD+ MRPVFGGRGFVP V  SP E
Sbjct  485   ANDSHRPSSIRDLLTTPTHTVHRLWRKFDDAIMRPVFGGRGFVPVVPTSPTE  536



>emb|CDY50586.1| BnaC02g39600D [Brassica napus]
Length=544

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/544 (74%), Positives = 455/544 (84%), Gaps = 8/544 (1%)
 Frame = -3

Query  1923  TKMAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALII  1747
             T MA  L S +     L TSDHASVVS+NLFVALLCACIVLGHLLEENRW+NESITAL+I
Sbjct  2     TMMASFLDSFVSKMPSLSTSDHASVVSLNLFVALLCACIVLGHLLEENRWMNESITALMI  61

Query  1746  GLCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGA  1567
             GL TGVVILL+S GKSS LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA
Sbjct  62    GLATGVVILLISNGKSSRLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGA  121

Query  1566  IGTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYS  1387
             IGT++SC++I+ G  + FK LDI   D GDYLAIGAIFAATDSVCTLQVL+QDETPLLYS
Sbjct  122   IGTVVSCTVITLGVTQFFKKLDIGTFDLGDYLAIGAIFAATDSVCTLQVLNQDETPLLYS  181

Query  1386  LVFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAY  1207
             LVFGEGVVNDATSVV+FNAIQSFD+T  + +     +GNF+YLFL ST LGV  GL+ AY
Sbjct  182   LVFGEGVVNDATSVVVFNAIQSFDLTHLNHEAAFQLLGNFMYLFLLSTLLGVATGLISAY  241

Query  1206  IIKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESS  1027
             +IKKLYFGRHSTDREVALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESS
Sbjct  242   VIKKLYFGRHSTDREVALMMLMAYLSYMLAELFDLSGILTVFFCGIVMSHYTWHNVTESS  301

Query  1026  RVTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAA  847
             R+TT+H+FATLSF+AETFIFLYVGMDALDI+KW+ V +S G SVAVSSIL+GL+++GRAA
Sbjct  302   RITTKHTFATLSFLAETFIFLYVGMDALDIDKWRSVSDSPGTSVAVSSILIGLLMLGRAA  361

Query  846   FVFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAI  667
             FVFPLSFLSNL KKN S+KI+F+ Q++IWW+GLMRGAVS+ALAYNKFT++GHT L  NAI
Sbjct  362   FVFPLSFLSNLVKKNESEKINFKMQVVIWWSGLMRGAVSMALAYNKFTSAGHTDLRGNAI  421

Query  666   MItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQ  487
             MITST+TV LFSTVVFG++TKPLI  LLP  K   S       S+ ++PK   +PLLD  
Sbjct  422   MITSTITVCLFSTVVFGMLTKPLIRFLLPHQKATTS-----FLSDGNTPKSIQIPLLDQ-  475

Query  486   PDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPV  307
              DS  +      V RP ++R  L  PT TVH YWRKFDDSFMRPVFGGRGFVPFV GSP 
Sbjct  476   -DSFIEFTGNHNVPRPDSIRGFLTRPTRTVHYYWRKFDDSFMRPVFGGRGFVPFVPGSPT  534

Query  306   EQSP  295
             E+ P
Sbjct  535   ERDP  538



>ref|XP_010941780.1| PREDICTED: sodium/hydrogen exchanger 2-like [Elaeis guineensis]
Length=546

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/524 (76%), Positives = 445/524 (85%), Gaps = 3/524 (1%)
 Frame = -3

Query  1869  SDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggksshl  1690
             SDH SVVS+NLFVALLCACIV+GHLLEENRW+NESITAL IGLCTGV+ILL + G+S HL
Sbjct  21    SDHMSVVSINLFVALLCACIVIGHLLEENRWMNESITALFIGLCTGVIILLTTKGRSPHL  80

Query  1689  LVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIFK  1510
             LVFSE+LFFIYLLPPIIFNAGFQVKKK+FF NFMTIMLFGA+GTLIS +IIS GA+ I K
Sbjct  81    LVFSEELFFIYLLPPIIFNAGFQVKKKRFFRNFMTIMLFGAVGTLISFTIISLGAIGIIK  140

Query  1509  HLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFNA  1330
              +DI  L+ GDYLAIGAIF+ATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATS+VLF A
Sbjct  141   KMDIGDLETGDYLAIGAIFSATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSIVLFKA  200

Query  1329  IQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAlm  1150
             IQ+FD    D    L F+ NF YLF +ST LG   GL  AY+IKKLYFGRHSTDREVALM
Sbjct  201   IQNFDPGHADAVTVLKFVANFFYLFFTSTLLGAFAGLFSAYLIKKLYFGRHSTDREVALM  260

Query  1149  mlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETFI  970
             +LM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AE F+
Sbjct  261   ILMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAEIFL  320

Query  969   FLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSDK  790
             FLYVGMDALDIEKWK   NS G SVAVSSIL+G++L+GRAAFVFPLSFLSNL+KK+ ++K
Sbjct  321   FLYVGMDALDIEKWKLASNSPGKSVAVSSILLGMVLIGRAAFVFPLSFLSNLSKKSPNEK  380

Query  789   ISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGLM  610
             I+F+QQ+IIWWAGLMRGAVSIALAYNKF  +GHT L  NAIMITST+T+VLFSTVVFGLM
Sbjct  381   ITFKQQVIIWWAGLMRGAVSIALAYNKFARTGHTILRGNAIMITSTITIVLFSTVVFGLM  440

Query  609   TKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTAL  430
             TKPLI  L+PP  +  S   SM +SEP SPK F  PLL N   SE +  TG  V RPT+L
Sbjct  441   TKPLIRFLMPPSAKHLSRDLSM-SSEPPSPKSFLSPLLGNGQGSEVE--TGQNVPRPTSL  497

Query  429   RMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             RMLL  PT +VH YWRKFDD+ MRPVFGGRGFVPF  GSP E+S
Sbjct  498   RMLLTAPTRSVHHYWRKFDDAVMRPVFGGRGFVPFFPGSPAERS  541



>gb|AFQ00709.1| sodium/hydrogen exchanger 1 [Ipomoea batatas]
Length=537

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/543 (73%), Positives = 459/543 (85%), Gaps = 10/543 (2%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLFT-SDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M   + +LL   +L T S+H SVVS+NLFVAL+CACI++GHLLEE+RW+NES TAL IG+
Sbjct  1     MGVDVGTLLSKMNLLTTSNHGSVVSINLFVALICACIIIGHLLEESRWMNESTTALTIGI  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTGVVILL SGG SSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF N  TIMLFGA+G
Sbjct  61    CTGVVILLTSGGTSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNISTIMLFGALG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS  IIS GA+ IFK ++I  L+ GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISFIIISLGAIGIFKKMNIGSLEIGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATS+VLFNA+Q+FD+++ +  + L   GNFLYLF+ ST LGV  GLL AYII
Sbjct  181   FGEGVVNDATSIVLFNAVQNFDLSNINTLVVLQLFGNFLYLFILSTLLGVVAGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDRE+A+M+ M+YLSY+++ELF LS ILTVFF GIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREIAIMICMAYLSYMLSELFSLSAILTVFFSGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSF+AE FIFLYVGMDALDIEKWKFV +S G SV VSSIL+GL+LVGRAAFV
Sbjct  301   TTKHAFATLSFIAEIFIFLYVGMDALDIEKWKFVSDSPGTSVEVSSILLGLVLVGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
              PLSFLSNL KK+  +KI FRQQ IIWWAGLMRGAVS+ALAYN+FT SG+T L ENAIMI
Sbjct  361   SPLSFLSNLIKKSRGEKIGFRQQFIIWWAGLMRGAVSMALAYNQFTRSGYTQLRENAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFSTVVFGL+TKPLI +LLP  K +    S M +SEP +PK FTVPLLD++ D
Sbjct  421   TSTITVVLFSTVVFGLITKPLIRILLPSPKHL----SRMVSSEPVTPKSFTVPLLDSEVD  476

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
                  + G    RP +LRMLL TP+HT+H YWRKFDD+FMRPVFGGRGFVP+V GSP EQ
Sbjct  477   -----LDGHVPPRPNSLRMLLTTPSHTIHYYWRKFDDAFMRPVFGGRGFVPYVPGSPTEQ  531

Query  300   SPR  292
             + +
Sbjct  532   NEQ  534



>ref|XP_010904755.1| PREDICTED: sodium/hydrogen exchanger 2 [Elaeis guineensis]
Length=543

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/541 (74%), Positives = 458/541 (85%), Gaps = 4/541 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLFT-SDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MA  L S+L    +F+ SD  SVVS+NLFVALLCACIV+GHLLEENRW+NESITAL IGL
Sbjct  1     MAMDLGSVLIKMGVFSASDRISVVSINLFVALLCACIVIGHLLEENRWMNESITALFIGL  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTGVVILL + G+SSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA G
Sbjct  61    CTGVVILLTTQGRSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAAG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS  IIS GA++I K +DI  L  GDYLAIGAIF+ATDSVCTLQVLSQDETPLLYSLV
Sbjct  121   TLISFFIISLGAIEIIKKMDIGDLGIGDYLAIGAIFSATDSVCTLQVLSQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATS+VLFNAIQ+FD+   D    L F+ NF YLF +STFLGV  GLL AYII
Sbjct  181   FGEGVVNDATSIVLFNAIQNFDLGHIDAVTILKFVANFFYLFFTSTFLGVFAGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVALM+LM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVALMILMAYLSYMLAELLNLSGILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSF+AETF+FLYVGMDALDIEKW+FV +S   S+ VSSIL+G++L+GRAAFV
Sbjct  301   TTKHAFATLSFIAETFLFLYVGMDALDIEKWEFVSDSPRKSIGVSSILLGMVLIGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL+KK+ ++KI+FRQQ+I+WWAGLMRGAVSIALAYN+F  +GHT +  +A MI
Sbjct  361   FPLSFLSNLSKKHPNEKITFRQQVIVWWAGLMRGAVSIALAYNQFAQTGHTQVPGHAFMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFSTVVFGL+TKPLI  LLPP  +      SM +SEP++PK    PLL N   
Sbjct  421   TSTITVVLFSTVVFGLLTKPLIRFLLPPSTRQLCRDLSM-SSEPATPKCLISPLLGNGQG  479

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE +   G  + RPT+LRMLL  P+ +VHRYWRKFDD+FMRPVFGGRGFVPFV GSP E+
Sbjct  480   SEVE--AGLIIQRPTSLRMLLSAPSRSVHRYWRKFDDAFMRPVFGGRGFVPFVPGSPTER  537

Query  300   S  298
             S
Sbjct  538   S  538



>ref|XP_010524896.1| PREDICTED: sodium/hydrogen exchanger 2 [Tarenaya hassleriana]
 ref|XP_010524897.1| PREDICTED: sodium/hydrogen exchanger 2 [Tarenaya hassleriana]
 ref|XP_010524898.1| PREDICTED: sodium/hydrogen exchanger 2 [Tarenaya hassleriana]
Length=546

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/530 (76%), Positives = 459/530 (87%), Gaps = 11/530 (2%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVS++LFVALLC CIV+GHLLEENRW+NESITAL+IGL TG+VILL+SGGKS
Sbjct  18    LSTSDHASVVSLSLFVALLCGCIVIGHLLEENRWMNESITALLIGLGTGIVILLISGGKS  77

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI+LFGAIGT+ISC II+ G  +
Sbjct  78    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIILFGAIGTVISCVIITLGVTQ  137

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LD+   D GDYLAIGAIFAATDSVCTLQVL+QD+TPLLYSLVFGEGVVNDATSVVL
Sbjct  138   FFKKLDLGTFDLGDYLAIGAIFAATDSVCTLQVLNQDDTPLLYSLVFGEGVVNDATSVVL  197

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD++  + +  LHF+GNFLYLFL ST LGV  GL+ AY+IKKLYFGRHSTDREV
Sbjct  198   FNAIQSFDLSHLNHEAALHFLGNFLYLFLLSTLLGVATGLISAYVIKKLYFGRHSTDREV  257

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSFVAE
Sbjct  258   ALMMLMAYLSYMLAELFELSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFVAE  317

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAFVFPLSF+SNL+KKN 
Sbjct  318   TFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLVMLGRAAFVFPLSFISNLSKKNQ  377

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KI  +QQ++IWWAGLMRGAVS+ALAYNKFT SGHT L  NAIMITST+TV L ST+VF
Sbjct  378   SEKIDIKQQVVIWWAGLMRGAVSMALAYNKFTRSGHTELRGNAIMITSTITVCLVSTMVF  437

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPS--SPKHFTVPLLD-NQPDSESDMITGPEV  448
             G++TKPLI  LLP        H   TTS  S  +PK  T+ LLD  Q DS ++++  P+V
Sbjct  438   GMLTKPLIQFLLP--------HQKATTSMLSDDTPKSMTISLLDGEQQDSFAELVGTPDV  489

Query  447   ARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              RP ++R LL  PTHTVH YWRKFDD+FMRPVFGGRGFVPFV GSP E+S
Sbjct  490   PRPNSIRALLTRPTHTVHYYWRKFDDAFMRPVFGGRGFVPFVPGSPTERS  539



>ref|XP_008223097.1| PREDICTED: sodium/hydrogen exchanger 2-like [Prunus mume]
Length=544

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/550 (75%), Positives = 465/550 (85%), Gaps = 21/550 (4%)
 Frame = -3

Query  1917  MAFGLSSLLQNS--DLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             MA  +SSL + S   L TSDH SVVSMNLFVALLCACI+LGHLLEE+RW+NESITAL IG
Sbjct  1     MAVDVSSLSERSVEMLMTSDHTSVVSMNLFVALLCACILLGHLLEESRWMNESITALAIG  60

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             LCTGV+ILL +GGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIM FGA+
Sbjct  61    LCTGVIILLTTGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMTFGAV  120

Query  1563  GTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSL  1384
             GTLIS +IIS GA+  F   +I  L  GDYLA+GAIF+ATDSVCTLQVL+QDETPLLYSL
Sbjct  121   GTLISFAIISLGAMHFFHKFNIGSLKIGDYLALGAIFSATDSVCTLQVLNQDETPLLYSL  180

Query  1383  VFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYI  1204
             VFGEGVVNDATSVVLFNAIQSFD++  +    L FIGNF Y FL +       GLL AYI
Sbjct  181   VFGEGVVNDATSVVLFNAIQSFDLSHINTSTALQFIGNFFYFFLQA-------GLLSAYI  233

Query  1203  IKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  1024
             IKKLYFGRHSTDREVALM+LM+YLSYI++ELFYLS ILTVFFCGIVMSHYTWHNVTESSR
Sbjct  234   IKKLYFGRHSTDREVALMILMAYLSYILSELFYLSAILTVFFCGIVMSHYTWHNVTESSR  293

Query  1023  VTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAF  844
             VTT+H+FATLSFVAE FIFLYVGMDALDIEKWKFV +S G S+AVSSIL+ L+LVGRAAF
Sbjct  294   VTTKHTFATLSFVAEIFIFLYVGMDALDIEKWKFVSDSPGKSIAVSSILLALVLVGRAAF  353

Query  843   VFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIM  664
             VFPLSFL+NL KK+ SDKIS +QQ+ IWWAGLMRG+VS+ALAYN+FT SGHT L  NAIM
Sbjct  354   VFPLSFLTNLTKKSPSDKISLKQQVTIWWAGLMRGSVSMALAYNQFTRSGHTDLRANAIM  413

Query  663   ItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQP  484
             ITST+TVVLFSTVVFGLMTKPL+ +LLP  K +    SSM +SEPSSPK  TVPLL N+ 
Sbjct  414   ITSTITVVLFSTVVFGLMTKPLVRILLPSSKHI----SSMISSEPSSPKSITVPLLSNEQ  469

Query  483   DSE-------SDMITGP-EVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVP  328
             DSE       S+   GP  + RPT+LRMLL +P+HTVH YWRKFD++FMRPVFGGRGFVP
Sbjct  470   DSEVSLGVQDSEANHGPVNIPRPTSLRMLLSSPSHTVHHYWRKFDNAFMRPVFGGRGFVP  529

Query  327   FVAGSPVEQS  298
             +V GSPVEQ+
Sbjct  530   YVPGSPVEQN  539



>gb|AFM85232.1| Na+/H+ antiporter [Oryza coarctata]
 gb|AFN22080.1| Na+/H+ antiporter [Oryza coarctata]
Length=539

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/525 (76%), Positives = 448/525 (85%), Gaps = 9/525 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSD+ASVVS+NLFVALLC CIVLGHLLEENRWVNESITALIIGLCTGVVILL + GKSSH
Sbjct  19    TSDYASVVSINLFVALLCGCIVLGHLLEENRWVNESITALIIGLCTGVVILLTTKGKSSH  78

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             + VFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GT+IS   I+  A+ IF
Sbjct  79    IFVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTMISFFTIAIAAIAIF  138

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
               ++I  LD GD+LAIGAIF+ATDSVCTLQVL+QDETP LYSLVFGEGVVNDATS+VLFN
Sbjct  139   SRMNIGTLDVGDFLAIGAIFSATDSVCTLQVLNQDETPFLYSLVFGEGVVNDATSIVLFN  198

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+Q+FD+   D  + L F+GNF YLFLSSTFLGV  GLL A+IIKKLY GRHSTDREVAL
Sbjct  199   ALQNFDLVHIDVAVVLKFLGNFFYLFLSSTFLGVFAGLLSAFIIKKLYIGRHSTDREVAL  258

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF
Sbjct  259   MMLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETF  318

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDIEKW+F  +S G S+ +SSIL+GL+LVGRAAFVFPLSFLSNL KK   +
Sbjct  319   LFLYVGMDALDIEKWEFASDSPGKSIGISSILLGLVLVGRAAFVFPLSFLSNLTKKAPYE  378

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI++RQQI+IWWAGLMRGAVSIALAYNKFT SGHT LH NAIMITST+TVVLFST+VFG+
Sbjct  379   KITWRQQIVIWWAGLMRGAVSIALAYNKFTRSGHTQLHGNAIMITSTITVVLFSTMVFGM  438

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             MTKPLI LLLP      S H+   TSEPSSPK    PLL +     SD+ +   + RP++
Sbjct  439   MTKPLIRLLLP-----ASSHT--VTSEPSSPKSLNSPLLTSMQG--SDLESSTHIVRPSS  489

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             LRMLL  PTHTVH YWRKFDD+ MRP+FGGRGFVPF  GSP EQS
Sbjct  490   LRMLLSKPTHTVHYYWRKFDDALMRPMFGGRGFVPFSPGSPTEQS  534



>emb|CDO98922.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/542 (73%), Positives = 463/542 (85%), Gaps = 9/542 (2%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLF--TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             M F L +LL   ++   TSDH SVVS+N+F+ LLC CIV+GHLLEENRW+NESITALIIG
Sbjct  1     MGFELGALLGKMNILSSTSDHTSVVSLNVFIVLLCICIVIGHLLEENRWMNESITALIIG  60

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             +CTGVVILL+SGG SSHLLVFSEDLFFIY+LPPIIFNAGFQVKKKQFF NF+TIMLFGA+
Sbjct  61    VCTGVVILLISGGTSSHLLVFSEDLFFIYMLPPIIFNAGFQVKKKQFFRNFITIMLFGAL  120

Query  1563  GTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSL  1384
             GTLIS  IIS GA+  F++++++ L  GD+LAIGAIF+ATDSVCTLQVL+QDETPLLYSL
Sbjct  121   GTLISFVIISLGAIGFFENMNLEPLKIGDFLAIGAIFSATDSVCTLQVLNQDETPLLYSL  180

Query  1383  VFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYI  1204
             VFGEGVVNDATS+V+FNA+Q+FD++  +  + L  IGNF+YLF++ST LGV  GLL A+I
Sbjct  181   VFGEGVVNDATSIVIFNAVQNFDLSHVNTSVALKLIGNFIYLFITSTLLGVVAGLLSAFI  240

Query  1203  IKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  1024
             IKKLYFGRHSTDREVALMMLM+YLSY++AELF LS ILTVFFCGIVMSHYTWHNVTESSR
Sbjct  241   IKKLYFGRHSTDREVALMMLMAYLSYMLAELFDLSAILTVFFCGIVMSHYTWHNVTESSR  300

Query  1023  VTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAF  844
             +TT+H+FATLSFVAE FIFLYVGMDALDI+KWK V +S   S+ VSSIL+GL+L+GRAAF
Sbjct  301   ITTKHAFATLSFVAEIFIFLYVGMDALDIDKWKIVSDSPKTSIKVSSILLGLVLLGRAAF  360

Query  843   VFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIM  664
             VFPLS LSNL KK+  +KI F+QQ+ IWWAGLMRGA+S+ALAYN+FT +G+T L  N+IM
Sbjct  361   VFPLSLLSNLTKKSPEEKIHFKQQVTIWWAGLMRGAISMALAYNQFTRAGYTKLPGNSIM  420

Query  663   ItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQP  484
             ITST+TVVLFSTVVFGLMTKPLI LLLP  K +    S M +SEP +PK F VPLL+ Q 
Sbjct  421   ITSTITVVLFSTVVFGLMTKPLIRLLLPSPKHL----SRMISSEPITPKSFIVPLLNGQ-  475

Query  483   DSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             DSE D   G  V RP++LRML+  P+HTVH YWRKFDD+FMRPVFGGRGFVP+V GSP E
Sbjct  476   DSEGD--PGAHVPRPSSLRMLMTAPSHTVHYYWRKFDDAFMRPVFGGRGFVPYVPGSPTE  533

Query  303   QS  298
             Q+
Sbjct  534   QN  535



>ref|XP_011071486.1| PREDICTED: sodium/hydrogen exchanger 2-like [Sesamum indicum]
 ref|XP_011071487.1| PREDICTED: sodium/hydrogen exchanger 2-like [Sesamum indicum]
 ref|XP_011071488.1| PREDICTED: sodium/hydrogen exchanger 2-like [Sesamum indicum]
Length=556

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/551 (72%), Positives = 457/551 (83%), Gaps = 16/551 (3%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC  1738
             M F   +++    L TSDHASVVS+ LFV LLC CIV+GHLLEENRW+NESI ALIIGL 
Sbjct  1     MGFESGTIIDPVKLATSDHASVVSITLFVTLLCTCIVIGHLLEENRWMNESIIALIIGLG  60

Query  1737  TGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGT  1558
             TGV ILL+SGGKSSHL++FSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIM+FGA+GT
Sbjct  61    TGVFILLVSGGKSSHLMLFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIMMFGALGT  120

Query  1557  LISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVF  1378
             LIS  IIS GA+  F  +DID L  GD+LAIGAIFAATDSVCTLQVLSQDETPLLYSLVF
Sbjct  121   LISFIIISLGAIAFFGKMDID-LAIGDFLAIGAIFAATDSVCTLQVLSQDETPLLYSLVF  179

Query  1377  GEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIK  1198
             GEGVVNDATSVVLFNA+Q FD++  +  I L  IGNF YLF++ST LGV  GLL AY+IK
Sbjct  180   GEGVVNDATSVVLFNAVQDFDLSHINTGIALQLIGNFFYLFITSTALGVVAGLLSAYVIK  239

Query  1197  KLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT  1018
             KLYFGRHSTDREVA+MML++YLSY++AELFYLSGILTVFFCGIVMSHYTWHN+TE+SR+T
Sbjct  240   KLYFGRHSTDREVAIMMLLAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNITENSRIT  299

Query  1017  TRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVF  838
             T+H+FATLSFVAETFIFLYVGMDALD+EKWK V +S   S++VS+ L+GL+LVGRAAFVF
Sbjct  300   TKHTFATLSFVAETFIFLYVGMDALDMEKWKVVSDSPKTSISVSATLLGLVLVGRAAFVF  359

Query  837   PLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMIt  658
             PLSFLSNL KK+  DKI F++QI IWWAGLMRGAVS+ALAYN+FT +GHT L  NAI+IT
Sbjct  360   PLSFLSNLTKKSPYDKIDFKKQITIWWAGLMRGAVSMALAYNQFTRAGHTQLRGNAILIT  419

Query  657   stvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDS  478
             ST+TVVLFSTVVFGLMTKPL+ LL+P  KQ+    S M +SEP +PK F VPLL    DS
Sbjct  420   STITVVLFSTVVFGLMTKPLVRLLMPSSKQL----SRMMSSEPLTPKSFNVPLLGESMDS  475

Query  477   ESDMITGPEVA-----------RPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFV  331
             E ++  G  +            RP+ LRMLL TPT TVH YWRKFDD+FMRPVFGGRGF 
Sbjct  476   EGELFGGNGLGSDAHGSGQGGVRPSRLRMLLTTPTRTVHYYWRKFDDAFMRPVFGGRGFA  535

Query  330   PFVAGSPVEQS  298
             P+V GSP E++
Sbjct  536   PYVPGSPTEEN  546



>gb|ABU49649.1| Na+/H+ antiporter [Salsola soda]
Length=559

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/537 (76%), Positives = 457/537 (85%), Gaps = 15/537 (3%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVSMNLFVALLC CIV+GHLLEENRW NESITAL+IGL TG++ILL+SGG+SSH
Sbjct  18    TSDHASVVSMNLFVALLCGCIVIGHLLEENRWTNESITALLIGLSTGIIILLISGGESSH  77

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI+LFGAIGTL+S  IIS G++ IF
Sbjct  78    LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIILFGAIGTLVSFIIISLGSIAIF  137

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             + +DI  L+ GD LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  138   QKMDIGSLELGDLLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  197

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQ+FD+T  D +I L F GNFLYLF +ST LG   GLL AY+IKKLYFGRHSTDREVAL
Sbjct  198   AIQNFDLTHIDHRIALQFSGNFLYLFFASTLLGAMTGLLSAYVIKKLYFGRHSTDREVAL  257

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNV ESSRVTT+H+FATLSFVAE F
Sbjct  258   MMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVIESSRVTTKHAFATLSFVAEIF  317

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAFVFPLS L N +KK+SS+
Sbjct  318   LFLYVGMDALDIEKWRFVSDSPGTSVAVSSILLGLLMLGRAAFVFPLSLLMNFSKKSSSE  377

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KISF QQI+IWWAGLMRGAVS+ALAYN+FT +GHT L  NAIMITST+TVVLFST+VFGL
Sbjct  378   KISFNQQIVIWWAGLMRGAVSMALAYNQFTRAGHTQLRGNAIMITSTITVVLFSTMVFGL  437

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPE------  451
             +TKPLI  LLP  K      S+ T S+  SPK F  PLL+   D+E D+    E      
Sbjct  438   LTKPLILFLLPHPKHFS---STSTVSDLGSPKAFFAPLLEGTQDTEVDVGNHDEETHHDE  494

Query  450   ------VARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
                   +ARP++LRMLL  PTHTVH YWRKFDDSFMRPVFGGRGFVPFV GSP EQS
Sbjct  495   ETNFRPIARPSSLRMLLNAPTHTVHHYWRKFDDSFMRPVFGGRGFVPFVPGSPTEQS  551



>ref|XP_004144972.1| PREDICTED: sodium/hydrogen exchanger 2-like [Cucumis sativus]
 ref|XP_004153971.1| PREDICTED: sodium/hydrogen exchanger 2-like [Cucumis sativus]
 gb|KGN46191.1| hypothetical protein Csa_6G067980 [Cucumis sativus]
Length=553

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/523 (74%), Positives = 444/523 (85%), Gaps = 16/523 (3%)
 Frame = -3

Query  1869  SDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggksshl  1690
             +DH SVVS+NLFVALLC CIV+GHLLEENRW+NESITAL+IGLCTG++IL+ + GKSSHL
Sbjct  22    ADHTSVVSLNLFVALLCGCIVIGHLLEENRWINESITALVIGLCTGIIILVTTRGKSSHL  81

Query  1689  LVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIFK  1510
              +F+E+LFFIYLLPPIIFNAGFQVKKKQFF N MTI+LFGA GTLIS  IIS GA+  F+
Sbjct  82    FLFNEELFFIYLLPPIIFNAGFQVKKKQFFRNIMTIVLFGAFGTLISFCIISLGALHFFQ  141

Query  1509  HLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFNA  1330
              ++I  LD GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFNA
Sbjct  142   KMNIGSLDLGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFNA  201

Query  1329  IQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAlm  1150
             IQ+FD++  +  I L FIGNFLYLFL+ST LG+ +GLL AYIIKKLYFGRHSTDREVALM
Sbjct  202   IQNFDVSHMNSSIVLQFIGNFLYLFLASTVLGILVGLLSAYIIKKLYFGRHSTDREVALM  261

Query  1149  mlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETFI  970
             +LM+Y SY++AELFYLS ILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE FI
Sbjct  262   ILMAYFSYMLAELFYLSAILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVAEIFI  321

Query  969   FLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSDK  790
             FLYVGMDALDIEKW+FV +S G S+ VSSIL+GL+LVGRAAFVFPLS LSNL KK S +K
Sbjct  322   FLYVGMDALDIEKWRFVSHSPGKSIGVSSILLGLVLVGRAAFVFPLSSLSNLTKKFSHEK  381

Query  789   ISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGLM  610
             ++  QQ+ IWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST+TVVL STVVFG+M
Sbjct  382   LNLEQQVTIWWAGLMRGAVSMALAYNQFTRSGHTHLPGNAIMITSTITVVLSSTVVFGMM  441

Query  609   TKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTAL  430
             TKPLI +LLP     P    SM +SEPSSPK FT+PLLDN  ++            P+ L
Sbjct  442   TKPLIGILLP----QPKYTMSMLSSEPSSPKSFTIPLLDNDQNT------------PSPL  485

Query  429   RMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
              + LR P+HTVH YWR+FDD+FMRPVFGGRGFVPFV GSP E 
Sbjct  486   DLFLRIPSHTVHHYWRRFDDAFMRPVFGGRGFVPFVPGSPTED  528



>ref|NP_001267815.1| nhx1 antiporter [Vitis vinifera]
 gb|AAV36562.1| nhx1 antiporter [Vitis vinifera]
Length=541

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/539 (75%), Positives = 454/539 (84%), Gaps = 6/539 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLF-TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M F L S++    +  TSDH+SVVSMNLFVALLCACIV+ H LEE RW+NESITAL +GL
Sbjct  1     MGFELGSVVMKLGMVSTSDHSSVVSMNLFVALLCACIVVDHWLEEYRWMNESITALALGL  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTG++ILL + GKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF  FMTIMLFGAIG
Sbjct  61    CTGIIILLTTRGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRTFMTIMLFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             T IS  IIS GA+  FK + I   D  D LA+G IF+ATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TXISFGIISLGAIHFFKKMKIGSXDIEDXLALGXIFSATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD++  D  I L FIGNFLYLF++ST LGV  GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIQSFDLSHIDSSIALQFIGNFLYLFITSTMLGVFAGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVA+M+LM+YLSY++AELFYLS ILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVAIMILMAYLSYMLAELFYLSAILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSFVAE FIFLYVGMDALDIEKW+FV +S G S+ VSSIL+GL+LV RAAFV
Sbjct  301   TTKHAFATLSFVAEIFIFLYVGMDALDIEKWRFVSDSPGKSIGVSSILLGLVLVERAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL KK+SS+KI   QQ+ IWWAGLMRGAVS+ALAYN+FT +GHT L  NAIMI
Sbjct  361   FPLSFLSNLTKKSSSEKIHIEQQVTIWWAGLMRGAVSMALAYNQFTRAGHTQLRGNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST++VVLFSTVVFGLMTKPL+ LLLP     P   SSM +SEPSSPK+  VPL+ N  +
Sbjct  421   TSTISVVLFSTVVFGLMTKPLVRLLLPS----PKPFSSMISSEPSSPKYLVVPLIGNGEE  476

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             +E+D      V RPT+LRMLL TP+HTVH YWRKFDDSFMRPVFGGRGF PF+ GSP E
Sbjct  477   TETDQ-ASQNVPRPTSLRMLLSTPSHTVHHYWRKFDDSFMRPVFGGRGFTPFIPGSPTE  534



>ref|XP_011090859.1| PREDICTED: sodium/hydrogen exchanger 1-like [Sesamum indicum]
 ref|XP_011090860.1| PREDICTED: sodium/hydrogen exchanger 1-like [Sesamum indicum]
Length=557

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/552 (72%), Positives = 459/552 (83%), Gaps = 17/552 (3%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLF-TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M F   ++ +  ++  TSDH SVVS+NLFV LLCACIV+GHLLEENRW+NESITALIIG+
Sbjct  1     MGFDSGTMFETMNMLSTSDHTSVVSINLFVTLLCACIVIGHLLEENRWMNESITALIIGV  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
              TGVVILL+SGGKSSHL+VFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+G
Sbjct  61    GTGVVILLISGGKSSHLMVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS  IIS GA+  F+ +D+  L  GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISFIIISLGAITFFRKMDVG-LAIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  179

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNA+Q+FD++  +  +    IGNF+YLF++ST LGV  GLL AYII
Sbjct  180   FGEGVVNDATSVVLFNAVQNFDLSHINTSVAFQLIGNFIYLFITSTVLGVVAGLLSAYII  239

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVA+MMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTE+SRV
Sbjct  240   KKLYFGRHSTDREVAIMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTENSRV  299

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSFVAE FIFLYVGMDALDIEKW+ V +S   S++VS+ L+GLILV RAAFV
Sbjct  300   TTKHTFATLSFVAEIFIFLYVGMDALDIEKWRVVSDSPKTSISVSATLLGLILVARAAFV  359

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNLAKK+  +KI F+QQI IWWAGLMRGAVS+ALAYN+FT +GHT    NA MI
Sbjct  360   FPLSFLSNLAKKSPYEKIDFKQQITIWWAGLMRGAVSMALAYNQFTRAGHTQERGNAFMI  419

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFSTVVFGL+TKPL+  L+P  KQ+    +SM +SE  +P  F VPLL    D
Sbjct  420   TSTITVVLFSTVVFGLLTKPLVRFLMPSSKQL----TSMISSESLTPNSFIVPLLGEGQD  475

Query  480   SESDMIT-----------GPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGF  334
             S +++ T           G  V RP++LRMLL  PT TVH YWRKFDD+FMRPVFGGRGF
Sbjct  476   SVAELFTGNGQVSEASEGGRSVPRPSSLRMLLTKPTRTVHYYWRKFDDAFMRPVFGGRGF  535

Query  333   VPFVAGSPVEQS  298
             VP+V GSP E++
Sbjct  536   VPYVPGSPTERN  547



>emb|CDY19707.1| BnaA09g03600D [Brassica napus]
Length=531

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/528 (75%), Positives = 446/528 (84%), Gaps = 7/528 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L  SDHASVVS+NLFVALLCACIVLGHLLEENRW+NESITAL+IGL TGVVILL+S GKS
Sbjct  4     LSASDHASVVSLNLFVALLCACIVLGHLLEENRWMNESITALLIGLATGVVILLISNGKS  63

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGAIGT++SC++I+ G  +
Sbjct  64    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGAIGTVVSCTVITLGVTQ  123

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI   D GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVV+
Sbjct  124   FFKKLDIGTFDLGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVV  183

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T  + +     +GNF YLFL ST LGV  GL+ AYIIKKLYFGRHSTDREV
Sbjct  184   FNAIQSFDLTHLNHEAAFRLLGNFFYLFLLSTLLGVATGLISAYIIKKLYFGRHSTDREV  243

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AE
Sbjct  244   ALMMLMAYLSYMLAELFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATLSFLAE  303

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDI+KW+ V +S G SVAVSSIL+GL+++GRAAFVFPLSFLSNLAKKN 
Sbjct  304   TFIFLYVGMDALDIDKWRSVSDSPGTSVAVSSILIGLLMLGRAAFVFPLSFLSNLAKKNQ  363

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KI F+ Q++IWW+GLMRGAVS+ALAYNKFT +G T L  NAIMITST+TV LFSTVVF
Sbjct  364   SEKIDFKMQVVIWWSGLMRGAVSMALAYNKFTRAGKTDLRGNAIMITSTITVCLFSTVVF  423

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             G++TKPLI  LLP  K   S       S+ ++PK   +PL+D   DS  +      V RP
Sbjct  424   GMLTKPLIRFLLPHQKATTS-----FLSDGNTPKSIQIPLIDQ--DSFIEFAGNHNVPRP  476

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
              ++R  L  PT TVH YWR+FDDSFMRPVFGGRGFVPFV GSP E+ P
Sbjct  477   DSIRGFLTRPTRTVHYYWRQFDDSFMRPVFGGRGFVPFVPGSPTERDP  524



>ref|XP_006299163.1| hypothetical protein CARUB_v10015306mg [Capsella rubella]
 gb|EOA32061.1| hypothetical protein CARUB_v10015306mg [Capsella rubella]
Length=539

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/528 (75%), Positives = 446/528 (84%), Gaps = 12/528 (2%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVS+NLFVALLCACIV+GHLLEENRW+NESITAL+IGLCTGVVILLLS GK+
Sbjct  16    LSTSDHASVVSLNLFVALLCACIVIGHLLEENRWMNESITALLIGLCTGVVILLLSRGKN  75

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIM FGAIGT++SC+IIS GA++
Sbjct  76    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMAFGAIGTVVSCTIISLGAIQ  135

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI   D GD+LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  136   FFKKLDIGTFDLGDFLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  195

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T  + +    F+GNFLYLFL ST LGV  GL+ AY+IKKLYFGRHSTDREV
Sbjct  196   FNAIQSFDLTHLNHEAAFKFLGNFLYLFLLSTLLGVATGLISAYVIKKLYFGRHSTDREV  255

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AE
Sbjct  256   ALMMLMAYLSYMLAELFALSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATLSFLAE  315

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDIEKW+FV +S G SVAVSSIL+GL+++GRAAFVFPLSFLSNL+KKN 
Sbjct  316   TFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILMGLVMLGRAAFVFPLSFLSNLSKKNQ  375

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KI  +QQI+IWWAGLMRGAVS+ALAYNKFT SGHT L  NAIMI          TVVF
Sbjct  376   SEKIDIKQQIVIWWAGLMRGAVSMALAYNKFTRSGHTELRGNAIMI------TSTITVVF  429

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLD-NQPDSESDMITGPEVAR  442
             G++TKPLI  L+P  K   S       S+ ++PK   +PLLD  Q DS     T  ++ R
Sbjct  430   GMLTKPLIRYLMPHQKATTS-----MLSDDNTPKSINIPLLDGEQLDSFELPGTHQDLPR  484

Query  441   PTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             P +LR  L  PT TVH YWR+FDD+FMRPVFGGRGFVPFV GSP E+S
Sbjct  485   PNSLRGFLMRPTRTVHHYWRQFDDAFMRPVFGGRGFVPFVPGSPTERS  532



>emb|CDY00002.1| BnaC09g02990D [Brassica napus]
Length=535

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/528 (74%), Positives = 446/528 (84%), Gaps = 7/528 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L  SDHASVVS+NLFVALLCACIVLGHLLEENRW+NESITAL+IGL TGVVILL+S GKS
Sbjct  8     LSASDHASVVSLNLFVALLCACIVLGHLLEENRWMNESITALLIGLATGVVILLISNGKS  67

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGAIGT++SC++I+ G  +
Sbjct  68    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGAIGTVVSCTVITLGVTQ  127

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI   D GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVV+
Sbjct  128   FFKKLDIGTFDLGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVV  187

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T  + +     +GNF YLFL ST LGV  GL+ AY+IKKLYFGRHSTDREV
Sbjct  188   FNAIQSFDLTHLNHEAAFRLLGNFFYLFLLSTLLGVATGLISAYVIKKLYFGRHSTDREV  247

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AE
Sbjct  248   ALMMLMAYLSYMLAELFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATLSFLAE  307

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDI+KW+ V +S G SVAVSSIL+GL+++GRAAFVFPLSFLSNLAKKN 
Sbjct  308   TFIFLYVGMDALDIDKWRSVSDSPGTSVAVSSILIGLLMLGRAAFVFPLSFLSNLAKKNQ  367

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KI F+ Q++IWW+GLMRGAVS+ALAYNKFT +G T L  NAIMITST+TV LFSTVVF
Sbjct  368   SEKIDFKMQVVIWWSGLMRGAVSMALAYNKFTRAGKTDLRGNAIMITSTITVCLFSTVVF  427

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             G++TKPLI  LLP  K   S       S+ ++PK   +PL+D   DS  +      V RP
Sbjct  428   GMLTKPLIRFLLPHQKATTS-----FLSDGNTPKSIQIPLIDQ--DSFIEFAGNHNVPRP  480

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
              ++R  L  PT TVH YWR+FDDSFMRPVFGGRGFVPFV GSP E+ P
Sbjct  481   DSIRGFLTRPTRTVHYYWRQFDDSFMRPVFGGRGFVPFVPGSPTEREP  528



>ref|XP_009111931.1| PREDICTED: sodium/hydrogen exchanger 1 [Brassica rapa]
Length=543

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/528 (74%), Positives = 446/528 (84%), Gaps = 7/528 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L  SDHASVVS+NLFVALLCACIVLGHLLEENRW+NESITAL+IGL TGVVILL+S GKS
Sbjct  16    LSASDHASVVSLNLFVALLCACIVLGHLLEENRWMNESITALLIGLATGVVILLISNGKS  75

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGAIGT++SC++I+ G  +
Sbjct  76    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGAIGTVVSCTVITLGVTQ  135

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI   D GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVV+
Sbjct  136   FFKKLDIGTFDLGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVV  195

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T  + +     +GNF YLFL ST LGV  GL+ AYIIKKLYFGRHSTDREV
Sbjct  196   FNAIQSFDLTHLNHEAAFRLLGNFFYLFLLSTLLGVATGLISAYIIKKLYFGRHSTDREV  255

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AE
Sbjct  256   ALMMLMAYLSYMLAELFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATLSFLAE  315

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDI+KW+ V +S G SVAVSSIL+GL+++GRAAFVFPLSFLSNLAKKN 
Sbjct  316   TFIFLYVGMDALDIDKWRSVSDSPGTSVAVSSILIGLLMLGRAAFVFPLSFLSNLAKKNQ  375

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S++I F+ Q++IWW+GLMRGAVS+ALAYNKFT +G T L  NAIMITST+TV LFSTVVF
Sbjct  376   SERIDFKMQVVIWWSGLMRGAVSMALAYNKFTRAGKTDLRGNAIMITSTITVCLFSTVVF  435

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             G++TKPLI  LLP  K   S       S+ ++PK   +PL+D   DS  +      V RP
Sbjct  436   GMLTKPLIRFLLPHQKATTS-----FLSDGNTPKSIQIPLIDQ--DSFIEFAGNHNVPRP  488

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
              ++R  L  PT TVH YWR+FDDSFMRPVFGGRGFVPFV GSP E+ P
Sbjct  489   DSIRGFLTRPTRTVHYYWRQFDDSFMRPVFGGRGFVPFVPGSPTERDP  536



>ref|XP_006658079.1| PREDICTED: sodium/hydrogen exchanger 2-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006658080.1| PREDICTED: sodium/hydrogen exchanger 2-like isoform X2 [Oryza 
brachyantha]
Length=537

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/525 (76%), Positives = 444/525 (85%), Gaps = 10/525 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSD+ASV S+NLFVALLC CIVLGHLLEENRWVNESITALIIGLCTGVVILL + GKSSH
Sbjct  18    TSDYASVSSINLFVALLCTCIVLGHLLEENRWVNESITALIIGLCTGVVILLTTKGKSSH  77

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             + VFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GT+IS   I+  A+ IF
Sbjct  78    IFVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTMISFFTIAIAAIAIF  137

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
               ++I  LD GD+LAIGAIF+ATDSVCTLQVL+QDETP LYSLVFGEGVVNDATS+VLFN
Sbjct  138   SRMNIGTLDVGDFLAIGAIFSATDSVCTLQVLNQDETPFLYSLVFGEGVVNDATSIVLFN  197

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+Q+ D+   D  + L F+GNF YLFLSSTFLGV  GLL AYIIKKLY GRHSTDREVAL
Sbjct  198   ALQNLDLVHIDAAVVLKFLGNFFYLFLSSTFLGVFAGLLSAYIIKKLYIGRHSTDREVAL  257

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF
Sbjct  258   MMLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETF  317

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDIEKW+F  +S G SV +SSIL+GL+L+GRAAFVFPLSFLSNL KK  ++
Sbjct  318   LFLYVGMDALDIEKWEFASDSPGKSVGISSILLGLVLLGRAAFVFPLSFLSNLTKKAPNE  377

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI++RQQI+IWWAGLMRGAVSIALAYNKFT SGHT LH NAIMITST+TVVLFST+VFG+
Sbjct  378   KITWRQQIVIWWAGLMRGAVSIALAYNKFTRSGHTQLHGNAIMITSTITVVLFSTMVFGM  437

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             MTKPLI LLLP         SS   SEPSSPK    PLL +     SD+     + RP++
Sbjct  438   MTKPLIRLLLPA--------SSHAVSEPSSPKSLHSPLLTSMQG--SDLENSAHIVRPSS  487

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             LRMLL  PTHTVH YWRKFDD+ MRP+FGGRGFVPF  GSP EQS
Sbjct  488   LRMLLSKPTHTVHYYWRKFDDALMRPMFGGRGFVPFSPGSPTEQS  532



>dbj|BAC56698.1| sodium/proton antiporter [Hordeum vulgare]
 dbj|BAK02334.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=538

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/541 (74%), Positives = 452/541 (84%), Gaps = 12/541 (2%)
 Frame = -3

Query  1917  MAFGL--SSLLQNSD-LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALII  1747
             MAF +  + L + SD L TSDHASVVS+NLFVALLCACIVLGHLLEENRW+NESITALII
Sbjct  1     MAFEVVAAQLARLSDALATSDHASVVSINLFVALLCACIVLGHLLEENRWLNESITALII  60

Query  1746  GLCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGA  1567
             GLCTGVVIL+ + GKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA
Sbjct  61    GLCTGVVILMTTKGKSSHVLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGA  120

Query  1566  IGTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYS  1387
             +GT+IS   IS  A+ IF  ++I  LD  D+LAIGAIF+ATDSVCTLQVL+QDETP LYS
Sbjct  121   VGTMISFFTISLAAIAIFSKMNIGTLDVSDFLAIGAIFSATDSVCTLQVLNQDETPFLYS  180

Query  1386  LVFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAY  1207
             LVFGEGVVNDATSVVLFNA+Q+FD    D  + L F+GNF YLF+SSTFLGV  GLL AY
Sbjct  181   LVFGEGVVNDATSVVLFNALQNFDPNQIDAIVILKFLGNFCYLFVSSTFLGVFSGLLSAY  240

Query  1206  IIKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESS  1027
             IIKKLY GRHSTDREVALMMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESS
Sbjct  241   IIKKLYIGRHSTDREVALMMLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESS  300

Query  1026  RVTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAA  847
             RVTT+H+FATLSF+AETF+FLYVGMDALDIEKWKF  +S G S+ +SSIL+GL+LVGRAA
Sbjct  301   RVTTKHAFATLSFIAETFLFLYVGMDALDIEKWKFASDSPGKSIGISSILLGLVLVGRAA  360

Query  846   FVFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAI  667
             FVFPLSFLSNL KK   +KIS+RQQI+IWWAGLMRGAVSIALAYNKFT SGHT LH NAI
Sbjct  361   FVFPLSFLSNLTKKTELEKISWRQQIVIWWAGLMRGAVSIALAYNKFTRSGHTQLHGNAI  420

Query  666   MItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQ  487
             MITST+TVVLFST++FG++TKPLI  LLP         S+   SEPSSPK    PLL + 
Sbjct  421   MITSTITVVLFSTMLFGILTKPLIRFLLP-------ASSNGDPSEPSSPKSLHSPLLTSM  473

Query  486   PDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPV  307
                 SDM     + RP++LRML+  PTHT+H YWRKFDD+ MRP+FGGRGFVP+  GSP 
Sbjct  474   LG--SDMEAPLPIVRPSSLRMLITKPTHTIHYYWRKFDDALMRPMFGGRGFVPYSPGSPT  531

Query  306   E  304
             +
Sbjct  532   D  532



>ref|NP_001284448.1| uncharacterized protein LOC103497886 [Cucumis melo]
 gb|ACO90356.1| Na+/H+ antiporter [Cucumis melo]
Length=553

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/523 (74%), Positives = 443/523 (85%), Gaps = 16/523 (3%)
 Frame = -3

Query  1869  SDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggksshl  1690
             +DH SVVS+NLFVALLC CIV+GHLLEENRW+NESITAL+IGLCTG++IL+ + GKSSHL
Sbjct  22    ADHTSVVSLNLFVALLCGCIVVGHLLEENRWINESITALVIGLCTGIIILVTTRGKSSHL  81

Query  1689  LVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIFK  1510
              +F+E LFFIYLLPPIIFNAGFQVKKKQFF N MT++LFGA GTLIS  IIS GA+  F+
Sbjct  82    FLFNEGLFFIYLLPPIIFNAGFQVKKKQFFRNIMTMVLFGAFGTLISFCIISLGALHFFQ  141

Query  1509  HLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFNA  1330
              ++I  LD GDYLAIGAIF+ATDSVCTLQ+L+QDETPLLYSLVFGEGVVNDATSVVLFNA
Sbjct  142   KMNIGSLDLGDYLAIGAIFSATDSVCTLQILNQDETPLLYSLVFGEGVVNDATSVVLFNA  201

Query  1329  IQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAlm  1150
             IQ+FD++  +  I L FIGNFLYLFL+ST LG+ +GLL AYIIKKLYFGRHSTDREVALM
Sbjct  202   IQNFDVSHMNSSIVLQFIGNFLYLFLASTVLGIFVGLLSAYIIKKLYFGRHSTDREVALM  261

Query  1149  mlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETFI  970
             +LM+Y SY++AELFYLS ILTVFFCGIVMSHYTWHN TESSRVTT+H+FATLSFVAE FI
Sbjct  262   ILMAYFSYMLAELFYLSAILTVFFCGIVMSHYTWHNATESSRVTTKHAFATLSFVAEIFI  321

Query  969   FLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSDK  790
             FLYVGMDALDIEKW+FV +S G S+ VSSIL+GL+LVGRAAFVFPLS LSNL KK+S +K
Sbjct  322   FLYVGMDALDIEKWRFVSHSPGKSIGVSSILLGLVLVGRAAFVFPLSSLSNLTKKSSHEK  381

Query  789   ISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGLM  610
             ++  QQ+ IWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST+TVVL STVVFG+M
Sbjct  382   LNLEQQVTIWWAGLMRGAVSMALAYNQFTRSGHTHLPGNAIMITSTITVVLSSTVVFGMM  441

Query  609   TKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTAL  430
             TKPLI +LLP     P    SM +SEPSSPK FTVPLLDN  ++            P+ L
Sbjct  442   TKPLIGILLP----QPKYTMSMLSSEPSSPKSFTVPLLDNDQNT------------PSPL  485

Query  429   RMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
              + LR P+HTVH YWR+FDD+FMRPVFGGRGFVPFV GSP E 
Sbjct  486   DLFLRIPSHTVHHYWRRFDDAFMRPVFGGRGFVPFVPGSPTED  528



>ref|NP_001267987.1| sodium/hydrogen exchanger 2-like [Vitis vinifera]
 gb|ACY03397.1| putative NHX2 antiporter isoform 1 [Vitis vinifera]
 gb|ACY03398.1| putative NHX2 antiporter isoform 2 [Vitis vinifera]
 gb|ACY03399.1| putative NHX2 antiporter isoform 3 [Vitis vinifera]
Length=538

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/539 (75%), Positives = 456/539 (85%), Gaps = 9/539 (2%)
 Frame = -3

Query  1908  GLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGV  1729
             GL+SL       TSD  S+ ++ LFVALLCACIV+GHLLEE RW+NESITAL IGLCTG+
Sbjct  2     GLNSLAGLGMRSTSDQVSIDAITLFVALLCACIVIGHLLEEYRWMNESITALFIGLCTGI  61

Query  1728  VIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLIS  1549
             V+LL +GGK S +L+F+E+LFFIYLLPPIIFNAGFQVKKKQFF NFMTI+LFGAIGTLIS
Sbjct  62    VLLLTTGGKISLILLFNEELFFIYLLPPIIFNAGFQVKKKQFFRNFMTIILFGAIGTLIS  121

Query  1548  CSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEG  1369
               IIS GA+++FK LDI FL+ GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEG
Sbjct  122   FGIISLGAIQLFKKLDIGFLEIGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEG  181

Query  1368  VVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLY  1189
             VVNDATSVVLFNAIQ FD++     I   F+GNFL LF +ST LGV IGLL AYI+KKLY
Sbjct  182   VVNDATSVVLFNAIQRFDLSHITSGIAFQFVGNFLSLFFASTLLGVFIGLLSAYIMKKLY  241

Query  1188  FGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRH  1009
             FGRHSTDREVALM++M+YLSYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H
Sbjct  242   FGRHSTDREVALMIVMAYLSYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKH  301

Query  1008  SFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLS  829
             +FATLSFV+E FIFLYVG+DALDIEKW+ V NS G S+ VSSIL+GL+L+GRAAFVFPLS
Sbjct  302   TFATLSFVSEIFIFLYVGIDALDIEKWRVVSNSPGTSIGVSSILLGLVLIGRAAFVFPLS  361

Query  828   FLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstv  649
             FLSNL KK+ SDKI F+QQI IWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST+
Sbjct  362   FLSNLTKKSESDKIGFKQQITIWWAGLMRGAVSVALAYNQFTMSGHTQLRGNAIMITSTI  421

Query  648   tvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDN--QPDSE  475
             T+VLFST+VFGLMTKPLI+ LLPP    P   SSM +SEP SPK F++PLL N   PD E
Sbjct  422   TIVLFSTLVFGLMTKPLISFLLPP----PKYFSSMMSSEPPSPKSFSMPLLANGQDPDIE  477

Query  474   SDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              D    P    PT LRML  TPTHTVH YWRKFD+++MRPVFGGRGFVP+VA S  E++
Sbjct  478   GDSHNTPP---PTNLRMLWTTPTHTVHHYWRKFDNAYMRPVFGGRGFVPYVATSLTERN  533



>emb|CBI32267.3| unnamed protein product [Vitis vinifera]
Length=538

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/539 (75%), Positives = 457/539 (85%), Gaps = 9/539 (2%)
 Frame = -3

Query  1908  GLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGV  1729
             GL+SL       TSD  S+ ++ LFVALLCACIV+GHLLEE RW+NESITAL IGLCTG+
Sbjct  2     GLNSLAGLGMRSTSDQVSIDAITLFVALLCACIVIGHLLEEYRWMNESITALFIGLCTGI  61

Query  1728  VIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLIS  1549
             V+LL +GGK S +L+F+E+LFFIYLLPPIIFNAGFQVKKKQFF NFMTI+LFGAIGTLIS
Sbjct  62    VLLLTTGGKISLILLFNEELFFIYLLPPIIFNAGFQVKKKQFFRNFMTIILFGAIGTLIS  121

Query  1548  CSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEG  1369
               IIS GA+++FK LDI FL+ GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEG
Sbjct  122   FGIISLGAIQLFKKLDIGFLEIGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEG  181

Query  1368  VVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLY  1189
             VVNDATSVVLFNAIQ FD++     I   F+GNFL LF +ST LGV IGLL AYI+KKLY
Sbjct  182   VVNDATSVVLFNAIQRFDLSHITSGIAFQFVGNFLSLFFASTLLGVFIGLLSAYIMKKLY  241

Query  1188  FGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRH  1009
             FGRHSTDREVALM++M+YLSYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H
Sbjct  242   FGRHSTDREVALMIVMAYLSYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKH  301

Query  1008  SFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLS  829
             +FATLSFV+E FIFLYVG+DALDIEKW+ V NS G S+ VSSIL+GL+L+GRAAFVFPLS
Sbjct  302   TFATLSFVSEIFIFLYVGIDALDIEKWRVVSNSPGTSIGVSSILLGLVLIGRAAFVFPLS  361

Query  828   FLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstv  649
             FLSNL KK+ SDKI F+QQI IWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST+
Sbjct  362   FLSNLTKKSESDKIGFKQQITIWWAGLMRGAVSVALAYNQFTMSGHTQLRGNAIMITSTI  421

Query  648   tvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDN--QPDSE  475
             T+VLFST+VFGLMTKPLI+ LLPP    P   SSM +SEPSSPK F++PLL N   PD E
Sbjct  422   TIVLFSTLVFGLMTKPLISFLLPP----PKYFSSMMSSEPSSPKSFSMPLLANGQDPDIE  477

Query  474   SDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              D    P    PT LRML  TPTHTVH YWRKFD+++MRPVFGGRGFVP+VA S  E++
Sbjct  478   GDSHNTPP---PTNLRMLWTTPTHTVHHYWRKFDNAYMRPVFGGRGFVPYVATSLTERN  533



>ref|XP_006394990.1| hypothetical protein EUTSA_v10003949mg [Eutrema salsugineum]
 gb|ABJ97691.1| Na+/H+ antiporter [Eutrema halophilum]
 gb|ACN76859.1| sodium/hydrogen antiporter [Eutrema halophilum]
 dbj|BAJ33874.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ32276.1| hypothetical protein EUTSA_v10003949mg [Eutrema salsugineum]
Length=545

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/528 (76%), Positives = 453/528 (86%), Gaps = 6/528 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVS+NLFVALLCACIVLGHLLEENRW+NESITAL+IGL TGVVILL+S GKS
Sbjct  18    LSTSDHASVVSLNLFVALLCACIVLGHLLEENRWMNESITALLIGLATGVVILLISKGKS  77

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGAIGT+ISC++I+ G  +
Sbjct  78    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGAIGTVISCTVITLGVTQ  137

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI   D GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVV+
Sbjct  138   FFKKLDIGTFDLGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVV  197

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T  + +   H +GNFLYLFL ST LGV  GL+ AY+IKKLYFGRHSTDREV
Sbjct  198   FNAIQSFDLTHLNHEAAFHLLGNFLYLFLLSTLLGVATGLISAYVIKKLYFGRHSTDREV  257

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AE
Sbjct  258   ALMMLMAYLSYMLAELFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLAE  317

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDI+KW+ V +S G SVAVSSIL+GL+++GRAAFVFPLSFLSNLAKKN 
Sbjct  318   TFIFLYVGMDALDIDKWRSVSDSPGTSVAVSSILIGLLMLGRAAFVFPLSFLSNLAKKNE  377

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KI+F+ Q++IWWAGLMRGAVS+ALAYNKFT +GHT L  NAIMITST+TV LFSTVVF
Sbjct  378   SEKINFKMQVVIWWAGLMRGAVSMALAYNKFTRAGHTDLRGNAIMITSTITVCLFSTVVF  437

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             G++TKPLI  LLP  K      +SM + + ++PK   +PLLD   DS  +      V RP
Sbjct  438   GMLTKPLIRHLLPHQK----ATTSMLSDDNNTPKSIQIPLLDQ--DSFIEFAGNHNVPRP  491

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
              ++R  L  PT TVH YWR+FDDSFMRPVFGGRGFVPFV GSP E+ P
Sbjct  492   DSIRGFLTRPTRTVHYYWRQFDDSFMRPVFGGRGFVPFVPGSPTERDP  539



>gb|ABF48496.1| sodium proton exchanger [Eutrema halophilum]
Length=545

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/528 (76%), Positives = 453/528 (86%), Gaps = 6/528 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVS+NLFVALLCACIVLGHLLEENRW+NESITAL+IGL TGVVILL+S GKS
Sbjct  18    LSTSDHASVVSLNLFVALLCACIVLGHLLEENRWMNESITALLIGLATGVVILLISKGKS  77

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGAIGT+ISC++I+ G  +
Sbjct  78    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGAIGTVISCTVITLGVTQ  137

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI   D GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVV+
Sbjct  138   FFKKLDIGTFDLGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVV  197

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T  + +   H +GNFLYLFL ST LGV  GL+ AY+IKKLYFGRHSTDREV
Sbjct  198   FNAIQSFDLTHLNHEAAFHLLGNFLYLFLLSTLLGVATGLISAYVIKKLYFGRHSTDREV  257

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AE
Sbjct  258   ALMMLMAYLSYMLAELFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLAE  317

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDI+KW+ V +S G SVAVSSIL+GL+++GRAAFVFPLSFLSNLAKKN 
Sbjct  318   TFIFLYVGMDALDIDKWRSVSDSPGTSVAVSSILIGLLMLGRAAFVFPLSFLSNLAKKNE  377

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KI+F+ Q++IWWAGLMRGAVS+ALAYNKFT +GHT L  NAIMITST+TV  FSTVVF
Sbjct  378   SEKINFKMQVVIWWAGLMRGAVSMALAYNKFTRAGHTDLRGNAIMITSTITVCPFSTVVF  437

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             G++TKPLI  LLP  K      +SM + + ++PK   +PLLD   DS  +      V RP
Sbjct  438   GMLTKPLIRHLLPHQK----ATTSMLSGDNNTPKSIQIPLLDQ--DSFIEFAGNHNVPRP  491

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
              ++R  L  PT TVH YWR+FDDSFMRPVFGGRGFVPFV GSP+E+ P
Sbjct  492   DSIRGFLTRPTRTVHYYWRQFDDSFMRPVFGGRGFVPFVPGSPIERDP  539



>gb|AES91776.2| Na+/H+ exchanger 1 [Medicago truncatula]
Length=529

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/526 (74%), Positives = 448/526 (85%), Gaps = 8/526 (2%)
 Frame = -3

Query  1884  SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsgg  1705
             + +FTSDHASVVS+N+FVALLC CIV+GHLLEENRW+NESITAL+IGLCTGV+IL  +GG
Sbjct  12    TTMFTSDHASVVSLNIFVALLCTCIVIGHLLEENRWINESITALLIGLCTGVLILFTTGG  71

Query  1704  ksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGA  1525
             +SSH++VFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGAIGTLIS  IIS GA
Sbjct  72    RSSHIMVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAIGTLISFCIISLGA  131

Query  1524  VKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSV  1345
             +  F+ LDI  L  GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATS+
Sbjct  132   IHFFQKLDIGSLKIGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSI  191

Query  1344  VLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDR  1165
             VLF AIQ+FD++  D    LH +GNFLYLF++ST LG+ +GL  AYIIK+LYFG+HSTDR
Sbjct  192   VLFKAIQNFDLSHIDLTTALHLLGNFLYLFIASTVLGIFVGLFSAYIIKRLYFGKHSTDR  251

Query  1164  EVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFV  985
             EVALM+LM+YLSY++AELF  S ILTVFFCGI+MSHYTWHNVTESSR+TT+H+FAT+SF+
Sbjct  252   EVALMILMAYLSYMLAELFSFSAILTVFFCGILMSHYTWHNVTESSRITTKHTFATMSFI  311

Query  984   AETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKK  805
             AE FIFLYVGMDALD+EKW+FV  SQ  S+ VSS+L+ LILVGRAAFVFPLSF+SNL+KK
Sbjct  312   AEIFIFLYVGMDALDMEKWRFVSQSQKKSIGVSSLLLALILVGRAAFVFPLSFISNLSKK  371

Query  804   NSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstv  625
             + S+KI F+QQ+ IWWAGLMRGAVSIALAYN+FT  GHT L ENAIMITST+TVVLFSTV
Sbjct  372   SQSEKIEFKQQVTIWWAGLMRGAVSIALAYNQFTRLGHTKLRENAIMITSTITVVLFSTV  431

Query  624   vFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVA  445
             VFGLMTKPL+ LLLP  K +         S PSSPK F+VPLL N  D   +  T     
Sbjct  432   VFGLMTKPLVRLLLPSSKHI----IISIPSPPSSPKSFSVPLLGNGEDVGGNGGT----Q  483

Query  444   RPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPV  307
             RP+ LR LLR P+H VH YWRKFDDSFMRPVFGGRGFVP+V GSP+
Sbjct  484   RPSRLRTLLRIPSHGVHHYWRKFDDSFMRPVFGGRGFVPYVPGSPL  529



>gb|AFF57538.1| vacuolar sodium proton antiporter [Cochlearia hollandica]
Length=542

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/528 (74%), Positives = 448/528 (85%), Gaps = 9/528 (2%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TS HASVVS+NLFVALLCACIVLGHLLEENRW+NES TAL++GL TGVVILL+S GKS
Sbjct  18    LSTSGHASVVSLNLFVALLCACIVLGHLLEENRWMNESTTALLLGLATGVVILLISNGKS  77

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGAIGT+ISC++I+ G  +
Sbjct  78    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGAIGTVISCTVITLGVTQ  137

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI   D GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVV+
Sbjct  138   FFKKLDIRTFDLGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVV  197

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T  + +     +GNF YLFL STFLGV  GL+ AY+IKKLYFGRHSTDREV
Sbjct  198   FNAIQSFDLTHLNHEAAFRLLGNFSYLFLLSTFLGVATGLISAYVIKKLYFGRHSTDREV  257

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AE
Sbjct  258   ALMMLMAYLSYMLAELFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLAE  317

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDI+KW+ V +S G SVAV SIL+GL+++GRAAFVFPLSFLSNLA+KN 
Sbjct  318   TFIFLYVGMDALDIDKWRSVSDSPGTSVAVRSILMGLVMLGRAAFVFPLSFLSNLARKNQ  377

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KI+F+ QI+IWW+GLMRGAVS+ALAYNKFT +GHT L  NAIMITST+TV LFST+VF
Sbjct  378   SEKINFKMQIVIWWSGLMRGAVSMALAYNKFTRAGHTDLRGNAIMITSTITVCLFSTMVF  437

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             G++TKPLI  LL      P   +SM  S+ ++PK   +PLLD   DS  +      V RP
Sbjct  438   GMLTKPLIRYLL------PQATTSM-LSDDNTPKSIHIPLLDQ--DSFIEFPGHQNVPRP  488

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
              ++R  L  PT TVH YWR+FDDSFMRPVFGGRGFVPFV GSP E+ P
Sbjct  489   DSIRGFLTRPTRTVHYYWRQFDDSFMRPVFGGRGFVPFVPGSPTERDP  536



>gb|ABC18331.1| vacuolar Na+/H+ antiporter Nhx2 [Karelinia caspia]
Length=550

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/530 (75%), Positives = 464/530 (88%), Gaps = 7/530 (1%)
 Frame = -3

Query  1887  NSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsg  1708
             ++ L TS+++S+VSMNLFVALLCACIVLGHLLEENRW+NESITAL+IGLCTGVVILL+SG
Sbjct  14    SNPLATSEYSSIVSMNLFVALLCACIVLGHLLEENRWMNESITALVIGLCTGVVILLISG  73

Query  1707  gksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFG  1528
             G +SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI+LFGA+GT+IS  IISF 
Sbjct  74    GTNSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIVLFGAVGTVISFVIISFA  133

Query  1527  AVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATS  1348
             ++ IFK ++I+ L+ GDYLAIGAIF+ATDSVCTLQVL+QD+TPLLYSLVFGEGVVNDATS
Sbjct  134   SMNIFKRMNIENLELGDYLAIGAIFSATDSVCTLQVLNQDQTPLLYSLVFGEGVVNDATS  193

Query  1347  VVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTD  1168
             +V+FNA+Q+FD++          IGNF YLF++ST LG G GLL AYIIKKLYFGRHSTD
Sbjct  194   IVIFNAVQNFDLSQITTSTAFQLIGNFFYLFVTSTLLGGGAGLLSAYIIKKLYFGRHSTD  253

Query  1167  REVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSF  988
             REVA+M+LM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTE SRVTT+H+FATLSF
Sbjct  254   REVAIMILMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTEKSRVTTKHAFATLSF  313

Query  987   VAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAK  808
             VAE FIFLYVGMDALDIEKW FV++S G SV VS+IL+GLILVGRAAFVFPLS LSNL K
Sbjct  314   VAELFIFLYVGMDALDIEKWSFVEDSPGTSVEVSAILLGLILVGRAAFVFPLSLLSNLMK  373

Query  807   KNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfst  628
             K+  +KI FRQQ++IWWAGLMRGAVS+ALAYN+FT  GHT L  NAIMITST+TVVLFST
Sbjct  374   KSPHEKIDFRQQVLIWWAGLMRGAVSMALAYNQFTKEGHTQLRGNAIMITSTITVVLFST  433

Query  627   vvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEV  448
             +VFGL+T+PL+ LLLPP K +    + M +SEP++PK F VPLL+ Q DSE D+     +
Sbjct  434   MVFGLITQPLVRLLLPPPKTL----TRMISSEPTTPKSFIVPLLNGQ-DSEIDL--NQNI  486

Query  447   ARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              RP++LRMLL TP+HTVH YWRKFD++FMRPVFGGRGFVPFV GSP EQS
Sbjct  487   PRPSSLRMLLSTPSHTVHYYWRKFDNAFMRPVFGGRGFVPFVPGSPTEQS  536



>ref|XP_002516862.1| sodium/hydrogen exchanger, putative [Ricinus communis]
 gb|EEF45476.1| sodium/hydrogen exchanger, putative [Ricinus communis]
Length=541

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/541 (75%), Positives = 457/541 (84%), Gaps = 7/541 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNS-DLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MAFG+ S+   S     SDH+SVVS+NLFVALLCACIV+GHLLEENRW+NESITAL IGL
Sbjct  1     MAFGVDSVFSKSVATVGSDHSSVVSINLFVALLCACIVVGHLLEENRWINESITALAIGL  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTG+VILL +GGKSS LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI+LFGA+G
Sbjct  61    CTGIVILLTTGGKSSRLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIILFGAVG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS  +IS GA+  F+ L+I  LD GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISTGVISVGAMHFFQKLNIGSLDIGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLF AIQSFD+++ +      F GNFLYLF+SST LGV  GL  A+II
Sbjct  181   FGEGVVNDATSVVLFKAIQSFDLSNINSTAATQFAGNFLYLFVSSTVLGVLAGLFSAFII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVALM+LM+YLSY++AELFYLS ILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVALMILMAYLSYMLAELFYLSAILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSFVAE FIFLYVGMDALDIEKWKFV +S G S+ VS+IL+GL+L+GRAAFV
Sbjct  301   TTKHAFATLSFVAEIFIFLYVGMDALDIEKWKFVSHSPGTSIGVSAILLGLVLLGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPL FLSNL KK+S  KI  +QQ+ IWWAGLMRGAVS+ALAYN+F +SG+      AIMI
Sbjct  361   FPLCFLSNLTKKSSYQKIDIKQQVTIWWAGLMRGAVSMALAYNQFNSSGYRRFRGCAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFST VFG+MTKPL+ +LLP  KQ     SSM +SEPSSPK F VP L+ Q D
Sbjct  421   TSTITVVLFSTAVFGMMTKPLVRILLPSSKQT----SSMLSSEPSSPKSFLVPFLNGQ-D  475

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE D   G  VARP++L MLL TP++TVH YWRKFDD+FMRPVFGGRGFVPFV  SP + 
Sbjct  476   SE-DNKDGQNVARPSSLMMLLSTPSYTVHHYWRKFDDAFMRPVFGGRGFVPFVPCSPTDP  534

Query  300   S  298
             S
Sbjct  535   S  535



>gb|ABW93557.1| Na+/H+ antiporter protein [Plantago maritima]
Length=553

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/534 (73%), Positives = 443/534 (83%), Gaps = 13/534 (2%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDH+SVVS+ LFV LLCACIV+GHLLEENRW+NESITALIIG+ TGVVILL+S GKS
Sbjct  15    LATSDHSSVVSITLFVTLLCACIVIGHLLEENRWMNESITALIIGVGTGVVILLISQGKS  74

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIM+FGA GT+IS +IIS GA+ 
Sbjct  75    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMMFGAFGTMISFTIISLGAIV  134

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              F  +D+  L  GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  135   FFGKMDVG-LAIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  193

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNA+Q+FD++     +    IGNF YLF+SST LGV  GLL AY+IK LYFGRHSTDREV
Sbjct  194   FNAVQNFDLSHISTAVAFQLIGNFFYLFISSTVLGVVTGLLSAYVIKTLYFGRHSTDREV  253

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             A+MMLM+YLSYI+AELF LSGILTVFFCGIVMSHYTWHNVTE+ R+TT+H+FATLSFVAE
Sbjct  254   AIMMLMAYLSYILAELFSLSGILTVFFCGIVMSHYTWHNVTENPRITTKHTFATLSFVAE  313

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              FIFLYVGMDALDIEKW+   NS   SVAVS+ L+GL++ GRAAFVFPLSFLSNL KK  
Sbjct  314   IFIFLYVGMDALDIEKWRVASNSPKTSVAVSATLLGLVMAGRAAFVFPLSFLSNLTKKAQ  373

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
              +KI  +QQ+ IWWAGLMRGAVS+ALAYN+FT  GHT    +AIMITST+TVVLFSTVVF
Sbjct  374   HEKIGLKQQVTIWWAGLMRGAVSMALAYNQFTKGGHTQERGSAIMITSTITVVLFSTVVF  433

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITG------  457
             GLMTKPL+  L+PPH  +      M +++  +PK F VPLL    DSE+D+  G      
Sbjct  434   GLMTKPLVRFLMPPHSLL-----RMISTDSLTPKSFAVPLLGESLDSEADLFLGNGITSE  488

Query  456   -PEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
               E+ RP +LRMLLRTPT TVH YWRKFD++FMRPVFGGRGFVPFV GSP EQS
Sbjct  489   SREIIRPNSLRMLLRTPTRTVHYYWRKFDNAFMRPVFGGRGFVPFVPGSPTEQS  542



>ref|XP_010024554.1| PREDICTED: sodium/hydrogen exchanger 2-like [Eucalyptus grandis]
 ref|XP_010024555.1| PREDICTED: sodium/hydrogen exchanger 2-like [Eucalyptus grandis]
 ref|XP_010024556.1| PREDICTED: sodium/hydrogen exchanger 2-like [Eucalyptus grandis]
 ref|XP_010024557.1| PREDICTED: sodium/hydrogen exchanger 2-like [Eucalyptus grandis]
 ref|XP_010024558.1| PREDICTED: sodium/hydrogen exchanger 2-like [Eucalyptus grandis]
 gb|KCW61009.1| hypothetical protein EUGRSUZ_H03765 [Eucalyptus grandis]
Length=536

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/540 (75%), Positives = 455/540 (84%), Gaps = 9/540 (2%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC  1738
             MA    S+      FTSDH SVVSMNLFVALLCACIV+GHLLEENRW+NESITAL IGLC
Sbjct  1     MAIDPGSIFSKLGAFTSDHDSVVSMNLFVALLCACIVIGHLLEENRWMNESITALAIGLC  60

Query  1737  TGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGT  1558
             TGVVILL +GGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+GT
Sbjct  61    TGVVILLTTGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVGT  120

Query  1557  LISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVF  1378
             LIS  IIS GA  IF+  +   LD GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLVF
Sbjct  121   LISFGIISSGAKYIFEVFNFHQLDIGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVF  180

Query  1377  GEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIK  1198
             GEGVVNDATSVVLFNAIQSFD++  +  I L F GNFLYLF+ ST LGV  GLL AYII+
Sbjct  181   GEGVVNDATSVVLFNAIQSFDLSHINSSIALQFAGNFLYLFILSTLLGVLTGLLSAYIIR  240

Query  1197  KLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT  1018
             KLYFGRHSTDREVALM+LM+Y+SY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT
Sbjct  241   KLYFGRHSTDREVALMILMAYMSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT  300

Query  1017  TRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVF  838
             T+H+FATLSFVAE FIFLYVGMDALDIE+W+ V NS  +S+  SSIL+GL+L+GRAAFVF
Sbjct  301   TKHTFATLSFVAEIFIFLYVGMDALDIERWRVVSNSPKISLQFSSILLGLVLIGRAAFVF  360

Query  837   PLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMIt  658
              LSFLSNL KK++ +K++ RQQ+IIWWAGLMRGAVS+ALAYNKF  S  T   +NA MIT
Sbjct  361   LLSFLSNLTKKSAHEKVNIRQQVIIWWAGLMRGAVSMALAYNKFALS-ETKDRKNAFMIT  419

Query  657   stvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDS  478
             ST+TVVLFSTVVFGLMTKPLI LLLP  K +      M +SEP+SPK F VPLL N   +
Sbjct  420   STITVVLFSTVVFGLMTKPLIRLLLPSPKHL----VRMASSEPTSPKSFIVPLLGNGQAT  475

Query  477   ESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             ES+      V RP++LRMLL TPT+TVH YWRKFD+ FMRPVFGGRGFVPFV GSP ++S
Sbjct  476   ESNQ----SVPRPSSLRMLLTTPTNTVHYYWRKFDNGFMRPVFGGRGFVPFVPGSPTDRS  531



>gb|AAK76738.2| Na+/H+ antiporter [Triticum aestivum]
Length=538

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/523 (74%), Positives = 441/523 (84%), Gaps = 9/523 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS+ LFVALLCACIVLGHLLEENRW+NESITALIIGLCTGVVIL+ + GKSSH
Sbjct  19    TSDHASVVSITLFVALLCACIVLGHLLEENRWLNESITALIIGLCTGVVILMTTKGKSSH  78

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             +LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFM I LFGA+GT++S   IS  A+ IF
Sbjct  79    VLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMAITLFGAVGTMMSFFTISLAAIAIF  138

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
               ++I  LD  D+LAIGAIF+ATDSVCTLQVL+QDETP LYSLVFGEGVVNDATSVVLFN
Sbjct  139   SRMNIGTLDVSDFLAIGAIFSATDSVCTLQVLNQDETPFLYSLVFGEGVVNDATSVVLFN  198

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+Q+FD    D  + L F+GNF YLF+SSTFLGV  GLL AY+IKKLY GRHSTDREVAL
Sbjct  199   ALQNFDPNQIDAIVILKFLGNFCYLFVSSTFLGVFTGLLSAYVIKKLYIGRHSTDREVAL  258

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             +MLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF
Sbjct  259   VMLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETF  318

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDIEKWKF  +S G S+ +SSIL+GL+LVGRAAFVFPLSFLSNL KK   +
Sbjct  319   LFLYVGMDALDIEKWKFASDSPGKSIGISSILLGLVLVGRAAFVFPLSFLSNLTKKTELE  378

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KIS+RQQI+IWWAGLMRGAVSIALAYNKFT SGHT LH NAIMITST+TVVLFST++FG+
Sbjct  379   KISWRQQIVIWWAGLMRGAVSIALAYNKFTRSGHTQLHGNAIMITSTITVVLFSTMLFGI  438

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             +TKPLI  LLP         S+   S+P+SPK    PLL +Q    SD+     + RP++
Sbjct  439   LTKPLIRFLLP-------ASSNGAASDPASPKSLHSPLLTSQLG--SDLEAPLPIVRPSS  489

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             LRML+  PTHT+H YWRKFDD+ MRP+FGGRGFVP+  GSP +
Sbjct  490   LRMLITKPTHTIHYYWRKFDDALMRPMFGGRGFVPYSPGSPTD  532



>gb|ACZ92142.1| Na+/H+ antiporter [Brassica napus]
Length=542

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/528 (74%), Positives = 444/528 (84%), Gaps = 7/528 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L  SDHASVVS+NLFVALLCACIVLGHLLEEN W+NESITAL+IGL TGVVILL+S GKS
Sbjct  15    LSASDHASVVSLNLFVALLCACIVLGHLLEENPWMNESITALLIGLATGVVILLISNGKS  74

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVF+EDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGAIGT++SC++I+ G  +
Sbjct  75    SHLLVFTEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGAIGTVVSCTVITLGVTQ  134

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI   D GDYLAIGAIFAATDSVCTLQVL+Q ETPLLYSLVFGEGVVNDATSVV+
Sbjct  135   FFKKLDIGTFDLGDYLAIGAIFAATDSVCTLQVLNQGETPLLYSLVFGEGVVNDATSVVV  194

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T  + +     +GNF YLFL ST LGV  GL+ AYIIKKLYFGRHSTDREV
Sbjct  195   FNAIQSFDLTHLNHEAAFRLLGNFFYLFLLSTLLGVATGLISAYIIKKLYFGRHSTDREV  254

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AE
Sbjct  255   ALMMLMAYLSYMLAELFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATLSFLAE  314

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDI+KW+ V +S G SVAVSSIL+GL+++GRAAFVFPLSFLSNLAKKN 
Sbjct  315   TFIFLYVGMDALDIDKWRSVSDSPGTSVAVSSILIGLLMLGRAAFVFPLSFLSNLAKKNQ  374

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KI F+ Q++IWW+GLMRGAVS+ALAYNKFT +G T L  NAIMITST+TV LFSTVVF
Sbjct  375   SEKIDFKMQVVIWWSGLMRGAVSMALAYNKFTRAGKTDLRGNAIMITSTITVCLFSTVVF  434

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             G++TKPLI  LLP  K   S       S+ ++PK   +PL+D   DS  +      V RP
Sbjct  435   GMLTKPLIRFLLPHQKATTS-----FLSDGNTPKSIQIPLIDQ--DSFIEFAGNHNVPRP  487

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
              ++R  L  PT TVH YWR+FDDSFMRPVFGGRGFVPFV GSP E+ P
Sbjct  488   DSIRGFLTRPTRTVHYYWRQFDDSFMRPVFGGRGFVPFVPGSPTERDP  535



>ref|XP_006394989.1| hypothetical protein EUTSA_v10003949mg [Eutrema salsugineum]
 gb|ESQ32275.1| hypothetical protein EUTSA_v10003949mg [Eutrema salsugineum]
Length=544

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/528 (74%), Positives = 446/528 (84%), Gaps = 7/528 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVS+NLFVALLCACIVLGHLLEENRW+NESITAL+IGL TGVVILL+S GKS
Sbjct  18    LSTSDHASVVSLNLFVALLCACIVLGHLLEENRWMNESITALLIGLATGVVILLISKGKS  77

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGAIGT+ISC++I+ G  +
Sbjct  78    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGAIGTVISCTVITLGVTQ  137

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI   D GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVV+
Sbjct  138   FFKKLDIGTFDLGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVV  197

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T  + +   H +GNFLYLFL ST LGV  GL+ AY+IKKLYFGRHSTDREV
Sbjct  198   FNAIQSFDLTHLNHEAAFHLLGNFLYLFLLSTLLGVATGLISAYVIKKLYFGRHSTDREV  257

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AE
Sbjct  258   ALMMLMAYLSYMLAELFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLAE  317

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDI+KW+ V +S G SVAVSSIL+GL+++GRAAFVFPLSFLSNLAKKN 
Sbjct  318   TFIFLYVGMDALDIDKWRSVSDSPGTSVAVSSILIGLLMLGRAAFVFPLSFLSNLAKKNE  377

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KI+F+ Q++IWWAGLMRGAVS+ALAYNKFT +GHT L  NAIMI ++   V   + VF
Sbjct  378   SEKINFKMQVVIWWAGLMRGAVSMALAYNKFTRAGHTDLRGNAIMI-TSTITVCLFSTVF  436

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             G++TKPLI  LLP  K      +SM + + ++PK   +PLLD   DS  +      V RP
Sbjct  437   GMLTKPLIRHLLPHQK----ATTSMLSDDNNTPKSIQIPLLDQ--DSFIEFAGNHNVPRP  490

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
              ++R  L  PT TVH YWR+FDDSFMRPVFGGRGFVPFV GSP E+ P
Sbjct  491   DSIRGFLTRPTRTVHYYWRQFDDSFMRPVFGGRGFVPFVPGSPTERDP  538



>gb|AAR17789.2| Na+/H+ antiporter [Lophopyrum elongatum]
Length=538

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/523 (74%), Positives = 441/523 (84%), Gaps = 9/523 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             T DHASVVS+NLFVALLCACIVLGHLLEENRW+NESITALIIGLCTGVVIL+ + GKSSH
Sbjct  19    TPDHASVVSINLFVALLCACIVLGHLLEENRWLNESITALIIGLCTGVVILMTAKGKSSH  78

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             +LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GT++S   IS  A+ IF
Sbjct  79    VLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTMMSFFTISLAAIAIF  138

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
               ++I  LD  D+LAIGAIF+ATDSVCTLQVL+QDETP LYSLVFGEGVVNDATSVVLFN
Sbjct  139   SKMNIGTLDVSDFLAIGAIFSATDSVCTLQVLNQDETPFLYSLVFGEGVVNDATSVVLFN  198

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+Q+FD    D  + L F+GNF YLF+SSTFLGV  GLL AY+IKKLY GRHSTDREVAL
Sbjct  199   ALQNFDPNQIDAIVILKFLGNFCYLFVSSTFLGVFTGLLSAYVIKKLYIGRHSTDREVAL  258

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             +MLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF
Sbjct  259   VMLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETF  318

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDIEKWKF  +S G S+ +SSIL+GL+LVGR AFVFPLSFLSNL KK   +
Sbjct  319   LFLYVGMDALDIEKWKFASDSPGKSIGISSILLGLVLVGRGAFVFPLSFLSNLTKKTELE  378

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KIS+RQQI+IWWAGLMRGAVSIALAYNKFT SGHT LH NAIMITST+TVVLFST++FG+
Sbjct  379   KISWRQQIVIWWAGLMRGAVSIALAYNKFTRSGHTQLHGNAIMITSTITVVLFSTMLFGI  438

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             +TKPLI  LLP         S+   S+P+SPK    PLL +Q    SD+     + RP++
Sbjct  439   LTKPLIRFLLP-------ASSNGAASDPASPKSLHSPLLTSQLG--SDLEAPLPIVRPSS  489

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             LRML+  PTHT+H YWRKFDD+ MRP+FGGRGFVP+  GSP +
Sbjct  490   LRMLITKPTHTIHYYWRKFDDALMRPMFGGRGFVPYSPGSPTD  532



>ref|XP_008390734.1| PREDICTED: sodium/hydrogen exchanger 2-like [Malus domestica]
 ref|XP_008390735.1| PREDICTED: sodium/hydrogen exchanger 2-like [Malus domestica]
Length=559

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/549 (74%), Positives = 459/549 (84%), Gaps = 14/549 (3%)
 Frame = -3

Query  1917  MAFGLSSLLQNSD--LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             MA   SS+   S   L +SDH SVVSMNLFVALLCACI+LGHLLEE+RW+NESITAL IG
Sbjct  1     MAVDASSIATESMGILMSSDHKSVVSMNLFVALLCACILLGHLLEESRWMNESITALAIG  60

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             LCTGVVILL +GGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIM FGA 
Sbjct  61    LCTGVVILLTTGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMTFGAA  120

Query  1563  GTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSL  1384
             GTLIS SIIS GA+  F   +I  L  GDYLA+GAIF+ATDSVCTLQVL+QDETPLLYSL
Sbjct  121   GTLISFSIISLGAMHFFHKFNIGSLKIGDYLALGAIFSATDSVCTLQVLNQDETPLLYSL  180

Query  1383  VFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYI  1204
             VFGEGVVNDATS+VLFNAIQSFD+++ +    L F G+FLYLF +ST LGV  GLL AYI
Sbjct  181   VFGEGVVNDATSIVLFNAIQSFDLSNINTSTALQFFGSFLYLFAASTMLGVAAGLLSAYI  240

Query  1203  IKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  1024
             IKKLYFGRHSTDREVALM+LM+Y SYI++ELFYLS ILTVFFCGIVMSHYTWHNVTESSR
Sbjct  241   IKKLYFGRHSTDREVALMILMAYFSYILSELFYLSAILTVFFCGIVMSHYTWHNVTESSR  300

Query  1023  VTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAF  844
             VTT+H+FATLSFVAE FIFLYVGMDALDI+KW+FV +S G S+AVSSIL+ L+LVGRAAF
Sbjct  301   VTTKHTFATLSFVAEIFIFLYVGMDALDIDKWRFVSDSPGKSIAVSSILLALVLVGRAAF  360

Query  843   VFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIM  664
             VFPLSFLSNL KK+  DK+S ++Q+ +WWAGLMRG+VS+ALAYN+F +SGHT L  NA M
Sbjct  361   VFPLSFLSNLTKKSPQDKLSLKEQVTVWWAGLMRGSVSMALAYNQFRSSGHTDLRANATM  420

Query  663   ItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQP  484
             ITST+TVVLFSTVVFGLMTKPL+ +LLP  K +    SSM +SEPSSPK  T  LL N  
Sbjct  421   ITSTITVVLFSTVVFGLMTKPLVRILLPVSKHV----SSMISSEPSSPKSITASLLSNGQ  476

Query  483   DSE-------SDMITGP-EVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVP  328
             DSE       S+   GP ++ RPT+LRMLL   +HTVH YWR+FD++FMRPVFGGRGFVP
Sbjct  477   DSEVNRGVEDSEANIGPVDIPRPTSLRMLLGASSHTVHHYWRRFDNAFMRPVFGGRGFVP  536

Query  327   FVAGSPVEQ  301
              V GSPVE+
Sbjct  537   VVPGSPVEE  545



>ref|XP_008353238.1| PREDICTED: sodium/hydrogen exchanger 2-like [Malus domestica]
Length=551

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/534 (75%), Positives = 455/534 (85%), Gaps = 12/534 (2%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L  SDH SVVSMNLFVALLCACI+LGHLLEE+RW+NESITAL+IGLCTGVVILL +GGKS
Sbjct  16    LMASDHTSVVSMNLFVALLCACILLGHLLEESRWMNESITALVIGLCTGVVILLTTGGKS  75

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI+ FGA+GTLIS +I+S GA+ 
Sbjct  76    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIVTFGAVGTLISFAIVSLGAMH  135

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              F    +  L  GDYLA+GAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATS+VL
Sbjct  136   FFHKFSVGSLKIGDYLALGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSIVL  195

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD++  +    L F GNFLYLF++ST LGV  GLL A+IIKKLYFGRHSTDREV
Sbjct  196   FNAIQSFDLSHINTSTALQFFGNFLYLFVTSTILGVAAGLLSAFIIKKLYFGRHSTDREV  255

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALM+LM+YLSY+++EL YLS ILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFVAE
Sbjct  256   ALMILMAYLSYVLSELCYLSAILTVFFCGIVMSHYTWHNVTESSRVTTKHTFATLSFVAE  315

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              FIFLYVGMD LDI+KW+FV +S G S+AVSSIL+ L+LVGRAAFVFPLSFLSNL KK+ 
Sbjct  316   IFIFLYVGMDTLDIDKWRFVSDSPGKSMAVSSILLVLVLVGRAAFVFPLSFLSNLTKKSP  375

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
              DK+S +QQ+ +WWAGLMRG+VS+ALAYN+F  SGHT L  NAIMITST+TVVLFSTVVF
Sbjct  376   QDKLSLKQQVTVWWAGLMRGSVSMALAYNQFNRSGHTDLRANAIMITSTITVVLFSTVVF  435

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSE-------SDMIT  460
             GLMTKPL+ +LLP  K +    SSM +SEPSSPK   VPLL N  DSE        +   
Sbjct  436   GLMTKPLVRILLPVSKHV----SSMISSEPSSPKSIVVPLLGNGQDSEVNCGVEDXEANI  491

Query  459   GP-EVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             GP ++ RPT+LRMLL +P+HTVH YWR+FD++FMRPVFGGRGFVPFV GSPVE+
Sbjct  492   GPVDIPRPTSLRMLLSSPSHTVHHYWRRFDNAFMRPVFGGRGFVPFVPGSPVEE  545



>ref|XP_009369099.1| PREDICTED: sodium/hydrogen exchanger 2-like [Pyrus x bretschneideri]
Length=551

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/549 (73%), Positives = 460/549 (84%), Gaps = 14/549 (3%)
 Frame = -3

Query  1917  MAFGLSSLLQNSD--LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             MA   SS+   S   L  SDH SVVSMNLFVALLCACI+LGHLLEE+RW+NESITAL+IG
Sbjct  1     MAVDASSIATESMRILMASDHTSVVSMNLFVALLCACILLGHLLEESRWMNESITALVIG  60

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             LCTGVVILL +GGKSS LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIM FGA+
Sbjct  61    LCTGVVILLTTGGKSSRLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIMTFGAV  120

Query  1563  GTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSL  1384
             GTLIS +I+S GA+  F    +  L  GDYLA+GAIF+ATDSVCTLQVL+QDETPLLYSL
Sbjct  121   GTLISFAIVSLGAMHFFHKFSVGSLKIGDYLALGAIFSATDSVCTLQVLNQDETPLLYSL  180

Query  1383  VFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYI  1204
             VFGEGVVNDATS+VLFNAIQSFD++  +    L F GNFLYLF++ST LG+  GLL A I
Sbjct  181   VFGEGVVNDATSIVLFNAIQSFDLSHINTSTALQFFGNFLYLFVTSTILGIAAGLLSAVI  240

Query  1203  IKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  1024
             IKKLYFGRHSTDREVALM+LM+YLSY+++EL YLS ILTVFFCGIVMSHYTWHNVTESSR
Sbjct  241   IKKLYFGRHSTDREVALMILMAYLSYMLSELCYLSAILTVFFCGIVMSHYTWHNVTESSR  300

Query  1023  VTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAF  844
             VTT+H+FATLSFVAE FIFLYVGMD LDI+KW+FV +S G S+AVSSIL+ L+L+GRAAF
Sbjct  301   VTTKHTFATLSFVAEIFIFLYVGMDTLDIDKWRFVSDSPGKSMAVSSILLVLVLIGRAAF  360

Query  843   VFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIM  664
             VFPLSFLSNL KK+  DK+S +QQ+ +WWAGLMRG+VS+ALAYN+F  SGHT L  NAIM
Sbjct  361   VFPLSFLSNLTKKSPQDKLSLKQQVTVWWAGLMRGSVSMALAYNQFNRSGHTDLRANAIM  420

Query  663   ItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQP  484
             ITST+TVVLFSTVVFGLMTKPL+ +LLP  K +    SSM +SEPSSPK   VPLL N  
Sbjct  421   ITSTITVVLFSTVVFGLMTKPLVRILLPVSKHV----SSMISSEPSSPKSIVVPLLGNGQ  476

Query  483   DSE-------SDMITGP-EVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVP  328
             DSE       S+   GP ++ RPT+LRMLL +P+HTVH YWR+FD++FMRPVFGGRGFVP
Sbjct  477   DSEVNCGVEDSEANIGPTDIPRPTSLRMLLSSPSHTVHHYWRRFDNAFMRPVFGGRGFVP  536

Query  327   FVAGSPVEQ  301
             FV GSPVE+
Sbjct  537   FVPGSPVEE  545



>ref|XP_006584042.1| PREDICTED: sodium/hydrogen exchanger 2-like isoform X1 [Glycine 
max]
Length=539

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/548 (73%), Positives = 447/548 (82%), Gaps = 24/548 (4%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDL----FTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALI  1750
             MA G+ +L     L     TSDHASVVSMNLFVALLCACI++GHLLEENRW+NESITAL+
Sbjct  1     MAVGVGALYLYDKLTTLMMTSDHASVVSMNLFVALLCACIIIGHLLEENRWINESITALL  60

Query  1749  IGLCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFG  1570
             IGLCTGV IL  +GGKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFG
Sbjct  61    IGLCTGVFILFTTGGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFG  120

Query  1569  AIGTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLY  1390
             A+GTLIS  IIS GA+  F+ LDID L  GD+LAIGAIF+ATDSVCTLQVL+QDETPLLY
Sbjct  121   AVGTLISFCIISLGAIHFFQKLDIDSLKIGDFLAIGAIFSATDSVCTLQVLNQDETPLLY  180

Query  1389  SLVFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCA  1210
             SLVFGEGVVNDATS+VLF AIQ+FD++  D    L  +GNFLYLF++ST LG+ +GLL A
Sbjct  181   SLVFGEGVVNDATSIVLFKAIQNFDLSHIDLTTALQLLGNFLYLFIASTVLGIFVGLLSA  240

Query  1209  YIIKKLYFG---RHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNV  1039
             +IIKKLYFG   RHSTDREVALM+LM+YLSY+++ELF LS ILTVFFCGIVMSHYTWHNV
Sbjct  241   FIIKKLYFGKLIRHSTDREVALMVLMAYLSYMLSELFSLSAILTVFFCGIVMSHYTWHNV  300

Query  1038  TESSRVTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILV  859
             TESSRVTT+H FATLSF+AE FIFLYVGMDALDIEKW+ V  S   S+ VSS+L+ LILV
Sbjct  301   TESSRVTTKHVFATLSFIAEIFIFLYVGMDALDIEKWRIVSQSPRKSIGVSSLLLALILV  360

Query  858   GRAAFVFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLH  679
             GRAAFVFPLSFLSNL K + S+KI  +QQ+ IWWAGLMRGAVSIALAYN+FT  GHT L 
Sbjct  361   GRAAFVFPLSFLSNLLKNSQSEKIELKQQVTIWWAGLMRGAVSIALAYNQFTRLGHTKLR  420

Query  678   ENAIMItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPL  499
             ENAIMITST+TVVLFST+ FGLMTKPL+ LLLP  K     H     S PS+PK FTVPL
Sbjct  421   ENAIMITSTITVVLFSTLAFGLMTKPLVRLLLPSSK-----HVMSLPSPPSTPKSFTVPL  475

Query  498   LDNQPDSESDMITGPEVARPTALRMLLR-TPTHTVHRYWRKFDDSFMRPVFGGRGFVPFV  322
             L +Q         GP    P+ LRMLL   PT  VH YWRKFDDS MRPVFGGRGFVP+V
Sbjct  476   LGSQ--------NGPP---PSTLRMLLSCIPTRGVHHYWRKFDDSVMRPVFGGRGFVPYV  524

Query  321   AGSPVEQS  298
              GSP+EQS
Sbjct  525   PGSPLEQS  532



>dbj|BAG48260.1| vacuolar Na+/H+ antiporter [Zostera marina]
Length=540

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/524 (74%), Positives = 448/524 (85%), Gaps = 6/524 (1%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASV S++LF ALLC CIV+GHLLEENRWVNESITAL+IGL TGVVILL + GKSSH
Sbjct  17    TSDHASVSSISLFSALLCGCIVIGHLLEENRWVNESITALLIGLVTGVVILLTTKGKSSH  76

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             +LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GTLIS SIISFGA+ + 
Sbjct  77    ILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTLISFSIISFGAIILL  136

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             K+      D GDYLA GAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  137   KN-GRSLTDIGDYLATGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  195

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQ+FD+   D  I L F GNFLYLFL+ST LGV  GLL A++IKKLYFGRHSTDREV+L
Sbjct  196   AIQNFDLVHIDGTIALKFFGNFLYLFLASTVLGVATGLLSAFVIKKLYFGRHSTDREVSL  255

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AE F
Sbjct  256   MMLMAYLSYLLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFIAEIF  315

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALDI+KW+F+ +S G S+ +SSIL+GL++VGRAAFVFPLSFLSNL+KK S +
Sbjct  316   IFLYVGMDALDIDKWRFISDSPGKSIGISSILLGLVMVGRAAFVFPLSFLSNLSKKFSHE  375

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI F+QQ+ IWWAGLMRGAVS+ALAYN+FT++GHT L  NAIMITST+TVVLFST VFGL
Sbjct  376   KIEFKQQVTIWWAGLMRGAVSMALAYNQFTSAGHTELPANAIMITSTITVVLFSTSVFGL  435

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             +TKPL+ LLL PHK +    SS+   +P+SPK F   LL +   SE +  T   + RP++
Sbjct  436   LTKPLVFLLL-PHKGLKQQMSSI--DDPTSPKSFLAALLGSVHGSEIEEPT--SIPRPSS  490

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             LR+L+ +PT  VH YWRKFDD+ MRP+FGGRGFVPF+ GSP E+
Sbjct  491   LRLLVTSPTRAVHYYWRKFDDAVMRPMFGGRGFVPFIPGSPTEE  534



>gb|AAS17948.1| Na+/H+ antiporter precursor [Hordeum vulgare]
Length=538

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/541 (73%), Positives = 448/541 (83%), Gaps = 12/541 (2%)
 Frame = -3

Query  1917  MAFGL--SSLLQNSD-LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALII  1747
             MAF +  + L + SD L TSDHASVVS+NLFVALLCACIVLGHLLEENRW+NESITALII
Sbjct  1     MAFEVVAAQLARLSDALATSDHASVVSINLFVALLCACIVLGHLLEENRWLNESITALII  60

Query  1746  GLCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGA  1567
             GLCTGVVIL+ + GKSSH+LVFSEDLFFIYLLPPIIFNAGFQV+KKQFF NFMTI  FGA
Sbjct  61    GLCTGVVILMTTKGKSSHVLVFSEDLFFIYLLPPIIFNAGFQVRKKQFFRNFMTITSFGA  120

Query  1566  IGTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYS  1387
             +GT+IS   IS  A+ IF  ++I  LD  D+LAIGAIF+ATDSVCTLQVL+QDETP LYS
Sbjct  121   VGTMISFFTISLAAIAIFSKMNIGTLDVSDFLAIGAIFSATDSVCTLQVLNQDETPFLYS  180

Query  1386  LVFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAY  1207
             LVFGEGVVNDATSVVLFNA+Q+FD    D  + L F+GNF YL +SSTFLGV  GLL AY
Sbjct  181   LVFGEGVVNDATSVVLFNALQNFDPNQIDAIVILKFLGNFCYLSVSSTFLGVFSGLLSAY  240

Query  1206  IIKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESS  1027
             IIKKLY GRHSTDREV LMMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESS
Sbjct  241   IIKKLYIGRHSTDREVVLMMLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESS  300

Query  1026  RVTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAA  847
             RVTT+H+FATLSF+ ETF+FLYVGMDALDIEKWKF  +S G S+ +SSIL+GL+LVGRAA
Sbjct  301   RVTTKHAFATLSFIVETFLFLYVGMDALDIEKWKFASDSPGKSIGISSILLGLVLVGRAA  360

Query  846   FVFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAI  667
             FVFPLSFLSNL KK   +KIS+RQQI+IWWAGLMRGAVSIALAYNKFT SGHT LH NAI
Sbjct  361   FVFPLSFLSNLTKKTELEKISWRQQIVIWWAGLMRGAVSIALAYNKFTRSGHTQLHGNAI  420

Query  666   MItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQ  487
             MITST+TVVLFST++FG++TKPLI  LLP         S+   SEPSSPK    PLL + 
Sbjct  421   MITSTITVVLFSTMLFGILTKPLIRFLLP-------ASSNGDPSEPSSPKSLHSPLLTSM  473

Query  486   PDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPV  307
                 SDM     + RP++LRML+  PTHT+H YWRKFDD+ MRP+FGGRGFVP+  GSP 
Sbjct  474   LG--SDMEAPLPIVRPSSLRMLITKPTHTIHYYWRKFDDALMRPMFGGRGFVPYSPGSPT  531

Query  306   E  304
             +
Sbjct  532   D  532



>ref|XP_004494660.1| PREDICTED: sodium/hydrogen exchanger 2-like [Cicer arietinum]
Length=541

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/544 (74%), Positives = 458/544 (84%), Gaps = 9/544 (2%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC  1738
             M  G+  +L+     TSD+ASV+SMNLFVALLCACIV+GHLLEEN W+NESITAL+IGLC
Sbjct  1     MGVGMLEMLK-----TSDYASVISMNLFVALLCACIVIGHLLEENPWMNESITALLIGLC  55

Query  1737  TGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGT  1558
             TGVVIL LSGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKK+FFVNF+TIM+FGAIGT
Sbjct  56    TGVVILWLSGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKRFFVNFITIMMFGAIGT  115

Query  1557  LISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVF  1378
             LISCSII+FG  +IFK + I  LD G+ LAIGAIFAATDSVCTLQVL+QDETPLLYS+VF
Sbjct  116   LISCSIITFGVSQIFKRMGIGTLDLGESLAIGAIFAATDSVCTLQVLNQDETPLLYSIVF  175

Query  1377  GEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIK  1198
             GEGVVNDATSVVLFNAI+SFD+   D  I L F GNFLYLF++ST LGV  GLL AYIIK
Sbjct  176   GEGVVNDATSVVLFNAIKSFDLEQLDHGIALLFFGNFLYLFIASTLLGVLGGLLTAYIIK  235

Query  1197  KLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT  1018
             KLYFGRHSTDREVALMMLM+YL+YI+AEL+YLSGILTVFFCGIVMSHYTWHNVTESSR+T
Sbjct  236   KLYFGRHSTDREVALMMLMAYLTYILAELWYLSGILTVFFCGIVMSHYTWHNVTESSRIT  295

Query  1017  TRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVF  838
             T+H+FATLSFVAETF+FLYVGMDALDIEKW+FV +  G SV VSS+L+ L+L+GRAAFVF
Sbjct  296   TKHAFATLSFVAETFLFLYVGMDALDIEKWRFVSDRPGTSVIVSSVLLALVLIGRAAFVF  355

Query  837   PLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMIt  658
             PLSFLSNL KK+ ++KISFRQQIIIWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMIT
Sbjct  356   PLSFLSNLTKKSQNEKISFRQQIIIWWAGLMRGAVSMALAYNEFTMSGHTQLRFNAIMIT  415

Query  657   stvtvvlfstvvFGLMTKPLINLLLP--PHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQP  484
             ST+TVVL ST+VFG+MTKPLI  LLP  P  +  +   ++  S P SPK   VP L +  
Sbjct  416   STITVVLVSTMVFGMMTKPLIRYLLPLGPPPKRKNSMVNLEDSSP-SPKSINVPFLGDNQ  474

Query  483   DSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             DSE +     +   P+++R LL TPTHTVH  WRKFDD+FMRPVFGGRGFVP    +P E
Sbjct  475   DSEVETDVN-DSQGPSSIRDLLTTPTHTVHHLWRKFDDAFMRPVFGGRGFVPVAPSTPTE  533

Query  303   QSPR  292
              + +
Sbjct  534   YNAK  537



>gb|AAR19752.1| Na+/H+ antiporter [Lophopyrum elongatum]
Length=539

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/526 (74%), Positives = 443/526 (84%), Gaps = 10/526 (2%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVVS+NLFVALLCACIVLGHLLEENRW+NESITALIIGLCTGVVIL+ + GKS
Sbjct  17    LGTSDHASVVSINLFVALLCACIVLGHLLEENRWLNESITALIIGLCTGVVILMTTKGKS  76

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GT++S   IS  A+ 
Sbjct  77    SHVLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTMMSFFTISLAAIA  136

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
             IF  ++I  LD  D+LAIGAIF+ATDSVCTLQVL+QDETP LYSLVFGEGVVNDATSVVL
Sbjct  137   IFSKMNIGTLDVSDFLAIGAIFSATDSVCTLQVLNQDETPFLYSLVFGEGVVNDATSVVL  196

Query  1338  FNAIQSFDMTS-FDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDRE  1162
             FNA+Q+FD  S  D  + L F+GN  YLF+SSTFLGV  GLL AY+IKKLY GRHSTDRE
Sbjct  197   FNALQNFDPNSKIDAIVILKFLGNLCYLFVSSTFLGVFTGLLSAYVIKKLYIGRHSTDRE  256

Query  1161  VAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVA  982
             VAL+MLM+YLSY++AE   LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+A
Sbjct  257   VALVMLMAYLSYMLAEPLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIA  316

Query  981   ETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKN  802
             ETF+FLYVGMDALDIEKWKF  +S G S+ +SSIL+GL+LVGRAAFVFPLSFLSNL KK 
Sbjct  317   ETFLFLYVGMDALDIEKWKFASDSPGKSIGISSILLGLVLVGRAAFVFPLSFLSNLTKKT  376

Query  801   SSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvv  622
               +KIS+RQQI+IWWAGLMRGAVSIALAYNKFT SGHT LH NAIMITST+TVVLFST++
Sbjct  377   ELEKISWRQQIVIWWAGLMRGAVSIALAYNKFTRSGHTQLHGNAIMITSTITVVLFSTML  436

Query  621   FGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVAR  442
             FG++TKPLI  LLP         S+   S+P+SPK    PLL +Q    SD+     + R
Sbjct  437   FGILTKPLIRFLLP-------ASSNGAASDPASPKSLHSPLLTSQLG--SDLEAPLPIVR  487

Query  441   PTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             P++LRML+  PTHT+H YWRKFDD+ MRP+FGGRGFVP+  GSP +
Sbjct  488   PSSLRMLITKPTHTIHYYWRKFDDALMRPMFGGRGFVPYSPGSPTD  533



>ref|XP_007154223.1| hypothetical protein PHAVU_003G1006000g [Phaseolus vulgaris]
 gb|ESW26217.1| hypothetical protein PHAVU_003G1006000g [Phaseolus vulgaris]
Length=546

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/534 (74%), Positives = 442/534 (83%), Gaps = 10/534 (2%)
 Frame = -3

Query  1884  SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsgg  1705
             + + TSDHASVVSMN+FVALLCACI++GHLLEENRW+NESITAL+IGLCTGV ILL SGG
Sbjct  11    TTVMTSDHASVVSMNIFVALLCACIIIGHLLEENRWINESITALLIGLCTGVSILLTSGG  70

Query  1704  ksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGA  1525
             KSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+GTLIS  IIS GA
Sbjct  71    KSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVGTLISFCIISLGA  130

Query  1524  VKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSV  1345
             +  F+ LDI  L  GD+LAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSV
Sbjct  131   IHFFQKLDIGSLKLGDFLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSV  190

Query  1344  VLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFG---RHS  1174
             VLF AIQ+FD++  D    L  IGNFLYLF++ST LG+  GLL AYIIKKLYFG   RHS
Sbjct  191   VLFKAIQNFDLSHIDLSTALQLIGNFLYLFIASTVLGIFAGLLSAYIIKKLYFGKLIRHS  250

Query  1173  TDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATL  994
             TDREVALM+LM+YLSY++AELF LS ILTVFFCGIVMSHYTWHNVTESSRVTT+H FATL
Sbjct  251   TDREVALMVLMAYLSYMLAELFSLSAILTVFFCGIVMSHYTWHNVTESSRVTTKHVFATL  310

Query  993   SFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNL  814
             SF+AE FIFLYVGMDALDIEKW+ V  S   S+ VSS+L+ LILVGRAAFVFPLSFLSNL
Sbjct  311   SFIAEIFIFLYVGMDALDIEKWRIVSESPRKSIGVSSLLLALILVGRAAFVFPLSFLSNL  370

Query  813   AKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlf  634
              KK+ ++K   +QQ+ IWWAGLMRGAVSIALAYN+FT SGHT L ENAIMITST+TVVLF
Sbjct  371   FKKSQAEKTDLKQQVTIWWAGLMRGAVSIALAYNQFTRSGHTKLRENAIMITSTITVVLF  430

Query  633   stvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITG-  457
             ST+ FGLMTKPL+ LLLP  K     H     S PS+PK FTVPLL +  +  S    G 
Sbjct  431   STLAFGLMTKPLVRLLLPSSK-----HVMSLASPPSTPKSFTVPLLGSGREDSSWANGGT  485

Query  456   PEVARPTALRMLLR-TPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             P    PT  RMLL   PT  VH YWRKFDDS MRPVFGGRGFVP+V GSP+EQ+
Sbjct  486   PNGPPPTTFRMLLSCIPTRGVHHYWRKFDDSVMRPVFGGRGFVPYVPGSPLEQT  539



>ref|XP_009628390.1| PREDICTED: sodium/hydrogen exchanger 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=535

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/529 (73%), Positives = 447/529 (84%), Gaps = 17/529 (3%)
 Frame = -3

Query  1881  DLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggk  1702
             D+  SDHASVVS+NLF+AL+CACIV+GHLLEENRW+NESITAL+IGLCTG +ILL+SGGK
Sbjct  14    DIGASDHASVVSINLFIALICACIVIGHLLEENRWMNESITALLIGLCTGALILLISGGK  73

Query  1701  sshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAV  1522
             SSH+ +FS DLFFIYLLPPIIFNAGFQVKKKQFF NFMTI+LFGA+GTLIS  IIS GA+
Sbjct  74    SSHVFMFSADLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIILFGALGTLISFVIISLGAI  133

Query  1521  KIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVV  1342
              IF+ ++I  L+ GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGV+NDATSVV
Sbjct  134   GIFRKINIGKLEIGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVLNDATSVV  193

Query  1341  LFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDRE  1162
             LFNA+Q+FD++  +  I L  +GNFLYLF+SSTFLG   GLL AYIIKKL FGRHSTDRE
Sbjct  194   LFNAVQNFDLSHINTSIALQLLGNFLYLFISSTFLGFVAGLLSAYIIKKLCFGRHSTDRE  253

Query  1161  VAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVA  982
             V++M+LM+YLSY++AELF LS ILTVFFCGIVMSHYTW+NVTE+SR TT+H+FATLSF+A
Sbjct  254   VSIMILMAYLSYMLAELFSLSAILTVFFCGIVMSHYTWYNVTENSRCTTKHTFATLSFIA  313

Query  981   ETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKN  802
             E FIFLYVGMDALDIEKW+FV +S G+SV VSSIL+GL+LVGRAAFVFPLSFLSNL KK+
Sbjct  314   EIFIFLYVGMDALDIEKWRFVSDSPGISVEVSSILLGLVLVGRAAFVFPLSFLSNLTKKS  373

Query  801   SSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvv  622
               +K  F+QQ+ IWWAGLMRGAVS+ALAYN+FT  GHT L  NAIMITST+TVVLFSTVV
Sbjct  374   PHEKTDFKQQVTIWWAGLMRGAVSMALAYNQFTKEGHTQLRGNAIMITSTITVVLFSTVV  433

Query  621   FGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHF-TVPLLDNQPDSESDMITGPEVA  445
             FGLMTKPLI LLLP                P +PK F  VPLL N  DSE+D+       
Sbjct  434   FGLMTKPLIRLLLP---------------SPGTPKSFINVPLLGNGQDSEADL-GAHNFP  477

Query  444   RPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             RP +LRM L TP++TVH YWRKFD++FMRPVFGGRGFVP+V GSP E S
Sbjct  478   RPNSLRMFLSTPSYTVHYYWRKFDNAFMRPVFGGRGFVPYVPGSPTEGS  526



>ref|XP_009628391.1| PREDICTED: sodium/hydrogen exchanger 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=526

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/529 (73%), Positives = 447/529 (84%), Gaps = 17/529 (3%)
 Frame = -3

Query  1881  DLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggk  1702
             D+  SDHASVVS+NLF+AL+CACIV+GHLLEENRW+NESITAL+IGLCTG +ILL+SGGK
Sbjct  5     DIGASDHASVVSINLFIALICACIVIGHLLEENRWMNESITALLIGLCTGALILLISGGK  64

Query  1701  sshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAV  1522
             SSH+ +FS DLFFIYLLPPIIFNAGFQVKKKQFF NFMTI+LFGA+GTLIS  IIS GA+
Sbjct  65    SSHVFMFSADLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIILFGALGTLISFVIISLGAI  124

Query  1521  KIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVV  1342
              IF+ ++I  L+ GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGV+NDATSVV
Sbjct  125   GIFRKINIGKLEIGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVLNDATSVV  184

Query  1341  LFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDRE  1162
             LFNA+Q+FD++  +  I L  +GNFLYLF+SSTFLG   GLL AYIIKKL FGRHSTDRE
Sbjct  185   LFNAVQNFDLSHINTSIALQLLGNFLYLFISSTFLGFVAGLLSAYIIKKLCFGRHSTDRE  244

Query  1161  VAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVA  982
             V++M+LM+YLSY++AELF LS ILTVFFCGIVMSHYTW+NVTE+SR TT+H+FATLSF+A
Sbjct  245   VSIMILMAYLSYMLAELFSLSAILTVFFCGIVMSHYTWYNVTENSRCTTKHTFATLSFIA  304

Query  981   ETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKN  802
             E FIFLYVGMDALDIEKW+FV +S G+SV VSSIL+GL+LVGRAAFVFPLSFLSNL KK+
Sbjct  305   EIFIFLYVGMDALDIEKWRFVSDSPGISVEVSSILLGLVLVGRAAFVFPLSFLSNLTKKS  364

Query  801   SSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvv  622
               +K  F+QQ+ IWWAGLMRGAVS+ALAYN+FT  GHT L  NAIMITST+TVVLFSTVV
Sbjct  365   PHEKTDFKQQVTIWWAGLMRGAVSMALAYNQFTKEGHTQLRGNAIMITSTITVVLFSTVV  424

Query  621   FGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHF-TVPLLDNQPDSESDMITGPEVA  445
             FGLMTKPLI LLLP                P +PK F  VPLL N  DSE+D+       
Sbjct  425   FGLMTKPLIRLLLP---------------SPGTPKSFINVPLLGNGQDSEADL-GAHNFP  468

Query  444   RPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             RP +LRM L TP++TVH YWRKFD++FMRPVFGGRGFVP+V GSP E S
Sbjct  469   RPNSLRMFLSTPSYTVHYYWRKFDNAFMRPVFGGRGFVPYVPGSPTEGS  517



>ref|XP_006287445.1| hypothetical protein CARUB_v10000654mg [Capsella rubella]
 gb|EOA20343.1| hypothetical protein CARUB_v10000654mg [Capsella rubella]
Length=541

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/546 (74%), Positives = 458/546 (84%), Gaps = 15/546 (3%)
 Frame = -3

Query  1923  TKMAFGLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             T +A  L S++  S L TSDHASVV++NLFVALLCACIVLGHLLEENRW+NESITAL+IG
Sbjct  2     TMLATHLDSIV--SKLTTSDHASVVALNLFVALLCACIVLGHLLEENRWMNESITALLIG  59

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             L TGV ILL+S GKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA+
Sbjct  60    LGTGVAILLISKGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGAV  119

Query  1563  GTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSL  1384
             GT+ISC+IIS G  + FK LDI   D GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSL
Sbjct  120   GTIISCTIISLGVTQFFKKLDIGTFDLGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSL  179

Query  1383  VFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYI  1204
             VFGEGVVNDATSVV+FNAIQSFD+T  + +   H +GNFLYLFL ST LG   GL+ AY+
Sbjct  180   VFGEGVVNDATSVVVFNAIQSFDLTHLNHEAAFHLLGNFLYLFLLSTLLGAATGLISAYV  239

Query  1203  IKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  1024
             IKKLYFGRHSTDREVALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR
Sbjct  240   IKKLYFGRHSTDREVALMMLMAYLSYMLAELFELSGILTVFFCGIVMSHYTWHNVTESSR  299

Query  1023  VTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAF  844
             +TT+H+FATLSF+AETFIFLYVGMDALDI+KW+ V ++ G S+AVSSIL+GLI+VGRAAF
Sbjct  300   ITTKHTFATLSFLAETFIFLYVGMDALDIDKWRSVSDTPGTSIAVSSILMGLIMVGRAAF  359

Query  843   VFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIM  664
             VFPLSFLSNLAKKN S+KI F  Q++IWW+GLMRGAVS+ALAYNKFT +GHT +  NAIM
Sbjct  360   VFPLSFLSNLAKKNQSEKIKFNMQVVIWWSGLMRGAVSMALAYNKFTRAGHTEVRGNAIM  419

Query  663   ItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTT---SEPSSPKHFTVPLLD  493
             ITST+TV LFSTVVFG++TKPLI+ LLP        H S TT   S+ ++PK   +PLLD
Sbjct  420   ITSTITVCLFSTVVFGMLTKPLISYLLP--------HQSATTSMLSDDNTPKSIHIPLLD  471

Query  492   NQPDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGS  313
                DS  +      V RP ++R  L  PT TVH YWR+FDDSFMRPVFGGRGFVPFV GS
Sbjct  472   Q--DSFIEPSGNHNVPRPDSIRGFLTRPTRTVHYYWRQFDDSFMRPVFGGRGFVPFVPGS  529

Query  312   PVEQSP  295
             P E+ P
Sbjct  530   PTERDP  535



>ref|XP_003626363.1| Sodium/hydrogen exchanger [Medicago truncatula]
Length=541

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/537 (74%), Positives = 447/537 (83%), Gaps = 24/537 (4%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSD+AS++SMNLFVALLCACIV+GHLLEENRWVNESITAL++GLCTGVVIL +SGGKS
Sbjct  9     LTTSDYASIISMNLFVALLCACIVIGHLLEENRWVNESITALLLGLCTGVVILWISGGKS  68

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKK+FFVNF+TIM FGA+GTLISCSII+FG  +
Sbjct  69    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKRFFVNFITIMSFGAVGTLISCSIITFGVSQ  128

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
             IFK + I  LD G+ +AIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  129   IFKRMGIGTLDLGEAVAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  188

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAI+SFD+   D  I L F GNFLYLF+         GLL AYIIKKLY GRHSTDREV
Sbjct  189   FNAIKSFDLEQLDHGIALQFFGNFLYLFIG--------GLLSAYIIKKLYIGRHSTDREV  240

Query  1158  AlmmlmsylsYIMA-----ELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATL  994
             ALMMLM+YL+YI+A     EL+YLSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATL
Sbjct  241   ALMMLMAYLTYILAEVRSKELWYLSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATL  300

Query  993   SFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNL  814
             SFVAETF+FLYVGMDALDIEKW+FV +  G SV VSS+L+ L+L+GRAAFVFPLSFLSNL
Sbjct  301   SFVAETFLFLYVGMDALDIEKWRFVSDRPGTSVIVSSVLLALVLIGRAAFVFPLSFLSNL  360

Query  813   AKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlf  634
              KK+ ++KISFR+Q+IIWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMITST+TVVL 
Sbjct  361   TKKSQNEKISFRKQVIIWWAGLMRGAVSMALAYNEFTMSGHTQLQFNAIMITSTITVVLV  420

Query  633   stvvFGLMTKPLINLLLP---PHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMI  463
             ST+VFG+MTKPLI  L+P   P KQ     +S+   E SSPK  TVP L  + DSE    
Sbjct  421   STMVFGMMTKPLIRFLIPLGHPPKQ----KNSLANLEESSPKSITVPFLGGRQDSEEVDN  476

Query  462   TGPEVA----RPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
                  A    RP+++R LL TPTHTVHR WRKFDD+ MRPVFGGRGFVP V  SP E
Sbjct  477   DNDNDANDSHRPSSIRDLLTTPTHTVHRLWRKFDDAIMRPVFGGRGFVPVVPTSPTE  533



>ref|XP_009352200.1| PREDICTED: sodium/hydrogen exchanger 2-like [Pyrus x bretschneideri]
 ref|XP_009352201.1| PREDICTED: sodium/hydrogen exchanger 2-like [Pyrus x bretschneideri]
 ref|XP_009352202.1| PREDICTED: sodium/hydrogen exchanger 2-like [Pyrus x bretschneideri]
Length=551

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/549 (73%), Positives = 459/549 (84%), Gaps = 14/549 (3%)
 Frame = -3

Query  1917  MAFGLSSLLQNSD--LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIG  1744
             MA   SS+   S   L +SDH SVVSMNLFVALLCACI+LGHLLEE+RW+NESITAL IG
Sbjct  1     MAVDASSIATESMGILTSSDHKSVVSMNLFVALLCACILLGHLLEESRWMNESITALAIG  60

Query  1743  LCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAI  1564
             LCTGVVILL++GGKSSHLL FSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIM FGA+
Sbjct  61    LCTGVVILLITGGKSSHLLEFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMTFGAV  120

Query  1563  GTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSL  1384
             GTLIS +IIS GA+  F   +I  L  GDYLA+GAIF+ATDSVCTLQVL+QDETPLLYSL
Sbjct  121   GTLISFTIISLGAMHFFHKFNIGSLKIGDYLALGAIFSATDSVCTLQVLNQDETPLLYSL  180

Query  1383  VFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYI  1204
             VFGEGVVNDATS+VLFNAIQSFD++  +    L F GNFLYLF +ST LGV  GLL AYI
Sbjct  181   VFGEGVVNDATSIVLFNAIQSFDLSHINTSTALQFFGNFLYLFATSTMLGVAAGLLSAYI  240

Query  1203  IKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR  1024
             IKKLYFGRHSTDREVALM+LM+YLSYI++ELFYLS ILTVFFCGIVMSHYTWHNVTESSR
Sbjct  241   IKKLYFGRHSTDREVALMILMAYLSYILSELFYLSAILTVFFCGIVMSHYTWHNVTESSR  300

Query  1023  VTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAF  844
             VTT+H+FATLSFVAE FIFLYVGMDALDI+KW+FV +S G S+AVSSIL+ L+LVGRAAF
Sbjct  301   VTTKHTFATLSFVAEIFIFLYVGMDALDIDKWRFVSDSPGKSIAVSSILLALVLVGRAAF  360

Query  843   VFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIM  664
             VFPLSFLSNL KK+   K+S ++Q+ +WWAGLMRG+VS+ALAYN+F +SGHT L  NA M
Sbjct  361   VFPLSFLSNLTKKSPQAKLSLKEQVTVWWAGLMRGSVSMALAYNQFNSSGHTDLRANATM  420

Query  663   ItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQP  484
             ITST+TVVLFSTVVFGLMTKPL+ +LLP  K +    SSM +SEPSSPK  TVPLL N  
Sbjct  421   ITSTITVVLFSTVVFGLMTKPLVRILLPVSKHV----SSMISSEPSSPKSITVPLLSNGQ  476

Query  483   DSE-------SDMITGP-EVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVP  328
             DSE       S+   GP ++ RP++LRMLL   +HTVH YWR+FD++FMRPVFGGRGFVP
Sbjct  477   DSEVNRGVEDSEANMGPVDIPRPSSLRMLLGASSHTVHHYWRRFDNAFMRPVFGGRGFVP  536

Query  327   FVAGSPVEQ  301
                GSP E+
Sbjct  537   LGPGSPAEE  545



>ref|XP_006600336.1| PREDICTED: sodium/hydrogen exchanger 2-like [Glycine max]
Length=536

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/533 (74%), Positives = 441/533 (83%), Gaps = 20/533 (4%)
 Frame = -3

Query  1884  SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsgg  1705
             + + TSDHASVVSMNLFVALLCACI++GHLLEENRW+NESITAL+IGLCTGV IL  +GG
Sbjct  13    TTVMTSDHASVVSMNLFVALLCACIIIGHLLEENRWINESITALLIGLCTGVFILFTTGG  72

Query  1704  ksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGA  1525
             KSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+GTLIS  IIS GA
Sbjct  73    KSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVGTLISFCIISLGA  132

Query  1524  VKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSV  1345
             +  F+ LDI  L  GD+LAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSV
Sbjct  133   IHFFQKLDIGSLKIGDFLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSV  192

Query  1344  VLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFG---RHS  1174
             VLF AIQ+FD++  D    L  +GNFLYLF++ST LG+  GLL A+IIKKLYFG   RHS
Sbjct  193   VLFKAIQNFDLSHIDLTTALQLLGNFLYLFIASTVLGIFAGLLSAFIIKKLYFGKLIRHS  252

Query  1173  TDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATL  994
             TDREVALM+LM+YLSY+++ELF LS ILTVFFCGIVMSHYTWHNVTESSRVTT+H FATL
Sbjct  253   TDREVALMVLMAYLSYMLSELFSLSAILTVFFCGIVMSHYTWHNVTESSRVTTKHVFATL  312

Query  993   SFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNL  814
             SF+AE FIFLYVGMDALDIEKW+ V  S   S+ VSS+L+ LILVGRAAFVFPLSFLSNL
Sbjct  313   SFIAEIFIFLYVGMDALDIEKWRIVSQSPRKSIGVSSLLLALILVGRAAFVFPLSFLSNL  372

Query  813   AKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlf  634
              KK+ S+KI  +QQ+ IWWAGLMRGAVSIALAYN+FT  GHT L ENAIMITST+TVVLF
Sbjct  373   LKKSQSEKIELKQQVTIWWAGLMRGAVSIALAYNQFTRLGHTKLRENAIMITSTITVVLF  432

Query  633   stvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGP  454
             ST+ FGLMTKPL+ LLLP  K     H     S PS+PK FTVPLL +Q         GP
Sbjct  433   STLAFGLMTKPLVRLLLPWSK-----HVMSLPSPPSTPKSFTVPLLGSQ--------NGP  479

Query  453   EVARPTALRMLLR-TPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
                 P+ LRMLL   PT  VH YWRKFDDS MRPVFGGRGFVP+V GSP+EQS
Sbjct  480   P---PSTLRMLLSCIPTRGVHHYWRKFDDSVMRPVFGGRGFVPYVPGSPLEQS  529



>ref|XP_009393239.1| PREDICTED: sodium/hydrogen exchanger 2-like [Musa acuminata subsp. 
malaccensis]
Length=545

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/529 (74%), Positives = 455/529 (86%), Gaps = 3/529 (1%)
 Frame = -3

Query  1884  SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsgg  1705
             S L TSDHASVVS+N+FV L+CACIV+GHLLEENRW+NESIT+LIIGLCTG+V+ L + G
Sbjct  15    SGLDTSDHASVVSINIFVTLICACIVIGHLLEENRWMNESITSLIIGLCTGIVLRLATRG  74

Query  1704  ksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGA  1525
              +S ++VFSEDLFFIY+LPPIIFNAGFQVKKKQFF NF+TIMLFGA+GTLIS  IIS GA
Sbjct  75    NNSRVMVFSEDLFFIYVLPPIIFNAGFQVKKKQFFRNFITIMLFGAVGTLISFIIISIGA  134

Query  1524  VKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSV  1345
             V+IF+ +DI  L+ GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSV
Sbjct  135   VEIFRKMDIGALEIGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSV  194

Query  1344  VLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDR  1165
             VLFNAIQ FD+   D  + L F+ NF YLF +ST LG   GLL AYIIKKLYFGRHSTDR
Sbjct  195   VLFNAIQKFDLVHMDVTVVLKFVANFFYLFSTSTLLGALGGLLSAYIIKKLYFGRHSTDR  254

Query  1164  EVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFV  985
             EVALM+LM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+
Sbjct  255   EVALMILMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATLSFI  314

Query  984   AETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKK  805
             AE F+FLYVGMDALDIEKW+FV NS G SV +SSIL+GL+L+GRAAFVFPLSF+SNL+K+
Sbjct  315   AEVFLFLYVGMDALDIEKWQFVSNSPGKSVGLSSILLGLVLIGRAAFVFPLSFISNLSKR  374

Query  804   NSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstv  625
             + +DKI+F+QQ+IIWWAGLMRGAVSIALAYN+FT SGHT    NA MITST+TVVLFST+
Sbjct  375   SQNDKITFKQQVIIWWAGLMRGAVSIALAYNQFTRSGHTHQRGNAFMITSTITVVLFSTM  434

Query  624   vFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVA  445
             VFGLMTKPLI  LLPP  +  +  S   +SEPSSPK F  PLL N   SE +  TG  + 
Sbjct  435   VFGLMTKPLIYFLLPPSMKHLT-RSLSLSSEPSSPKSFLSPLLGNGQGSELE--TGHSIP  491

Query  444   RPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             RPT+LRMLL TP+ +VH YWRKFDD+FMRP+FGGRGFVPFV GSP+E+S
Sbjct  492   RPTSLRMLLMTPSRSVHHYWRKFDDAFMRPMFGGRGFVPFVPGSPIERS  540



>gb|ABQ58865.1| Na+/H+ antiporter [Arabidopsis thaliana]
Length=538

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/531 (75%), Positives = 453/531 (85%), Gaps = 13/531 (2%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVV++NLFVALLCACIVLGHLLEENRW+NESITAL+IGL TGV ILL+S GKS
Sbjct  12    LSTSDHASVVALNLFVALLCACIVLGHLLEENRWMNESITALLIGLGTGVTILLISKGKS  71

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA+GT+ISC+IIS G  +
Sbjct  72    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGAVGTIISCTIISLGVTQ  131

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI+  D GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVV+
Sbjct  132   FFKKLDIETFDLGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVV  191

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T  + +   H +GNFLYLFL ST LG   GL+ AY+IKKLYFGRHSTDREV
Sbjct  192   FNAIQSFDLTHLNHEAAFHLLGNFLYLFLLSTLLGAATGLISAYVIKKLYFGRHSTDREV  251

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AE
Sbjct  252   ALMMLMAYLSYMLAELFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLAE  311

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDI+KW+ V ++ G S+AVSSIL+GL++VGRAAFVFPLSFLSNLAKKN 
Sbjct  312   TFIFLYVGMDALDIDKWRSVSDTPGTSIAVSSILMGLVMVGRAAFVFPLSFLSNLAKKNQ  371

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KI+F  Q++IWW+GLMRGAVS+ALAYNKFT +GHT +  NAIMITST+TV LFSTVVF
Sbjct  372   SEKINFNMQVVIWWSGLMRGAVSMALAYNKFTRAGHTDVRGNAIMITSTITVCLFSTVVF  431

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTT---SEPSSPKHFTVPLLDNQPDSESDMITGPEV  448
             G++TKPLI+ LLP        H + TT   S+ ++PK   +PLLD   DS  +      V
Sbjct  432   GMLTKPLISYLLP--------HQNATTSMLSDDNTPKSIHIPLLDQ--DSFIEPSGNHNV  481

Query  447   ARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
              RP ++R  L  PT TVH YWR+FDDSFMRPVFGGRGFVPFV GSP E++P
Sbjct  482   PRPDSIRGFLTRPTRTVHYYWRQFDDSFMRPVFGGRGFVPFVPGSPTERNP  532



>gb|AGG11160.1| NHX-like protein [Olimarabidopsis pumila]
Length=534

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/533 (74%), Positives = 451/533 (85%), Gaps = 14/533 (3%)
 Frame = -3

Query  1884  SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsgg  1705
             S L TSDHASVV++NLFVALLCACIVLGHLLEENRW+NESITAL+IGL TGV ILL+S G
Sbjct  7     SKLTTSDHASVVALNLFVALLCACIVLGHLLEENRWMNESITALLIGLGTGVAILLISKG  66

Query  1704  ksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGA  1525
             KSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA+GT+ISC+IIS G 
Sbjct  67    KSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGAVGTIISCTIISLGV  126

Query  1524  VKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSV  1345
              + FK LDI   D GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSV
Sbjct  127   TQFFKKLDIGTFDLGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSV  186

Query  1344  VLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDR  1165
             V+FNAIQSFD+T  + +   H +GNFLYLFL ST LG   GL+ AY+IKKLYFGRHSTDR
Sbjct  187   VVFNAIQSFDLTHLNHEAAFHLLGNFLYLFLLSTLLGAATGLISAYVIKKLYFGRHSTDR  246

Query  1164  EVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFV  985
             EVALMMLM+YLSY++AELF LSGILTVFFCGIVM+HYTWHNVTESSR+TT+H+FATLSF+
Sbjct  247   EVALMMLMAYLSYMLAELFDLSGILTVFFCGIVMTHYTWHNVTESSRITTKHTFATLSFL  306

Query  984   AETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKK  805
             AETFIFLYVGMDALDI+KW+ V ++ G S+AVSSIL+GL++VGRAAFVFPLSFLSNLAKK
Sbjct  307   AETFIFLYVGMDALDIDKWRSVSDTPGTSIAVSSILMGLVMVGRAAFVFPLSFLSNLAKK  366

Query  804   NSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstv  625
             N S+KI+F  Q++IWW+GLMRGAVS+ALAYNKFT +GHT +  NAIMITST+TV LFSTV
Sbjct  367   NQSEKINFNMQVVIWWSGLMRGAVSMALAYNKFTRAGHTDVRGNAIMITSTITVCLFSTV  426

Query  624   vFGLMTKPLINLLLPPHKQMPSGHSSMTT---SEPSSPKHFTVPLLDNQPDSESDMITGP  454
             VFG++TKPLI+ LLP        H S TT   S+ ++PK   +PL+D     E    +  
Sbjct  427   VFGMLTKPLISYLLP--------HQSATTSMLSDDNTPKSIHIPLIDQDSFIEP---SNH  475

Query  453   EVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
              V RP ++R  L  PT TVH YWR+FDDSFMRPVFGGRGFVPFV GSP E+ P
Sbjct  476   NVPRPDSIRGFLTRPTRTVHYYWRQFDDSFMRPVFGGRGFVPFVPGSPTERDP  528



>ref|NP_198067.1| sodium/hydrogen exchanger 1 [Arabidopsis thaliana]
 sp|Q68KI4.2|NHX1_ARATH RecName: Full=Sodium/hydrogen exchanger 1; AltName: Full=Na(+)/H(+) 
exchanger 1; Short=NHE-1 [Arabidopsis thaliana]
 gb|AAF21755.1|AF056190_1 Na+/H+ exchanger [Arabidopsis thaliana]
 gb|AAD16946.1| sodium proton exchanger Nhx1 [Arabidopsis thaliana]
 dbj|BAE98703.1| Na+/H+ exchanger [Arabidopsis thaliana]
 gb|AED93655.1| sodium/hydrogen exchanger 1 [Arabidopsis thaliana]
 emb|CCH26522.1| Na+/H+ exchanger [Arabidopsis thaliana]
 emb|CCH26523.1| Na+/H+ exchanger [Arabidopsis thaliana]
 emb|CCH26524.1| Na+/H+ exchanger [Arabidopsis thaliana]
 emb|CCH26525.1| Na+/H+ exchanger [Arabidopsis thaliana]
 emb|CCH26526.1| Na+/H+ exchanger [Arabidopsis thaliana]
 emb|CCH26527.1| Na+/H+ exchanger [Arabidopsis thaliana]
 emb|CCH26528.1| Na+/H+ exchanger [Arabidopsis thaliana]
 emb|CCH26529.1| Na+/H+ exchanger [Arabidopsis thaliana]
 emb|CCH26530.1| Na+/H+ exchanger [Arabidopsis thaliana]
 emb|CCH26531.1| Na+/H+ exchanger [Arabidopsis thaliana]
 emb|CCH26532.1| Na+/H+ exchanger [Arabidopsis thaliana]
 emb|CCH26533.1| Na+/H+ exchanger [Arabidopsis thaliana]
 emb|CCH26534.1| Na+/H+ exchanger [Arabidopsis thaliana]
 emb|CCH26535.1| Na+/H+ exchanger [Arabidopsis thaliana]
 emb|CCH26536.1| Na+/H+ exchanger [Arabidopsis thaliana]
 emb|CCH26537.1| Na+/H+ exchanger [Arabidopsis thaliana]
 emb|CCH26538.1| Na+/H+ exchanger [Arabidopsis thaliana]
 emb|CCH26539.1| Na+/H+ exchanger [Arabidopsis thaliana]
 emb|CCH26540.1| Na+/H+ exchanger [Arabidopsis thaliana]
 emb|CCH26541.1| Na+/H+ exchanger [Arabidopsis thaliana]
Length=538

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/531 (75%), Positives = 452/531 (85%), Gaps = 13/531 (2%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVV++NLFVALLCACIVLGHLLEENRW+NESITAL+IGL TGV ILL+S GKS
Sbjct  12    LSTSDHASVVALNLFVALLCACIVLGHLLEENRWMNESITALLIGLGTGVTILLISKGKS  71

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA+GT+ISC+IIS G  +
Sbjct  72    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGAVGTIISCTIISLGVTQ  131

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI   D GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVV+
Sbjct  132   FFKKLDIGTFDLGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVV  191

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T  + +   H +GNFLYLFL ST LG   GL+ AY+IKKLYFGRHSTDREV
Sbjct  192   FNAIQSFDLTHLNHEAAFHLLGNFLYLFLLSTLLGAATGLISAYVIKKLYFGRHSTDREV  251

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AE
Sbjct  252   ALMMLMAYLSYMLAELFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLAE  311

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDI+KW+ V ++ G S+AVSSIL+GL++VGRAAFVFPLSFLSNLAKKN 
Sbjct  312   TFIFLYVGMDALDIDKWRSVSDTPGTSIAVSSILMGLVMVGRAAFVFPLSFLSNLAKKNQ  371

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KI+F  Q++IWW+GLMRGAVS+ALAYNKFT +GHT +  NAIMITST+TV LFSTVVF
Sbjct  372   SEKINFNMQVVIWWSGLMRGAVSMALAYNKFTRAGHTDVRGNAIMITSTITVCLFSTVVF  431

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTT---SEPSSPKHFTVPLLDNQPDSESDMITGPEV  448
             G++TKPLI+ LLP        H + TT   S+ ++PK   +PLLD   DS  +      V
Sbjct  432   GMLTKPLISYLLP--------HQNATTSMLSDDNTPKSIHIPLLDQ--DSFIEPSGNHNV  481

Query  447   ARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
              RP ++R  L  PT TVH YWR+FDDSFMRPVFGGRGFVPFV GSP E++P
Sbjct  482   PRPDSIRGFLTRPTRTVHYYWRQFDDSFMRPVFGGRGFVPFVPGSPTERNP  532



>gb|AEA51351.1| Na+/H+ antiporter-like protein [Olimarabidopsis pumila]
Length=538

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/531 (75%), Positives = 452/531 (85%), Gaps = 13/531 (2%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVV++NLFVALLCACIVLGHLLEENRW+NESITAL+IGL TGV ILL+S GKS
Sbjct  12    LSTSDHASVVALNLFVALLCACIVLGHLLEENRWMNESITALLIGLGTGVTILLISKGKS  71

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA+GT+ISC+IIS G  +
Sbjct  72    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFCNFVTIMLFGAVGTIISCTIISLGVAQ  131

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI   D GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVV+
Sbjct  132   FFKKLDIGTFDLGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVV  191

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T  + +   H +GNFLYLFL ST LG   GL+ AY+IKKLYFGRHSTDREV
Sbjct  192   FNAIQSFDLTHLNHEAAFHLLGNFLYLFLLSTLLGAATGLISAYVIKKLYFGRHSTDREV  251

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AE
Sbjct  252   ALMMLMAYLSYMLAELFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLAE  311

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDI+KW+ V ++ G S+AVSSIL+GL++VGRAAFVFPLSFLSNLAKKN 
Sbjct  312   TFIFLYVGMDALDIDKWRSVSDTPGTSIAVSSILMGLVMVGRAAFVFPLSFLSNLAKKNQ  371

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KI+F  Q++IWW+GLMRGAVS+ALAYNKFT +GHT +  NAIMITST+TV LFSTVVF
Sbjct  372   SEKINFNMQVVIWWSGLMRGAVSMALAYNKFTRAGHTDVRGNAIMITSTITVCLFSTVVF  431

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTT---SEPSSPKHFTVPLLDNQPDSESDMITGPEV  448
             G++TKPLI+ LLP        H + TT   S+ ++PK   +PLLD   DS  +      V
Sbjct  432   GMLTKPLISYLLP--------HQNATTSMLSDDNTPKSIHIPLLDQ--DSFIEPSGNHNV  481

Query  447   ARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
              RP ++R  L  PT TVH YWR+FDDSFMRPVFGGRGFVPFV GSP E++P
Sbjct  482   PRPDSIRGFLTRPTRTVHYYWRQFDDSFMRPVFGGRGFVPFVPGSPTERNP  532



>ref|NP_001105224.1| Na+/H+ antiporter NHX6 [Zea mays]
 gb|AAP20433.1| Na+/H+ antiporter NHX6 [Zea mays]
Length=541

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/526 (73%), Positives = 446/526 (85%), Gaps = 8/526 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS+NLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILL + GKSSH
Sbjct  18    TSDHASVVSINLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILLTTKGKSSH  77

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             +LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GT+IS   IS GA+ + 
Sbjct  78    ILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTMISFFTISLGALGLI  137

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
               L+I  L+ GDYLA+GAIF+ATDSVCTLQVLSQDETP LYSLVFGEGVVNDATSVV+FN
Sbjct  138   SRLNIGALELGDYLALGAIFSATDSVCTLQVLSQDETPFLYSLVFGEGVVNDATSVVVFN  197

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+Q+FD+T  D ++  H +GNF YLFL ST LGV  GL+ A +IKKLYFGRHSTDREVAL
Sbjct  198   ALQNFDITHIDAEVVFHLLGNFFYLFLLSTVLGVATGLISALVIKKLYFGRHSTDREVAL  257

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AELF LSGILTVFF  IVMSHYTWHNVTESSR+TT+H+FATLSF+AETF
Sbjct  258   MMLMAYLSYMLAELFALSGILTVFFGCIVMSHYTWHNVTESSRITTKHAFATLSFLAETF  317

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDI+KW+ V ++ G S+A+SSIL+GL++VGRAAFVFPLSFLSNLAKK   +
Sbjct  318   LFLYVGMDALDIDKWRSVSDTPGKSLAISSILMGLVMVGRAAFVFPLSFLSNLAKKTEHE  377

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KIS++QQ++IWWAGLMRGAVS+ALAY KFT +GHT +  NAIMITST+ VVLFST+VFGL
Sbjct  378   KISWKQQVVIWWAGLMRGAVSMALAYKKFTRAGHTQVRGNAIMITSTIIVVLFSTMVFGL  437

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             +TKPLINLL+ PH+   S       S+ SSPK    PLL +Q    SD+     + RP++
Sbjct  438   LTKPLINLLI-PHRNATS-----MLSDDSSPKSLHSPLLTSQLG--SDLEEPTNIPRPSS  489

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
             +R    T T TVHRYWRKFDD+FMRP+FGGRGFVPFV GSP E++P
Sbjct  490   IRGEFLTMTRTVHRYWRKFDDAFMRPMFGGRGFVPFVPGSPTERNP  535



>ref|XP_010036683.1| PREDICTED: sodium/hydrogen exchanger 3-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010036691.1| PREDICTED: sodium/hydrogen exchanger 3-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW84408.1| hypothetical protein EUGRSUZ_B01263 [Eucalyptus grandis]
Length=538

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/526 (75%), Positives = 445/526 (85%), Gaps = 6/526 (1%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDH+SVVSMNLFVALLCACIV+GHLLEE RW+NESITAL IGLCTGVVILL + GKS
Sbjct  13    LMTSDHSSVVSMNLFVALLCACIVVGHLLEEYRWMNESITALAIGLCTGVVILLTTQGKS  72

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             S L+VFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGAIGTLIS  IIS GAV 
Sbjct  73    SRLMVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAIGTLISFGIISLGAVH  132

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
             IF+ ++I  L+  DYLAIGAI +ATDSVCTLQVL+QDETPLLYSLVFGEGVVNDA SVVL
Sbjct  133   IFQKMNIGPLEMRDYLAIGAILSATDSVCTLQVLNQDETPLLYSLVFGEGVVNDAASVVL  192

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAI+SFD+T  + +I L F+GNFLYLF+ ST LGV  GLL AYI+KKLYFGRHSTDREV
Sbjct  193   FNAIKSFDITHINSRIALEFMGNFLYLFILSTMLGVLAGLLSAYIVKKLYFGRHSTDREV  252

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALM+LM+YLSY++AE FYLS ILTVFFCGIVMSHYTWHNVTESSRVTT+H FATLSFVAE
Sbjct  253   ALMILMAYLSYMLAEFFYLSAILTVFFCGIVMSHYTWHNVTESSRVTTKHVFATLSFVAE  312

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              FIFLYVGMDALDIEKW  V NS G S+ VSSIL+GL+L+GRAAFVFPLSFLSNL +K+ 
Sbjct  313   IFIFLYVGMDALDIEKWGVVSNSPGKSIKVSSILLGLVLIGRAAFVFPLSFLSNLTRKSK  372

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
              +KI  +QQ+ IWWAGLMRGAVS+ALAYN+FT S    L  NA MITST+TVVLFSTVVF
Sbjct  373   YEKIDLKQQVTIWWAGLMRGAVSMALAYNQFTRSD-AKLRGNAFMITSTITVVLFSTVVF  431

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARP  439
             GL+TKPL+ +LLP  K      +S T+SEPSSPK FT PLL N  D E+    G  + RP
Sbjct  432   GLLTKPLVRILLPSTKYF----ASTTSSEPSSPKSFTQPLLSNGHDLETHQ-NGKSILRP  486

Query  438   TALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             ++LR LL TP+HTVH YWRKFDD+FMRPVFGGRGFVPF+  SP +Q
Sbjct  487   SSLRKLLSTPSHTVHHYWRKFDDAFMRPVFGGRGFVPFIPCSPTDQ  532



>ref|XP_002874403.1| hypothetical protein ARALYDRAFT_910883 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50662.1| hypothetical protein ARALYDRAFT_910883 [Arabidopsis lyrata subsp. 
lyrata]
Length=542

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/531 (74%), Positives = 451/531 (85%), Gaps = 13/531 (2%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVV++NLFVALLCACIVLGHLLEENRW+NESITAL+IGL TGV ILL+S GKS
Sbjct  16    LSTSDHASVVALNLFVALLCACIVLGHLLEENRWMNESITALLIGLGTGVAILLISKGKS  75

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA+GT+ISC+IIS G  +
Sbjct  76    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGAVGTIISCTIISLGVTQ  135

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI   D GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVV+
Sbjct  136   FFKKLDIGTFDLGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVV  195

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T  + +   H +GNFLYLFL ST LG   GL+ AY+IKKLYFGRHSTDREV
Sbjct  196   FNAIQSFDLTHLNHEAAFHLLGNFLYLFLLSTLLGAATGLISAYVIKKLYFGRHSTDREV  255

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AE
Sbjct  256   ALMMLMAYLSYMLAELFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLAE  315

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDI+KW+ V ++ G S+AVSSIL+GL+++GRAAFVFPLSFLSNLAKKN 
Sbjct  316   TFIFLYVGMDALDIDKWRSVSDTPGTSIAVSSILMGLVMLGRAAFVFPLSFLSNLAKKNQ  375

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KI F  Q++IWW+GLMRGAVS+ALAYNKFT +GHT +  NAIMITST+TV LFSTVVF
Sbjct  376   SEKIKFNMQVVIWWSGLMRGAVSMALAYNKFTRAGHTDVRGNAIMITSTITVCLFSTVVF  435

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTT---SEPSSPKHFTVPLLDNQPDSESDMITGPEV  448
             G++TKPLI+ LLP        H + TT   S+ ++PK   +PLLD   DS  +      V
Sbjct  436   GMLTKPLISYLLP--------HQNATTSMLSDDNTPKSIHIPLLDQ--DSFIEPSGNHNV  485

Query  447   ARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
              RP ++R  L  PT TVH YWR+FDDSFMRPVFGGRGFVPFV GSP E++P
Sbjct  486   PRPDSIRGFLTRPTRTVHYYWRQFDDSFMRPVFGGRGFVPFVPGSPTERNP  536



>gb|ACN40903.1| unknown [Picea sitchensis]
Length=552

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/521 (73%), Positives = 443/521 (85%), Gaps = 7/521 (1%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDH+SVV++ LFV LLCACIV+GHLLEENRW++ESITALIIGLCTGV++LL S GKSSH
Sbjct  28    TSDHSSVVAITLFVTLLCACIVIGHLLEENRWMSESITALIIGLCTGVIVLLFSQGKSSH  87

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             +++FSE+LFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA+GT IS SI+S GA+ +F
Sbjct  88    IMLFSEELFFIYLLPPIIFNAGFQVKKKQFFRNFITIMLFGAVGTFISFSIVSAGAMLLF  147

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             K  DI   + GDYLAIG IF+ATDSVCTLQ+LSQDETPLLYSLVFGEGVVNDATS+VLFN
Sbjct  148   KKFDIGPFEIGDYLAIGTIFSATDSVCTLQILSQDETPLLYSLVFGEGVVNDATSIVLFN  207

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+ +FD+T  D    L   GNF+YLFL+ST LG+G GLL AYIIK LYFGRHSTDREVA+
Sbjct  208   AVHNFDLTHIDGSTALQLFGNFVYLFLTSTALGIGAGLLSAYIIKALYFGRHSTDREVAI  267

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             M+LMSYLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FAT+SF+AETF
Sbjct  268   MILMSYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRITTKHAFATMSFIAETF  327

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALDIEKWK  K S G SV +S +L+GLILVGRAAFVFPLSFLSN  K+  + 
Sbjct  328   IFLYVGMDALDIEKWKMAKRSPGTSVGLSGVLLGLILVGRAAFVFPLSFLSNCLKRTPNS  387

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             +I FRQQ +IWWAGLMRGAVS+ALAYN+FT SG T L ENAIMITST++VVLFSTVVFG+
Sbjct  388   RIGFRQQFVIWWAGLMRGAVSMALAYNQFTRSGLTKLPENAIMITSTISVVLFSTVVFGM  447

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             +TKPLI LLLP   +   G  +  TS+PSSPK   +PLL N    E+  I G  V RP++
Sbjct  448   ITKPLIRLLLPQSSK--PGQDN--TSDPSSPKGLHIPLLGN---GEAVDIDGCHVRRPSS  500

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSP  310
             LRMLL+ P+ TVH YWRKFDD++MRP+FGGRGFVPFV  SP
Sbjct  501   LRMLLQAPSFTVHYYWRKFDDAYMRPMFGGRGFVPFVPSSP  541



>ref|XP_009777204.1| PREDICTED: sodium/hydrogen exchanger 1-like [Nicotiana sylvestris]
Length=543

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/541 (72%), Positives = 451/541 (83%), Gaps = 18/541 (3%)
 Frame = -3

Query  1914  AFGLSSLLQNSD-LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC  1738
              F + +LL+    L+T DH SVVS+NLFVAL+CACIV+GHLLEENRW+NESITAL IGLC
Sbjct  3     GFDIGALLEKLKMLWTLDHGSVVSINLFVALMCACIVIGHLLEENRWMNESITALTIGLC  62

Query  1737  TGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGT  1558
             TGV ILL+SGGKSSH+ +FS DLFFIYLLPPIIFNAGFQVKKKQFF NFMTI+LFGA+GT
Sbjct  63    TGVWILLISGGKSSHVFMFSADLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIILFGALGT  122

Query  1557  LISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVF  1378
             LIS  IIS GA+ IF+ ++I  L+ GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLVF
Sbjct  123   LISFVIISLGAIGIFRKMNIGKLETGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVF  182

Query  1377  GEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIK  1198
             GEGV+NDATSVVLFNA+Q+FD++  +  I L  +GNFLYLF+SSTFLG   GLL AYIIK
Sbjct  183   GEGVLNDATSVVLFNAVQNFDLSHINTSIALQLLGNFLYLFISSTFLGFVAGLLSAYIIK  242

Query  1197  KLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT  1018
             KL FGRHSTDREV++M+LM+YLSY++AELF LS ILTVFFCGIVMSHYTWHNVTE+SR T
Sbjct  243   KLCFGRHSTDREVSIMILMAYLSYMLAELFNLSAILTVFFCGIVMSHYTWHNVTENSRCT  302

Query  1017  TRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVF  838
             T+H+FATLSFVAE FIFLYVGMDALDIEKW+FV +S G+SV VSSIL+GL+LVGRAAFVF
Sbjct  303   TKHTFATLSFVAEIFIFLYVGMDALDIEKWRFVSDSPGISVEVSSILLGLVLVGRAAFVF  362

Query  837   PLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMIt  658
             PLSFLSNL KK+  +KI F+QQ+II WAGLMRGAVS+ALAYN+FT  GHT L  NAIMIT
Sbjct  363   PLSFLSNLTKKSPHEKIDFKQQVIICWAGLMRGAVSMALAYNQFTKEGHTQLRGNAIMIT  422

Query  657   stvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHF-TVPLLDNQPD  481
             ST+TVVLFSTVVFGLMTKPLI LLLP                P +PK F  VPLL N  D
Sbjct  423   STITVVLFSTVVFGLMTKPLIRLLLP---------------SPGTPKSFINVPLLGNGRD  467

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE+D+       RP +LRM L TP++TVH YWRKFD++FMRPVFGGRGFVP+  G+P E 
Sbjct  468   SEADL-GAHNFPRPNSLRMFLSTPSYTVHYYWRKFDNTFMRPVFGGRGFVPYAPGTPTEG  526

Query  300   S  298
             S
Sbjct  527   S  527



>gb|AAM34759.1|AF510074_1 Na+/H+ antiporter [Arabidopsis thaliana]
Length=538

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/531 (74%), Positives = 451/531 (85%), Gaps = 13/531 (2%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVV++NLFVALLCACIVLGHLLEENRW+NESITAL+IGL T V ILL+S GKS
Sbjct  12    LSTSDHASVVALNLFVALLCACIVLGHLLEENRWMNESITALLIGLGTSVTILLISKGKS  71

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA+GT+ISC+IIS G  +
Sbjct  72    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGAVGTIISCTIISLGVTQ  131

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI   D GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVV+
Sbjct  132   FFKKLDIGTFDMGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVV  191

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T  + +   H +GNFLYLFL ST LG   GL+ AY+IKKLYFGRHSTDREV
Sbjct  192   FNAIQSFDLTHLNHEAAFHLLGNFLYLFLLSTLLGAATGLISAYVIKKLYFGRHSTDREV  251

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AE
Sbjct  252   ALMMLMAYLSYMLAELFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLAE  311

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDI+KW+ V ++ G S+AVSSIL+GL++VGRAAFVFPLSFLSNLAKKN 
Sbjct  312   TFIFLYVGMDALDIDKWRSVSDTPGTSIAVSSILMGLVMVGRAAFVFPLSFLSNLAKKNQ  371

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KI+F  Q++IWW+GLMRGAVS+ALAYNKFT +GHT +  NAIMITST+TV LFSTVVF
Sbjct  372   SEKINFNMQVVIWWSGLMRGAVSMALAYNKFTRAGHTDVRGNAIMITSTITVCLFSTVVF  431

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTT---SEPSSPKHFTVPLLDNQPDSESDMITGPEV  448
             G++TKPLI+ LLP        H + TT   S+ ++PK   +PLLD   DS  +      V
Sbjct  432   GMLTKPLISYLLP--------HQNATTSMLSDDNTPKSIHIPLLDQ--DSFIEPSGNHNV  481

Query  447   ARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
              RP ++R  L  PT TVH YWR+FDDSFMRPVFGGRGFVPFV GSP E++P
Sbjct  482   PRPDSIRGFLTRPTRTVHYYWRQFDDSFMRPVFGGRGFVPFVPGSPTERNP  532



>gb|EYU45585.1| hypothetical protein MIMGU_mgv1a004101mg [Erythranthe guttata]
Length=544

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/537 (72%), Positives = 445/537 (83%), Gaps = 30/537 (6%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVV++ LFV LLCACIV+GHLLEENRW+NESITALIIG+ TG++IL+ S GKS
Sbjct  16    LSTSDHASVVAIALFVTLLCACIVIGHLLEENRWMNESITALIIGVVTGILILVTSRGKS  75

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+GTLIS  +IS GA+ 
Sbjct  76    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGALGTLISFIVISLGAIA  135

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              F+ +++  L  GDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL
Sbjct  136   FFERMNVG-LAIGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  194

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNA+Q+FD++     + +  +GNF+YLF+SST LGV  GLL AYIIKKLYFGRHSTDREV
Sbjct  195   FNAVQNFDLSDLSAGVAIKLLGNFIYLFISSTVLGVVAGLLSAYIIKKLYFGRHSTDREV  254

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             A+MMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVT++SRVTT+H+FATLSFVAE
Sbjct  255   AIMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTQNSRVTTKHTFATLSFVAE  314

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              FIFLYVGMDALD+EKW+ V +S   S++VS+ L+GL+L GRAAFVFPLSFLSNL KK  
Sbjct  315   IFIFLYVGMDALDMEKWRVVSDSPKTSLSVSATLLGLVLAGRAAFVFPLSFLSNLTKK--  372

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KI F+QQ+ IWWAGLMRGAVS+ALAYN+FT  GHT LH NA++ITST+TVVLFSTVVF
Sbjct  373   SEKIDFKQQVTIWWAGLMRGAVSMALAYNQFTRDGHTQLHGNALLITSTITVVLFSTVVF  432

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMI--------  463
             GL+TKPL+ LL+                 P +P  FTVPLL    DS S++         
Sbjct  433   GLITKPLVRLLM-----------------PGTPMSFTVPLLGESQDSVSELFDDNGALET  475

Query  462   --TGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
                G  + RP++LRMLL TPT TVH YWRKFDDSFMRPVFGGRGFVP+V GSP EQS
Sbjct  476   RGEGRNLVRPSSLRMLLTTPTRTVHYYWRKFDDSFMRPVFGGRGFVPYVPGSPTEQS  532



>gb|KHF98023.1| Sodium/hydrogen exchanger 2 -like protein [Gossypium arboreum]
Length=534

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/543 (73%), Positives = 449/543 (83%), Gaps = 21/543 (4%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC  1738
             +A  L+++L       SDHASVVSMNLFVALLCA IV+GHLLEENRW+NESITAL IGLC
Sbjct  2     VASQLAAVLSKLQTLYSDHASVVSMNLFVALLCASIVIGHLLEENRWMNESITALAIGLC  61

Query  1737  TGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGT  1558
             TGVVILL SGGKSS LLVFSEDLFFIYLLPPIIFNAGF VKKKQFF NF+TIMLFGA+  
Sbjct  62    TGVVILLTSGGKSSRLLVFSEDLFFIYLLPPIIFNAGFSVKKKQFFRNFITIMLFGAVA-  120

Query  1557  LISCSIISF-GAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
                 S+  + G +K FK +DI  L+ GD+LAIGAIFAATDSV     L+QDETPLLYSLV
Sbjct  121   --KGSVRGWLGVIKFFKEMDIGSLEIGDFLAIGAIFAATDSV-----LNQDETPLLYSLV  173

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD+T+ + +I L FIG+FLYLFL+ST LGV +GL+ AYII
Sbjct  174   FGEGVVNDATSVVLFNAIQSFDLTNTNHRIALEFIGSFLYLFLASTLLGVAVGLVSAYII  233

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             K LYFGRHSTDRE ALMMLM+YLSYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSR+
Sbjct  234   KTLYFGRHSTDREFALMMLMAYLSYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRI  293

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             T++H+FATLSFV ETFIFL+VGMDALDIE WKFV +  G S+ VSS+L+ L++ GRAAFV
Sbjct  294   TSKHAFATLSFVCETFIFLHVGMDALDIETWKFVNDRPGTSIIVSSVLLALVMAGRAAFV  353

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNLA K++++KISFRQQIIIWWAGLMRGAVS+ALAYN+FT +GHT L  NAIMI
Sbjct  354   FPLSFLSNLAHKSANEKISFRQQIIIWWAGLMRGAVSMALAYNQFTRAGHTQLRCNAIMI  413

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHK--QMPSGHSSMTTSEPSSPKHFTVPLLDNQ  487
             TST+TVVLFSTVVFGLMTKPLI  LLP  K    PSG         SSPK  TVP L + 
Sbjct  414   TSTITVVLFSTVVFGLMTKPLIRFLLPNSKVTSAPSG--------SSSPKSITVPFLGST  465

Query  486   PDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPV  307
              DS  D   G  V +P+++R LL TPTHTVH YWRKFD++FMRPVFGGRGFVPFV GSP 
Sbjct  466   QDSFEDSPKG--VQQPSSIRALLTTPTHTVHYYWRKFDNAFMRPVFGGRGFVPFVPGSPA  523

Query  306   EQS  298
             E+S
Sbjct  524   ERS  526



>ref|XP_007050783.1| Sodium/hydrogen exchanger isoform 1 [Theobroma cacao]
 ref|XP_007050784.1| Sodium/hydrogen exchanger isoform 1 [Theobroma cacao]
 gb|EOX94940.1| Sodium/hydrogen exchanger isoform 1 [Theobroma cacao]
 gb|EOX94941.1| Sodium/hydrogen exchanger isoform 1 [Theobroma cacao]
Length=524

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/521 (72%), Positives = 442/521 (85%), Gaps = 6/521 (1%)
 Frame = -3

Query  1866  DHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggksshlL  1687
             D ASV S+ LFVALLC+CIV+GHLLE+NRW NESITAL IGLCTG++IL  + G+ SH+L
Sbjct  6     DQASVDSITLFVALLCSCIVIGHLLEKNRWFNESITALAIGLCTGIIILFTTEGRRSHIL  65

Query  1686  VFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIFKH  1507
             VF+E+LFFIYLLPPIIFNAGFQVKKKQFF NF+ I+LFGA+GTLIS  IIS G++K+FK 
Sbjct  66    VFNEELFFIYLLPPIIFNAGFQVKKKQFFRNFVMIILFGAVGTLISFVIISIGSMKLFKK  125

Query  1506  LDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFNAI  1327
             LD+ FLDFGDYLA+GAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATS+VLFNAI
Sbjct  126   LDVGFLDFGDYLALGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSIVLFNAI  185

Query  1326  QSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAlmm  1147
             Q FD++     I +  +GNF+YLF +ST LGV +GL+ AYIIKKLYFGRHSTDREVALM+
Sbjct  186   QKFDLSHITSSIFMELMGNFVYLFTTSTLLGVVVGLISAYIIKKLYFGRHSTDREVALMI  245

Query  1146  lmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETFIF  967
             LM+YLSY+MAELF LS ILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF++E FIF
Sbjct  246   LMAYLSYMMAELFNLSSILTVFFCGIVMSHYTWHNVTESSRITTKHAFATLSFISEIFIF  305

Query  966   LYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSDKI  787
             LYVGMDALDIEKWK V  S G+S  VSSIL+GL+L+GRAA VFPLSF+SNL+K++ S K+
Sbjct  306   LYVGMDALDIEKWKVVSKSLGISAGVSSILLGLVLIGRAASVFPLSFISNLSKRSQSGKV  365

Query  786   SFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGLMT  607
             +F+QQ+IIWWAGLMRG+VS+ALAYN+FT SGHT L  NAIMITST+TVVLFSTVVFGLMT
Sbjct  366   TFKQQVIIWWAGLMRGSVSMALAYNQFTRSGHTQLRGNAIMITSTITVVLFSTVVFGLMT  425

Query  606   KPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTALR  427
             KPL+ LLL P K +    SS  +SE   PK   +PL+ N   ++S+M  G ++ RP +LR
Sbjct  426   KPLMRLLL-PRKHL----SSAMSSESFLPKPMNLPLIANGQTADSEM-GGDDIPRPASLR  479

Query  426   MLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             MLL TP HTVH YWRKFDDS MRPVFGGRGF P   GSP E
Sbjct  480   MLLTTPAHTVHYYWRKFDDSVMRPVFGGRGFAPCTPGSPTE  520



>ref|XP_010421653.1| PREDICTED: sodium/hydrogen exchanger 1 [Camelina sativa]
 ref|XP_010421654.1| PREDICTED: sodium/hydrogen exchanger 1 [Camelina sativa]
Length=539

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/533 (74%), Positives = 450/533 (84%), Gaps = 13/533 (2%)
 Frame = -3

Query  1884  SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsgg  1705
             S L TSDHASVV++NLFVALLCACIVLGHLLEENRW+NESITAL+IGL TGV ILL+S G
Sbjct  11    SKLTTSDHASVVALNLFVALLCACIVLGHLLEENRWMNESITALLIGLGTGVSILLISKG  70

Query  1704  ksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGA  1525
             KSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA+GT+ISC+IIS G 
Sbjct  71    KSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGAVGTIISCTIISLGV  130

Query  1524  VKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSV  1345
              + FK LDI   D GD LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSV
Sbjct  131   TQFFKKLDIGTFDLGDILAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSV  190

Query  1344  VLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDR  1165
             V+FNAIQSFD+T  + +   H  GNFLYLFL ST LG   GL+ AY+IKKLYFGRHSTDR
Sbjct  191   VVFNAIQSFDLTHLNHEAAFHLFGNFLYLFLLSTLLGAATGLISAYVIKKLYFGRHSTDR  250

Query  1164  EVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFV  985
             EVALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+
Sbjct  251   EVALMMLMAYLSYMLAELFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFL  310

Query  984   AETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKK  805
             AETFIFLYVGMDALDI+KW+ V ++ G S+AVSSIL+GLI+VGRAAF+FPLSFLSNLAKK
Sbjct  311   AETFIFLYVGMDALDIDKWRSVSDTPGTSIAVSSILMGLIMVGRAAFIFPLSFLSNLAKK  370

Query  804   NSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstv  625
             N ++KI+F  QI+IWW+GLMRGAVS+ALAYNKFT +GHT +  NAIMITST+TV LFSTV
Sbjct  371   NQNEKINFNMQIVIWWSGLMRGAVSMALAYNKFTRAGHTEVRGNAIMITSTITVCLFSTV  430

Query  624   vFGLMTKPLINLLLPPHKQMPSGHSSMTT---SEPSSPKHFTVPLLDNQPDSESDMITGP  454
             VFG++TKPLI+ LLP        H S TT   S+ ++PK   +PLLD   DS  +     
Sbjct  431   VFGMLTKPLISYLLP--------HQSATTSMLSDENTPKSIHIPLLDQ--DSFIEPSGNH  480

Query  453   EVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
              V RP ++R  L  PT TVH YWR+FDDSFMRPVFGGRGFVPFV GSP E+ P
Sbjct  481   NVPRPDSIRGFLTRPTRTVHYYWRQFDDSFMRPVFGGRGFVPFVPGSPTERDP  533



>gb|ABS11687.1| Na+/H+ transporter [Robinia pseudoacacia]
Length=535

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/541 (75%), Positives = 457/541 (84%), Gaps = 12/541 (2%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLF-TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             MAF +SS++    +  TSDHASVVSMNLFVALLCACIV+GHLLEENRW+NESITAL+IG+
Sbjct  1     MAFEISSVVSKLQMLSTSDHASVVSMNLFVALLCACIVIGHLLEENRWMNESITALLIGV  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTGVVILL SGGKSSH+LVFSEDLFFIYLLPPIIFNAGFQVKKK+FFVNFMTIM+FGAIG
Sbjct  61    CTGVVILLFSGGKSSHILVFSEDLFFIYLLPPIIFNAGFQVKKKKFFVNFMTIMMFGAIG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLISC++I+ G  ++FK LDI  L+ GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISCTVITLGVTQVFKRLDIGPLEIGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEG VNDATSVVLFNAIQSFD+   DP I LHF+GNFLYLF++ST LGV  GLL AY+I
Sbjct  181   FGEGDVNDATSVVLFNAIQSFDLNQIDPSIALHFLGNFLYLFITSTLLGVLTGLLSAYVI  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLY GRHSTDREVALMMLM+YLSY++AEL YLSGILTVFFCGIVMSHYTWHNVTESSR+
Sbjct  241   KKLYIGRHSTDREVALMMLMAYLSYMLAELTYLSGILTVFFCGIVMSHYTWHNVTESSRI  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSFVAE FIFLYVGMDALDIEKW+FV +S G SVA SS+L+GLILVGRAAFV
Sbjct  301   TTKHAFATLSFVAEIFIFLYVGMDALDIEKWRFVSDSPGTSVAASSVLLGLILVGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNLAKK+SSDKI      ++ W+   R  ++    Y +FT SGHT L  NA MI
Sbjct  361   FPLSFLSNLAKKSSSDKIDH----LVGWS-YERCCLNGTCLY-QFTMSGHTQLRCNAFMI  414

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVL STVVFGLMTKPL  LLLP     P   +SM +++PS+PK   VPLL N  D
Sbjct  415   TSTITVVLVSTVVFGLMTKPLTRLLLP----HPKVTTSMISTDPSTPKSVIVPLLGNAQD  470

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             SE+D+  G E+ RP++LR LL TPTHTVHR WRKFDDSFMRPVFGGRGFVP    SP E+
Sbjct  471   SEADL-DGHEIHRPSSLRALLSTPTHTVHRLWRKFDDSFMRPVFGGRGFVPVEPVSPTER  529

Query  300   S  298
             +
Sbjct  530   N  530



>gb|AAT95387.1| sodium proton exchanger [Arabidopsis thaliana]
Length=538

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/531 (74%), Positives = 452/531 (85%), Gaps = 13/531 (2%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDHASVV++NLFVALLCACIVLGHLL+ENRW+NESITAL+IGL TGV ILL+S GKS
Sbjct  12    LSTSDHASVVALNLFVALLCACIVLGHLLKENRWMNESITALLIGLGTGVTILLISKGKS  71

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA+GT+ISC+IIS G  +
Sbjct  72    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGAVGTIISCTIISLGVTQ  131

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI   D GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVV+
Sbjct  132   FFKKLDIGTFDLGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVV  191

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQSFD+T  + +   H +GNFLYLFL ST LG   GL+ AY+IKKLYFGRHSTDREV
Sbjct  192   FNAIQSFDLTHLNHEAAFHLLGNFLYLFLLSTLLGAATGLISAYVIKKLYFGRHSTDREV  251

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AE
Sbjct  252   ALMMLMAYLSYMLAELFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFLAE  311

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
             TFIFLYVGMDALDI+KW+ V ++ G S+AVSSIL+GL++VGRAAFVFPLSFLSNLAKKN 
Sbjct  312   TFIFLYVGMDALDIDKWRSVSDTPGTSIAVSSILMGLVMVGRAAFVFPLSFLSNLAKKNQ  371

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
             S+KI+F  Q++IWW+GLMRGAVS+ALAYNKFT +GHT +  NAIMITST+TV LFSTVVF
Sbjct  372   SEKINFNMQVVIWWSGLMRGAVSMALAYNKFTRAGHTDVRGNAIMITSTITVCLFSTVVF  431

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTT---SEPSSPKHFTVPLLDNQPDSESDMITGPEV  448
             G++TKPLI+ LLP        H + TT   S+ ++PK   +PLLD   DS  +      V
Sbjct  432   GMLTKPLISYLLP--------HQNATTSMLSDDNTPKSIHIPLLDQ--DSFIEPSGNHNV  481

Query  447   ARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
              +P ++R  L  PT TVH YWR+FDDSFMRPVFGGRGFVPFV GSP E++P
Sbjct  482   PQPDSIRGFLTRPTRTVHYYWRQFDDSFMRPVFGGRGFVPFVPGSPTERNP  532



>ref|XP_010546638.1| PREDICTED: sodium/hydrogen exchanger 2 [Tarenaya hassleriana]
Length=540

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/532 (73%), Positives = 451/532 (85%), Gaps = 13/532 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDH+SVVS+NLFVALLCACIV+GHLLEENRW+NESITAL+IGL TG+VILL+SGGKSS 
Sbjct  20    TSDHSSVVSLNLFVALLCACIVIGHLLEENRWMNESITALLIGLGTGIVILLISGGKSSR  79

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             L+VFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI+LFGAIGT+ISC II+ G  + F
Sbjct  80    LMVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIILFGAIGTIISCIIITLGVTQFF  139

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             K+LDI   D GDYLAIGAIFAATDSVCTLQ+L+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  140   KNLDIGTFDLGDYLAIGAIFAATDSVCTLQILNQDETPLLYSLVFGEGVVNDATSVVLFN  199

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQSFD++  + +  LHF+GNFLYLF+ ST LGV  GL+ AYIIKKLYFGRHSTDREV+L
Sbjct  200   AIQSFDLSHLNLEAALHFLGNFLYLFILSTLLGVATGLVSAYIIKKLYFGRHSTDREVSL  259

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSFVAETF
Sbjct  260   MMLMAYLSYMLAELFELSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFVAETF  319

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALDIEKW+ V +S G SVAVSSIL+GL+++G       +SF+SNL+KKN ++
Sbjct  320   IFLYVGMDALDIEKWRSVSDSPGTSVAVSSILLGLVMLG-------ISFISNLSKKNPNE  372

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI  +QQ++IWWAGLMRGAVS+ALAYNKFT SGHT L  NAIMITST+TV L ST+VFG+
Sbjct  373   KIDIKQQVVIWWAGLMRGAVSMALAYNKFTRSGHTELRGNAIMITSTITVCLVSTMVFGM  432

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLD-NQPDSESDMITGPEVARPT  436
             +TKPLI  LLP  K   S       S+  +PK  T+PLL+  Q DS  +++  PE+ RP 
Sbjct  433   LTKPLIQFLLPQQKATTS-----MLSDGGTPKSITIPLLEGEQQDSFLELVGTPEMQRPN  487

Query  435   ALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSPR*GTK  280
             ++R LL  PT TVH YWRKFDD+FMRPVFGGRGFVPFV GSP E+S    TK
Sbjct  488   SIRALLTRPTRTVHHYWRKFDDAFMRPVFGGRGFVPFVRGSPTERSSHDLTK  539



>ref|XP_010494039.1| PREDICTED: sodium/hydrogen exchanger 1-like [Camelina sativa]
 ref|XP_010494040.1| PREDICTED: sodium/hydrogen exchanger 1-like [Camelina sativa]
Length=539

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/533 (74%), Positives = 450/533 (84%), Gaps = 13/533 (2%)
 Frame = -3

Query  1884  SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsgg  1705
             S L TSDHASVV++NLFVALLCACIVLGHLLEENRW+NESITAL+IGL TGV ILL+S G
Sbjct  11    SKLTTSDHASVVALNLFVALLCACIVLGHLLEENRWMNESITALLIGLGTGVSILLISKG  70

Query  1704  ksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGA  1525
             KSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA+GT+ISC+IIS G 
Sbjct  71    KSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGAVGTIISCTIISLGV  130

Query  1524  VKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSV  1345
              + FK LDI   D GD LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSV
Sbjct  131   TQFFKKLDIGTFDLGDILAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSV  190

Query  1344  VLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDR  1165
             V+FNAIQSFD+T  + +   H  GNFLYLFL ST LG   GL+ AY+IKKLYFGRHSTDR
Sbjct  191   VVFNAIQSFDLTHLNHEAAFHLFGNFLYLFLLSTLLGAVTGLISAYVIKKLYFGRHSTDR  250

Query  1164  EVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFV  985
             EVALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+
Sbjct  251   EVALMMLMAYLSYMLAELFDLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFL  310

Query  984   AETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKK  805
             AETFIFLYVGMDALDI+KW+ V ++ G S+AVSSIL+GLI+VGRAAF+FPLSFLSNLAKK
Sbjct  311   AETFIFLYVGMDALDIDKWRSVSDTPGTSIAVSSILMGLIMVGRAAFIFPLSFLSNLAKK  370

Query  804   NSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstv  625
             N ++KI+F  QI+IWW+GLMRGAVS+ALAYNKFT +GHT +  NAIMITST+TV LFSTV
Sbjct  371   NQNEKINFNMQIVIWWSGLMRGAVSMALAYNKFTRAGHTEVRGNAIMITSTITVCLFSTV  430

Query  624   vFGLMTKPLINLLLPPHKQMPSGHSSMTT---SEPSSPKHFTVPLLDNQPDSESDMITGP  454
             VFG++TKPLI+ LLP        H S TT   S+ ++PK   +PLLD   DS  +     
Sbjct  431   VFGMLTKPLISYLLP--------HQSATTSMLSDENTPKSIHIPLLDQ--DSFIEPSGNH  480

Query  453   EVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
              V RP ++R  L  PT TVH YWR+FDDSFMRPVFGGRGFVPFV GSP E+ P
Sbjct  481   NVPRPDSIRGFLTRPTRTVHYYWRQFDDSFMRPVFGGRGFVPFVPGSPTERDP  533



>ref|XP_010455152.1| PREDICTED: sodium/hydrogen exchanger 1-like [Camelina sativa]
 ref|XP_010455153.1| PREDICTED: sodium/hydrogen exchanger 1-like [Camelina sativa]
Length=539

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/531 (75%), Positives = 449/531 (85%), Gaps = 13/531 (2%)
 Frame = -3

Query  1884  SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsgg  1705
             S L TSDHASVV++NLFVALLCACIVLGHLLEENRW+NESITAL+IGL TGV ILL+S G
Sbjct  11    SKLTTSDHASVVALNLFVALLCACIVLGHLLEENRWMNESITALLIGLGTGVSILLISKG  70

Query  1704  ksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGA  1525
             KSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA+GT+ISC+IIS G 
Sbjct  71    KSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGAVGTIISCTIISLGV  130

Query  1524  VKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSV  1345
              + FK LDI   D GD LAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSV
Sbjct  131   TQFFKKLDIGTFDLGDILAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSV  190

Query  1344  VLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDR  1165
             V+FNAIQSFD+T  + +   H  GNFLYLFL ST LG   GL+ AY+IKKLYFGRHSTDR
Sbjct  191   VVFNAIQSFDLTHLNHEAAFHLFGNFLYLFLLSTLLGAATGLISAYVIKKLYFGRHSTDR  250

Query  1164  EVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFV  985
             EVALMMLM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+
Sbjct  251   EVALMMLMAYLSYMLAELFELSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFL  310

Query  984   AETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKK  805
             AETFIFLYVGMDALDI+KW+ V ++ G S+AVSSIL+GLI+VGRAAF+FPLSFLSNLAKK
Sbjct  311   AETFIFLYVGMDALDIDKWRSVSDTPGTSIAVSSILMGLIMVGRAAFIFPLSFLSNLAKK  370

Query  804   NSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstv  625
             N ++KI+F  QI+IWW+GLMRGAVS+ALAYNKFT +GHT +  NAIMITST+TV LFSTV
Sbjct  371   NQNEKINFNMQIVIWWSGLMRGAVSMALAYNKFTRAGHTEVRGNAIMITSTITVCLFSTV  430

Query  624   vFGLMTKPLINLLLPPHKQMPSGHSSMTT---SEPSSPKHFTVPLLDNQPDSESDMITGP  454
             VFG++TKPLI+ LLP        H S TT   S+ ++PK   +PLLD   DS  +     
Sbjct  431   VFGMLTKPLISYLLP--------HQSATTSMLSDENTPKSIHIPLLDQ--DSFIEPSGNH  480

Query  453   EVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
              V RP ++R  L  PT TVH YWR+FDDSFMRPVFGGRGFVPFV GSP E+
Sbjct  481   NVPRPDSIRGFLTRPTRTVHYYWRQFDDSFMRPVFGGRGFVPFVPGSPTER  531



>gb|EAZ41007.1| hypothetical protein OsJ_25492 [Oryza sativa Japonica Group]
Length=516

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/525 (73%), Positives = 431/525 (82%), Gaps = 28/525 (5%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSD+ASVVS+NLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILL++ GKSSH
Sbjct  16    TSDYASVVSINLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVILLMTKGKSSH  75

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             L VFSEDLFFIYLLPPIIFNAG           F  +  +       S SI S  A+ IF
Sbjct  76    LFVFSEDLFFIYLLPPIIFNAG-----------FCLLEFY-------SWSIYS-AAIAIF  116

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
               ++I  LD GD+LAIGAIF+ATDSVCTLQVL+QDETP LYSLVFGEGVVNDATS+VLFN
Sbjct  117   SRMNIGTLDVGDFLAIGAIFSATDSVCTLQVLNQDETPFLYSLVFGEGVVNDATSIVLFN  176

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+Q+FD+   D  + L F+GNF YLFLSSTFLGV  GLL AYIIKKLY GRHSTDREVAL
Sbjct  177   ALQNFDLVHIDAAVVLKFLGNFFYLFLSSTFLGVFAGLLSAYIIKKLYIGRHSTDREVAL  236

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF
Sbjct  237   MMLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETF  296

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDIEKW+F  +  G S+ +SSIL+GL+L+GRAAFVFPLSFLSNL KK  ++
Sbjct  297   LFLYVGMDALDIEKWEFASDRPGKSIGISSILLGLVLIGRAAFVFPLSFLSNLTKKAPNE  356

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI++RQQ++IWWAGLMRGAVSIALAYNKFT SGHT LH NAIMITST+TVVLFST+VFG+
Sbjct  357   KITWRQQVVIWWAGLMRGAVSIALAYNKFTRSGHTQLHGNAIMITSTITVVLFSTMVFGM  416

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             MTKPLI LLLP      SGH    TSEPSSPK    PLL +     SD+ +   + RP++
Sbjct  417   MTKPLIRLLLP-----ASGHP--VTSEPSSPKSLHSPLLTSMQG--SDLESTTNIVRPSS  467

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             LRMLL  PTHTVH YWRKFDD+ MRP+FGGRGFVPF  GSP EQS
Sbjct  468   LRMLLTKPTHTVHYYWRKFDDALMRPMFGGRGFVPFSPGSPTEQS  512



>ref|XP_006663078.1| PREDICTED: sodium/hydrogen exchanger 2-like [Oryza brachyantha]
Length=545

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/526 (72%), Positives = 443/526 (84%), Gaps = 5/526 (1%)
 Frame = -3

Query  1869  SDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggksshl  1690
             +D+ S+ ++ LFVAL+C CIV+GHLLEE+RW+NESITALIIGL TG VIL+ S  K S +
Sbjct  14    ADYGSIAAVGLFVALICVCIVVGHLLEESRWMNESITALIIGLGTGAVILMASSWKHSRI  73

Query  1689  LVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIFK  1510
             LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GTLIS ++IS GA+ +  
Sbjct  74    LVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTLISFTVISLGAIGLIS  133

Query  1509  HLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFNA  1330
              L+I  LD GDYLA+GAIF+ATDSVCTLQVLSQD+TPLLYSLVFGEGVVNDATSVVLFNA
Sbjct  134   RLNIGSLDLGDYLALGAIFSATDSVCTLQVLSQDDTPLLYSLVFGEGVVNDATSVVLFNA  193

Query  1329  IQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAlm  1150
             IQ+FD+ +F     L FIGNFLYLF +STFLGV  GLL A+IIKKLYFGRHSTDREV++M
Sbjct  194   IQNFDLANFSSVKFLQFIGNFLYLFATSTFLGVAAGLLSAFIIKKLYFGRHSTDREVSIM  253

Query  1149  mlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETFI  970
             MLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF+
Sbjct  254   MLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETFL  313

Query  969   FLYVGMDALDIEKWKFVKN--SQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSS  796
             FLYVGMDALDIEKWK V    S   S+A+SS L+ L+LV RAAFVFPLSFL+NL KK+  
Sbjct  314   FLYVGMDALDIEKWKIVSEAYSPMKSIALSSTLLFLVLVARAAFVFPLSFLANLTKKSEG  373

Query  795   DKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFG  616
              KIS RQQ+IIWWAGLMRGAVSIALAYNKFT SGHT L  NAIMITST+T+VL ST+VFG
Sbjct  374   GKISIRQQVIIWWAGLMRGAVSIALAYNKFTRSGHTQLPSNAIMITSTITIVLLSTMVFG  433

Query  615   LMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPT  436
             L+TKPLI LL+P  + +    S++  S+P SPK F  PL+ N+ + +++  TG  + RPT
Sbjct  434   LLTKPLIRLLIPA-RHLSREASAL--SDPPSPKSFLDPLILNESEVDAENGTGIGIRRPT  490

Query  435   ALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             +LR+LL +PT +VH YWRKFD++FMRPVFGGRGFVPFV GSP E+S
Sbjct  491   SLRLLLASPTRSVHHYWRKFDNAFMRPVFGGRGFVPFVPGSPTERS  536



>gb|EMT05063.1| Sodium/hydrogen exchanger 2 [Aegilops tauschii]
Length=568

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/553 (70%), Positives = 443/553 (80%), Gaps = 39/553 (7%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS+ LFVALLCACIVLGHLLEENRW+NESITALIIGLCTGVVIL+ + GKSSH
Sbjct  19    TSDHASVVSITLFVALLCACIVLGHLLEENRWLNESITALIIGLCTGVVILMTTKGKSSH  78

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLIS------------  1549
             +LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GT++S            
Sbjct  79    VLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTMMSFFTYLLVKKKQF  138

Query  1548  ----CSIISFGAV--------------KIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQ  1423
                  +I  FGAV               IF  ++I  LD  D+LAIGAIF+ATDSVCTLQ
Sbjct  139   FRNFMTITLFGAVGTMMSFFTISLAAIAIFSRMNIGTLDVSDFLAIGAIFSATDSVCTLQ  198

Query  1422  VLSQDETPLLYSLVFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSST  1243
             VL+QDETP LYSLVFGEGVVNDATSVVLFNA+Q+FD    D  + L F+GNF YLF+SST
Sbjct  199   VLNQDETPFLYSLVFGEGVVNDATSVVLFNALQNFDPNQIDAIVILKFLGNFCYLFVSST  258

Query  1242  FLGVGIGLLCAYIIKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVM  1063
             FLGV  GLL AY+IKKLY GRHSTDREVAL+MLM+YLSY++AEL  LSGILTVFFCGIVM
Sbjct  259   FLGVFTGLLSAYVIKKLYIGRHSTDREVALVMLMAYLSYMLAELLDLSGILTVFFCGIVM  318

Query  1062  SHYTWHNVTESSRVTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSS  883
             SHYTWHNVTESSRVTT+H+FATLSF+AETF+FLYVGMDALDIEKWKF  +S G S+ +SS
Sbjct  319   SHYTWHNVTESSRVTTKHAFATLSFIAETFLFLYVGMDALDIEKWKFASDSPGKSIGISS  378

Query  882   ILVGLILVGRAAFVFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFT  703
             IL+GL+LVGRAAFVFPLSFLSNL KK   +KIS+RQQI+IWWAGLMRGAVSIALAYNKFT
Sbjct  379   ILLGLVLVGRAAFVFPLSFLSNLTKKTELEKISWRQQIVIWWAGLMRGAVSIALAYNKFT  438

Query  702   TSGHTSLHENAIMItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSS  523
              SGHT LH NAIMITST+TVVLFST++FG++TKPLI  LLP         S+   S+P+S
Sbjct  439   RSGHTQLHGNAIMITSTITVVLFSTMLFGILTKPLIRFLLP-------ASSNGAASDPAS  491

Query  522   PKHFTVPLLDNQPDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGG  343
             PK    PLL +Q    SD+     + RP+ LRML+  PTHT+H YWRKFDD+ MRP+FGG
Sbjct  492   PKSLHSPLLTSQLG--SDLEAPLPIVRPSRLRMLITKPTHTIHYYWRKFDDALMRPMFGG  549

Query  342   RGFVPFVAGSPVE  304
             RGFVP+  GSP +
Sbjct  550   RGFVPYSPGSPTD  562



>dbj|BAB56107.1| Na H-antiportor [Torenia hybrid cultivar]
Length=555

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/550 (71%), Positives = 446/550 (81%), Gaps = 17/550 (3%)
 Frame = -3

Query  1890  QNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIllls  1711
             +  +L++S H SVV++ LFV LLC CIV+GHLLEENRW+NESI ALIIGL TGV+ILL+S
Sbjct  13    ETDNLWSSGHGSVVAITLFVTLLCTCIVIGHLLEENRWMNESIIALIIGLATGVIILLIS  72

Query  1710  ggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISF  1531
             GGKSSHLLVFSEDLFFIY LPPIIFNAGFQVKKK FF NF TIM+FGA+GTLIS  IIS 
Sbjct  73    GGKSSHLLVFSEDLFFIYALPPIIFNAGFQVKKKSFFRNFATIMMFGAVGTLISFIIISL  132

Query  1530  GAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDAT  1351
             G +  F  +++  L  GDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDAT
Sbjct  133   GTIAFFPKMNMR-LGVGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDAT  191

Query  1350  SVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHST  1171
             SVVLFNA+Q+FD+           +GNF YLF +ST LGV  GLL AYIIKKLYFGRHST
Sbjct  192   SVVLFNAVQNFDLPHMSTAKAFELVGNFFYLFATSTVLGVLTGLLSAYIIKKLYFGRHST  251

Query  1170  DREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLS  991
             DREVA+M+LM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTE+SRVTT+H+FATLS
Sbjct  252   DREVAIMILMAYLSYMLAELFDLSGILTVFFCGIVMSHYTWHNVTENSRVTTKHTFATLS  311

Query  990   FVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLA  811
             FVAE FIFLYVGMDALDIEKW+FV  S   S AVS+ L+GL+L+ RAAFVFPLSFLSNLA
Sbjct  312   FVAEIFIFLYVGMDALDIEKWRFVSGSMTTSAAVSATLLGLVLLSRAAFVFPLSFLSNLA  371

Query  810   KKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfs  631
             KK+  +KIS RQQIIIWWAGLMRGAVS+ALAY +FT  G T   ENAI ITST+T+VLFS
Sbjct  372   KKSPLEKISLRQQIIIWWAGLMRGAVSMALAYKQFTREGLTVERENAIFITSTITIVLFS  431

Query  630   tvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMIT---  460
             TVVFGLMTKPLINLL+P  K   S      +SEP +P   T+PLL    DS +++ +   
Sbjct  432   TVVFGLMTKPLINLLIPSPKLNRS-----VSSEPLTPNSITIPLLGESQDSVAELFSIRG  486

Query  459   -----GPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
                  G  VARP++LRMLL  PTHTVH YWRKFD++FMRPVFGGRGFVP+V GSP E+S 
Sbjct  487   QTSQGGEPVARPSSLRMLLTKPTHTVHYYWRKFDNAFMRPVFGGRGFVPYVPGSPTERSV  546

Query  294   R*GTKYKQDT  265
             R    ++++T
Sbjct  547   R---NWEEET  553



>ref|NP_001105531.1| Na+/H+ antiporter NHX2 [Zea mays]
 gb|AAP20429.1| Na+/H+ antiporter NHX2 [Zea mays]
Length=540

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/526 (73%), Positives = 446/526 (85%), Gaps = 9/526 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS N FVALLCACIVLGHLLEENR VNESITAL++GL TG VIL++S G S H
Sbjct  18    TSDHASVVSNNFFVALLCACIVLGHLLEENRMVNESITALLVGLGTGTVILMISRGVSIH  77

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             +LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI+LFGAIGTLIS  IIS GA+ +F
Sbjct  78    VLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIILFGAIGTLISFVIISLGAMGLF  137

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             K LD+  L+ GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATS+V+FN
Sbjct  138   KKLDVGPLELGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSIVVFN  197

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+Q+FD+T  + ++  H +GNFLYLFL ST LGV  GL+ A +IKK+YFGRHSTDREVAL
Sbjct  198   ALQNFDITHINAEVVFHLLGNFLYLFLLSTVLGVATGLISALVIKKIYFGRHSTDREVAL  257

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AELF LSGILTVFF  IVMSHYTWHNVTESSR+TT+H+FATLSF+AETF
Sbjct  258   MMLMAYLSYMLAELFALSGILTVFFGCIVMSHYTWHNVTESSRITTKHAFATLSFLAETF  317

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALDIEKW+ V ++ G S+A+SSIL+GL+++GRAAFVFPLSFLSNLAKKN  +
Sbjct  318   IFLYVGMDALDIEKWRSVSDTPGKSIAISSILMGLVMLGRAAFVFPLSFLSNLAKKNEHE  377

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KIS++QQ++IWW+GLMRGAVS+ALAYNKFT +GHT +  N IMITST+TVVLFSTVVFGL
Sbjct  378   KISWKQQVVIWWSGLMRGAVSMALAYNKFTRAGHTEVRGNEIMITSTITVVLFSTVVFGL  437

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             +TKPLI LL      MP  H +M  S+ S+PK    PLL +Q  S  +  T  ++ RPT 
Sbjct  438   LTKPLIRLL------MPHRHLTM-LSDDSTPKSLHSPLLTSQLGSSIEEPT--QIPRPTN  488

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
             +R    T T TVHRYWRKFDD FMRP+FGGRGFVPFV GSP E++P
Sbjct  489   IRGEFTTMTRTVHRYWRKFDDKFMRPMFGGRGFVPFVPGSPTERNP  534



>ref|XP_009412081.1| PREDICTED: sodium/hydrogen exchanger 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=546

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/544 (73%), Positives = 456/544 (84%), Gaps = 7/544 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQN---SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALII  1747
             MAFG  +++     S L  SDHASVVS+N+FV L+CACIV+GHLLEENRW+NESITALII
Sbjct  1     MAFGWGAVMMKLGLSRLEASDHASVVSINIFVTLICACIVIGHLLEENRWMNESITALII  60

Query  1746  GLCTGVVIlllsg-gksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFG  1570
             GLCTG +I L +    +SH++VFSEDLFFIY+LPPIIFNAGFQVKKKQFF NF+TIMLFG
Sbjct  61    GLCTGFIIRLATRGKNNSHIMVFSEDLFFIYVLPPIIFNAGFQVKKKQFFRNFITIMLFG  120

Query  1569  AIGTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLY  1390
             A+GTLIS  IIS GAV+ F+ +DI  L+ GDYLAIGAIF+ATDSVCTLQVL+QDETPLLY
Sbjct  121   AVGTLISFVIISLGAVEFFRKMDIGALEVGDYLAIGAIFSATDSVCTLQVLNQDETPLLY  180

Query  1389  SLVFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCA  1210
             SLVFGEGVVNDATSVVLFNA+Q+FD+   D  + L F+ NF YLF SST LG   GLL A
Sbjct  181   SLVFGEGVVNDATSVVLFNALQNFDLVHVDATVLLKFVANFFYLFASSTLLGALTGLLSA  240

Query  1209  YIIKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTES  1030
             YIIKKLYFGRHSTDREVALM+LM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTES
Sbjct  241   YIIKKLYFGRHSTDREVALMILMAYLSYMLAELLNLSGILTVFFCGIVMSHYTWHNVTES  300

Query  1029  SRVTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRA  850
             SR+TT+H+FATLSF+AE F+FLYVG DALDIEKWKFV +S G S+ VSSIL+GL+LVGRA
Sbjct  301   SRITTKHAFATLSFIAEVFLFLYVGTDALDIEKWKFVSDSPGKSLGVSSILLGLVLVGRA  360

Query  849   AFVFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENA  670
             AFVFPLSF+SNL KK+ +DKI+F+QQ+IIWWAGLMRGAVSIALAYN+FT SGHT    NA
Sbjct  361   AFVFPLSFISNLFKKSQNDKITFKQQVIIWWAGLMRGAVSIALAYNQFTRSGHTQQRGNA  420

Query  669   IMItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDN  490
              MITST+TVVLFST+VFGLMTKPLI  LLPP+ +  +  S   +SEPSSPK F  PLL N
Sbjct  421   FMITSTITVVLFSTMVFGLMTKPLIYFLLPPNSKHLT-RSLSVSSEPSSPKSFLSPLLGN  479

Query  489   QPDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSP  310
                SE +      + RPT LRMLL TP+ +VH YWRKFDD+FMRP+FGGRGFVPFV GSP
Sbjct  480   GQGSELE--AAQCIPRPTNLRMLLTTPSRSVHHYWRKFDDAFMRPMFGGRGFVPFVPGSP  537

Query  309   VEQS  298
             VE+S
Sbjct  538   VERS  541



>ref|NP_001105943.1| Na+/H+ antiporter NHX4 [Zea mays]
 gb|AAP20431.1| Na+/H+ antiporter NHX4 [Zea mays]
Length=538

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/526 (72%), Positives = 437/526 (83%), Gaps = 8/526 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             ++DHASVV + LFVALLCACIVLGHLLEENRW+NESITALIIGL TGVVILL+S GK+S 
Sbjct  15    SADHASVVIITLFVALLCACIVLGHLLEENRWLNESITALIIGLGTGVVILLISRGKNSR  74

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGA+GT+IS   IS GA+  F
Sbjct  75    LLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAVGTMISFFTISLGAIATF  134

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
               + I  LD GD+LAIGAIF+ATDSVCTLQVL QDETP LYSLVFGEGVVNDATSVVLFN
Sbjct  135   SRMSIGTLDVGDFLAIGAIFSATDSVCTLQVLHQDETPFLYSLVFGEGVVNDATSVVLFN  194

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+Q    T  +    L  IGNFLYLF +ST LG+G GL+ A+++KKLYFGRHST RE+A+
Sbjct  195   AVQKIQFTHINAWTALQLIGNFLYLFSTSTLLGIGTGLITAFVLKKLYFGRHSTTRELAI  254

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             M+LM+YLSY++AELF LSG+LTVFFCG++MSH TWHNVTESSR T+RH FATLSF++ETF
Sbjct  255   MILMAYLSYMLAELFSLSGLLTVFFCGVLMSHVTWHNVTESSRTTSRHVFATLSFISETF  314

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALD EKWK    S G ++ VS +L+GL+++GRAAFVFPLSFLSNLAKK+ S+
Sbjct  315   IFLYVGMDALDFEKWKTSSLSFGGTLGVSGVLMGLVMLGRAAFVFPLSFLSNLAKKHQSE  374

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KISFR Q++IWWAGLMRGAVS+ALA NKFT SGHT LH NAIMITST+TVVLFST+VFG+
Sbjct  375   KISFRMQVVIWWAGLMRGAVSMALALNKFTRSGHTQLHGNAIMITSTITVVLFSTMVFGM  434

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             +TKPLI LLLP      SGH     SEPSSPK F  PLL +Q    SD+ +   + RP++
Sbjct  435   ITKPLIRLLLP-----ASGHPR-ELSEPSSPKSFHSPLLTSQQG--SDLESTTNIVRPSS  486

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
             LR LL  PTHTVH YWRKFDD+ MRPVFGGRGFVPFV GSP E++P
Sbjct  487   LRGLLTKPTHTVHYYWRKFDDALMRPVFGGRGFVPFVPGSPTERNP  532



>gb|AHK80837.1| Na+/H+ antiporter, partial [Lilium tenuifolium]
Length=499

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/503 (76%), Positives = 432/503 (86%), Gaps = 9/503 (2%)
 Frame = -3

Query  1806  LGHLLEENRWVNESITALIIGLCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAG  1627
             +G  +EENRW+NESITAL IG+CTGVVILL + GKSSH+LVFSEDLFFIYLLPPIIFNAG
Sbjct  1     MGSGMEENRWMNESITALFIGVCTGVVILLTTKGKSSHILVFSEDLFFIYLLPPIIFNAG  60

Query  1626  fqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAA  1447
             FQVKKKQFF NFMTIMLFGA+GTLIS  IIS GA+++FK +DI   + GDYLAIGAIF+A
Sbjct  61    FQVKKKQFFRNFMTIMLFGAVGTLISFVIISVGAIELFKKMDIGSREIGDYLAIGAIFSA  120

Query  1446  TDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNF  1267
             TDSVCTLQVL+QDETP LYSLVFGEGVVNDATSVVLFNAIQ+FD+   D ++ LHFIGNF
Sbjct  121   TDSVCTLQVLNQDETPFLYSLVFGEGVVNDATSVVLFNAIQNFDLVHMDSRVMLHFIGNF  180

Query  1266  LYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILT  1087
             +YLFL+STFLG   GLL AYIIKKLYFGRHSTDREVALMMLM+YLSY++AEL  LSGILT
Sbjct  181   VYLFLTSTFLGAFAGLLSAYIIKKLYFGRHSTDREVALMMLMAYLSYMLAELLDLSGILT  240

Query  1086  VFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQ  907
             VFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF+AETF+FLYVGMDALDIEKW+F   S 
Sbjct  241   VFFCGIVMSHYTWHNVTESSRITTKHAFATLSFMAETFLFLYVGMDALDIEKWRFASTSP  300

Query  906   GLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSI  727
             G S+ +SSIL+GL++VGRAAFVFPLSFLSNLAKK+ S+KI F+QQ+ IWWAGLMRGAVSI
Sbjct  301   GKSIGISSILLGLVMVGRAAFVFPLSFLSNLAKKSPSEKIIFKQQVTIWWAGLMRGAVSI  360

Query  726   ALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSS  547
             ALAYN+FT SGHT +  NAIMITST+TVVLFSTVVFGL+TKPL+ LL    KQ    H S
Sbjct  361   ALAYNQFTRSGHTQMRSNAIMITSTITVVLFSTVVFGLITKPLVRLLCA--KQ----HGS  414

Query  546   MTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDS  367
             +  SEPSSPK     L++N P+ E +    P V RP +LRMLL  PTHTVH YWRKFDDS
Sbjct  415   V--SEPSSPKSLFSSLIENGPEFEGEGEVHP-VLRPPSLRMLLTKPTHTVHHYWRKFDDS  471

Query  366   FMRPVFGGRGFVPFVAGSPVEQS  298
             FMRP+FGGRGFVPFV GSP EQS
Sbjct  472   FMRPMFGGRGFVPFVPGSPTEQS  494



>gb|EYU33528.1| hypothetical protein MIMGU_mgv1a023716mg [Erythranthe guttata]
Length=528

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/544 (72%), Positives = 443/544 (81%), Gaps = 38/544 (7%)
 Frame = -3

Query  1893  LQNSDLF--TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIl  1720
             ++ +D++  TSDHASVVS+ LFV LLCACIV GHLLEENRW+NESITALIIG+ TGV+IL
Sbjct  1     MKETDIYLSTSDHASVVSITLFVTLLCACIVFGHLLEENRWMNESITALIIGVGTGVLIL  60

Query  1719  llsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSI  1540
             ++SGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+GTLIS  I
Sbjct  61    VISGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVGTLISFII  120

Query  1539  ISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVN  1360
             IS                    LAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVN
Sbjct  121   IS--------------------LAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVN  160

Query  1359  DATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGR  1180
             DATSVVLFNA+Q FD++  +  + L  +GNF+YLF+SST LGV  GLL AYIIKKLYFGR
Sbjct  161   DATSVVLFNAVQDFDLSHLNTGVALQLLGNFIYLFISSTVLGVVSGLLSAYIIKKLYFGR  220

Query  1179  HSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFA  1000
             HSTDREVA+MMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTE+SR+TT+H+FA
Sbjct  221   HSTDREVAIMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTENSRITTKHTFA  280

Query  999   TLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLS  820
             TLSFVAE FIFLYVGMDALDIEKW+ V +S   S++VS+ L+GL+L GRAAFVFPLSFLS
Sbjct  281   TLSFVAEIFIFLYVGMDALDIEKWRVVSDSPKTSLSVSATLLGLVLAGRAAFVFPLSFLS  340

Query  819   NLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvv  640
             NL KK  S+KI F+QQ+ IWWAGLMRGAVS+ALAYN+FT  GHT LH NA++ITST+TVV
Sbjct  341   NLTKK--SEKIEFKQQVTIWWAGLMRGAVSMALAYNQFTREGHTQLHGNALLITSTITVV  398

Query  639   lfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMIT  460
             LFSTVVFGL+TKPL+ LL+P  KQ+    S    SEP +P  F VPLL    DSE ++  
Sbjct  399   LFSTVVFGLITKPLVRLLMPSSKQLCRSLS----SEPVTPNSFHVPLLGESRDSEGELFD  454

Query  459   G----------PEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSP  310
                            RP++LRMLL TPT TVH YWRKFDDSFMRPVFGGRGFVP+V GSP
Sbjct  455   DNGHLQARGECQNTVRPSSLRMLLTTPTRTVHYYWRKFDDSFMRPVFGGRGFVPYVPGSP  514

Query  309   VEQS  298
              EQS
Sbjct  515   TEQS  518



>gb|KDP28082.1| hypothetical protein JCGZ_13853 [Jatropha curcas]
Length=541

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/546 (71%), Positives = 442/546 (81%), Gaps = 13/546 (2%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLFT-SDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M F L SL+    L + SD   V S+ LFV L+CACI++GHLLE+NRW+NESITAL IGL
Sbjct  1     MGFNLGSLVVRLGLKSGSDEVHVDSITLFVTLICACIIIGHLLEKNRWMNESITALAIGL  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTGV+ILL + GKSSHL +F E LFFIY+LPPIIFNAGFQVKKKQFF NFMTI+LFGA+G
Sbjct  61    CTGVIILLTTQGKSSHLFLFDEHLFFIYVLPPIIFNAGFQVKKKQFFRNFMTIVLFGAVG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS  IIS G+ K+FK L+IDFLD  DYLA+GAIF+ATDSVCTLQVL Q+ETPLLYSLV
Sbjct  121   TLISFIIISVGSAKLFKKLNIDFLDTVDYLALGAIFSATDSVCTLQVLDQEETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDAT VVLFNAIQ FD++     I +   GNFLYLF++STFLGV +GL  AYII
Sbjct  181   FGEGVVNDATVVVLFNAIQRFDLSHITSSIAVQLFGNFLYLFVTSTFLGVAVGLGSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVALM+LM+YLSYIMAELF LS ILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVALMILMAYLSYIMAELFNLSAILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+HSFATLSF+AE +IFLYVGMDALD+EKWK V  S G SV VSSIL+GL+L+GRAAF+
Sbjct  301   TTKHSFATLSFIAEIYIFLYVGMDALDMEKWKIVSKSPGTSVGVSSILLGLVLIGRAAFI  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSF+SNL +K+  DKI  +QQ++IWWAGLMRGAVS+ALAYN+FT SGHT L  NAIMI
Sbjct  361   FPLSFISNLTRKSQGDKIGLKQQVVIWWAGLMRGAVSMALAYNQFTQSGHTQLPGNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TST+TVVLFSTVVFGL+ KPLI LLLP        H+S         K   +PL+ N  D
Sbjct  421   TSTITVVLFSTVVFGLVIKPLIRLLLPKK------HTSHALLAYLDSKSLDLPLIANGKD  474

Query  480   SESDMI-----TGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAG  316
              ES+M      +G  + RP +LRMLL TPT+TVH YWRKFDDSFMRPVFGGRGF P+V G
Sbjct  475   LESEMSGDGNPSGDIIHRPASLRMLL-TPTYTVHYYWRKFDDSFMRPVFGGRGFTPYVPG  533

Query  315   SPVEQS  298
             SP E S
Sbjct  534   SPTEGS  539



>ref|NP_001105221.1| Na+/H+ antiporter NHX1 [Zea mays]
 gb|AAP20428.1| Na+/H+ antiporter NHX1 [Zea mays]
Length=540

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/526 (72%), Positives = 442/526 (84%), Gaps = 9/526 (2%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             TSDHASVVS+NLFVALLCACIVLGHLLEENRWVNES TALI+GL TG VIL++S G   H
Sbjct  18    TSDHASVVSINLFVALLCACIVLGHLLEENRWVNES-TALIVGLGTGTVILMISRGVVIH  76

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             +LVFSEDLFF YLLPPIIFNAGFQVKKKQFF NF+TI LFGA+GTLIS ++IS GA+ + 
Sbjct  77    VLVFSEDLFFFYLLPPIIFNAGFQVKKKQFFRNFITITLFGAVGTLISFTVISLGALGLI  136

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
               L+I  L+ GDYLA+GAIF+ATDSVCTLQVLSQDETP LYSLVFGEGVVNDATSVV+FN
Sbjct  137   SRLNIGALELGDYLALGAIFSATDSVCTLQVLSQDETPFLYSLVFGEGVVNDATSVVVFN  196

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             A+Q+FD+T  D ++  H +GNF YLFL ST LGV  GL+ A +IKKLYFGRHSTDREVAL
Sbjct  197   ALQNFDITHIDAEVVFHLLGNFFYLFLLSTVLGVATGLISALVIKKLYFGRHSTDREVAL  256

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             MMLM+YLSY++AELF LSGILTVFF  IVMSHYTWHNVTESSR+TT+H+FATLSF+AETF
Sbjct  257   MMLMAYLSYMLAELFALSGILTVFFGCIVMSHYTWHNVTESSRITTKHAFATLSFLAETF  316

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             +FLYVGMDALDI+KW+ V ++ G S+A+SSIL+GL++VGRAAFVFPLSFLSNLAKK   +
Sbjct  317   LFLYVGMDALDIDKWRSVSDTPGKSLAISSILMGLVMVGRAAFVFPLSFLSNLAKKTEHE  376

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KIS++QQ++IWWAGLMRGAVS+ALAY KFT +GHT +  NAIMITST+ VVLFST+VFGL
Sbjct  377   KISWKQQVVIWWAGLMRGAVSMALAYKKFTRAGHTQVRGNAIMITSTIIVVLFSTMVFGL  436

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             +TKPLINLL+ PH+   S       S+ SSPK    PLL +Q    SD+     + RP++
Sbjct  437   LTKPLINLLI-PHRNATS-----MLSDDSSPKSLHSPLLTSQLG--SDLEEPTNIPRPSS  488

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQSP  295
             +R    T T TVHRYWRKFDD+FMRP+FGGRGFVPFV GSP E++P
Sbjct  489   IRGEFLTMTRTVHRYWRKFDDAFMRPMFGGRGFVPFVPGSPTERNP  534



>gb|AAO25547.1| Na+/H+ antiporter [Hordeum brevisubulatum]
Length=540

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/526 (71%), Positives = 437/526 (83%), Gaps = 7/526 (1%)
 Frame = -3

Query  1869  SDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggksshl  1690
             +D+ S++++ LFVAL+C CI++GHLLEENRW+NES TAL++GL  G VIL  S GK+S L
Sbjct  10    ADYGSIMAVGLFVALMCICIIVGHLLEENRWMNESTTALLLGLGAGTVILFASSGKNSRL  69

Query  1689  LVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIFK  1510
             +VFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LF  +GTLIS SIIS GA+ +  
Sbjct  70    MVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFAVVGTLISFSIISLGAMGLIS  129

Query  1509  HLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFNA  1330
              L+I  L+ GDYLA+GAIF+ATDSVCTLQVLSQDETP LYSLVFGEGVVNDATSVVLFNA
Sbjct  130   RLNIGALELGDYLALGAIFSATDSVCTLQVLSQDETPFLYSLVFGEGVVNDATSVVLFNA  189

Query  1329  IQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAlm  1150
             IQ+FD+ +F     L FIGNFLYLF +STFLGV  GLL AY+IKKLYFGRHSTDREVA+M
Sbjct  190   IQNFDLGNFSSLKFLQFIGNFLYLFGASTFLGVASGLLSAYVIKKLYFGRHSTDREVAIM  249

Query  1149  mlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETFI  970
             MLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF++ETF+
Sbjct  250   MLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFISETFL  309

Query  969   FLYVGMDALDIEKWKFVKN--SQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSS  796
             FLYVGMDALDIEKWK V    S   S+ +SSI++ L+LV RAAFVFPLS+LSNL KK + 
Sbjct  310   FLYVGMDALDIEKWKIVSETYSPMKSITLSSIILALVLVARAAFVFPLSYLSNLTKKTAG  369

Query  795   DKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFG  616
             +KIS RQQ+IIWWAGLMRGAVSIALAYNKF  SGHT L  NAIMITST+ +VLFST+VFG
Sbjct  370   EKISIRQQVIIWWAGLMRGAVSIALAYNKFAKSGHTQLPSNAIMITSTIIIVLFSTIVFG  429

Query  615   LMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPT  436
             L+TKPLI LL+P  + +    S++  SEPSSPK F   L  N P  E+D+  G  + RPT
Sbjct  430   LLTKPLIRLLIPA-RHLTREVSAL--SEPSSPKSFLEQLTVNGP--ETDVENGVSIRRPT  484

Query  435   ALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             +LRMLL +PT +VH YWRKFD++FMRPVFGGRGFVPFV GSP E S
Sbjct  485   SLRMLLASPTRSVHHYWRKFDNAFMRPVFGGRGFVPFVPGSPTESS  530



>ref|XP_010097354.1| Sodium/hydrogen exchanger 2 [Morus notabilis]
 gb|EXB67664.1| Sodium/hydrogen exchanger 2 [Morus notabilis]
Length=507

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/530 (73%), Positives = 431/530 (81%), Gaps = 47/530 (9%)
 Frame = -3

Query  1878  LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggks  1699
             L TSDH+S+VSMNLFVALL ACIV+GHLLEENRW+NESITALIIG+CTG+VILL+SGGKS
Sbjct  15    LSTSDHSSIVSMNLFVALLLACIVIGHLLEENRWMNESITALIIGVCTGIVILLISGGKS  74

Query  1698  shlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVK  1519
             SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNF+TI+LFGA+GTLISC+II+ GA +
Sbjct  75    SHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFVNFITIVLFGAVGTLISCTIIALGATQ  134

Query  1518  IFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVL  1339
              FK LDI  LD GDYLAIGAIFAATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSVVL
Sbjct  135   FFKKLDIGTLDVGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVL  194

Query  1338  FNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREV  1159
             FNAIQ+FD+T  + +I   FIGNFLYLF +ST LGV  GLL AYIIKKLYFGRHSTDREV
Sbjct  195   FNAIQNFDLTRINSQIAFKFIGNFLYLFATSTLLGVFTGLLSAYIIKKLYFGRHSTDREV  254

Query  1158  AlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAE  979
             ALMMLM+YLSY++AELFYLSGILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSFVAE
Sbjct  255   ALMMLMAYLSYMLAELFYLSGILTVFFCGIVMSHYTWHNVTESSRITTKHTFATLSFVAE  314

Query  978   TFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNS  799
              FIFLYVGMDALDIEKW++V +S G SVAV                              
Sbjct  315   IFIFLYVGMDALDIEKWRYVSDSPGTSVAV------------------------------  344

Query  798   SDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvF  619
                       IIWWAGLMRGAVS+ALAYN+FT +GHT L  NAIMITST+TVVL STVVF
Sbjct  345   ----------IIWWAGLMRGAVSMALAYNQFTRAGHTQLRANAIMITSTITVVLVSTVVF  394

Query  618   GLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGP---EV  448
             GLMTKPLI  LLP     P   +SMT S+PSSPK F  PLL+   DSE+D+  G    +V
Sbjct  395   GLMTKPLIRFLLP----HPKHTTSMTISDPSSPKSFLTPLLETGLDSEADLGLGGHEHDV  450

Query  447   ARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
              RP ++R LL TPT +VHRYWRKFDD+FMRPVFGGRGFVPFV GSP E+S
Sbjct  451   PRPNSIRALLTTPTRSVHRYWRKFDDAFMRPVFGGRGFVPFVPGSPTERS  500



>ref|XP_003609579.1| Sodium/hydrogen exchanger [Medicago truncatula]
Length=543

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/545 (71%), Positives = 442/545 (81%), Gaps = 32/545 (6%)
 Frame = -3

Query  1884  SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsgg  1705
             + +FTSDHASVVS+N+FVALLC CIV+GHLLEENRW+NESITAL+IGLCTGV+IL  +GG
Sbjct  12    TTMFTSDHASVVSLNIFVALLCTCIVIGHLLEENRWINESITALLIGLCTGVLILFTTGG  71

Query  1704  ksshlLVFSEDLFFIYLLPPIIFNAGf-------------------qvkkkqffVNFMTI  1582
             +SSH++VFSEDLFFIYLLPPIIFNAG                    QVKKKQFF NFMTI
Sbjct  72    RSSHIMVFSEDLFFIYLLPPIIFNAGVHNCMVLTSIPLLFFIHLRFQVKKKQFFRNFMTI  131

Query  1581  MLFGAIGTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDET  1402
             MLFGAIGTLIS  IIS GA+  F+ LDI  L  GDYLAIGAIF+ATDSVCTLQVL+QDET
Sbjct  132   MLFGAIGTLISFCIISLGAIHFFQKLDIGSLKIGDYLAIGAIFSATDSVCTLQVLNQDET  191

Query  1401  PLLYSLVFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIG  1222
             PLLYSLVFGEGVVNDATS+VLF AIQ+FD++  D    LH +GNFLYLF++ST LG+ +G
Sbjct  192   PLLYSLVFGEGVVNDATSIVLFKAIQNFDLSHIDLTTALHLLGNFLYLFIASTVLGIFVG  251

Query  1221  LLCAYIIKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHN  1042
             L  AYIIK     RHSTDREVALM+LM+YLSY++AELF  S ILTVFFCGI+MSHYTWHN
Sbjct  252   LFSAYIIK-----RHSTDREVALMILMAYLSYMLAELFSFSAILTVFFCGILMSHYTWHN  306

Query  1041  VTESSRVTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLIL  862
             VTESSR+TT+H+FAT+SF+AE FIFLYVGMDALD+EKW+FV  SQ  S+ VSS+L+ LIL
Sbjct  307   VTESSRITTKHTFATMSFIAEIFIFLYVGMDALDMEKWRFVSQSQKKSIGVSSLLLALIL  366

Query  861   VGRAAFVFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSL  682
             VGRAAFVFPLSF+SNL+KK+ S+KI F+QQ+ IWWAGLMRGAVSIALAYN+FT  GHT L
Sbjct  367   VGRAAFVFPLSFISNLSKKSQSEKIEFKQQVTIWWAGLMRGAVSIALAYNQFTRLGHTKL  426

Query  681   HENAIMItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVP  502
              ENAIMITST+TVVLFSTVVFGLMTKPL+ LLLP  K +         S PSSPK F+VP
Sbjct  427   RENAIMITSTITVVLFSTVVFGLMTKPLVRLLLPSSKHI----IISIPSPPSSPKSFSVP  482

Query  501   LLDNQPDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFV  322
             LL N  D   +  T     RP+ LR LLR P+H VH YWRKFDDSFMRPVFGGRGFVP+V
Sbjct  483   LLGNGEDVGGNGGT----QRPSRLRTLLRIPSHGVHHYWRKFDDSFMRPVFGGRGFVPYV  538

Query  321   AGSPV  307
              GSP+
Sbjct  539   PGSPL  543



>ref|XP_002520686.1| sodium/hydrogen exchanger, putative [Ricinus communis]
 gb|EEF41648.1| sodium/hydrogen exchanger, putative [Ricinus communis]
Length=536

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/519 (72%), Positives = 432/519 (83%), Gaps = 6/519 (1%)
 Frame = -3

Query  1866  DHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggksshlL  1687
             D A + S+ LFVALLCACI++GHL E+NRW+NESITAL+IGLCTGV+ILL + GKSSHL 
Sbjct  18    DEAHIDSITLFVALLCACILIGHLFEKNRWMNESITALVIGLCTGVIILLATEGKSSHLF  77

Query  1686  VFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIFKH  1507
              FSE+LFFIY+LPPIIFNAGFQVKKKQFF NF+TIMLFG +GTLIS  IIS GAV++FK 
Sbjct  78    QFSEELFFIYVLPPIIFNAGFQVKKKQFFRNFITIMLFGVVGTLISFIIISLGAVQLFKT  137

Query  1506  LDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFNAI  1327
             L IDFLD  DYLA+GAIF+ATDSVCTLQVL+Q+ETPLLYSLVFGEGVVNDATSVVLFNAI
Sbjct  138   LGIDFLDTMDYLALGAIFSATDSVCTLQVLNQEETPLLYSLVFGEGVVNDATSVVLFNAI  197

Query  1326  QSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAlmm  1147
             Q FD++     I L   G F+YLF +STFLGV +GL+CA+IIKKLYFGRHSTDREVALM+
Sbjct  198   QGFDLSHITSSIALELFGQFIYLFATSTFLGVAVGLICAFIIKKLYFGRHSTDREVALMV  257

Query  1146  lmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETFIF  967
             LM+YLSYIMAELF LS ILTVFFCGI MSHYTWHNVTESSRVTT+H+FAT+SF+AE FIF
Sbjct  258   LMAYLSYIMAELFNLSAILTVFFCGIAMSHYTWHNVTESSRVTTKHAFATMSFIAEIFIF  317

Query  966   LYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSDKI  787
             LYVGMDALD+EKWKFV  S G SV VSSIL+GLILVGRAAF+FPLSF+SNL + + SD+I
Sbjct  318   LYVGMDALDMEKWKFVSKSPGTSVGVSSILLGLILVGRAAFIFPLSFISNLKRNSQSDRI  377

Query  786   SFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGLMT  607
               +QQ++IWWAGLMRGAVS+ALAYNKFT  GHT L  NAI+ITST+TVVLFSTVVFGL+T
Sbjct  378   GLKQQVVIWWAGLMRGAVSMALAYNKFTKLGHTQLPGNAILITSTITVVLFSTVVFGLVT  437

Query  606   KPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTALR  427
             KPLI LLLP         S + TS  +  K    PLL N    + +     ++ RPT+LR
Sbjct  438   KPLIRLLLPRKYLSSLLPSDLATS--TDFKSLASPLLSNGNGKDQEF----DIPRPTSLR  491

Query  426   MLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSP  310
             MLL TPT+ VH YWRKFDD+ MRPVFGGRGF+P+V GSP
Sbjct  492   MLLTTPTNAVHYYWRKFDDTIMRPVFGGRGFMPYVPGSP  530



>gb|KHG14035.1| Sodium/hydrogen exchanger 2 -like protein [Gossypium arboreum]
Length=525

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/521 (72%), Positives = 436/521 (84%), Gaps = 5/521 (1%)
 Frame = -3

Query  1866  DHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggksshlL  1687
             D  SV S+ LFVALLC+CIV+GHLLE+NRW NESITAL IGLC+G++ILL + GK SH+L
Sbjct  6     DQTSVDSITLFVALLCSCIVIGHLLEKNRWFNESITALAIGLCSGIIILLTTEGKRSHIL  65

Query  1686  VFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIFKH  1507
             VF+E+LFFIYLLPPIIFNAGFQVKKKQFF NF  I+LFGA+GTLIS  I+S G +++FK 
Sbjct  66    VFNEELFFIYLLPPIIFNAGFQVKKKQFFRNFAMIILFGAVGTLISFVIVSIGTMQLFKK  125

Query  1506  LDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFNAI  1327
             LDI FLD GDYLA+GAIF+ATDSVCTLQVL+QDETPLLYS+VFGEGVVNDATS+VLFNAI
Sbjct  126   LDIGFLDIGDYLALGAIFSATDSVCTLQVLNQDETPLLYSIVFGEGVVNDATSIVLFNAI  185

Query  1326  QSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAlmm  1147
             Q FD++    +I + FIGNFLY F++ST LGVG+GL+ AYIIKKLY GRHSTDREVALM+
Sbjct  186   QKFDLSHITSRIFIEFIGNFLYFFITSTLLGVGVGLISAYIIKKLYIGRHSTDREVALMI  245

Query  1146  lmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETFIF  967
             LM+YLSY+MAELF LS ILTVFFCGIVMSHYTWHNVTESSR+TT+H+FATLSF++E FIF
Sbjct  246   LMAYLSYMMAELFNLSSILTVFFCGIVMSHYTWHNVTESSRITTKHAFATLSFISEIFIF  305

Query  966   LYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSDKI  787
             LYVGMDALDIEKWK V  S G S  VSSIL+GL+LVGRAA VFPLSF+SNL K++ SDK 
Sbjct  306   LYVGMDALDIEKWKVVSKSPGTSAGVSSILLGLVLVGRAASVFPLSFISNLFKRSESDKF  365

Query  786   SFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGLMT  607
             + +QQ+ IWWAGLMRG+VS+ALAYN+FT SGHT L  N+IMITST+TVVLFSTVVFGLMT
Sbjct  366   TLKQQVTIWWAGLMRGSVSVALAYNQFTRSGHTQLRGNSIMITSTITVVLFSTVVFGLMT  425

Query  606   KPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTALR  427
             KPLI LLL P K +  G SS +     S     +PL+ N  D+E   + G  + RPT+LR
Sbjct  426   KPLIRLLL-PSKHLCGGVSSGSFDSFPSKLMTDLPLIANG-DAE---VGGNNIPRPTSLR  480

Query  426   MLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             MLL TPT TVH YWRKFDDS MRP+FGGRGFVP V GSP E
Sbjct  481   MLLATPTRTVHYYWRKFDDSVMRPMFGGRGFVPHVPGSPTE  521



>gb|KHN16165.1| Sodium/hydrogen exchanger 2 [Glycine soja]
Length=506

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/546 (72%), Positives = 441/546 (81%), Gaps = 51/546 (9%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M F +SS++     L TSDHASVVSMNLFVALLC CIVLGHLLEENRW+NESITAL+IG+
Sbjct  1     MVFEISSVVSKLQTLSTSDHASVVSMNLFVALLCGCIVLGHLLEENRWMNESITALLIGV  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTGVVILL SGGKSSH+LVFSEDLFFIYLLPPIIFNAG                      
Sbjct  61    CTGVVILLFSGGKSSHILVFSEDLFFIYLLPPIIFNAG----------------------  98

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
                               LD+  L+ GD+LAIGAIFAATDSVCTLQVL+QDETPLLYSLV
Sbjct  99    ------------------LDVGPLELGDFLAIGAIFAATDSVCTLQVLNQDETPLLYSLV  140

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQSFD+   D  I +HF+GNFLYLF++ST LGV  GLL AYII
Sbjct  141   FGEGVVNDATSVVLFNAIQSFDLNQIDSSIAVHFLGNFLYLFIASTMLGVLTGLLSAYII  200

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLY GRHSTDREVALMMLM+YLSY++AEL YLSGILTVFFCGIVMSHYTWHNVTESSR+
Sbjct  201   KKLYIGRHSTDREVALMMLMAYLSYMLAELCYLSGILTVFFCGIVMSHYTWHNVTESSRI  260

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+HSFATLSFVAE FIFLYVGMDALDIEKWKFV +S G SVA S +L+GLIL+GRAAFV
Sbjct  261   TTKHSFATLSFVAEIFIFLYVGMDALDIEKWKFVSDSPGTSVATSGVLLGLILLGRAAFV  320

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSF+SNLAKK+ ++KISFRQQ+IIWWAGLMRGAVSIALAYN+FT SGHTSL  NAIMI
Sbjct  321   FPLSFISNLAKKSPNEKISFRQQVIIWWAGLMRGAVSIALAYNQFTMSGHTSLRSNAIMI  380

Query  660   tstvtvvlfstvvFGLMTKPLINLLLP--PHKQMPSGHSSMT-TSEPS--SPKHFTVPLL  496
             TST+TVVLFSTVVFGL+TKPLI LLLP  PH +     SS+T  ++PS  SPK  T+PLL
Sbjct  381   TSTITVVLFSTVVFGLLTKPLIRLLLPHTPHHK----ESSITIITDPSTPSPKSVTIPLL  436

Query  495   DNQPDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAG  316
              +  +SE D I G ++ RP+++R LL TPTHTVHR WRKFDD+FMRPVFGGRGFVP   G
Sbjct  437   GSAQESEVD-IDGHDIHRPSSIRALLTTPTHTVHRLWRKFDDAFMRPVFGGRGFVPVEPG  495

Query  315   SPVEQS  298
             SP E++
Sbjct  496   SPTERN  501



>gb|EEC83172.1| hypothetical protein OsI_28401 [Oryza sativa Indica Group]
Length=545

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/526 (72%), Positives = 438/526 (83%), Gaps = 7/526 (1%)
 Frame = -3

Query  1869  SDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggksshl  1690
             +D+ S+ ++ LFVAL+C CIV+GHLLEE+RW+NESITALIIGL TG VIL++S  K S +
Sbjct  16    ADYGSIAAVGLFVALICVCIVVGHLLEESRWMNESITALIIGLGTGGVILMVSSWKHSRI  75

Query  1689  LVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIFK  1510
             LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGAIGTLIS S+IS G++ +  
Sbjct  76    LVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAIGTLISFSVISLGSLGLIS  135

Query  1509  HLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFNA  1330
              L+I  LD GDYLA+GAIF+ATDSVCTLQVL+QDETP LYSLVFGEGVVNDATSVVLFNA
Sbjct  136   RLNIGSLDLGDYLALGAIFSATDSVCTLQVLNQDETPFLYSLVFGEGVVNDATSVVLFNA  195

Query  1329  IQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAlm  1150
             +Q+FD+ +F     L FIGNFLYLF +STFLGV  GLL AYIIKKLYFGRHSTDREV++M
Sbjct  196   MQNFDLANFSSVKFLQFIGNFLYLFATSTFLGVAAGLLSAYIIKKLYFGRHSTDREVSIM  255

Query  1149  mlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETFI  970
             MLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF+
Sbjct  256   MLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETFL  315

Query  969   FLYVGMDALDIEKWKFVKN--SQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSS  796
             FLYVGMDALD+EKWK V    S   S+A+S+ ++ L+LV RAAFVFPLSFL+NL KK   
Sbjct  316   FLYVGMDALDMEKWKIVGETYSPMKSIALSATILFLVLVARAAFVFPLSFLANLTKKTEE  375

Query  795   DKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFG  616
              KIS +QQ+IIWWAGLMRGAVSIALAYNKFT SGHT L  NAIMITST+TVVLFST+VFG
Sbjct  376   GKISIKQQVIIWWAGLMRGAVSIALAYNKFTRSGHTQLPSNAIMITSTITVVLFSTMVFG  435

Query  615   LMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPT  436
             L+TKPLI LL+P          S   S+P SPK F  PL+ N   S++D+  G  + RPT
Sbjct  436   LLTKPLIRLLVPARHL---NRESSALSDPPSPKSFLDPLILN--GSDADLEIGVGIRRPT  490

Query  435   ALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             +LR+LL +PT +VH YWRKFD++FMRPVFGGRGFVPFV GSP E+S
Sbjct  491   SLRLLLASPTRSVHHYWRKFDNAFMRPVFGGRGFVPFVPGSPTERS  536



>dbj|BAJ90308.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=541

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/526 (71%), Positives = 436/526 (83%), Gaps = 7/526 (1%)
 Frame = -3

Query  1869  SDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggksshl  1690
             +D+ S++++ LFVAL+C CI++GHLLEENRW+NES TAL++GL  G VIL  S GK+S L
Sbjct  11    ADYGSIMAVGLFVALMCICIIVGHLLEENRWMNESTTALLLGLGAGTVILFASSGKNSRL  70

Query  1689  LVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIFK  1510
             +VFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LF  +GTLIS SIIS GA+ +  
Sbjct  71    MVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFAVVGTLISFSIISLGAMGLVS  130

Query  1509  HLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFNA  1330
              L+I  L+ GDYLA+GAIF+ATDSVCTLQVLSQDETP LYSLVFGEGVVNDATSVVLFNA
Sbjct  131   RLNIGALELGDYLALGAIFSATDSVCTLQVLSQDETPFLYSLVFGEGVVNDATSVVLFNA  190

Query  1329  IQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAlm  1150
             IQ+FD+ +F     L FIGNFLYLF +STFLGV  GLL AY+IKKLYFGRHSTDREVA+M
Sbjct  191   IQNFDLGNFSSLKFLQFIGNFLYLFGASTFLGVSSGLLSAYVIKKLYFGRHSTDREVAIM  250

Query  1149  mlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETFI  970
             MLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF++ETF+
Sbjct  251   MLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFISETFL  310

Query  969   FLYVGMDALDIEKWKFVKN--SQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSS  796
             FLYVGMDALDIEKWK V    S   S+A+SSI++ L+LV RAAFVFPLS+LSNL KK   
Sbjct  311   FLYVGMDALDIEKWKIVSETYSPMKSIALSSIILALVLVARAAFVFPLSYLSNLTKKTPG  370

Query  795   DKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFG  616
             +KIS RQQ+IIWWAGLMRGAVSIALAYNKF  SGHT L  NAIMITST+ +VLFST+VFG
Sbjct  371   EKISVRQQVIIWWAGLMRGAVSIALAYNKFAKSGHTQLPSNAIMITSTIIIVLFSTIVFG  430

Query  615   LMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPT  436
             L+TKPLI LL+P  + +    S++  SEPSSPK F   L  N P  E+D+     + RPT
Sbjct  431   LLTKPLIRLLIPA-RHLTREVSAL--SEPSSPKSFLEQLTVNGP--ETDVENSVSIRRPT  485

Query  435   ALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             +LRMLL +PT +VH YWRKFD++FMRP+FGGRGFVPFV GSP E S
Sbjct  486   SLRMLLASPTRSVHHYWRKFDNAFMRPMFGGRGFVPFVPGSPTESS  531



>gb|ABB86294.1| vacuolar Na+/H+ antiporter [Hordeum brevisubulatum]
Length=543

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/526 (71%), Positives = 436/526 (83%), Gaps = 7/526 (1%)
 Frame = -3

Query  1869  SDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggksshl  1690
             +D+ S++++ L VAL+C CI++GH LEENRW+NES TAL++GL  G VIL  S GK+S L
Sbjct  10    ADYGSIMAVGLIVALMCICIIVGHPLEENRWMNESTTALLLGLGAGTVILFASSGKNSRL  69

Query  1689  LVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIFK  1510
             +VFSEDLFFIYLLPPIIFNAGFQV+KKQFF NFMTI LF  +GTLIS SIIS GA+ +  
Sbjct  70    MVFSEDLFFIYLLPPIIFNAGFQVRKKQFFRNFMTITLFAVVGTLISFSIISLGAMGLIS  129

Query  1509  HLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFNA  1330
              L+I  L+ GDYLA+GAIF+ATDSVCTLQVLSQDETP LYSLVFGEGVVNDATSVVLFNA
Sbjct  130   RLNIGALELGDYLALGAIFSATDSVCTLQVLSQDETPFLYSLVFGEGVVNDATSVVLFNA  189

Query  1329  IQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAlm  1150
             IQ+FD+ +F     L FIGNFLYLF +STFLGV  GLL AY+IKKLYFGRHSTDREVA+M
Sbjct  190   IQTFDLGNFSSLKFLQFIGNFLYLFGASTFLGVASGLLSAYVIKKLYFGRHSTDREVAIM  249

Query  1149  mlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETFI  970
             MLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF++ETF+
Sbjct  250   MLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFISETFL  309

Query  969   FLYVGMDALDIEKWKFVKN--SQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSS  796
             FLYVGMDALDIEKWK V    S   S+A+SSI++ L+LV RAAFVFPLS+LSNL KK + 
Sbjct  310   FLYVGMDALDIEKWKIVSETYSPMKSIALSSIILALVLVARAAFVFPLSYLSNLTKKTAG  369

Query  795   DKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFG  616
             +KIS RQQ+IIWWAGLMRGAVSIALAYNKF  SGHT L  NAIMITST+ +VLFST+VFG
Sbjct  370   EKISIRQQVIIWWAGLMRGAVSIALAYNKFAKSGHTQLPSNAIMITSTIIIVLFSTIVFG  429

Query  615   LMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPT  436
             L+TKPLI LL+P  + +    S++  SEPSSPK F   L  N P  E+D+  G  + RPT
Sbjct  430   LLTKPLIRLLIPA-RHLTREVSAL--SEPSSPKSFLEQLTVNGP--ETDVENGVSIRRPT  484

Query  435   ALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             +LRMLL +PT +VH YWRKFD++FMRPVFGGRGFVPFV GSP E S
Sbjct  485   SLRMLLASPTRSVHHYWRKFDNAFMRPVFGGRGFVPFVPGSPTESS  530



>ref|XP_004979862.1| PREDICTED: sodium/hydrogen exchanger 2-like [Setaria italica]
Length=547

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/528 (72%), Positives = 430/528 (81%), Gaps = 10/528 (2%)
 Frame = -3

Query  1869  SDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggksshl  1690
             +D+ S+ ++ LFVAL+C CIV+GHLLEENRW+NESITAL IGL TG VIL  S GK S +
Sbjct  17    ADYGSIAAVGLFVALMCVCIVVGHLLEENRWMNESITALFIGLGTGAVILFASSGKHSRV  76

Query  1689  LVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIFK  1510
             LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI LFGA+GTLIS ++IS GA+ +  
Sbjct  77    LVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITITLFGAVGTLISFTVISLGALGLIS  136

Query  1509  HLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFNA  1330
              L+I  L+ GDYLA+GAIF+ATDSVCTLQVLSQDETP LYSLVFGEGVVNDATSVVLFNA
Sbjct  137   RLNIGALELGDYLALGAIFSATDSVCTLQVLSQDETPFLYSLVFGEGVVNDATSVVLFNA  196

Query  1329  IQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAlm  1150
             IQ+FD+ + +    L FIG+FLYLF SST LGV  GLL AYIIKKLYFGRHSTDREV++M
Sbjct  197   IQNFDLGNINTAKLLKFIGSFLYLFSSSTILGVAAGLLSAYIIKKLYFGRHSTDREVSIM  256

Query  1149  mlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETFI  970
             MLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF+
Sbjct  257   MLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETFL  316

Query  969   FLYVGMDALDIEKWKFVKN--SQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSS  796
             FLYVGMDALDIEKWK V    S   S+A+SS ++ L+LV RAAFVFPLSFLSNL KK   
Sbjct  317   FLYVGMDALDIEKWKIVGQTYSPVKSIALSSTILALVLVSRAAFVFPLSFLSNLTKKTPE  376

Query  795   DKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFG  616
              KISF+QQ+I+WWAGLMRGAVSIALAYNKFT SGHT    NAIMITST+ VVLFST VFG
Sbjct  377   GKISFKQQVIVWWAGLMRGAVSIALAYNKFTRSGHTQQPSNAIMITSTIIVVLFSTFVFG  436

Query  615   LMTKPLINLLLPPH--KQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVAR  442
             L+TKPLI LL+PP    + PS       SEPSSPK F   L  N P    D+  G  + R
Sbjct  437   LLTKPLIRLLIPPRHLSREPSA-----LSEPSSPKSFLEHLAANSP-GHPDLENGISLRR  490

Query  441   PTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             P +LR+LL +PT +VH YWRKFDD FMRPVFGGRGFVPFV GSP E S
Sbjct  491   PASLRLLLVSPTRSVHHYWRKFDDGFMRPVFGGRGFVPFVPGSPTESS  538



>ref|NP_001068371.1| Os11g0648000 [Oryza sativa Japonica Group]
 gb|ABA95118.1| sodium/hydrogen exchanger 3 family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28734.1| Os11g0648000 [Oryza sativa Japonica Group]
 dbj|BAJ06109.1| sodium/proton antiporter [Oryza sativa Japonica Group]
Length=545

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/526 (71%), Positives = 437/526 (83%), Gaps = 7/526 (1%)
 Frame = -3

Query  1869  SDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggksshl  1690
             +D+ S+ ++ +FVAL+C CIV+GHLLEE+RW+NESITALIIGL TG VIL++S  K S +
Sbjct  16    ADYGSIAAVGMFVALICVCIVVGHLLEESRWMNESITALIIGLGTGGVILMVSSWKHSRI  75

Query  1689  LVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIFK  1510
             LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LFGAIGTLIS S+IS G++ +  
Sbjct  76    LVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFGAIGTLISFSVISLGSLGLIS  135

Query  1509  HLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFNA  1330
              L+I  LD GDYLA+GAIF+ATDSVCTLQVL+QDETP LYSLVFGEGVVNDATSVVLFNA
Sbjct  136   RLNIGSLDLGDYLALGAIFSATDSVCTLQVLNQDETPFLYSLVFGEGVVNDATSVVLFNA  195

Query  1329  IQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAlm  1150
             +Q+FD+ +F     L FIGNFLYLF +STFLGV  GLL AYIIKKLYFGRHSTDREV++M
Sbjct  196   MQNFDLANFSSVKFLQFIGNFLYLFATSTFLGVAAGLLSAYIIKKLYFGRHSTDREVSIM  255

Query  1149  mlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETFI  970
             MLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF+
Sbjct  256   MLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETFL  315

Query  969   FLYVGMDALDIEKWKFVKN--SQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSS  796
             FLYVGMDALD+EKWK V    S   S+A+SS ++ L+LV RAAFVFPLSFL+NL KK   
Sbjct  316   FLYVGMDALDMEKWKIVGETFSPMKSIALSSTILFLVLVARAAFVFPLSFLANLTKKTEE  375

Query  795   DKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFG  616
              KIS +QQ+IIWWAGLMRGAVSIALAYNKFT SGHT L  NAIMITST+TVVLFST+VFG
Sbjct  376   GKISIKQQVIIWWAGLMRGAVSIALAYNKFTRSGHTQLPSNAIMITSTITVVLFSTMVFG  435

Query  615   LMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPT  436
             L+TKPLI LL+P          S   S+P SPK F  PL+ N  D + ++  G  + RPT
Sbjct  436   LLTKPLIRLLIPARHL---NRESSALSDPPSPKSFLDPLILNGSDVDPEIGVG--IRRPT  490

Query  435   ALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             +LR+LL +PT +VH YWRKFD++FMRPVFGGRGFVPFV GSP E+S
Sbjct  491   SLRLLLASPTQSVHHYWRKFDNAFMRPVFGGRGFVPFVPGSPTERS  536



>gb|AFU88788.1| Na+/H+ antiporter [Paeonia lactiflora]
Length=536

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/541 (72%), Positives = 443/541 (82%), Gaps = 13/541 (2%)
 Frame = -3

Query  1917  MAFGLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLC  1738
             MAF L +L+  + L TSDHASV+S+NLFVALLCACIV+GHLLEE RW+NESITAL+IGLC
Sbjct  1     MAFQLYALM--TRLSTSDHASVISINLFVALLCACIVIGHLLEETRWMNESITALMIGLC  58

Query  1737  TGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGT  1558
             TGVVILL+SGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA+GT
Sbjct  59    TGVVILLISGGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIMLFGAVGT  118

Query  1557  LISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVF  1378
             LISC IIS G  + FK +D+  LD GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLVF
Sbjct  119   LISCGIISLGVTQFFKIMDVGSLDIGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVF  178

Query  1377  GEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIK  1198
             GEGVVNDA SVVLFNAIQSFD+T  +P+I L F GNF YLFL+ST LGV  GLL AYIIK
Sbjct  179   GEGVVNDAASVVLFNAIQSFDLTHLNPRIALQFTGNFFYLFLASTVLGVFGGLLSAYIIK  238

Query  1197  KLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT  1018
             KLYFGRHSTDREVALMMLM YLSYI+AELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT
Sbjct  239   KLYFGRHSTDREVALMMLMVYLSYILAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVT  298

Query  1017  TRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVF  838
             T+H+FAT SFVAE FIFLYVGMDALDIEKW+ + +S G SVAVSSI +GL+LVGRAAFVF
Sbjct  299   TKHAFATSSFVAEIFIFLYVGMDALDIEKWRSISDSPGTSVAVSSIFLGLVLVGRAAFVF  358

Query  837   PLSFLSNLAKKNSSDKISFRQQI--IIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIM  664
             PLSFLSNLAKK+ +DKI+F+     ++ W+   R  V  A  Y +FT SG T L  NAI+
Sbjct  359   PLSFLSNLAKKSPNDKINFQAASYDMVGWSH-ERCCVYGARLY-QFTRSGQTQLRTNAIL  416

Query  663   Itstvtvvlfst-vvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQ  487
             ITST+T          GL+T+ L+  LLP  K +     +  +S+P S K  + PLL ++
Sbjct  417   ITSTITGRSLQQWWYLGLLTQALVRFLLPHPKPL-----TPASSDPHSSKSASTPLLGSR  471

Query  486   PDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPV  307
              DSE+D+    ++ RPT+LRMLL TPTHTVHRYWRKFDDS MRPVFGGRGFVP V GSP 
Sbjct  472   QDSEADL-DFHDIPRPTSLRMLLTTPTHTVHRYWRKFDDSVMRPVFGGRGFVPVVPGSPS  530

Query  306   E  304
             E
Sbjct  531   E  531



>ref|XP_003568941.1| PREDICTED: sodium/hydrogen exchanger 2-like [Brachypodium distachyon]
Length=545

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/554 (69%), Positives = 446/554 (81%), Gaps = 16/554 (3%)
 Frame = -3

Query  1917  MAFGLSSL-LQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M   L +L L+ + L  SDH S+V++N+FVALLC CIV GHLLE NRWVNES TAL++GL
Sbjct  1     MGLDLGALALRYTGLSVSDHDSIVAINIFVALLCGCIVFGHLLEGNRWVNESTTALLMGL  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
              TG VILL++ G +S +LVFSED+FFIYLLPPIIFNAGFQVKKKQFF NFMTI+LFGA+G
Sbjct  61    LTGFVILLVTNGVNSRILVFSEDIFFIYLLPPIIFNAGFQVKKKQFFRNFMTIILFGAVG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS  II+ GA+ +F  LD+  L  GDYLAIGAIF+ATDSVCTLQVL+QDE PLLYSLV
Sbjct  121   TLISFVIITLGAMGLFSKLDVGPLQLGDYLAIGAIFSATDSVCTLQVLNQDEAPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQ+ D+  FD  + L FIG FLYLF +ST LGV  GLL AYII
Sbjct  181   FGEGVVNDATSVVLFNAIQNIDINHFDALVLLQFIGKFLYLFFTSTILGVAAGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKL F RHSTDREVA+M+LM+YLSY+++ L  LSGILTVFFCGIVMSHYTWHNVTESSRV
Sbjct  241   KKLCFARHSTDREVAIMILMAYLSYMLSMLLDLSGILTVFFCGIVMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FATLSF+AE F+FLYVGMDALDIEKWK   +S    +A+S++++GL++VGRAAFV
Sbjct  301   TTKHTFATLSFIAEIFLFLYVGMDALDIEKWKLASSSPKKPIALSAVIMGLVMVGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL+KK S  KISF+QQ+IIWWAGLMRGAVSIALAYNKFTTSGHT++  NAIMI
Sbjct  361   FPLSFLSNLSKKESRTKISFKQQVIIWWAGLMRGAVSIALAYNKFTTSGHTAVRVNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TSTV VVLFST+VFGL+TKPLINLL+PP   M +  SS         + F  PLL +   
Sbjct  421   TSTVIVVLFSTMVFGLLTKPLINLLIPPRPGMAADISS---------QSFLDPLLGSLLG  471

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE-  304
             S+ D+    +V   T L++LL  PT +VHR WRKFDDSFMRPVFGGRGFVPFV GSPVE 
Sbjct  472   SDFDV---GQVPPQTNLQLLLTMPTRSVHRVWRKFDDSFMRPVFGGRGFVPFVPGSPVER  528

Query  303   --QSPR*GTKYKQD  268
               Q P  GT  + +
Sbjct  529   SVQGPSLGTVTEAE  542



>gb|KHG14686.1| Sodium/hydrogen exchanger 2 -like protein [Gossypium arboreum]
Length=497

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/529 (71%), Positives = 424/529 (80%), Gaps = 43/529 (8%)
 Frame = -3

Query  1884  SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsgg  1705
             S L  SDH+S+VSMNLFVALLC CIV+GHLLEE+RW+NESITAL+IG+CTGVVILL +GG
Sbjct  7     SSLLASDHSSIVSMNLFVALLCGCIVIGHLLEESRWMNESITALVIGVCTGVVILLTTGG  66

Query  1704  ksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGA  1525
             KSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TIMLFGA+GTLIS  IIS GA
Sbjct  67    KSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIMLFGAVGTLISFGIISAGA  126

Query  1524  VKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSV  1345
             ++ FK L I  L  GDYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLVFGEGVVNDATSV
Sbjct  127   IQFFKELHIGDLQIGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEGVVNDATSV  186

Query  1344  VLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDR  1165
             VLFNAIQSFD+T  +  I L F+GNF YLF+SST LGV                      
Sbjct  187   VLFNAIQSFDLTHINSTIALKFVGNFFYLFISSTLLGV----------------------  224

Query  1164  EVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFV  985
                              LFYLSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFV
Sbjct  225   ----------------VLFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFV  268

Query  984   AETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKK  805
             AE FIFLYVGMDALDIEKW+ + +S G SV VSSIL+GLILVGRAAFVFPLSF+SNL KK
Sbjct  269   AEIFIFLYVGMDALDIEKWRVISDSPGKSVGVSSILLGLILVGRAAFVFPLSFISNLTKK  328

Query  804   NSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstv  625
                +KI F+QQ+ IWWAGLMRGAVS+ALAYN+FT+ GHT +  NA+MITST+TVVLFSTV
Sbjct  329   APHEKIEFKQQVTIWWAGLMRGAVSMALAYNQFTSLGHTQVRGNAMMITSTITVVLFSTV  388

Query  624   vFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVA  445
             VFGLMTKPL+ +LLP  K +    S M +SEP++PK F +PLLDN   SE++      V 
Sbjct  389   VFGLMTKPLVRILLPSPKHL----SRMLSSEPTTPKSFFLPLLDNGQGSEAEQ-GNRSVV  443

Query  444   RPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             RP++LRMLL TP+HTVH YWRKFDD+FMRPVFGGRGFVPFV GSP E++
Sbjct  444   RPSSLRMLLTTPSHTVHYYWRKFDDAFMRPVFGGRGFVPFVPGSPTERN  492



>gb|AAS17949.1| Na+/H+ antiporter precursor [Triticum aestivum]
Length=541

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/526 (71%), Positives = 434/526 (83%), Gaps = 7/526 (1%)
 Frame = -3

Query  1869  SDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggksshl  1690
             +D+ S++++ LFVAL+C CI++GHLLEENRW+NES TAL++GL  G VIL  S GK+S L
Sbjct  11    ADYGSIMAVGLFVALMCICIIVGHLLEENRWMNESTTALLLGLGAGTVILFASSGKNSRL  70

Query  1689  LVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIFK  1510
             +VFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI LF  +GTLIS SIIS GA+ +  
Sbjct  71    MVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTITLFAVVGTLISFSIISLGAMGLIS  130

Query  1509  HLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFNA  1330
              L+I  L+ GDYLA+GAIF+ATDSVCTLQVL+QDETP LYSLVFGEGVVNDATSVVLFNA
Sbjct  131   RLNIGSLELGDYLALGAIFSATDSVCTLQVLNQDETPFLYSLVFGEGVVNDATSVVLFNA  190

Query  1329  IQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAlm  1150
             IQ+FD+ +F     L FIGNFLYLF +STFLGV  GLL AY+IKKLYFGRHSTDREVA+M
Sbjct  191   IQNFDLGNFSSLKFLQFIGNFLYLFGASTFLGVASGLLSAYVIKKLYFGRHSTDREVAIM  250

Query  1149  mlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETFI  970
             MLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF++ETF+
Sbjct  251   MLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFISETFL  310

Query  969   FLYVGMDALDIEKWKFVKN--SQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSS  796
             FLYVGMDALDIEKWK V    S   S+ +SSI+V L+LV RAAFVFPLS+LSNL K    
Sbjct  311   FLYVGMDALDIEKWKIVSETYSPMKSIGLSSIIVALVLVARAAFVFPLSYLSNLTKTTPG  370

Query  795   DKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFG  616
             +KIS RQQ+IIWWAGLMRGAVSIALAYNKF  SGHT L  NAIMITST+ +VLFST+VFG
Sbjct  371   EKISIRQQVIIWWAGLMRGAVSIALAYNKFAKSGHTQLPSNAIMITSTIIIVLFSTIVFG  430

Query  615   LMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPT  436
             L+TKPLI LL+P  + +    S++  SEPSSPK F   L  N P  E+D+     + RPT
Sbjct  431   LLTKPLIRLLIPA-RHLTREVSAL--SEPSSPKSFLEQLPGNGP--ETDLENAVSIRRPT  485

Query  435   ALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             +LRMLL +PT +VH YWRKFD++FMRPVFGGRGFVPFV GSP E S
Sbjct  486   SLRMLLASPTRSVHHYWRKFDNAFMRPVFGGRGFVPFVPGSPTESS  531



>gb|ACT53748.1| vacuolar Na+/H+ antiporter [Rhizophora stylosa]
Length=537

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/540 (70%), Positives = 440/540 (81%), Gaps = 9/540 (2%)
 Frame = -3

Query  1917  MAFGLSSLLQN-SDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M F L S++        +D ASV S+ LFVALLCAC+++G LLE+NRWVNESITAL IGL
Sbjct  1     MGFSLGSIVSRLVAPLEADEASVHSVTLFVALLCACVLIGQLLEKNRWVNESITALAIGL  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
              TG++ILL +G +SS +L+FSE+LFFIYLLPPIIFNAGFQVKKKQFF NF+TI+LFGA+G
Sbjct  61    FTGIIILLSTGWRSSRILLFSEELFFIYLLPPIIFNAGFQVKKKQFFRNFITIVLFGAVG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS +I+S G+ +IF  +D+  L+  DYLA+GAIF+ATD+VCTLQ+LSQ+ETPLLYSLV
Sbjct  121   TLISFAIVSLGSAQIFSKMDVGLLETVDYLALGAIFSATDTVCTLQILSQEETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDAT+VVLFNAIQ FD++     I +   GNFLYLF +ST LGV +GLL AYII
Sbjct  181   FGEGVVNDATAVVLFNAIQRFDLSHTTSSIAMQLFGNFLYLFTTSTLLGVAVGLLSAYII  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLYFGRHSTDREVALM+LM+YLSY++AELF LSGILTVFFCGI MSHYTWHNVTESSRV
Sbjct  241   KKLYFGRHSTDREVALMILMAYLSYMIAELFNLSGILTVFFCGIAMSHYTWHNVTESSRV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TTRH+FATLSF++E FIFLYVGMDALDIEKWKFV  S G S+ VSSIL+GL L+GRAA V
Sbjct  301   TTRHAFATLSFISEIFIFLYVGMDALDIEKWKFVSKSPGKSLGVSSILLGLTLIGRAASV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSF+SNL KK+ +DKI  RQQ+IIWWAGLMRGAVS+ALAYNKFT SGHT L  +AI+I
Sbjct  361   FPLSFISNLTKKSQTDKIGLRQQVIIWWAGLMRGAVSMALAYNKFTMSGHTQLQGDAILI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSS-MTTSEPSSPKHFTVPLLDNQP  484
             TST+TVVLFSTVVFGL TKPLI  LLP        HSS M +S     K   +PL+ N  
Sbjct  421   TSTITVVLFSTVVFGLATKPLIRWLLPQK------HSSGMVSSGFDESKSIVLPLIANGQ  474

Query  483   DSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
             D+ES+   G  V RP +LRMLL TPT+TVH  WRKFDD+FMRPVFGGRGF P+  GSP E
Sbjct  475   DAESEG-GGSNVTRPISLRMLLSTPTNTVHYCWRKFDDAFMRPVFGGRGFAPYHPGSPTE  533



>ref|XP_003577286.2| PREDICTED: sodium/hydrogen exchanger 2-like [Brachypodium distachyon]
Length=555

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/550 (69%), Positives = 442/550 (80%), Gaps = 11/550 (2%)
 Frame = -3

Query  1941  GRKRGRTKMAFGLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESI  1762
             G  R    M  GL  +        +D+ S+ ++ +FVAL+C CI++GHLLEENRW+NES 
Sbjct  5     GLPREEVGMMMGLGGVALGDP--PADYGSIAAVGMFVALMCVCIIVGHLLEENRWMNEST  62

Query  1761  TALIIGLCTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTI  1582
             TAL+IGL +G VILL+S GK+S ++VFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTI
Sbjct  63    TALLIGLGSGTVILLVSSGKNSRIMVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTI  122

Query  1581  MLFGAIGTLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDET  1402
              LF  +GTLIS SIIS GA+ I   L+I  L+ GD+LA+GAIF+ATDSVCTLQVLSQDET
Sbjct  123   TLFAVVGTLISFSIISLGAMGIISKLNIGALELGDFLALGAIFSATDSVCTLQVLSQDET  182

Query  1401  PLLYSLVFGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIG  1222
             P LYSLVFGEGVVNDATSVVLFNAIQ+FD+ +F     L  +G+FLYLF +STFLGV  G
Sbjct  183   PFLYSLVFGEGVVNDATSVVLFNAIQNFDLANFSSFKFLQLVGSFLYLFGTSTFLGVATG  242

Query  1221  LLCAYIIKKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHN  1042
             LL AYIIKKLYFGRHSTDREV++MMLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHN
Sbjct  243   LLSAYIIKKLYFGRHSTDREVSIMMLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHN  302

Query  1041  VTESSRVTTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKN--SQGLSVAVSSILVGL  868
             VTESSRVTT+H+FATLSF++ETF+FLYVGMDALDIEKWK V    S   SVA+SSI+V L
Sbjct  303   VTESSRVTTKHAFATLSFISETFLFLYVGMDALDIEKWKIVSETYSPMKSVALSSIIVAL  362

Query  867   ILVGRAAFVFPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHT  688
             +LV RAAFVFPLS+LSNL KK   +KIS RQQ+IIWWAGLMRGAVSIALAYNKF  SGHT
Sbjct  363   VLVARAAFVFPLSYLSNLTKKTPGEKISIRQQVIIWWAGLMRGAVSIALAYNKFAKSGHT  422

Query  687   SLHENAIMItstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFT  508
              L  NAIMITST+ +VLFST+VFGL+TKPLI LL+ P + +    S++  SEP+SPK F 
Sbjct  423   QLPSNAIMITSTIIIVLFSTIVFGLLTKPLIRLLI-PTRHITRELSAL--SEPASPKSFL  479

Query  507   VPLLDNQPDSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVP  328
               L    PD E+ +     + RPT+LRMLL +PT +VH YWRKFD++FMRPVFGGRGFVP
Sbjct  480   EQLTAGGPDPENSV----GIRRPTSLRMLLASPTRSVHYYWRKFDNAFMRPVFGGRGFVP  535

Query  327   FVAGSPVEQS  298
             FV GSP E S
Sbjct  536   FVPGSPTESS  545



>ref|XP_008234992.1| PREDICTED: sodium/hydrogen exchanger 2-like [Prunus mume]
Length=551

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/524 (70%), Positives = 433/524 (83%), Gaps = 4/524 (1%)
 Frame = -3

Query  1872  TSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggkssh  1693
             T+D A + S+ LFV LLC C+V+GHLLE++RW+ ES+TAL+IGLCTG+VILL +  KSS 
Sbjct  18    TTDEAPINSITLFVVLLCFCVVIGHLLEKSRWMTESVTALLIGLCTGIVILLNTEWKSSR  77

Query  1692  lLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIF  1513
             +LVF+ED+FFIYLLPPIIFNAGFQVKKK+FF NFMTIML GA+G+ IS  II  G++++F
Sbjct  78    VLVFNEDIFFIYLLPPIIFNAGFQVKKKRFFQNFMTIMLLGAVGSFISFVIIWLGSLQLF  137

Query  1512  KHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFN  1333
             + +DI FL+  DYLA+GAIF+ATD+VCTLQVL+QDETPLLYSLVFGEGVVNDATSVVLFN
Sbjct  138   EKMDIGFLEMNDYLALGAIFSATDTVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFN  197

Query  1332  AIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAl  1153
             AIQ FD++  +  I + FIGNFLYLFL+ST LG+ +GLL AYI+KKLY GRHSTDREVAL
Sbjct  198   AIQRFDLSHINSTIVMEFIGNFLYLFLTSTLLGIAVGLLSAYIMKKLYLGRHSTDREVAL  257

Query  1152  mmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETF  973
             M+LM+YLSY++AELF LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSFV+E F
Sbjct  258   MILMAYLSYMVAELFDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFVSEIF  317

Query  972   IFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSSD  793
             IFLYVGMDALDIEKWKFV  S G S+ VSSIL+GL+L+GRAAFVFPL F SNL KK+ SD
Sbjct  318   IFLYVGMDALDIEKWKFVSQSPGTSIGVSSILLGLVLIGRAAFVFPLCFASNLTKKHQSD  377

Query  792   KISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFGL  613
             KI F+QQ+ +WWAGLMRGAVS+ALAYN FT SGHT    NA+MITST+TVVLF+ VV GL
Sbjct  378   KIGFKQQVTVWWAGLMRGAVSVALAYNWFTMSGHTQRRGNAVMITSTITVVLFTNVVCGL  437

Query  612   MTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPTA  433
             +TKPL+  LLP HK   SG S M++   SS     +PLL N  D + DM  G  + R T 
Sbjct  438   LTKPLVRWLLPQHKH--SG-SIMSSELLSSETSLAMPLLTNGDDLKWDM-PGDRIPRRTV  493

Query  432   LRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             LRMLL TP  +VH YWR FDDSFMRPVFGGRGFVPF  GSP E 
Sbjct  494   LRMLLMTPVRSVHYYWRMFDDSFMRPVFGGRGFVPFAPGSPNED  537



>ref|XP_008386615.1| PREDICTED: sodium/hydrogen exchanger 2-like [Malus domestica]
Length=545

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/540 (68%), Positives = 438/540 (81%), Gaps = 13/540 (2%)
 Frame = -3

Query  1908  GLSSLLQNSDLFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGV  1729
             G+S++++      +  ASV S+ LFV LLC CI++GHLLE+NRW+ ES+TAL+IGLCTG+
Sbjct  2     GVSAVVRLGVRSAASEASVNSITLFVVLLCLCILIGHLLEKNRWMTESVTALLIGLCTGI  61

Query  1728  VIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLIS  1549
             VILL + GKSSH+LVF+EDLFFIYLLPPIIFNAGFQVKKK+FF NFMTI L GA+G+L+S
Sbjct  62    VILLNTEGKSSHILVFNEDLFFIYLLPPIIFNAGFQVKKKRFFQNFMTITLLGAVGSLVS  121

Query  1548  CSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEG  1369
               IIS G++++FK LDI FL+ GDYLA+GAIF+ATDSVCTLQVL QDETPLLYSLVFGEG
Sbjct  122   FVIISLGSMQLFKKLDIGFLEMGDYLALGAIFSATDSVCTLQVLDQDETPLLYSLVFGEG  181

Query  1368  VVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLY  1189
             VVNDATSV LFNAIQ FD++  +  I + F G+FL L  +S  LGV +GLL AYIIKKLY
Sbjct  182   VVNDATSVALFNAIQKFDLSHINSTIAMEFSGSFLVLLFASMVLGVAVGLLSAYIIKKLY  241

Query  1188  FGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRH  1009
              GRHSTDREVALM+LM+YLSY++AELF LSGILTVFFCG+VMSHYTWHNVTESSRVTT+H
Sbjct  242   LGRHSTDREVALMILMAYLSYMVAELFNLSGILTVFFCGLVMSHYTWHNVTESSRVTTKH  301

Query  1008  SFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFVFPLS  829
             +FAT SFV+E FIFLYVGMDALD+EKWKFVK S G S+ VSSIL+GL+LVGRAAFVFPL 
Sbjct  302   AFATFSFVSEIFIFLYVGMDALDMEKWKFVKESPGTSIGVSSILLGLVLVGRAAFVFPLC  361

Query  828   FLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstv  649
             FLSNL +++ +DKI F+QQ+ +WWAGLMRGAVS+ALAYN FT SGHT    NA+MITST+
Sbjct  362   FLSNLTRRSQTDKIGFKQQVTVWWAGLMRGAVSVALAYNWFTMSGHTQQRGNAVMITSTI  421

Query  648   tvvlfstvvFGLMTKPLINLLLPPHKQ----MPSGHSSMTTSEPSSPKHFTVPLLDNQPD  481
             TVVLF+ VV GL+TKPL+ LLLP  KQ    + S  S M+ + P         LL N  D
Sbjct  422   TVVLFTNVVCGLLTKPLVRLLLPQQKQFDSILMSSESEMSLAMP--------LLLANGED  473

Query  480   SESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQ  301
             S+S M +   + RP++LRM L TPT +VH YWRKFDD +MRPVFGGRGFVP+  GSP E 
Sbjct  474   SKSSM-SSDTMPRPSSLRMFLTTPTRSVHYYWRKFDDGYMRPVFGGRGFVPYAPGSPNEN  532



>ref|XP_002451198.1| hypothetical protein SORBIDRAFT_05g025700 [Sorghum bicolor]
 gb|EES10186.1| hypothetical protein SORBIDRAFT_05g025700 [Sorghum bicolor]
Length=541

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/526 (72%), Positives = 434/526 (83%), Gaps = 6/526 (1%)
 Frame = -3

Query  1869  SDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGLCTGVVIlllsggksshl  1690
             +D+AS+ ++ LFVAL+C CI++GHLLEENRW+NESITAL IGL TG VIL  S GK S +
Sbjct  11    ADYASIAAVGLFVALMCVCIIVGHLLEENRWMNESITALFIGLGTGAVILFASSGKHSRV  70

Query  1689  LVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIGTLISCSIISFGAVKIFK  1510
             L FSEDLFFIYLLPPIIFNAGFQVKKKQFF NF+TI LFGA+GTLIS ++IS GA+ +  
Sbjct  71    LQFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITITLFGAVGTLISFTVISLGALGLVS  130

Query  1509  HLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLVFGEGVVNDATSVVLFNA  1330
              L+I  L+ GDYLA+GAIF+ATDSVCTLQVLSQDETP LYSLVFGEGVVNDATSVVLFNA
Sbjct  131   RLNIGALELGDYLALGAIFSATDSVCTLQVLSQDETPFLYSLVFGEGVVNDATSVVLFNA  190

Query  1329  IQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYIIKKLYFGRHSTDREVAlm  1150
             IQ+FD+ +      L+FIG+FLYLF +ST LGV  GLL AYIIKKLYFGRHSTDREV++M
Sbjct  191   IQNFDLGNISGAKLLNFIGSFLYLFGTSTILGVASGLLSAYIIKKLYFGRHSTDREVSIM  250

Query  1149  mlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRVTTRHSFATLSFVAETFI  970
             MLM+YLSY++AEL  LSGILTVFFCGIVMSHYTWHNVTESSRVTT+H+FATLSF+AETF+
Sbjct  251   MLMAYLSYMLAELLDLSGILTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETFL  310

Query  969   FLYVGMDALDIEKWKFVKN--SQGLSVAVSSILVGLILVGRAAFVFPLSFLSNLAKKNSS  796
             FLYVGMDALDIEKWK V    S   SVA+SS ++ L+LV RAAFVFPLSFLSNL KK  +
Sbjct  311   FLYVGMDALDIEKWKIVSQTYSPVKSVALSSTILALVLVSRAAFVFPLSFLSNLTKKTPN  370

Query  795   DKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMItstvtvvlfstvvFG  616
              KISFRQQ+I+WWAGLMRGAVSIALAYNKFT SGHT    NAIMITST+TVVLFST+VFG
Sbjct  371   GKISFRQQVIVWWAGLMRGAVSIALAYNKFTRSGHTQQPSNAIMITSTITVVLFSTIVFG  430

Query  615   LMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLLDNQPDSESDMITGPEVARPT  436
             L+TKPLI LL+PP + +    S++  SEPSSPK F   L  N P    D+  G  + RPT
Sbjct  431   LLTKPLIRLLIPP-RHLSREASAL--SEPSSPKSFFEQLATNSP-GLPDIENGISLRRPT  486

Query  435   ALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVEQS  298
             +LR+LL +P  +VH YWRKFDD FMRPVFGGRGFVPF  GSP E S
Sbjct  487   SLRLLLASPARSVHYYWRKFDDGFMRPVFGGRGFVPFHPGSPTESS  532



>ref|XP_002884574.1| hypothetical protein ARALYDRAFT_896752 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60833.1| hypothetical protein ARALYDRAFT_896752 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/544 (70%), Positives = 444/544 (82%), Gaps = 7/544 (1%)
 Frame = -3

Query  1917  MAFGLSSLLQNSD-LFTSDHASVVSMNLFVALLCACIVLGHLLEENRWVNESITALIIGL  1741
             M  GL+++L+ S+ LF SDHASVVSMNLFVALLCACIVLGHLLEE RW+NESITALIIG 
Sbjct  1     MVIGLTTMLEKSEALFASDHASVVSMNLFVALLCACIVLGHLLEETRWMNESITALIIGS  60

Query  1740  CTGVVIlllsggksshlLVFSEDLFFIYLLPPIIFNAGfqvkkkqffVNFMTIMLFGAIG  1561
             CTG+VILL+SGGKSS +LVFSEDLFFIYLLPPIIFNAGFQVKKKQFF NFMTIMLFGA+G
Sbjct  61    CTGIVILLISGGKSSRILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAVG  120

Query  1560  TLISCSIISFGAVKIFKHLDIDFLDFGDYLAIGAIFAATDSVCTLQVLSQDETPLLYSLV  1381
             TLIS  IIS GA   FK ++I  L   DYLAIGAIF+ATDSVCTLQVL+QDETPLLYSLV
Sbjct  121   TLISFVIISLGAKHFFKKMNIGDLTISDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLV  180

Query  1380  FGEGVVNDATSVVLFNAIQSFDMTSFDPKIGLHFIGNFLYLFLSSTFLGVGIGLLCAYII  1201
             FGEGVVNDATSVVLFNAIQ FD+T  +  I L F GNF YLF+ ST LGV  GLL A++I
Sbjct  181   FGEGVVNDATSVVLFNAIQRFDLTHINSAIALEFAGNFFYLFILSTALGVAAGLLSAFVI  240

Query  1200  KKLYFGRHSTDREVAlmmlmsylsYIMAELFYLSGILTVFFCGIVMSHYTWHNVTESSRV  1021
             KKLY GRHSTDREVALMML++YLSY++AELF+LS ILTVFFCGIVMSHYTWHNVT+ S+V
Sbjct  241   KKLYIGRHSTDREVALMMLLAYLSYMLAELFHLSSILTVFFCGIVMSHYTWHNVTDKSKV  300

Query  1020  TTRHSFATLSFVAETFIFLYVGMDALDIEKWKFVKNSQGLSVAVSSILVGLILVGRAAFV  841
             TT+H+FA LSF+AE FIFLYVGMDALDIEKW  V++S G S+ VSSIL+GLILVGRAAFV
Sbjct  301   TTKHTFAALSFLAEIFIFLYVGMDALDIEKWDVVRSSPGQSIGVSSILLGLILVGRAAFV  360

Query  840   FPLSFLSNLAKKNSSDKISFRQQIIIWWAGLMRGAVSIALAYNKFTTSGHTSLHENAIMI  661
             FPLSFLSNL K +  +KI +++Q+ IWWAGLMRGAVS+ALAYN+FTTSGHT +  NAIMI
Sbjct  361   FPLSFLSNLTKSSLDEKIDWKKQVTIWWAGLMRGAVSMALAYNQFTTSGHTKVLGNAIMI  420

Query  660   tstvtvvlfstvvFGLMTKPLINLLLPPHKQMPSGHSSMTTSEPSSPKHFTVPLL-DNQP  484
             TST+TVVLFSTVVFGL+TKPL+  L P  K+     SS T  + ++   F  PLL +N+P
Sbjct  421   TSTITVVLFSTVVFGLLTKPLVKHLQPSSKR-----SSTTALQITTGSSFHDPLLTNNEP  475

Query  483   DSESDMITGPEVARPTALRMLLRTPTHTVHRYWRKFDDSFMRPVFGGRGFVPFVAGSPVE  304
                +   +   + +P + RM   +P+  +H YWRKFD++ MR +FGGRG  P V GSP++
Sbjct  476   LLSTQGPSEYNIEQPVSFRMFWNSPSRAIHHYWRKFDNAVMRRIFGGRGVSPVVPGSPID  535

Query  303   QSPR  292
              S R
Sbjct  536   TSVR  539



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6807917298256