BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18452_g1_i1 len=2965 path=[1:0-1500 1502:1501-1667 6614:1668-1675
1677:1676-1712 1714:1713-1713 1715:1714-2964]

Length=2965
                                                                      Score     E

ref|XP_006337994.1|  PREDICTED: alkaline/neutral invertase CINV2-...   1020   0.0     
ref|XP_011071359.1|  PREDICTED: alkaline/neutral invertase CINV2       1011   0.0     
emb|CDP20748.1|  unnamed protein product                               1011   0.0     
ref|XP_010319230.1|  PREDICTED: LOW QUALITY PROTEIN: alkaline/neu...   1010   0.0     
ref|XP_007035889.1|  Neutral invertase isoform 1                       1005   0.0     
gb|KHG04460.1|  hypothetical protein F383_29023                         996   0.0     
ref|XP_006419305.1|  hypothetical protein CICLE_v10004474mg             992   0.0     
ref|XP_006488793.1|  PREDICTED: alkaline/neutral invertase CINV2-...    991   0.0     
gb|AEP31948.1|  neutral/alkaline invertase                              989   0.0     
gb|AHD25653.1|  neutral invertase 2                                     988   0.0     
ref|XP_008223426.1|  PREDICTED: alkaline/neutral invertase CINV2        987   0.0     
emb|CAN63178.1|  hypothetical protein VITISV_029106                     986   0.0     Vitis vinifera
emb|CAA76145.1|  neutral invertase                                      985   0.0     Daucus carota [carrots]
emb|CBI22843.3|  unnamed protein product                                985   0.0     
ref|XP_002519277.1|  beta-fructofuranosidase, putative                  985   0.0     Ricinus communis
gb|AHF27220.1|  invertase                                               984   0.0     
ref|XP_003529503.1|  PREDICTED: alkaline/neutral invertase CINV2-...    982   0.0     
ref|NP_001267976.1|  neutral invertase                                  981   0.0     
ref|XP_011019331.1|  PREDICTED: alkaline/neutral invertase CINV2        979   0.0     
ref|XP_003550817.1|  PREDICTED: alkaline/neutral invertase CINV2-...    976   0.0     
emb|CAP59644.1|  putative neutral invertase                             976   0.0     Vitis vinifera
emb|CAP59643.1|  putative neutral invertase                             975   0.0     Vitis vinifera
gb|EYU45478.1|  hypothetical protein MIMGU_mgv1a002360mg                974   0.0     
ref|XP_002311370.2|  hypothetical protein POPTR_0008s10090g             972   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010045364.1|  PREDICTED: alkaline/neutral invertase CINV2        969   0.0     
ref|XP_010102907.1|  hypothetical protein L484_005970                   965   0.0     
ref|XP_007154423.1|  hypothetical protein PHAVU_003G118400g             965   0.0     
ref|XP_004295043.1|  PREDICTED: uncharacterized protein LOC101296189    962   0.0     
gb|KDP27968.1|  hypothetical protein JCGZ_19048                         959   0.0     
ref|NP_001281053.1|  alkaline/neutral invertase CINV2                   957   0.0     
gb|KHN28199.1|  hypothetical protein glysoja_024017                     955   0.0     
ref|XP_004508109.1|  PREDICTED: uncharacterized protein LOC101491074    951   0.0     
ref|XP_009372083.1|  PREDICTED: alkaline/neutral invertase CINV2        948   0.0     
ref|XP_010270854.1|  PREDICTED: alkaline/neutral invertase CINV2        947   0.0     
ref|XP_008390412.1|  PREDICTED: alkaline/neutral invertase CINV2-...    946   0.0     
ref|XP_007225679.1|  hypothetical protein PRUPE_ppa002847mg             943   0.0     
gb|AGX27472.1|  plant neutral invertase                                 935   0.0     
gb|KDP23366.1|  hypothetical protein JCGZ_23199                         933   0.0     
emb|CDP15231.1|  unnamed protein product                                925   0.0     
ref|XP_010546951.1|  PREDICTED: LOW QUALITY PROTEIN: alkaline/neu...    925   0.0     
gb|KEH32364.1|  alkaline/neutral invertase                              924   0.0     
gb|AHA82519.1|  neutral/alkaline invertase                              924   0.0     
ref|XP_011023805.1|  PREDICTED: alkaline/neutral invertase CINV1-...    922   0.0     
ref|XP_002277312.2|  PREDICTED: alkaline/neutral invertase CINV2        921   0.0     Vitis vinifera
ref|XP_010667189.1|  PREDICTED: alkaline/neutral invertase CINV2-...    919   0.0     
ref|XP_011038960.1|  PREDICTED: alkaline/neutral invertase CINV2-...    917   0.0     
ref|XP_002318940.2|  hypothetical protein POPTR_0013s00800g             917   0.0     Populus trichocarpa [western balsam poplar]
gb|KGN61014.1|  hypothetical protein Csa_2G034660                       916   0.0     
emb|CAP59645.1|  putative neutral invertase                             916   0.0     Vitis vinifera
ref|XP_009777348.1|  PREDICTED: alkaline/neutral invertase CINV2        915   0.0     
ref|XP_008453273.1|  PREDICTED: alkaline/neutral invertase CINV1-...    915   0.0     
emb|CAP59646.1|  putative neutral invertase                             915   0.0     Vitis vinifera
ref|XP_010024149.1|  PREDICTED: alkaline/neutral invertase CINV1        914   0.0     
ref|XP_007031201.1|  Neutral invertase isoform 1                        914   0.0     
ref|XP_002512536.1|  beta-fructofuranosidase, putative                  912   0.0     Ricinus communis
ref|XP_004158710.1|  PREDICTED: uncharacterized LOC101218389            912   0.0     
ref|XP_004144808.1|  PREDICTED: uncharacterized protein LOC101218389    912   0.0     
gb|AFA46813.1|  neutral/alkaline invertase                              912   0.0     
emb|CBI39621.3|  unnamed protein product                                910   0.0     
ref|XP_010092957.1|  hypothetical protein L484_018894                   910   0.0     
ref|XP_009587952.1|  PREDICTED: alkaline/neutral invertase CINV2        909   0.0     
ref|XP_008246215.1|  PREDICTED: alkaline/neutral invertase CINV2        909   0.0     
ref|XP_006433565.1|  hypothetical protein CICLE_v10000500mg             909   0.0     
gb|KDO81624.1|  hypothetical protein CISIN_1g005783mg                   908   0.0     
ref|XP_006472236.1|  PREDICTED: alkaline/neutral invertase CINV2-...    907   0.0     
ref|XP_008438972.1|  PREDICTED: alkaline/neutral invertase CINV2        905   0.0     
ref|XP_004302290.1|  PREDICTED: uncharacterized protein LOC101304591    902   0.0     
ref|XP_004165515.1|  PREDICTED: uncharacterized protein LOC101231486    902   0.0     
gb|KGN57182.1|  hypothetical protein Csa_3G168930                       902   0.0     
ref|XP_007208331.1|  hypothetical protein PRUPE_ppa002385mg             900   0.0     
ref|XP_011087506.1|  PREDICTED: LOW QUALITY PROTEIN: alkaline/neu...    898   0.0     
ref|XP_009373311.1|  PREDICTED: alkaline/neutral invertase CINV2-...    898   0.0     
gb|KHN02814.1|  Cell cycle checkpoint protein RAD1                      898   0.0     
ref|XP_009337633.1|  PREDICTED: alkaline/neutral invertase CINV2        897   0.0     
ref|XP_003555178.1|  PREDICTED: alkaline/neutral invertase CINV2-...    897   0.0     
ref|XP_009335501.1|  PREDICTED: alkaline/neutral invertase CINV2-...    895   0.0     
ref|XP_008370364.1|  PREDICTED: alkaline/neutral invertase CINV2-...    894   0.0     
ref|XP_010553709.1|  PREDICTED: alkaline/neutral invertase CINV2        894   0.0     
ref|XP_004495636.1|  PREDICTED: uncharacterized protein LOC101503498    893   0.0     
ref|XP_010486160.1|  PREDICTED: alkaline/neutral invertase CINV2-...    892   0.0     
ref|XP_008388459.1|  PREDICTED: alkaline/neutral invertase CINV2        892   0.0     
gb|KCW60577.1|  hypothetical protein EUGRSUZ_H03308                     892   0.0     
gb|ADF27783.1|  neutral/alkaline invertase 2                            889   0.0     
gb|EYU38407.1|  hypothetical protein MIMGU_mgv1a002478mg                889   0.0     
ref|XP_010674559.1|  PREDICTED: alkaline/neutral invertase CINV2        887   0.0     
gb|KHN16041.1|  hypothetical protein glysoja_012017                     885   0.0     
ref|XP_007145019.1|  hypothetical protein PHAVU_007G203100g             885   0.0     
ref|XP_003535315.1|  PREDICTED: alkaline/neutral invertase CINV2-...    884   0.0     
ref|XP_004230329.1|  PREDICTED: alkaline/neutral invertase CINV1        883   0.0     
ref|XP_010914649.1|  PREDICTED: LOW QUALITY PROTEIN: alkaline/neu...    881   0.0     
ref|XP_006344790.1|  PREDICTED: alkaline/neutral invertase CINV2-...    881   0.0     
dbj|BAE98459.1|  putative neutral invertase                             881   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|NP_187302.2|  protein alkaline/neutral invertase C                  880   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KFK38110.1|  hypothetical protein AALP_AA3G070900                    879   0.0     
ref|XP_006392417.1|  hypothetical protein EUTSA_v10023341mg             879   0.0     
gb|AAP40464.1|  putative neutral invertase                              878   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407938.1|  hypothetical protein EUTSA_v10020219mg             877   0.0     
ref|XP_002891983.1|  hypothetical protein ARALYDRAFT_474815             876   0.0     
ref|XP_002882475.1|  hypothetical protein ARALYDRAFT_896781             876   0.0     
ref|XP_010441142.1|  PREDICTED: alkaline/neutral invertase CINV2-...    875   0.0     
ref|XP_010511297.1|  PREDICTED: alkaline/neutral invertase CINV2-...    872   0.0     
ref|XP_010480269.1|  PREDICTED: alkaline/neutral invertase CINV2-...    871   0.0     
ref|NP_176049.1|  alkaline/neutral invertase A                          871   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297136.1|  hypothetical protein CARUB_v10013138mg             871   0.0     
ref|XP_010415004.1|  PREDICTED: alkaline/neutral invertase CINV2-...    870   0.0     
ref|XP_008793361.1|  PREDICTED: alkaline/neutral invertase CINV2        868   0.0     
ref|XP_010415005.1|  PREDICTED: alkaline/neutral invertase CINV2-...    867   0.0     
ref|XP_006302021.1|  hypothetical protein CARUB_v10020003mg             867   0.0     
ref|XP_010941514.1|  PREDICTED: alkaline/neutral invertase CINV2-...    866   0.0     
gb|KHG16119.1|  hypothetical protein F383_01238                         865   0.0     
ref|XP_010938195.1|  PREDICTED: alkaline/neutral invertase CINV1-...    865   0.0     
gb|AFS17279.1|  neutral/alkaline invertase                              862   0.0     
ref|XP_008794511.1|  PREDICTED: alkaline/neutral invertase CINV2-...    862   0.0     
ref|XP_009124460.1|  PREDICTED: alkaline/neutral invertase CINV2        860   0.0     
emb|CDY04446.1|  BnaA03g59380D                                          860   0.0     
emb|CDY04374.1|  BnaC04g18190D                                          859   0.0     
gb|KFK22543.1|  hypothetical protein AALP_AAs68488U000500               858   0.0     
ref|XP_003591226.1|  Neutral invertase                                  853   0.0     
emb|CDY05271.1|  BnaC05g45320D                                          854   0.0     
ref|XP_006841615.1|  hypothetical protein AMTR_s00003p00222410          852   0.0     
ref|XP_009414162.1|  PREDICTED: alkaline/neutral invertase CINV2-...    848   0.0     
gb|AAF26084.1|AC012393_10  putative alkaline/neutral invertase          847   0.0     Arabidopsis thaliana [mouse-ear cress]
sp|Q84JL5.1|INVH_ARATH  RecName: Full=Probable alkaline/neutral i...    847   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010276558.1|  PREDICTED: alkaline/neutral invertase CINV1-...    847   0.0     
ref|NP_187233.5|  alkaline/neutral invertase H                          847   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010551013.1|  PREDICTED: alkaline/neutral invertase CINV2        844   0.0     
ref|XP_009147157.1|  PREDICTED: alkaline/neutral invertase CINV2        845   0.0     
gb|AAG51337.1|AC020580_17  neutral invertase, putative; 73674-70896     840   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008655058.1|  PREDICTED: alkaline/neutral invertase CINV2-...    843   0.0     
emb|CDY24687.1|  BnaA05g30860D                                          844   0.0     
gb|EPS61872.1|  neutral/alkaline invertase 2                            837   0.0     
ref|XP_002465359.1|  hypothetical protein SORBIDRAFT_01g037120          842   0.0     Sorghum bicolor [broomcorn]
ref|XP_002884536.1|  hypothetical protein ARALYDRAFT_896678             842   0.0     
ref|XP_006299298.1|  hypothetical protein CARUB_v10015452mg             841   0.0     
ref|XP_006408025.1|  hypothetical protein EUTSA_v10020291mg             839   0.0     
ref|XP_004984582.1|  PREDICTED: alkaline/neutral invertase CINV2-...    837   0.0     
ref|XP_006649984.1|  PREDICTED: alkaline/neutral invertase CINV2-...    836   0.0     
ref|XP_003520789.1|  PREDICTED: alkaline/neutral invertase CINV2-...    837   0.0     
ref|XP_009381188.1|  PREDICTED: alkaline/neutral invertase CINV2-...    835   0.0     
ref|XP_010432487.1|  PREDICTED: alkaline/neutral invertase CINV1-...    835   0.0     
ref|XP_010464135.1|  PREDICTED: alkaline/neutral invertase CINV1-...    834   0.0     
ref|NP_001049936.1|  Os03g0314800                                       833   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_007035890.1|  Neutral invertase isoform 2                        833   0.0     
gb|KHN03923.1|  hypothetical protein glysoja_022609                     832   0.0     
ref|XP_010486057.1|  PREDICTED: alkaline/neutral invertase CINV1-...    833   0.0     
ref|XP_003558048.1|  PREDICTED: alkaline/neutral invertase CINV1-...    832   0.0     
dbj|BAJ94475.1|  predicted protein                                      832   0.0     
gb|EEC75120.1|  hypothetical protein OsI_11302                          833   0.0     Oryza sativa Indica Group [Indian rice]
emb|CDY18825.1|  BnaAnng02900D                                          829   0.0     
ref|XP_009124963.1|  PREDICTED: alkaline/neutral invertase CINV1        828   0.0     
ref|XP_003567650.1|  PREDICTED: alkaline/neutral invertase CINV1-...    827   0.0     
gb|KEH24469.1|  alkaline/neutral invertase                              825   0.0     
ref|NP_001169586.1|  hypothetical protein                               825   0.0     Zea mays [maize]
ref|XP_006645848.1|  PREDICTED: alkaline/neutral invertase CINV2-...    820   0.0     
gb|EMT27716.1|  hypothetical protein F775_26108                         812   0.0     
gb|EMS59378.1|  hypothetical protein TRIUR3_23445                       812   0.0     
gb|AGG41113.1|  putative neutral/alkaline invertase                     816   0.0     
gb|EMS48780.1|  hypothetical protein TRIUR3_08899                       812   0.0     
gb|EAY73839.1|  hypothetical protein OsI_01715                          814   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_007163312.1|  hypothetical protein PHAVU_001G224200g             816   0.0     
ref|XP_009412138.1|  PREDICTED: alkaline/neutral invertase CINV1-...    814   0.0     
ref|XP_002455584.1|  hypothetical protein SORBIDRAFT_03g013420          813   0.0     Sorghum bicolor [broomcorn]
ref|NP_001042931.1|  Os01g0332100                                       813   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|AGG41122.1|  putative neutral/alkaline invertase                     812   0.0     
ref|XP_004968681.1|  PREDICTED: alkaline/neutral invertase CINV2-...    812   0.0     
ref|XP_008674013.1|  PREDICTED: alkaline/neutral invertase CINV1-...    810   0.0     
ref|XP_006605260.1|  PREDICTED: alkaline/neutral invertase CINV2-...    810   0.0     
gb|KHN43356.1|  hypothetical protein glysoja_001939                     809   0.0     
ref|XP_004494531.1|  PREDICTED: uncharacterized protein LOC101506288    808   0.0     
gb|AAO25633.1|  invertase                                               805   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_007035891.1|  Neutral invertase isoform 3                        795   0.0     
gb|KFK37997.1|  hypothetical protein AALP_AA3G056600                    794   0.0     
emb|CBI17063.3|  unnamed protein product                                771   0.0     
ref|XP_009606001.1|  PREDICTED: alkaline/neutral invertase CINV2-...    775   0.0     
ref|XP_009606000.1|  PREDICTED: alkaline/neutral invertase CINV2-...    775   0.0     
ref|XP_009605998.1|  PREDICTED: alkaline/neutral invertase CINV2-...    776   0.0     
ref|XP_003632264.1|  PREDICTED: alkaline/neutral invertase CINV1-...    773   0.0     
ref|XP_006349102.1|  PREDICTED: alkaline/neutral invertase CINV2-...    767   0.0     
emb|CAL64380.1|  putative neutral invertase                             761   0.0     Prunus persica
ref|NP_001047012.1|  Os02g0529400                                       769   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008661659.1|  PREDICTED: uncharacterized protein LOC100274...    768   0.0     
gb|AAS79609.1|  putative neutral invertase                              769   0.0     Ipomoea trifida
ref|XP_002452195.1|  hypothetical protein SORBIDRAFT_04g021550          767   0.0     Sorghum bicolor [broomcorn]
ref|XP_006349099.1|  PREDICTED: alkaline/neutral invertase CINV2-...    768   0.0     
gb|AHA82517.1|  neutral/alkaline invertase                              767   0.0     
ref|XP_006349098.1|  PREDICTED: alkaline/neutral invertase CINV2-...    768   0.0     
ref|XP_011090015.1|  PREDICTED: alkaline/neutral invertase CINV1        767   0.0     
ref|XP_004251032.1|  PREDICTED: alkaline/neutral invertase CINV1        768   0.0     
ref|NP_001142296.1|  alkaline/neutral invertase isoform 1               765   0.0     Zea mays [maize]
ref|XP_006349097.1|  PREDICTED: alkaline/neutral invertase CINV2-...    768   0.0     
ref|XP_003575059.1|  PREDICTED: alkaline/neutral invertase CINV1        765   0.0     
ref|XP_004952630.1|  PREDICTED: alkaline/neutral invertase CINV2-...    764   0.0     
ref|XP_006647331.1|  PREDICTED: alkaline/neutral invertase CINV2-...    764   0.0     
ref|XP_009790874.1|  PREDICTED: alkaline/neutral invertase CINV2-...    766   0.0     
ref|XP_010244028.1|  PREDICTED: alkaline/neutral invertase CINV1-...    764   0.0     
ref|XP_002975181.1|  hypothetical protein SELMODRAFT_267827             757   0.0     
gb|AFV94466.1|  alkaline/neutral invertase protein                      762   0.0     
ref|XP_002311958.2|  hypothetical protein POPTR_0008s02460g             763   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010088753.1|  hypothetical protein L484_018310                   760   0.0     
gb|KDP34707.1|  hypothetical protein JCGZ_10912                         761   0.0     
ref|XP_006851551.1|  hypothetical protein AMTR_s00040p00181990          761   0.0     
ref|XP_008788363.1|  PREDICTED: alkaline/neutral invertase CINV1        761   0.0     
gb|KDO46923.1|  hypothetical protein CISIN_1g006329mg                   761   0.0     
gb|KDO72047.1|  hypothetical protein CISIN_1g0061311mg                  756   0.0     
gb|KHG04215.1|  hypothetical protein F383_30053                         759   0.0     
ref|XP_006492196.1|  PREDICTED: alkaline/neutral invertase CINV2-...    761   0.0     
ref|XP_009364876.1|  PREDICTED: alkaline/neutral invertase CINV2-...    759   0.0     
gb|EAY86114.1|  hypothetical protein OsI_07486                          758   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_010535668.1|  PREDICTED: alkaline/neutral invertase CINV1        759   0.0     
ref|XP_002529075.1|  beta-fructofuranosidase, putative                  759   0.0     Ricinus communis
emb|CDP06959.1|  unnamed protein product                                759   0.0     
emb|CDY26937.1|  BnaC09g36460D                                          758   0.0     
emb|CAM32308.1|  neutral/alkaline invertase                             757   0.0     Lolium perenne [perennial ryegrass]
emb|CAA05869.1|  alkaline/neutral invertase                             756   0.0     Lolium temulentum
gb|KDP45002.1|  hypothetical protein JCGZ_01502                         759   0.0     
ref|XP_003630134.1|  Alkaline/neutral invertase                         759   0.0     
emb|CDX92345.1|  BnaA10g13840D                                          757   0.0     
ref|XP_011032827.1|  PREDICTED: alkaline/neutral invertase CINV1-...    759   0.0     
gb|EYU36087.1|  hypothetical protein MIMGU_mgv1a002839mg                758   0.0     
ref|XP_010658734.1|  PREDICTED: alkaline/neutral invertase CINV1-...    758   0.0     
ref|XP_002532011.1|  beta-fructofuranosidase, putative                  759   0.0     Ricinus communis
ref|XP_007015893.1|  Alkaline/neutral invertase isoform 1               757   0.0     
ref|XP_008355223.1|  PREDICTED: alkaline/neutral invertase CINV2-...    758   0.0     
gb|AFH77954.1|  neutral/alkaline invertase                              758   0.0     
ref|XP_007208045.1|  hypothetical protein PRUPE_ppa002614mg             758   0.0     
emb|CDO99885.1|  unnamed protein product                                758   0.0     
ref|XP_009120650.1|  PREDICTED: alkaline/neutral invertase CINV1        756   0.0     
ref|XP_007010262.1|  Alkaline/neutral invertase isoform 1               757   0.0     
ref|XP_010067152.1|  PREDICTED: alkaline/neutral invertase CINV1-...    756   0.0     
ref|XP_008227420.1|  PREDICTED: alkaline/neutral invertase CINV2        756   0.0     
ref|NP_197643.1|  alkaline/neutral invertase                            755   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009364274.1|  PREDICTED: alkaline/neutral invertase CINV2-...    755   0.0     
ref|XP_009356115.1|  PREDICTED: alkaline/neutral invertase CINV1-...    756   0.0     
ref|XP_006424304.1|  hypothetical protein CICLE_v10028002mg             755   0.0     
ref|XP_006287277.1|  hypothetical protein CARUB_v10000472mg             754   0.0     
ref|XP_006471382.1|  PREDICTED: alkaline/neutral invertase CINV1-...    755   0.0     
ref|XP_010093212.1|  hypothetical protein L484_008994                   755   0.0     
ref|XP_006361445.1|  PREDICTED: alkaline/neutral invertase CINV1-...    755   0.0     
dbj|BAJ89009.1|  predicted protein                                      752   0.0     
ref|XP_008345689.1|  PREDICTED: alkaline/neutral invertase CINV1-...    754   0.0     
gb|AFP23358.1|  neutral invertase                                       754   0.0     
ref|XP_002316508.2|  hypothetical protein POPTR_0010s24250g             754   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009393828.1|  PREDICTED: alkaline/neutral invertase CINV1-...    753   0.0     
ref|XP_004249987.1|  PREDICTED: alkaline/neutral invertase CINV1-...    754   0.0     
ref|XP_007015894.1|  Alkaline/neutral invertase isoform 2               753   0.0     
ref|XP_009618314.1|  PREDICTED: alkaline/neutral invertase CINV1-...    754   0.0     
ref|XP_002874073.1|  hypothetical protein ARALYDRAFT_489110             752   0.0     
gb|EMS48943.1|  hypothetical protein TRIUR3_16260                       754   0.0     
gb|EMT12815.1|  hypothetical protein F775_30387                         751   0.0     
ref|XP_010493339.1|  PREDICTED: alkaline/neutral invertase CINV1-...    752   0.0     
ref|XP_010421041.1|  PREDICTED: alkaline/neutral invertase CINV1-...    751   0.0     
ref|XP_009787814.1|  PREDICTED: alkaline/neutral invertase CINV1-...    752   0.0     
ref|XP_007221417.1|  hypothetical protein PRUPE_ppa002625mg             752   0.0     
ref|XP_006400758.1|  hypothetical protein EUTSA_v10012973mg             750   0.0     
ref|XP_010454516.1|  PREDICTED: alkaline/neutral invertase CINV1-...    750   0.0     
ref|XP_004504002.1|  PREDICTED: uncharacterized protein LOC101511142    751   0.0     
ref|XP_008446771.1|  PREDICTED: alkaline/neutral invertase CINV1        751   0.0     
ref|XP_010940279.1|  PREDICTED: alkaline/neutral invertase CINV1 ...    750   0.0     
ref|XP_011024247.1|  PREDICTED: alkaline/neutral invertase CINV2-...    751   0.0     
ref|XP_010242620.1|  PREDICTED: alkaline/neutral invertase CINV1-...    751   0.0     
emb|CAD19320.1|  neutral invertase                                      749   0.0     Beta vulgaris [beet]
ref|XP_010686069.1|  PREDICTED: alkaline/neutral invertase CINV1        748   0.0     
ref|XP_004150486.1|  PREDICTED: uncharacterized protein LOC101217778    749   0.0     
ref|XP_003531388.1|  PREDICTED: alkaline/neutral invertase CINV2-...    749   0.0     
ref|XP_010031480.1|  PREDICTED: alkaline/neutral invertase CINV1-...    749   0.0     
ref|XP_004291628.1|  PREDICTED: uncharacterized protein LOC101292085    748   0.0     
ref|XP_006653369.1|  PREDICTED: alkaline/neutral invertase CINV2-...    745   0.0     
ref|XP_010940271.1|  PREDICTED: alkaline/neutral invertase CINV1 ...    749   0.0     
ref|XP_011005355.1|  PREDICTED: alkaline/neutral invertase CINV1-...    746   0.0     
gb|KDO81625.1|  hypothetical protein CISIN_1g005783mg                   744   0.0     
ref|XP_008385536.1|  PREDICTED: alkaline/neutral invertase CINV2-...    742   0.0     
gb|AGU19630.1|  neutral/alkaline invertase 3                            746   0.0     
ref|XP_011102049.1|  PREDICTED: alkaline/neutral invertase CINV1-...    743   0.0     
dbj|BAF37799.1|  hypothetical protein                                   744   0.0     Ipomoea trifida
ref|XP_009404816.1|  PREDICTED: alkaline/neutral invertase CINV1-...    743   0.0     
ref|XP_006580314.1|  PREDICTED: alkaline/neutral invertase CINV2-...    743   0.0     
ref|XP_011102136.1|  PREDICTED: LOW QUALITY PROTEIN: alkaline/neu...    743   0.0     
ref|XP_006384642.1|  hypothetical protein POPTR_0004s19760g             739   0.0     
gb|EAY94016.1|  hypothetical protein OsI_15793                          739   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_003579686.1|  PREDICTED: alkaline/neutral invertase CINV1-...    739   0.0     
ref|XP_001754878.1|  predicted protein                                  740   0.0     
ref|XP_008349784.1|  PREDICTED: alkaline/neutral invertase CINV1-...    741   0.0     
ref|XP_004975545.1|  PREDICTED: alkaline/neutral invertase CINV2-...    738   0.0     
ref|XP_010031479.1|  PREDICTED: alkaline/neutral invertase CINV1-...    741   0.0     
emb|CAE04902.1|  OSJNBa0042I15.24                                       736   0.0     
ref|XP_007159781.1|  hypothetical protein PHAVU_002G266600g             736   0.0     
ref|XP_001780432.1|  predicted protein                                  727   0.0     
gb|KDO81628.1|  hypothetical protein CISIN_1g005783mg                   726   0.0     
ref|XP_001781871.1|  predicted protein                                  724   0.0     
gb|EMT27375.1|  hypothetical protein F775_29966                         716   0.0     
gb|KHG09699.1|  Enolase-like protein ENO4                               723   0.0     
gb|KEH32363.1|  alkaline/neutral invertase                              717   0.0     
ref|XP_002978791.1|  hypothetical protein SELMODRAFT_443960             712   0.0     
gb|EEE60952.1|  hypothetical protein OsJ_14709                          707   0.0     
gb|KDO81626.1|  hypothetical protein CISIN_1g005783mg                   706   0.0     
tpg|DAA45080.1|  TPA: hypothetical protein ZEAMMB73_402946              687   0.0     
ref|XP_002984705.1|  hypothetical protein SELMODRAFT_181158             694   0.0     
gb|KDO72048.1|  hypothetical protein CISIN_1g0061311mg                  662   0.0     
ref|XP_006471384.1|  PREDICTED: alkaline/neutral invertase CINV1-...    647   0.0     
gb|KCW65220.1|  hypothetical protein EUGRSUZ_G02704                     647   0.0     
gb|KDO46928.1|  hypothetical protein CISIN_1g006329mg                   640   0.0     
ref|XP_008363531.1|  PREDICTED: LOW QUALITY PROTEIN: alkaline/neu...    639   0.0     
ref|XP_006287276.1|  hypothetical protein CARUB_v10000472mg             641   0.0     
gb|KHG19326.1|  Replicase polyprotein 1ab                               640   0.0     
gb|KDO46929.1|  hypothetical protein CISIN_1g006329mg                   642   0.0     
ref|XP_006436654.1|  hypothetical protein CICLE_v100309251mg            640   0.0     
ref|XP_010031481.1|  PREDICTED: alkaline/neutral invertase CINV1-...    639   0.0     
dbj|BAJ88500.1|  predicted protein                                      633   0.0     
dbj|BAH20226.1|  AT3G06500                                              619   0.0     
gb|EPS58532.1|  hypothetical protein M569_16281                         609   0.0     
gb|ACJ07081.1|  putative beta-fructofuranosidase                        606   0.0     
ref|XP_011024246.1|  PREDICTED: alkaline/neutral invertase CINV2-...    604   0.0     
ref|XP_009404817.1|  PREDICTED: alkaline/neutral invertase CINV1-...    600   0.0     
gb|EPS64471.1|  neutral/alkaline invertase 1                            594   0.0     
ref|XP_002276670.1|  PREDICTED: alkaline/neutral invertase CINV2        594   0.0     
gb|ACX33985.1|  neutral invertase                                       582   0.0     
ref|XP_010268239.1|  PREDICTED: alkaline/neutral invertase CINV2 ...    591   0.0     
ref|XP_010268259.1|  PREDICTED: alkaline/neutral invertase CINV2 ...    590   0.0     
emb|CAP59642.1|  putative neutral invertase                             590   0.0     
emb|CAP59641.1|  putative neutral invertase                             589   0.0     
gb|AFH77953.1|  neutral/alkaline invertase                              588   0.0     
gb|KDP27592.1|  hypothetical protein JCGZ_19597                         587   0.0     
ref|XP_010690448.1|  PREDICTED: alkaline/neutral invertase CINV2        588   0.0     
ref|XP_009401124.1|  PREDICTED: alkaline/neutral invertase CINV2-...    587   0.0     
ref|XP_007211552.1|  hypothetical protein PRUPE_ppa004112mg             585   0.0     
ref|XP_004292948.1|  PREDICTED: uncharacterized protein LOC101309221    586   0.0     
ref|XP_008236189.1|  PREDICTED: alkaline/neutral invertase CINV2-...    587   0.0     
ref|XP_010088674.1|  hypothetical protein L484_003226                   587   0.0     
ref|XP_007201719.1|  hypothetical protein PRUPE_ppa003483mg             587   0.0     
ref|XP_006487399.1|  PREDICTED: alkaline/neutral invertase CINV2-...    586   0.0     
ref|XP_006423584.1|  hypothetical protein CICLE_v10030393mg             586   0.0     
ref|NP_195212.1|  beta-fructofuranosidase-like protein                  586   0.0     
dbj|BAH20183.1|  AT4G34860                                              586   0.0     
ref|NP_001130493.1|  uncharacterized protein LOC100191591               585   0.0     
ref|XP_004952843.1|  PREDICTED: alkaline/neutral invertase CINV2-...    585   0.0     
ref|XP_002867101.1|  hypothetical protein ARALYDRAFT_491170             585   0.0     
gb|EYU28230.1|  hypothetical protein MIMGU_mgv1a023298mg                585   0.0     
ref|XP_009621341.1|  PREDICTED: alkaline/neutral invertase CINV1        585   0.0     
ref|XP_009801620.1|  PREDICTED: alkaline/neutral invertase CINV1-...    585   0.0     
ref|XP_002453965.1|  hypothetical protein SORBIDRAFT_04g022350          584   0.0     
ref|XP_009602730.1|  PREDICTED: alkaline/neutral invertase CINV2-...    584   0.0     
gb|ADF27782.1|  neutral/alkaline invertase 1                            584   0.0     
ref|XP_004289834.1|  PREDICTED: uncharacterized protein LOC101301732    584   0.0     
ref|XP_006412178.1|  hypothetical protein EUTSA_v10024783mg             584   0.0     
ref|NP_001168719.1|  uncharacterized protein LOC100382511               583   0.0     
ref|XP_006283418.1|  hypothetical protein CARUB_v10004468mg             584   0.0     
ref|XP_008350490.1|  PREDICTED: alkaline/neutral invertase CINV2-...    583   0.0     
gb|AEY78488.1|  neutral invertase 1                                     583   0.0     
ref|XP_008231940.1|  PREDICTED: alkaline/neutral invertase CINV2-...    584   0.0     
ref|XP_011009346.1|  PREDICTED: alkaline/neutral invertase CINV2-...    583   0.0     
ref|XP_007017803.1|  Plant neutral invertase family protein             583   0.0     
ref|XP_002976121.1|  hypothetical protein SELMODRAFT_104721             583   0.0     
ref|XP_007222917.1|  hypothetical protein PRUPE_ppa003670mg             583   0.0     
ref|XP_011037256.1|  PREDICTED: alkaline/neutral invertase CINV2        583   0.0     
ref|XP_011092865.1|  PREDICTED: alkaline/neutral invertase CINV1-...    583   0.0     
ref|XP_010447027.1|  PREDICTED: alkaline/neutral invertase CINV2        583   0.0     
ref|XP_006353610.1|  PREDICTED: alkaline/neutral invertase CINV2-...    582   0.0     
ref|XP_002968256.1|  hypothetical protein SELMODRAFT_89558              583   0.0     
ref|XP_009801178.1|  PREDICTED: alkaline/neutral invertase CINV2-...    583   0.0     
ref|XP_008218919.1|  PREDICTED: alkaline/neutral invertase CINV2        582   0.0     
ref|XP_008221404.1|  PREDICTED: alkaline/neutral invertase CINV2-...    582   0.0     
gb|EPS61890.1|  hypothetical protein M569_12899                         582   0.0     
ref|XP_004241837.1|  PREDICTED: alkaline/neutral invertase CINV2        582   0.0     
ref|XP_007020016.1|  Cytosolic invertase 2 isoform 1                    582   0.0     
gb|EAY86242.1|  hypothetical protein OsI_07611                          580   0.0     
ref|XP_008377226.1|  PREDICTED: alkaline/neutral invertase CINV2-...    581   0.0     
gb|AHF27219.1|  invertase                                               582   0.0     
ref|XP_008339170.1|  PREDICTED: alkaline/neutral invertase CINV2        582   0.0     
gb|KHG29973.1|  Protein degV                                            582   0.0     
ref|XP_007226952.1|  hypothetical protein PRUPE_ppa025225mg             581   0.0     
ref|XP_002306166.1|  beta-fructofuranosidase family protein             582   0.0     
ref|XP_007041939.1|  Plant neutral invertase family protein isofo...    582   0.0     
ref|XP_002976468.1|  hypothetical protein SELMODRAFT_151264             578   0.0     
ref|NP_001047095.1|  Os02g0550600                                       581   0.0     
ref|XP_010526906.1|  PREDICTED: alkaline/neutral invertase CINV2-...    581   0.0     
ref|XP_006350338.1|  PREDICTED: alkaline/neutral invertase CINV2-...    580   0.0     
ref|XP_006359646.1|  PREDICTED: alkaline/neutral invertase CINV2-...    581   0.0     
gb|ADC68260.1|  neutral/alkaline invertase 2                            580   0.0     
ref|XP_006397189.1|  hypothetical protein EUTSA_v10028553mg             580   0.0     
ref|XP_010530788.1|  PREDICTED: alkaline/neutral invertase CINV2        581   0.0     
ref|XP_006647359.1|  PREDICTED: alkaline/neutral invertase CINV2-...    580   0.0     
emb|CDX75467.1|  BnaA01g02350D                                          580   0.0     
ref|XP_006852072.1|  hypothetical protein AMTR_s00041p00232150          580   0.0     
emb|CDY58813.1|  BnaAnng15360D                                          580   0.0     
ref|XP_009775050.1|  PREDICTED: alkaline/neutral invertase CINV2        580   0.0     
ref|XP_004250416.1|  PREDICTED: alkaline/neutral invertase CINV2-...    580   0.0     
ref|XP_009379225.1|  PREDICTED: alkaline/neutral invertase CINV2        580   0.0     
ref|XP_011083552.1|  PREDICTED: alkaline/neutral invertase CINV2-...    580   0.0     
gb|KHG01868.1|  Collagen and calcium-binding EGF domain-containing 1    580   0.0     
ref|XP_009362420.1|  PREDICTED: alkaline/neutral invertase CINV2-...    580   0.0     
ref|XP_009108698.1|  PREDICTED: alkaline/neutral invertase CINV2-...    580   0.0     
ref|XP_009108292.1|  PREDICTED: alkaline/neutral invertase CINV2        580   0.0     
ref|XP_006397461.1|  hypothetical protein EUTSA_v10001814mg             580   0.0     
ref|XP_010438391.1|  PREDICTED: alkaline/neutral invertase CINV2 ...    580   0.0     
ref|WP_036615988.1|  alkaline invertase                                 576   0.0     
emb|CDY34812.1|  BnaA09g41790D                                          580   0.0     
ref|XP_002994046.1|  hypothetical protein SELMODRAFT_163303             576   0.0     
ref|XP_010438400.1|  PREDICTED: alkaline/neutral invertase CINV2 ...    579   0.0     
ref|XP_008447991.1|  PREDICTED: alkaline/neutral invertase CINV2        580   0.0     
gb|EYU40403.1|  hypothetical protein MIMGU_mgv1a003765mg                580   0.0     
ref|XP_002312983.1|  beta-fructofuranosidase family protein             580   0.0     
ref|XP_009383978.1|  PREDICTED: alkaline/neutral invertase CINV2-...    580   0.0     
ref|XP_002275648.1|  PREDICTED: alkaline/neutral invertase CINV2        580   0.0     
ref|XP_004144831.1|  PREDICTED: uncharacterized protein LOC101204549    580   0.0     
gb|EKQ70800.1|  glycogen debranching enzyme                             576   0.0     
ref|XP_009410668.1|  PREDICTED: alkaline/neutral invertase CINV2-...    578   0.0     
gb|AHD25652.1|  neutral invertase 1                                     579   0.0     
gb|AFO84094.1|  neutral invertase                                       580   0.0     
ref|XP_008461922.1|  PREDICTED: alkaline/neutral invertase CINV2        578   0.0     
ref|XP_003556210.1|  PREDICTED: alkaline/neutral invertase CINV2-...    578   0.0     
gb|AEY78489.1|  neutral invertase 2                                     578   0.0     
ref|XP_010437560.1|  PREDICTED: alkaline/neutral invertase CINV2-...    579   0.0     
ref|XP_009596246.1|  PREDICTED: alkaline/neutral invertase CINV2        578   0.0     
ref|XP_010432372.1|  PREDICTED: alkaline/neutral invertase CINV2-...    579   0.0     
ref|XP_009624723.1|  PREDICTED: alkaline/neutral invertase CINV2-...    578   0.0     
ref|XP_010455341.1|  PREDICTED: alkaline/neutral invertase CINV2-...    578   0.0     
ref|NP_567347.1|  cytosolic invertase 2                                 578   0.0     
emb|CBI18174.3|  unnamed protein product                                575   0.0     
ref|XP_002526803.1|  beta-fructofuranosidase, putative                  578   0.0     
ref|XP_002874570.1|  hypothetical protein ARALYDRAFT_489803             578   0.0     
ref|XP_004139679.1|  PREDICTED: uncharacterized protein LOC101214631    578   0.0     
ref|XP_002271919.1|  PREDICTED: alkaline/neutral invertase CINV2        577   0.0     
emb|CDX69092.1|  BnaC01g03610D                                          580   0.0     
gb|KDP46923.1|  hypothetical protein JCGZ_08911                         578   0.0     
gb|ABA08442.1|  neutral/alkaline invertase                              577   0.0     
ref|XP_009393808.1|  PREDICTED: alkaline/neutral invertase CINV2-...    577   0.0     
ref|XP_004309908.1|  PREDICTED: uncharacterized protein LOC101296831    577   0.0     
ref|XP_011046819.1|  PREDICTED: alkaline/neutral invertase CINV2-...    578   0.0     
ref|XP_007020017.1|  Cytosolic invertase 2 isoform 2                    577   0.0     
ref|XP_004230910.1|  PREDICTED: alkaline/neutral invertase CINV2        578   0.0     
ref|XP_006287300.1|  hypothetical protein CARUB_v10000493mg             579   0.0     
ref|XP_010256463.1|  PREDICTED: alkaline/neutral invertase CINV2        577   0.0     
ref|XP_009402636.1|  PREDICTED: alkaline/neutral invertase CINV2-...    577   0.0     
emb|CDY41869.1|  BnaA08g06300D                                          577   0.0     
ref|XP_009803417.1|  PREDICTED: alkaline/neutral invertase CINV2-...    577   0.0     
ref|XP_011088508.1|  PREDICTED: alkaline/neutral invertase CINV2-...    577   0.0     
ref|XP_004978830.1|  PREDICTED: alkaline/neutral invertase CINV2-...    576   0.0     
ref|XP_010679425.1|  PREDICTED: alkaline/neutral invertase CINV2        576   0.0     
gb|KHN17098.1|  hypothetical protein glysoja_011572                     576   0.0     
ref|XP_003536372.1|  PREDICTED: alkaline/neutral invertase CINV2-...    576   0.0     
ref|XP_009766405.1|  PREDICTED: alkaline/neutral invertase CINV2-...    577   0.0     
ref|XP_008372873.1|  PREDICTED: alkaline/neutral invertase CINV2        576   0.0     
ref|XP_009618880.1|  PREDICTED: alkaline/neutral invertase CINV2-...    576   0.0     
dbj|BAJ85099.1|  predicted protein                                      575   0.0     
ref|XP_009145124.1|  PREDICTED: alkaline/neutral invertase CINV1-...    575   0.0     
ref|XP_003575117.1|  PREDICTED: alkaline/neutral invertase CINV2-...    575   0.0     
ref|XP_010066240.1|  PREDICTED: alkaline/neutral invertase CINV2-...    576   0.0     
emb|CDY05058.1|  BnaC03g28560D                                          574   0.0     
ref|XP_009134146.1|  PREDICTED: LOW QUALITY PROTEIN: alkaline/neu...    575   0.0     
ref|XP_011045089.1|  PREDICTED: alkaline/neutral invertase CINV2-...    575   0.0     
ref|XP_006342050.1|  PREDICTED: alkaline/neutral invertase CINV2-...    575   0.0     
ref|XP_002325983.1|  putative beta-fructofuranosidase family protein    575   0.0     
emb|CDX90723.1|  BnaA03g24030D                                          574   0.0     
gb|ADC68261.1|  neutral/alkaline invertase 1                            575   0.0     
ref|XP_004505683.1|  PREDICTED: uncharacterized protein LOC101490083    573   0.0     
ref|XP_010496150.1|  PREDICTED: alkaline/neutral invertase CINV2-...    575   0.0     
ref|XP_007143667.1|  hypothetical protein PHAVU_007G091300g             575   0.0     
ref|XP_002450402.1|  hypothetical protein SORBIDRAFT_05g004770          575   0.0     
ref|XP_006662773.1|  PREDICTED: alkaline/neutral invertase CINV2-...    574   0.0     
ref|XP_002979690.1|  hypothetical protein SELMODRAFT_111393             572   0.0     
ref|XP_004238357.1|  PREDICTED: alkaline/neutral invertase CINV2        575   0.0     
ref|XP_011004003.1|  PREDICTED: LOW QUALITY PROTEIN: alkaline/neu...    574   0.0     
ref|XP_010061984.1|  PREDICTED: alkaline/neutral invertase CINV2-...    574   0.0     
ref|XP_006473178.1|  PREDICTED: alkaline/neutral invertase CINV2-...    574   0.0     
gb|AGG41114.1|  putative neutral/alkaline invertase                     574   0.0     
gb|AGG41120.1|  putative neutral/alkaline invertase                     574   0.0     
emb|CDY17491.1|  BnaC03g65720D                                          574   0.0     
ref|XP_010691858.1|  PREDICTED: alkaline/neutral invertase CINV2-...    574   0.0     
gb|KHG01139.1|  hypothetical protein F383_23193                         574   0.0     
gb|AGG41118.1|  putative neutral/alkaline invertase                     573   0.0     
ref|XP_009416915.1|  PREDICTED: alkaline/neutral invertase CINV2-...    574   0.0     
tpg|DAA39011.1|  TPA: hypothetical protein ZEAMMB73_928957              573   0.0     
ref|XP_002307726.1|  hypothetical protein POPTR_0005s26090g             573   0.0     
gb|AFH77958.1|  neutral/alkaline invertase                              573   0.0     
ref|XP_003577807.1|  PREDICTED: alkaline/neutral invertase CINV2-...    573   0.0     
ref|NP_001146670.1|  hypothetical protein                               573   0.0     
emb|CAG30577.1|  putative neutral/alkaline invertase                    573   0.0     
ref|XP_006301300.1|  hypothetical protein CARUB_v10021707mg             572   0.0     
ref|XP_010521142.1|  PREDICTED: alkaline/neutral invertase CINV2        573   0.0     
ref|XP_006416176.1|  hypothetical protein EUTSA_v10007305mg             572   0.0     
ref|XP_010061067.1|  PREDICTED: alkaline/neutral invertase CINV2-...    573   0.0     
ref|XP_003523504.1|  PREDICTED: alkaline/neutral invertase CINV2-...    573   0.0     
ref|XP_009105864.1|  PREDICTED: alkaline/neutral invertase CINV2        572   0.0     
ref|XP_003591988.1|  Neutral invertase-like protein                     572   0.0     
ref|XP_001777804.1|  predicted protein                                  571   0.0     
ref|XP_009107914.1|  PREDICTED: alkaline/neutral invertase CINV1        572   0.0     
ref|XP_006376270.1|  putative beta-fructofuranosidase family protein    572   0.0     
gb|KHN20009.1|  hypothetical protein glysoja_014587                     570   0.0     
emb|CAL26914.1|  alkaline invertase                                     571   0.0     
ref|XP_009407007.1|  PREDICTED: alkaline/neutral invertase CINV2-...    572   0.0     
gb|AFH77952.1|  neutral/alkaline invertase                              572   0.0     
ref|XP_006581104.1|  PREDICTED: alkaline/neutral invertase CINV2-...    572   0.0     
ref|XP_003591999.1|  Neutral invertase-like protein                     571   0.0     
ref|XP_010911892.1|  PREDICTED: alkaline/neutral invertase CINV2-...    571   0.0     
ref|XP_010415921.1|  PREDICTED: alkaline/neutral invertase CINV1-...    571   0.0     
ref|XP_004496345.1|  PREDICTED: uncharacterized protein LOC101512400    571   0.0     
ref|XP_004500744.1|  PREDICTED: uncharacterized protein LOC101500758    571   0.0     
ref|NP_564177.1|  putative neutral invertase                            570   0.0     
gb|EYU22816.1|  hypothetical protein MIMGU_mgv1a005865mg                567   0.0     
ref|XP_006390718.1|  hypothetical protein EUTSA_v10019647mg             568   0.0     



>ref|XP_006337994.1| PREDICTED: alkaline/neutral invertase CINV2-like [Solanum tuberosum]
Length=678

 Score =  1020 bits (2637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/690 (74%), Positives = 570/690 (83%), Gaps = 17/690 (2%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIF-WYPFGRCNRQVMDNLSKSQQKIKDVhrmgggr  2514
             M + SCIGISTMKPC RIL S   S F  Y FG+CN  + DNLS    K+ D+HR+    
Sbjct  1     MNTSSCIGISTMKPCCRILSSCKGSSFIGYSFGKCNHLINDNLSNPHCKLDDIHRVSNYA  60

Query  2513  yrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSH  2334
              R       +  VI SNR  FCGS SN  +H      +    + R   V    ASD+R+H
Sbjct  61    NR-------VIGVIGSNRSVFCGSDSNW-RHARILLGFRLNKETRCYCVNANAASDVRNH  112

Query  2333  STSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVN-  2157
             STS EAQVN+K F KFYI GG+NVKPLVI+R E+ +DV     + +  R ++ D S VN 
Sbjct  113   STSIEAQVNEKIFDKFYIHGGLNVKPLVIDRKESGKDVA----KVEKVRTDVNDGSGVNV  168

Query  2156  ---KNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNY  1986
                 N LNG S+S+   E+E+SEVEKEAW LL+GAVVNYCG+PVGTVAANDPAD  PLNY
Sbjct  169   KHPDNYLNGESVSESPHEKELSEVEKEAWTLLRGAVVNYCGFPVGTVAANDPADMQPLNY  228

Query  1985  DQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTM  1806
             DQVFIRDF+PSALAFLLNGEG IVKNFLLHTLQLQSWEK+VDCY+PG+GLMPASFKVRT+
Sbjct  229   DQVFIRDFVPSALAFLLNGEGGIVKNFLLHTLQLQSWEKSVDCYNPGKGLMPASFKVRTV  288

Query  1805  PLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGI  1626
             PLDG NGEF+DVLDPDFGESAIGRVAPVDSGLWWIILLRAY +ITGDYTLQERVDVQTGI
Sbjct  289   PLDGSNGEFKDVLDPDFGESAIGRVAPVDSGLWWIILLRAYGRITGDYTLQERVDVQTGI  348

Query  1625  RLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDS  1446
              LIL+LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALR + EML +NDS
Sbjct  349   CLILHLCLSDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRSSHEMLTINDS  408

Query  1445  TKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWI  1266
             TKSLV+AINNRLSALSFH+REYYW+D KKINEIYRYKTEEYS DAINKFNIYPDQIP W+
Sbjct  409   TKSLVSAINNRLSALSFHMREYYWLDRKKINEIYRYKTEEYSTDAINKFNIYPDQIPSWL  468

Query  1265  VNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQ  1086
             ++WIPE GGYLVGNLQPAHMDFRFFT GN+W IISSLG+HEQN+SILN IE KWDDL+ +
Sbjct  469   MDWIPEIGGYLVGNLQPAHMDFRFFTHGNIWTIISSLGSHEQNESILNLIEDKWDDLMGK  528

Query  1085  MPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAV  906
             MPLKICYPALE E+W IITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+PELA KAV
Sbjct  529   MPLKICYPALEHEEWCIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELAQKAV  588

Query  905   AVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNED  726
              +AE+RL  D WPEYYDTRHGRFIGKQARL QTWT+AGYLTSKMLL+NPDMAS L WNED
Sbjct  589   DLAEKRLSADHWPEYYDTRHGRFIGKQARLCQTWTIAGYLTSKMLLQNPDMASKLFWNED  648

Query  725   YELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             YELLENCVC L+ NGRRKCSR   RSQVG+
Sbjct  649   YELLENCVCALRPNGRRKCSRSATRSQVGL  678



>ref|XP_011071359.1| PREDICTED: alkaline/neutral invertase CINV2 [Sesamum indicum]
Length=684

 Score =  1011 bits (2614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/691 (73%), Positives = 566/691 (82%), Gaps = 15/691 (2%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRIL-GSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggr  2514
             M + S IGIS MKPC  IL    N S+F YP  +       NLSKSQ K    + +   +
Sbjct  1     MKTGSSIGISRMKPCCNILILGRNSSVFGYPHPKGGHFTEYNLSKSQSK---SYCLMKNK  57

Query  2513  yrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSH  2334
               +   ++    VI+SNR  FCGSGSN  Q R    NW G   N+ + V+  VAS+ R+H
Sbjct  58    CFYSIKILGFRSVIDSNRRVFCGSGSNWGQSRVPSVNW-GEKNNKFLSVIANVASNTRNH  116

Query  2333  STSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGG-----RVEITDD  2169
             S+S E +VN+ SF+K YIQGG NVKPLVIER E  +D+V     KD G     + ++ D 
Sbjct  117   SSSVEPRVNENSFEKIYIQGGFNVKPLVIERIEEGQDLVG----KDEGVEKEHKSKVDDG  172

Query  2168  STVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLN  1989
             +  + +    + + +  P R +SEVEKEAW+LL+GAVVNYCG PVGTVAA DPADK PLN
Sbjct  173   ANASTDQFGKAEVLESKPTRHLSEVEKEAWELLRGAVVNYCGNPVGTVAAADPADKQPLN  232

Query  1988  YDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT  1809
             YDQVFIRDF+PSALAFLLNGE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT
Sbjct  233   YDQVFIRDFVPSALAFLLNGEAEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT  292

Query  1808  MPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTG  1629
             +PLDGR GEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAY K+TGDYTLQERVDVQTG
Sbjct  293   VPLDGRVGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYTLQERVDVQTG  352

Query  1628  IRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVND  1449
             IRLILNLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC REML VND
Sbjct  353   IRLILNLCLSDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMLTVND  412

Query  1448  STKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPW  1269
             STK+LV A+NNRLSALSFH+REYYWVDMKKINEIYRYKTEEYS +AINKFNIYPDQIP W
Sbjct  413   STKNLVVAVNNRLSALSFHLREYYWVDMKKINEIYRYKTEEYSTEAINKFNIYPDQIPGW  472

Query  1268  IVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIA  1089
             +V+WIPETGGY +GNLQPAHMDFRFFTLGNLWAI+SSL T +Q++ ILN IE KWDDL+A
Sbjct  473   LVDWIPETGGYFIGNLQPAHMDFRFFTLGNLWAIVSSLSTSKQSEGILNLIEEKWDDLVA  532

Query  1088  QMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKA  909
             QMPLKICYPALE E+WRIITG DPKNTPWSYHNGGSWPTLLWQFTLACIKM +PELA KA
Sbjct  533   QMPLKICYPALEHEEWRIITGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMERPELARKA  592

Query  908   VAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNE  729
             VA+AE+RLPVDQWPEYYDTR+GRFIGKQARL+QTWT+AGYLTSK+LL NP +AS+L WNE
Sbjct  593   VALAEKRLPVDQWPEYYDTRYGRFIGKQARLHQTWTIAGYLTSKLLLDNPQLASILSWNE  652

Query  728   DYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             DYELLENCVCGLK +G RKCSR   RS V  
Sbjct  653   DYELLENCVCGLK-SGIRKCSRLTARSHVAA  682



>emb|CDP20748.1| unnamed protein product [Coffea canephora]
Length=699

 Score =  1011 bits (2614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/689 (74%), Positives = 570/689 (83%), Gaps = 15/689 (2%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGS-YNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggr  2514
             M + S IG+STMKPC RIL S  N S+F +PF   N  + DNLSK Q  + D+       
Sbjct  1     MNTSSGIGLSTMKPCRRILVSCKNSSLFGFPFLNSNYLITDNLSKLQPNLNDLPDSSN--  58

Query  2513  yrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSH  2334
                   VV  TR    N  AFC SGS+  Q R      L  S +RLV  +  VASD+R+H
Sbjct  59    -----RVVGFTRTNTPNWRAFCLSGSDSGQSRFFSGCPLNTSNDRLVSNIANVASDVRNH  113

Query  2333  STSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQ-KD-GGRVEITDDSTV  2160
             STS E++VN  SF+K Y++G ++VKPL+IE  E    V+E  E+ KD   RVE  D   V
Sbjct  114   STSIESRVNQNSFEKIYVRGDLHVKPLLIETIEEAHKVLENVEKDKDYEARVEANDSLGV  173

Query  2159  NKNDLN----GSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPL  1992
             N+++LN    GS + +   +REVSEVEKEAWKLL+GAVVNYCG PVGTVAA DPADKLPL
Sbjct  174   NRDNLNQRSDGSMVFRSTLKREVSEVEKEAWKLLRGAVVNYCGLPVGTVAAADPADKLPL  233

Query  1991  NYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR  1812
             NYDQVFIRDF+PSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDC+SPGQGLMPASFKV+
Sbjct  234   NYDQVFIRDFVPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCHSPGQGLMPASFKVK  293

Query  1811  TMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQT  1632
              +PL+GRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY+LQERVDVQT
Sbjct  294   AVPLEGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYSLQERVDVQT  353

Query  1631  GIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVN  1452
             GIR ILNLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSALRC+REML VN
Sbjct  354   GIRWILNLCLTDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLTVN  413

Query  1451  DSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPP  1272
             DSTK LVAAINNRLSALSFHIRE+YWVDMKKINEIYRYKTEEYS +AINKFNIYP+QIP 
Sbjct  414   DSTKKLVAAINNRLSALSFHIREHYWVDMKKINEIYRYKTEEYSTEAINKFNIYPEQIPS  473

Query  1271  WIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLI  1092
             W+V+WIPE GGY +GNLQPAHMDFRFFTLGNLWAIISSLGT  QN+ +++ IE KWDDL+
Sbjct  474   WLVDWIPENGGYFIGNLQPAHMDFRFFTLGNLWAIISSLGTPTQNEGVVSLIEDKWDDLV  533

Query  1091  AQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMK  912
             + MPLKICYPALE E+WR+ITGSDPKNTPWSYHN GSWPTLLWQFTLAC+KMGKPELA +
Sbjct  534   SGMPLKICYPALEYEEWRVITGSDPKNTPWSYHNAGSWPTLLWQFTLACMKMGKPELASR  593

Query  911   AVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWN  732
             A+A AE+RL VDQWPEYYDTRHGRFIGKQ+RL QTWT+AGYLTSKMLL+NP+MAS+L WN
Sbjct  594   ALASAEKRLLVDQWPEYYDTRHGRFIGKQSRLYQTWTIAGYLTSKMLLENPEMASMLFWN  653

Query  731   EDYELLENCVCGLKYNGRR-KCSRFGVRS  648
             EDYE+LENCVCGL  NGRR KC+R   RS
Sbjct  654   EDYEILENCVCGLNKNGRRTKCARVASRS  682



>ref|XP_010319230.1| PREDICTED: LOW QUALITY PROTEIN: alkaline/neutral invertase CINV1 
[Solanum lycopersicum]
Length=669

 Score =  1010 bits (2612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/689 (74%), Positives = 564/689 (82%), Gaps = 24/689 (3%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M + SCI ISTMKPC RIL S   S F    G+CN  + DNLS    K+ D+H +     
Sbjct  1     MNTSSCISISTMKPCCRILSSCKGSSF---IGKCNHFINDNLSNPHCKLDDIHTVSDY--  55

Query  2510  rhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSHS  2331
                        +I SNR  FCGS SN    R +        + R   V   VASD R+ S
Sbjct  56    -----ATRAIGIIGSNRSFFCGSDSNWRHFRLN-------KETRCYSVDANVASDGRNFS  103

Query  2330  TSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTV---  2160
             TS EAQVN+K F KFYIQG +NVKPLVI+R E+ +DV +  E+    R +I + S V   
Sbjct  104   TSIEAQVNEKRFNKFYIQGCLNVKPLVIDRIESGKDVAKVEEEI---RTDINNGSGVYVK  160

Query  2159  -NKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
                N LNG  +S+   E+E+SEVEKEAW LL+GAVVNYCG+PVGT AANDPADK PLNYD
Sbjct  161   HPDNYLNGECVSESPHEKELSEVEKEAWNLLRGAVVNYCGFPVGTGAANDPADKQPLNYD  220

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             QVFIRDF+PSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCY+PG+GLMPASFKVRT+P
Sbjct  221   QVFIRDFVPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYNPGEGLMPASFKVRTVP  280

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LDGRNGEFED+LDPDFGESAIGRVAPVDSGLWW+ILLRAY +ITGDY LQERVDVQTGI 
Sbjct  281   LDGRNGEFEDMLDPDFGESAIGRVAPVDSGLWWVILLRAYGRITGDYNLQERVDVQTGIC  340

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             LILNLCL DGFD+FPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALR +REML +NDST
Sbjct  341   LILNLCLSDGFDLFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRSSREMLSINDST  400

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
             KSLV+AINNRLSALSFH+R+YYW+D KKINEIYRYKTEEYS DAINKFNIYPDQIP W+V
Sbjct  401   KSLVSAINNRLSALSFHMRDYYWLDRKKINEIYRYKTEEYSTDAINKFNIYPDQIPSWLV  460

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
             +WIPE GGYLVGNLQPAHMDFRFFT GN+W IISSLG+HEQN+SILN IE KWDDL+ +M
Sbjct  461   DWIPEIGGYLVGNLQPAHMDFRFFTHGNIWTIISSLGSHEQNESILNLIEDKWDDLMGKM  520

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVA  903
             PLKICYPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+PELA KAV 
Sbjct  521   PLKICYPALEHEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELAQKAVD  580

Query  902   VAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDY  723
             +AE+RL  D WPEYYDTRHGRFIGKQARL QTWT+AGYLTSKMLL+NPDMAS L WNEDY
Sbjct  581   LAEKRLSADHWPEYYDTRHGRFIGKQARLCQTWTIAGYLTSKMLLQNPDMASKLFWNEDY  640

Query  722   ELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             ELLENCVC L+ NGRRKCSR   RSQVG+
Sbjct  641   ELLENCVCALRPNGRRKCSRSAARSQVGL  669



>ref|XP_007035889.1| Neutral invertase isoform 1 [Theobroma cacao]
 gb|EOY06815.1| Neutral invertase isoform 1 [Theobroma cacao]
Length=677

 Score =  1005 bits (2598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/685 (74%), Positives = 568/685 (83%), Gaps = 12/685 (2%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSY-NHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggr  2514
             M S +CIGIS+MKPC RIL SY + SIF     + NR  + NLSKS  K  D  R     
Sbjct  1     MKSSTCIGISSMKPCCRILISYKSSSIFGLSPPKMNRSGIHNLSKSLSKAVD-RRRFHCY  59

Query  2513  yrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRD---SFCNWLGRSKNRLVFVVPKVASDM  2343
                +  +V     ++SNR AF  S S+  Q R    SFC   GRS  R V V+PKVASD 
Sbjct  60    KHSKSQIVGYNCAVDSNRRAFSVSDSSWGQSRGFTGSFCVNKGRS--RGVLVIPKVASDF  117

Query  2342  RSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDST  2163
             R+HSTS E  VN+K+F++ YIQGG+NVKPLVIER ET   +V    ++D   +++ ++S 
Sbjct  118   RNHSTSVEPHVNEKNFERIYIQGGLNVKPLVIERIETGNGLV----KEDNTGIDV-NESG  172

Query  2162  VNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
             VN +++ G ++++   EREVSE+EKEAWK+L+GAVVNYCG+PVGTVAANDPADK PLNYD
Sbjct  173   VNIDNVKGLNLTETEIEREVSEIEKEAWKILRGAVVNYCGHPVGTVAANDPADKQPLNYD  232

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             Q+FIRDF+PSALAFLLNGE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT P
Sbjct  233   QIFIRDFVPSALAFLLNGEPEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTAP  292

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LDG +  FE+VLD DFGESAIGRVAPVDSGLWWIILLRAY KITGDYTLQERVDVQTGI 
Sbjct  293   LDGSSEAFEEVLDADFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERVDVQTGIS  352

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             LILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML VND+T
Sbjct  353   LILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVNDAT  412

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
             K+LVAAIN+RLSALSFHIREYYWVDMKKINEIYRYKTEEYS DAINKFNIYPDQIP W+V
Sbjct  413   KNLVAAINSRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPSWLV  472

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
             +WIP+ GGY +GNLQPAHMDFRFFTLGNLWAI+SSLGT +QN+ +LN IE KWDD +A M
Sbjct  473   DWIPDEGGYFIGNLQPAHMDFRFFTLGNLWAIVSSLGTSKQNEDVLNLIEAKWDDFVANM  532

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVA  903
             PLKI YPALE ++WRIITGSDPKNTPWSYHNGGSWPTLLWQFT+ACIKMGKPELA KAVA
Sbjct  533   PLKIIYPALESDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTVACIKMGKPELAQKAVA  592

Query  902   VAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDY  723
             +AEERL  DQWPEYYDTR G+FIGKQ+RL QTWTVAG+LTSKMLL+NP  ASLL W EDY
Sbjct  593   LAEERLSADQWPEYYDTRSGKFIGKQSRLFQTWTVAGFLTSKMLLQNPQKASLLFWEEDY  652

Query  722   ELLENCVCGLKYNGRRKCSRFGVRS  648
             ELLE CVCGL   GRRKCSR   +S
Sbjct  653   ELLETCVCGLGKTGRRKCSRLAAKS  677



>gb|KHG04460.1| hypothetical protein F383_29023 [Gossypium arboreum]
Length=677

 Score =   996 bits (2574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/685 (73%), Positives = 570/685 (83%), Gaps = 12/685 (2%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSY-NHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggr  2514
             M S +CIGIS+MKPC   L SY + SIF +   + +R  + NLSKS  K  D  R     
Sbjct  1     MKSSTCIGISSMKPCCIFLVSYRSSSIFGFSPPKMSRSGIRNLSKSLSKAVD-RRRLHSC  59

Query  2513  yrhrHSVVTLTRVINSNRCAFCGSGSNGDQHR---DSFCNWLGRSKNRLVFVVPKVASDM  2343
               ++  +V    V + N  AF  S S+  Q R   DSF    GRS  R V V+P+VASD 
Sbjct  60    KHNKSQIVGYKCVADPNWRAFSVSDSSWGQSRVFSDSFRVDKGRS--RGVLVIPRVASDF  117

Query  2342  RSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDST  2163
             R+HSTS E  +N+K+F++ YIQGG+NVKPLVIER ET + +V    ++D   + +++ S 
Sbjct  118   RNHSTSVEHHLNEKNFERIYIQGGLNVKPLVIERIETGDGLV----KEDNTGINVSE-SD  172

Query  2162  VNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
             VN N++ GS++++   EREVSE+EKEAW +L+GAVV+YCG PVGT+AANDPADK PLNYD
Sbjct  173   VNTNNVEGSNLTEPRIEREVSEIEKEAWNILRGAVVSYCGNPVGTIAANDPADKQPLNYD  232

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             Q+FIRDF+PSALAFLLNGE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+P
Sbjct  233   QIFIRDFVPSALAFLLNGEAEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVP  292

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
              DG    FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY+LQ+RVDVQTGIR
Sbjct  293   RDGSPEAFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYSLQDRVDVQTGIR  352

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             LILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML VND+T
Sbjct  353   LILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVNDAT  412

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
             K+LVAA+NNRLSALSFHIREYYWVDMKKINEIYRY TEEYS DAINKFNIYPDQIP W+V
Sbjct  413   KNLVAAVNNRLSALSFHIREYYWVDMKKINEIYRYNTEEYSTDAINKFNIYPDQIPSWLV  472

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
             +WIP+ GGY +GNLQPAHMDFRFFTLGNLWAI+SSLGT +QNK +L+ IE KWDDL+A M
Sbjct  473   DWIPDEGGYFIGNLQPAHMDFRFFTLGNLWAIVSSLGTPKQNKDVLDLIEAKWDDLVANM  532

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVA  903
             PLKI YPALE ++WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELA +AVA
Sbjct  533   PLKIIYPALESDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAQRAVA  592

Query  902   VAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDY  723
             +AEERL VDQWPEYYDTR GRFIGKQ+RL QTWTVAG+LTSKMLL+NP+ ASLL W EDY
Sbjct  593   LAEERLAVDQWPEYYDTRSGRFIGKQSRLYQTWTVAGFLTSKMLLQNPEKASLLFWEEDY  652

Query  722   ELLENCVCGLKYNGRRKCSRFGVRS  648
             ELLE CVCGL  NGRRKCSR G RS
Sbjct  653   ELLETCVCGLSKNGRRKCSRLGPRS  677



>ref|XP_006419305.1| hypothetical protein CICLE_v10004474mg [Citrus clementina]
 gb|ESR32545.1| hypothetical protein CICLE_v10004474mg [Citrus clementina]
Length=678

 Score =   992 bits (2564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/692 (72%), Positives = 563/692 (81%), Gaps = 21/692 (3%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYN-HSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggr  2514
             M + SCIGISTMKPC RIL  Y   SIF     R N ++++N SK   K K         
Sbjct  1     MNTSSCIGISTMKPCCRILIGYRISSIFGVSHIRSNHKIVNNSSKLHSKSK-----LSCY  55

Query  2513  yrhrHSVVTLTR-VINSNRCAFCGSGSNGDQHRDSFCNWLGRSKN--RLVFVVPKVASDM  2343
                +  V+   + VI+ NR AF  SGSN  + +    N LG +K+  R + V+P VASD 
Sbjct  56    NDAKCKVIGHKKGVIDLNRRAFFASGSNWGESKILGKNKLGVNKDSSRGILVIPHVASDF  115

Query  2342  RSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDST  2163
             R+HSTS ++ V++K F+  YIQGG+NVKP VIE+ E   +VV    ++D  RV++ + S 
Sbjct  116   RNHSTSIDSHVSEKGFESIYIQGGLNVKPFVIEKIENGNEVV----KEDESRVQV-NGSG  170

Query  2162  VNKN---DLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPL  1992
             VN +   DLN      +  E E S +EKEAWKLL+ AVVNYCG PVGTVAAN+PADK PL
Sbjct  171   VNLDILKDLN----ENVETESEASNIEKEAWKLLRDAVVNYCGNPVGTVAANNPADKQPL  226

Query  1991  NYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR  1812
             NYDQVFIRDF+PSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR
Sbjct  227   NYDQVFIRDFVPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR  286

Query  1811  TMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQT  1632
             T+PLDG +G  E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQT
Sbjct  287   TVPLDGADGTLEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQT  346

Query  1631  GIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVN  1452
             GIRLILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQ+LFYSALRC+REMLIVN
Sbjct  347   GIRLILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLIVN  406

Query  1451  DSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPP  1272
             D TK+LVAAINNRLSALSFH+REYYWVDM KINEIYRYKTEEYS+DAINKFNIYPDQIP 
Sbjct  407   DGTKNLVAAINNRLSALSFHVREYYWVDMMKINEIYRYKTEEYSVDAINKFNIYPDQIPS  466

Query  1271  WIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLI  1092
             W+V+WIP  GGYL+GNL+P HMDFRFFTLGNLWAI+SSLGT  QN+ ILN IE KWDDL+
Sbjct  467   WLVDWIPNEGGYLIGNLEPGHMDFRFFTLGNLWAIVSSLGTARQNEGILNLIEAKWDDLV  526

Query  1091  AQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMK  912
             A MPLKICYPALE E+WRIITG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+PELA K
Sbjct  527   AHMPLKICYPALEYEEWRIITGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELAEK  586

Query  911   AVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWN  732
             AVA+AE+RL VDQWPEYYDT+ GRFIGKQ+RL+QTWT+AGYLTSKMLL+NP  ASLL W 
Sbjct  587   AVAMAEKRLSVDQWPEYYDTQSGRFIGKQSRLHQTWTIAGYLTSKMLLENPAKASLLFWE  646

Query  731   EDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             EDYELLENCVC L   GR+KC RF  RSQ+ V
Sbjct  647   EDYELLENCVCALSKTGRKKCLRFAARSQIRV  678



>ref|XP_006488793.1| PREDICTED: alkaline/neutral invertase CINV2-like [Citrus sinensis]
Length=678

 Score =   991 bits (2561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/692 (72%), Positives = 563/692 (81%), Gaps = 21/692 (3%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYN-HSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggr  2514
             M + SCIGISTMKPC RIL  Y   SIF     R N ++++N SK   K K         
Sbjct  1     MNTSSCIGISTMKPCCRILIGYRISSIFGVSHIRSNHKIVNNSSKLHSKSK-----LSCY  55

Query  2513  yrhrHSVVTLTR-VINSNRCAFCGSGSNGDQHRDSFCNWLGRSKN--RLVFVVPKVASDM  2343
                +  V+   + VI+ NR AF  SGSN  + +    N LG +K+  R + V+P VASD 
Sbjct  56    NDAKCKVIGHKKGVIDLNRRAFFASGSNWGESKILGKNKLGVNKDSSRGILVIPHVASDF  115

Query  2342  RSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDST  2163
             R+HSTS ++ V++K F+  YIQGG+NVKP VIE+ E   +VV    ++D  RV++ + S 
Sbjct  116   RNHSTSIDSHVSEKGFESIYIQGGLNVKPFVIEKIENGNEVV----KEDESRVQV-NGSG  170

Query  2162  VNKN---DLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPL  1992
             VN +   DLN      +  E E S +EKEAWKLL+ AVVNYCG PVGTVAAN+PADK PL
Sbjct  171   VNLDILKDLN----ENVETESEASNIEKEAWKLLRDAVVNYCGNPVGTVAANNPADKQPL  226

Query  1991  NYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR  1812
             NYDQVFIRDF+PSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR
Sbjct  227   NYDQVFIRDFVPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR  286

Query  1811  TMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQT  1632
             T+PLDG +G  E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQT
Sbjct  287   TVPLDGGDGTLEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQT  346

Query  1631  GIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVN  1452
             GIRLILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQ+LFYSALRC+REMLIVN
Sbjct  347   GIRLILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLIVN  406

Query  1451  DSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPP  1272
             D TK+LVAAINNRLSALSFH+REYYWVDM KINEIYRYKTEEYS+DAINKFNIYPDQIP 
Sbjct  407   DGTKNLVAAINNRLSALSFHVREYYWVDMMKINEIYRYKTEEYSVDAINKFNIYPDQIPS  466

Query  1271  WIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLI  1092
             W+V+WIP  GGYL+GNL+P HMDFRFFTLGNLWAI+SSLGT  QN+ ILN IE KWDDL+
Sbjct  467   WLVDWIPNEGGYLIGNLEPGHMDFRFFTLGNLWAIVSSLGTARQNEGILNLIEAKWDDLV  526

Query  1091  AQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMK  912
             A MPLKICYPALE E+WRIITG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+PELA K
Sbjct  527   AHMPLKICYPALEYEEWRIITGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELAEK  586

Query  911   AVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWN  732
             AVA+AE+RL VDQWPEYYDT+ GRFIGKQ+RL+QTWT+AGYLTSKMLL+NP  ASLL W 
Sbjct  587   AVAMAEKRLSVDQWPEYYDTQSGRFIGKQSRLHQTWTIAGYLTSKMLLENPAKASLLFWE  646

Query  731   EDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             EDYELLENCVC L   GR+KC RF  RSQ+ V
Sbjct  647   EDYELLENCVCALSKTGRKKCLRFAARSQIRV  678



>gb|AEP31948.1| neutral/alkaline invertase [Manihot esculenta]
Length=685

 Score =   989 bits (2556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/687 (72%), Positives = 564/687 (82%), Gaps = 10/687 (1%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFW--YPFGRCNRQVMDNLSKSQQKIKDVhrmggg  2517
             M + SCI IST+KPC RIL  Y  S  +   P    NR + +NLSKS  K     R    
Sbjct  1     MNTSSCIVISTVKPCCRILIGYTSSSLFGISPQKFNNRVIHNNLSKSLPKSSHHRRFHCH  60

Query  2516  ryrhrHSVVTLTRVINSNRCAFCGSGSNGDQHR---DSFCNWLGRSKNRLVFVVPKVASD  2346
                +R  ++    V++SN  AF  S S+ DQ +    SF   + R + R V V+PKV+SD
Sbjct  61    SVNNRSRIIGNKSVVHSNSRAFNVSDSSWDQSKVLTPSF--HVNRGRGRGVLVIPKVSSD  118

Query  2345  MRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDS  2166
              R+HSTS E+ +N+K F+  YIQGG+NVKPLVI++ ET  +VVE   +    R+EI + +
Sbjct  119   FRNHSTSVESHINEKGFENIYIQGGLNVKPLVIKKIETGNNVVEE--EDKSSRIEI-NGT  175

Query  2165  TVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNY  1986
             +VN + L G + +    EREVS++EKEAWKLLQGAVVNYCG PVGTVAANDPADK PLNY
Sbjct  176   SVNIDYLKGLNETAPKVEREVSDIEKEAWKLLQGAVVNYCGNPVGTVAANDPADKQPLNY  235

Query  1985  DQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTM  1806
             DQVFIRDF+PSALAFLLNGE EIVKNFLL+TLQLQSWEKTVDCYSPGQGLMPASFKVRT 
Sbjct  236   DQVFIRDFVPSALAFLLNGEVEIVKNFLLYTLQLQSWEKTVDCYSPGQGLMPASFKVRTA  295

Query  1805  PLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGI  1626
             PLDG +G FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY +ITGDY LQER+DVQTGI
Sbjct  296   PLDGSDGAFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGRITGDYALQERIDVQTGI  355

Query  1625  RLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDS  1446
             RLILNLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFY+ALRC REMLIVND 
Sbjct  356   RLILNLCLSDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYAALRCAREMLIVNDG  415

Query  1445  TKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWI  1266
             TK+LVAA+N+RLSALSFHIREYYWVDMKKINEIYRYKTEE S DA+NKFNIYPDQIP W+
Sbjct  416   TKNLVAAVNSRLSALSFHIREYYWVDMKKINEIYRYKTEECSTDAVNKFNIYPDQIPSWL  475

Query  1265  VNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQ  1086
             V+WIPE GGYL+GNLQPAHMDFRFFTLGNLWAIISSLGT +QN+ ILN IE KWDDL+A 
Sbjct  476   VDWIPEEGGYLIGNLQPAHMDFRFFTLGNLWAIISSLGTVKQNEGILNLIESKWDDLVAH  535

Query  1085  MPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAV  906
             MPLKICYPALE E+WRIITGSDPKNTP SYHNGGSWPTLLWQFTLACIKMG+PELA +AV
Sbjct  536   MPLKICYPALEHEEWRIITGSDPKNTPRSYHNGGSWPTLLWQFTLACIKMGRPELAQRAV  595

Query  905   AVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNED  726
             ++AE+RL +DQWPEYYDTR GRFIGKQ+RL QTWT+AG+L SK LL+NPD ASLL W+ED
Sbjct  596   SLAEKRLSLDQWPEYYDTRSGRFIGKQSRLFQTWTIAGFLASKKLLENPDKASLLFWDED  655

Query  725   YELLENCVCGLKYNGRRKCSRFGVRSQ  645
             Y+LLE CVC L    R+KCSRF  RSQ
Sbjct  656   YDLLETCVCALSKTSRKKCSRFASRSQ  682



>gb|AHD25653.1| neutral invertase 2 (chloroplast) [Camellia sinensis]
Length=675

 Score =   988 bits (2555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/687 (73%), Positives = 561/687 (82%), Gaps = 14/687 (2%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGS-YNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggr  2514
             M + SCIGISTMKPC +IL S  N SIF +P+ +CN  V DNLSKSQ K   + R     
Sbjct  1     MNTCSCIGISTMKPCCKILISCRNSSIFGFPYPKCNHLVADNLSKSQLKANSLRRFHTCN  60

Query  2513  yrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSH  2334
                   ++    VI+ NR AFC S  +  Q R       G  K++ V V+  VASD ++H
Sbjct  61    N----KILGFRCVIDLNRRAFCVSDLSWGQSR--VLTSQGVDKSKRVSVIANVASDFKNH  114

Query  2333  STSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNK  2154
             STS E  +N+K F++ YIQGG+NVKPLVIER E   DVV      D   +   + S VN 
Sbjct  115   STSVETHINEKGFERIYIQGGLNVKPLVIERIERGPDVV------DKESMVEVNGSKVNV  168

Query  2153  NDLNGSSISKLAP-EREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQV  1977
             ++L G +  K++  ER +S++EKEAW+LL+GAVV+YCG PVGTVAA DPADK PLNYDQV
Sbjct  169   DNLKGLNEEKVSTHERRLSKIEKEAWELLRGAVVDYCGNPVGTVAAKDPADKQPLNYDQV  228

Query  1976  FIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLD  1797
             FIRDF+PSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR +PLD
Sbjct  229   FIRDFVPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRPVPLD  288

Query  1796  GRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLI  1617
             G NG F DVLDPDFGESAIGRVAPVDSGLWWIILLRAY K+TGDYTLQERVDVQTGIRLI
Sbjct  289   GSNGAFVDVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYTLQERVDVQTGIRLI  348

Query  1616  LNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKS  1437
             L LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALR +REMLIVND TK+
Sbjct  349   LKLCLTDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRSSREMLIVNDGTKN  408

Query  1436  LVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNW  1257
             LVAA+NNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DAINKFNIYPDQIP W+V+W
Sbjct  409   LVAAVNNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPSWLVDW  468

Query  1256  IPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPL  1077
             I E GGYL+GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN+ ILN IE KWDD +A MPL
Sbjct  469   ISEEGGYLIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEGILNLIEAKWDDFVAHMPL  528

Query  1076  KICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVA  897
             KICYPALE ++WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKM KPELA KA+ +A
Sbjct  529   KICYPALEYDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMKKPELARKAIDLA  588

Query  896   EERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYEL  717
             E+RL  DQWPEYYDTR GRFIGKQ+RL QTWT+AG+LTSKMLL NP+MASLL W+EDYEL
Sbjct  589   EKRLSEDQWPEYYDTRSGRFIGKQSRLFQTWTIAGFLTSKMLLDNPEMASLLFWDEDYEL  648

Query  716   LENCVCGLKYNGRRKCSRFGVRSQVGV  636
             LE CVC L   GR+KCSR   +SQ+ +
Sbjct  649   LEICVCALSKTGRKKCSRGLAKSQIHI  675



>ref|XP_008223426.1| PREDICTED: alkaline/neutral invertase CINV2 [Prunus mume]
Length=680

 Score =   987 bits (2552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/694 (71%), Positives = 557/694 (80%), Gaps = 23/694 (3%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRIL---GSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgg  2520
             M S +CIGI TM+PC RIL   GS + S+F  P  + N  V  NLSK Q + +       
Sbjct  1     MSSSNCIGICTMRPCCRILMGYGSRSSSVFGSPQPKLNDIVTHNLSKLQSRRQ-------  53

Query  2519  gryrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGR-----SKNRLVFVVPKV  2355
              +      +V   RV + NR  F  S  N  Q R   C    R     S  R + V+P V
Sbjct  54    -KRSCNSQIVGYIRVSDPNRRVFSVSDLNWGQTR--VCKTTSRVGNSSSSRRGILVIPNV  110

Query  2354  ASDMRSHSTSTEAQVNDK-SFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEI  2178
             ASD+R+HSTS E QVN K SF+  YIQG +NVKPLVIE+ ET    V    +++  RVE+
Sbjct  111   ASDIRNHSTSVETQVNGKTSFESIYIQGRLNVKPLVIEKIETDHGDVV---REEESRVEV  167

Query  2177  TDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKL  1998
              + S +N N  N   ++    ERE+S++EKEAW LL+ +VV+YCG PVGT+AA DPADK 
Sbjct  168   -NGSNINVNIGNSKGLNDTKDERELSDIEKEAWSLLRDSVVSYCGNPVGTLAATDPADKT  226

Query  1997  PLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFK  1818
             PLNYDQVFIRDF+PSALAFLLNGE +IVKNFLLHTLQLQSWEKTVDC+SPGQGLMPASFK
Sbjct  227   PLNYDQVFIRDFVPSALAFLLNGEADIVKNFLLHTLQLQSWEKTVDCHSPGQGLMPASFK  286

Query  1817  VRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDV  1638
             V+T+PLDG NG FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVD 
Sbjct  287   VKTVPLDGMNGAFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDF  346

Query  1637  QTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLI  1458
             QTGIRL+LNLCL++GFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REMLI
Sbjct  347   QTGIRLVLNLCLKNGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLI  406

Query  1457  VNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQI  1278
             VNDSTK LVAAINNRLSALSFH+REYYWVDMKKINEIYRYKTEEYS DA+NKFNIYPDQI
Sbjct  407   VNDSTKDLVAAINNRLSALSFHMREYYWVDMKKINEIYRYKTEEYSTDAVNKFNIYPDQI  466

Query  1277  PPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDD  1098
             P W+V+WIPE GGYL+GNLQPAHMDFR FTLGNLW+I+SSLGTH+QN+ ILN IE KWDD
Sbjct  467   PSWLVDWIPEEGGYLIGNLQPAHMDFRLFTLGNLWSIVSSLGTHKQNEGILNLIEAKWDD  526

Query  1097  LIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELA  918
              +AQMPLKICYPALE E+WRIITG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ ELA
Sbjct  527   FVAQMPLKICYPALEYEEWRIITGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRTELA  586

Query  917   MKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLV  738
              KAV +AE+RL  DQWPEYYDT+ GRFIGKQ+RL QTWT+AGYLTSKMLL+NP+ ASLL+
Sbjct  587   QKAVDLAEKRLSADQWPEYYDTKSGRFIGKQSRLFQTWTIAGYLTSKMLLENPEKASLLL  646

Query  737   WNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             W EDYELLE CVC L   GR+KCSR   +SQ+ V
Sbjct  647   WEEDYELLETCVCALTKTGRKKCSRLAAKSQIAV  680



>emb|CAN63178.1| hypothetical protein VITISV_029106 [Vitis vinifera]
Length=673

 Score =   986 bits (2550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/689 (72%), Positives = 544/689 (79%), Gaps = 21/689 (3%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGS-YNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggr  2514
             M S S IGI+TMKP  R+L S  N SIF +P  + N  + DN SK Q K+          
Sbjct  1     MNSSSYIGITTMKPYCRVLTSCRNSSIFKFPSSKSNHFIADNSSKFQSKLX----XSRRF  56

Query  2513  yrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSH  2334
             +     ++     INSNR AF  S  N  Q R            R V V+  VASD R H
Sbjct  57    HCCSAQILGKKCGINSNRRAFRXSDPNWGQIRVYRSCSGAHGGRRGVLVISNVASDFRKH  116

Query  2333  STSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNK  2154
             STS E+ VN+K F+  YI GG+NVKPLVIE             + + G VE         
Sbjct  117   STSVESHVNEKGFESIYINGGLNVKPLVIE-------------RIERGHVEEESGLEFKD  163

Query  2153  NDLN---GSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
              D+N      ++K   EREV E+EKEAW+LL+ AVV+YCG PVGTVAANDP DK PLNYD
Sbjct  164   PDVNFDHSEGLNKEKVEREVPEIEKEAWRLLRSAVVDYCGNPVGTVAANDPGDKQPLNYD  223

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             QVFIRDF+PSALAFLL GEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+P
Sbjct  224   QVFIRDFVPSALAFLLKGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVP  283

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LDG NG FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGIR
Sbjct  284   LDGGNGAFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIR  343

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             LILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REM  VND T
Sbjct  344   LILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMJTVNDGT  403

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
             K+LV AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DAINKFNIYPDQIP W+V
Sbjct  404   KNLVRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPTWLV  463

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
             +WIP+ GGYL+GNLQPAHMDFRFFTLGNLW+IISSLGT +QN+ ILN IE KWDDL+A M
Sbjct  464   DWIPDQGGYLIGNLQPAHMDFRFFTLGNLWSIISSLGTAKQNEGILNLIEAKWDDLVAHM  523

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVA  903
             PLKICYPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+PELA KAVA
Sbjct  524   PLKICYPALENEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARKAVA  583

Query  902   VAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDY  723
             +AEERL VD WPEYYDTR+GRFIGKQ+RL QTWT+AG+LTSKMLL+NP+MASLL W EDY
Sbjct  584   LAEERLSVDHWPEYYDTRNGRFIGKQSRLYQTWTIAGFLTSKMLLENPEMASLLAWEEDY  643

Query  722   ELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             ELLE CVC L   GR+KCSR   RSQ+ V
Sbjct  644   ELLEICVCALSKTGRKKCSRSAARSQIPV  672



>emb|CAA76145.1| neutral invertase [Daucus carota]
Length=675

 Score =   985 bits (2547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/685 (73%), Positives = 566/685 (83%), Gaps = 20/685 (3%)
 Frame = -3

Query  2678  SCIGISTMKPCSRILGS-YNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggryrhr  2502
             +CI +S M+PC R+L S  N SIF Y F +C+ ++  NLSK Q K+  +      R    
Sbjct  4     TCIAVSNMRPCCRMLLSCKNSSIFGYSFRKCDHRMGTNLSKKQFKVYGLRGYVSCRGGKG  63

Query  2501  HSVVTLTRVINSNRCAFCGSGSNGDQHR--DSFCNWLGRSKNRLVFVVPKVASDMRSHST  2328
                      I+ NR  F GSGS+  Q R   S C  +  S  R V V   VASD R+HST
Sbjct  64    LGYRC---GIDPNRKGFFGSGSDWGQPRVLTSGCRRVD-SGGRSVLV--NVASDYRNHST  117

Query  2327  STEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKND  2148
             S E  VNDKSF++ Y++GG+NVKPLVIER E  E V     +++ GRV + + S VN  D
Sbjct  118   SVEGHVNDKSFERIYVRGGLNVKPLVIERVEKGEKV-----REEEGRVGV-NGSNVNIGD  171

Query  2147  ---LNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQV  1977
                LNG  +  L+P+REVSEVEKEAW+LL+GAVV+YCG PVGTVAA+DPAD  PLNYDQV
Sbjct  172   SKGLNGGKV--LSPKREVSEVEKEAWELLRGAVVDYCGNPVGTVAASDPADSTPLNYDQV  229

Query  1976  FIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLD  1797
             FIRDF+PSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDC+SPGQGLMPASFKV+ + +D
Sbjct  230   FIRDFVPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCHSPGQGLMPASFKVKNVAID  289

Query  1796  GRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLI  1617
             G+ GE ED+LDPDFGESAIGRVAPVDSGLWWIILLRAY K+TGDY LQ RVDVQTGIRLI
Sbjct  290   GKIGESEDILDPDFGESAIGRVAPVDSGLWWIILLRAYTKLTGDYGLQARVDVQTGIRLI  349

Query  1616  LNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKS  1437
             LNLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REMLIVNDSTK+
Sbjct  350   LNLCLTDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDSTKN  409

Query  1436  LVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNW  1257
             LVAA+NNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DAINKFNIYPDQIP W+V+W
Sbjct  410   LVAAVNNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPSWLVDW  469

Query  1256  IPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPL  1077
             +PETGGYL+GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN+SILN IE KWDDL+A MPL
Sbjct  470   MPETGGYLIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNESILNLIEDKWDDLVAHMPL  529

Query  1076  KICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVA  897
             KICYPALE E+WR+ITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKM KPELA KAVA+A
Sbjct  530   KICYPALEYEEWRVITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMKKPELARKAVALA  589

Query  896   EERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYEL  717
             E++L  D WPEYYDTR GRFIGKQ+RL QTWT+AG+LTSK+LL+NP+MAS L W EDYEL
Sbjct  590   EKKLSEDHWPEYYDTRRGRFIGKQSRLYQTWTIAGFLTSKLLLENPEMASKLFWEEDYEL  649

Query  716   LENCVCGLKYNGRRKCSRFGVRSQV  642
             LE+CVC +  +GR+KCSRF  +SQV
Sbjct  650   LESCVCAIGKSGRKKCSRFAAKSQV  674



>emb|CBI22843.3| unnamed protein product [Vitis vinifera]
Length=673

 Score =   985 bits (2547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/689 (72%), Positives = 545/689 (79%), Gaps = 21/689 (3%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGS-YNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggr  2514
             M S S IGI+TMKP  R+L S  N SIF +P  + N  + DN SK Q K+          
Sbjct  1     MNSSSYIGITTMKPYCRVLTSCRNSSIFKFPSSKSNHFIADNSSKFQSKL----IHSRRF  56

Query  2513  yrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSH  2334
             +     ++     INSNR AF  S  N  Q R            R V V+  VASD R H
Sbjct  57    HCCSAQILGKKCGINSNRRAFRLSDPNWGQIRVYRSCSGAHGGRRGVLVISNVASDFRKH  116

Query  2333  STSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNK  2154
             STS E+ VN+K F+  YI GG+NVKPLVIE             + + G VE         
Sbjct  117   STSVESHVNEKGFESIYINGGLNVKPLVIE-------------RIERGHVEEESGLEFKD  163

Query  2153  NDLN---GSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
              D+N      ++K   EREV E+EKEAW+LL+ AVV+YCG PVGTVAANDP DK PLNYD
Sbjct  164   PDVNFDHSEGLNKEKVEREVPEIEKEAWRLLRSAVVDYCGNPVGTVAANDPGDKQPLNYD  223

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             QVFIRDF+PSALAFLL GEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+P
Sbjct  224   QVFIRDFVPSALAFLLKGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVP  283

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LDG NG FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGIR
Sbjct  284   LDGGNGAFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIR  343

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             LILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REM+ VND T
Sbjct  344   LILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMITVNDGT  403

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
             K+LV AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DAINKFNIYPDQIP W+V
Sbjct  404   KNLVRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPTWLV  463

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
             +WIP+ GGYL+GNLQPAHMDFRFFTLGNLW+IISSLGT +QN+ ILN IE KWDDL+A M
Sbjct  464   DWIPDQGGYLIGNLQPAHMDFRFFTLGNLWSIISSLGTAKQNEGILNLIEAKWDDLVAHM  523

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVA  903
             PLKICYPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+PELA KAVA
Sbjct  524   PLKICYPALENEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARKAVA  583

Query  902   VAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDY  723
             +AEERL VD WPEYYDTR+GRFIGKQ+RL QTWT+AG+LTSKMLL+NP+MASLL W EDY
Sbjct  584   LAEERLSVDHWPEYYDTRNGRFIGKQSRLYQTWTIAGFLTSKMLLENPEMASLLAWEEDY  643

Query  722   ELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             ELLE CVC L   GR+KCSR   RSQ+ V
Sbjct  644   ELLEICVCALSKTGRKKCSRSAARSQIPV  672



>ref|XP_002519277.1| beta-fructofuranosidase, putative [Ricinus communis]
 gb|EEF43141.1| beta-fructofuranosidase, putative [Ricinus communis]
Length=686

 Score =   985 bits (2546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/690 (73%), Positives = 571/690 (83%), Gaps = 15/690 (2%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSY-NHSIFWYPFGRCNRQVMDN-LSKSQQKIKDVhrmggg  2517
             M + SCIGIST+KPC RIL  Y N S+F +   + + QV++N LSKSQ K     R    
Sbjct  1     MSTSSCIGISTVKPCCRILIGYKNSSLFGFSPPKLSNQVINNNLSKSQSKSPHHRRFHCY  60

Query  2516  ryrhrHSVVTLTR-VINSNRCAFCGSGSNGDQHR---DSFCNWLGRSKNRLVFVVPKVAS  2349
                +R  ++   + ++N NR  F  S S   Q +    S    +G    R + V+PKV+S
Sbjct  61    SVNNRSRIIGNNKCIVNPNRRTFNISDSCWSQSKVLTSSLHVNIGTL--RGLLVIPKVSS  118

Query  2348  DMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDD  2169
             D+R+HSTS E+ +N+K F+  YIQGG+NVKPLVIE+ ET  +VV+  +Q    +VEI + 
Sbjct  119   DIRNHSTSVESHINEKGFENIYIQGGLNVKPLVIEKIETGNNVVKEEDQ--CSKVEI-NG  175

Query  2168  STVNKNDLNGSSISKLAP--EREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLP  1995
             + VN +   G  ++++AP  ERE SE+EKEAWKLL+GA+VNYCG PVGTVAANDPADK P
Sbjct  176   THVNLDYFKG--LNEIAPKVERERSEIEKEAWKLLEGAIVNYCGNPVGTVAANDPADKQP  233

Query  1994  LNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV  1815
             LNYDQVFIRDF+PSALAFLLNGE +IVKNFLL+TLQLQSWEKTVDCYSPGQGLMPASFKV
Sbjct  234   LNYDQVFIRDFVPSALAFLLNGEADIVKNFLLYTLQLQSWEKTVDCYSPGQGLMPASFKV  293

Query  1814  RTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQ  1635
             R +PLDG +G FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDYTLQER+DVQ
Sbjct  294   RGVPLDGSDGAFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERIDVQ  353

Query  1634  TGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIV  1455
             TGIRLILNLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC REMLIV
Sbjct  354   TGIRLILNLCLSDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMLIV  413

Query  1454  NDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIP  1275
             ND TK+LVAAIN+RLSALSFHIREYYWVDM KINEIYRYKTEEYS +A+NKFNIYPDQIP
Sbjct  414   NDGTKNLVAAINSRLSALSFHIREYYWVDMMKINEIYRYKTEEYSSNAVNKFNIYPDQIP  473

Query  1274  PWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDL  1095
              W+V+WIPE GGYL+GNLQPAHMDFRFFTLGNLWAI+SSLGT +QN+ ILN IE KWDDL
Sbjct  474   SWLVDWIPEEGGYLIGNLQPAHMDFRFFTLGNLWAIVSSLGTQKQNEGILNLIEAKWDDL  533

Query  1094  IAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAM  915
             +A MPLKI YPAL+ E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKP LA 
Sbjct  534   VAHMPLKISYPALDSEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPGLAE  593

Query  914   KAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVW  735
             KA+A+AE+RL VDQWPEYYDTR GRFIGKQ+RL QTWTVAGYLTSKMLL+NP+ ASLL W
Sbjct  594   KAIALAEKRLSVDQWPEYYDTRSGRFIGKQSRLCQTWTVAGYLTSKMLLENPEKASLLFW  653

Query  734   NEDYELLENCVCGLKYNGRRKCSRFGVRSQ  645
             +EDY+LLE CVC L    R+KCSRF  RSQ
Sbjct  654   DEDYDLLETCVCALSKTSRKKCSRFAARSQ  683



>gb|AHF27220.1| invertase [Hevea brasiliensis]
Length=683

 Score =   984 bits (2543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/684 (72%), Positives = 560/684 (82%), Gaps = 6/684 (1%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRI-LGSYNHSIFWYPFGRCNRQVM-DNLSKSQQKIKDVhrmggg  2517
             M + SCIGISTMKPC  I +G  + S+F     + N  V+ +NLSKS  K     R    
Sbjct  1     MSTSSCIGISTMKPCCGIVIGYKSSSLFGLSVPKLNNPVIHNNLSKSLSKSAHHRRFHCH  60

Query  2516  ryrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRS  2337
                +R  ++    V+N NR AF  S S+  Q  + F + +   + R V V+PKV+SD+R+
Sbjct  61    SVNNRSRIIGNKSVVNLNRRAFNVSDSSWGQ-SNVFTSHVDMDRVRDVLVIPKVSSDIRN  119

Query  2336  HSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVN  2157
             HS S E+ +N+K F+  YIQGG+NV PL+I++ ET  DVV+   +    R+EI + + VN
Sbjct  120   HSISIESHINEKGFENIYIQGGLNVNPLMIKKIETGNDVVKE--EDKSNRIEI-NGTNVN  176

Query  2156  KNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQV  1977
              + L G + +    EREVSE+EKEAWKLLQGA+VNYCG PVGTVAANDPADK PLNYDQV
Sbjct  177   IDYLKGLNETASKVEREVSEIEKEAWKLLQGAIVNYCGNPVGTVAANDPADKQPLNYDQV  236

Query  1976  FIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLD  1797
             FIRDF+PSALAFLLNG+ EIVKNFLL+TLQLQSWEKTVDCYSPGQGLMPASFKVRT PLD
Sbjct  237   FIRDFVPSALAFLLNGDAEIVKNFLLYTLQLQSWEKTVDCYSPGQGLMPASFKVRTAPLD  296

Query  1796  GRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLI  1617
             G +G FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY +IT DY LQER+DVQTGIRLI
Sbjct  297   GSDGAFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGRITSDYALQERIDVQTGIRLI  356

Query  1616  LNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKS  1437
             LNLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFY+ALRC REMLIVND TK+
Sbjct  357   LNLCLSDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYAALRCAREMLIVNDGTKN  416

Query  1436  LVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNW  1257
             LV A+NNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DA+NKFNIYPDQIP W+V+W
Sbjct  417   LVTAVNNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAVNKFNIYPDQIPSWLVDW  476

Query  1256  IPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPL  1077
             IPE GGYL+GNLQPAHMDFRFFTLGNLWAIISSLGT +QN+ ILN IE KWDDL+A MPL
Sbjct  477   IPEEGGYLIGNLQPAHMDFRFFTLGNLWAIISSLGTIKQNEGILNLIESKWDDLVAHMPL  536

Query  1076  KICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVA  897
             KICYPALE E+W IITGSDPKNTPWSYHNGGSWPTLLWQFTLAC+KMG+PELA +AV +A
Sbjct  537   KICYPALEYEEWHIITGSDPKNTPWSYHNGGSWPTLLWQFTLACVKMGRPELAQRAVDLA  596

Query  896   EERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYEL  717
             E+RL +DQWPEYYDTR GRFIGKQ+RL QTWT+AG+LTSK LL+NP+ ASLL W+EDY+L
Sbjct  597   EKRLSLDQWPEYYDTRSGRFIGKQSRLFQTWTIAGFLTSKKLLENPEKASLLFWDEDYDL  656

Query  716   LENCVCGLKYNGRRKCSRFGVRSQ  645
             LE CVC L    R+KCSR   RSQ
Sbjct  657   LETCVCALSKTSRKKCSRIASRSQ  680



>ref|XP_003529503.1| PREDICTED: alkaline/neutral invertase CINV2-like [Glycine max]
Length=679

 Score =   982 bits (2539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/690 (71%), Positives = 557/690 (81%), Gaps = 16/690 (2%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNH-SIFWY-PFGRCNRQVMDNLSKSQQKIKDVhrmggg  2517
             M S SCIGISTMKPC RIL +Y   SIF + P    +  +M  LS+S    +        
Sbjct  1     MTSGSCIGISTMKPCCRILCNYKSPSIFGFSPTKLSDSAIMGMLSRS---CRHNSTHRHR  57

Query  2516  ryrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRD---SFCNWLGRSKNRLVFVVPKVASD  2346
                     V     I+ NR  F  SGSN    R+   SFC  +G  + R+V ++P VASD
Sbjct  58    YNTCNTQNVGYINGIHPNRRDFSVSGSNWGLARNFSTSFCVNIGSFRPRVVSLIPHVASD  117

Query  2345  MRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDS  2166
              R+HSTS ++  ND SF+K +IQ  +NVKPL+IER ET +  +E   +      E  D+S
Sbjct  118   FRNHSTSVDSNANDTSFEKIFIQSSLNVKPLIIERIETDQSKLEEVAE------ERCDES  171

Query  2165  TVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNY  1986
              VN ++L   S +K+  +REVSE+EKEAWKLLQ AVV YCG PVGTVAANDPADK PLNY
Sbjct  172   NVNIDNLKDLSENKV--QREVSEIEKEAWKLLQDAVVTYCGNPVGTVAANDPADKQPLNY  229

Query  1985  DQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTM  1806
             DQVFIRDF+PSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+
Sbjct  230   DQVFIRDFVPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTV  289

Query  1805  PLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGI  1626
             PLDG N  FE+VLDPDFGESAIGRVAPVDSGLWWIILLR Y K+TGDY LQERVDVQTGI
Sbjct  290   PLDGSNEAFEEVLDPDFGESAIGRVAPVDSGLWWIILLRVYGKLTGDYALQERVDVQTGI  349

Query  1625  RLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDS  1446
             RLIL LCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REMLIVND+
Sbjct  350   RLILKLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDA  409

Query  1445  TKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWI  1266
             TKSLVAA++NRLSAL FH+REYYWVDMKKINEIYRYKTEEYS DA+NKFNIYP+QIP W+
Sbjct  410   TKSLVAAVSNRLSALCFHMREYYWVDMKKINEIYRYKTEEYSTDAVNKFNIYPEQIPSWL  469

Query  1265  VNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQ  1086
             V+WI E GGY +GNLQPAHMDFRFF+LGNLWAI+SSLGT  QN+ ILN IE KWDD++AQ
Sbjct  470   VDWISEEGGYFIGNLQPAHMDFRFFSLGNLWAIVSSLGTTRQNQGILNLIEAKWDDIVAQ  529

Query  1085  MPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAV  906
             MPLKICYPALEGE+WRI TG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+P+LA KAV
Sbjct  530   MPLKICYPALEGEEWRITTGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPDLAQKAV  589

Query  905   AVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNED  726
               AE+RL  D+WPEYYDTR+GRFIGKQ+RL QTWT+AG++TSKMLL+NP+ ASLL W ED
Sbjct  590   DSAEKRLSADRWPEYYDTRNGRFIGKQSRLMQTWTIAGFVTSKMLLENPEKASLLFWEED  649

Query  725   YELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             +ELL+NCVC L  +GRRKCSRF  RSQ  V
Sbjct  650   FELLQNCVCKLSKSGRRKCSRFAARSQFIV  679



>ref|NP_001267976.1| neutral invertase [Vitis vinifera]
 gb|ABS52644.1| neutral invertase [Vitis vinifera]
Length=673

 Score =   981 bits (2537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/689 (72%), Positives = 542/689 (79%), Gaps = 21/689 (3%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGS-YNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggr  2514
             M S S IGI+TMKP  R+L S  N SIF +P  + N  + DN SK Q K+          
Sbjct  1     MNSSSYIGITTMKPYCRVLTSCRNSSIFKFPSSKSNHFIADNSSKFQSKLTQ----SRRF  56

Query  2513  yrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSH  2334
             +     ++     INSNR AF  S  N  Q R            R V V+  VASD R H
Sbjct  57    HCCSAQILGKKCGINSNRRAFRFSDPNWGQIRVYRSCSGAHGGRRGVLVISNVASDFRKH  116

Query  2333  STSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNK  2154
             STS E+ VN+K F+  YI GG+NVKPLVIE             + + G VE         
Sbjct  117   STSVESHVNEKGFESIYINGGLNVKPLVIE-------------RIERGHVEEESGLEFKD  163

Query  2153  NDLN---GSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
              D+N      ++K   EREV E+EKEAW+LL+ AVV+YCG PVGTVAANDP DK PLNYD
Sbjct  164   PDVNFDHSEGLNKEKVEREVPEIEKEAWRLLRSAVVDYCGNPVGTVAANDPGDKQPLNYD  223

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             QVFIRDF+PSALAFLL GEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+P
Sbjct  224   QVFIRDFVPSALAFLLKGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVP  283

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LDG NG FE+VLDPDFGESAIGRVAPVDSGLWWIILL AY KITGDY LQERVDVQTGIR
Sbjct  284   LDGGNGAFEEVLDPDFGESAIGRVAPVDSGLWWIILLGAYGKITGDYALQERVDVQTGIR  343

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             LILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML VND T
Sbjct  344   LILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVNDGT  403

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
             K+LV AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DAINKFNIYPDQIP W+V
Sbjct  404   KNLVRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPTWLV  463

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
             +WIP+ GGYL+GNLQPAHMDFRFFTLGNLW+IISSLGT +QN+ ILN IE KWDDL+A M
Sbjct  464   DWIPDQGGYLIGNLQPAHMDFRFFTLGNLWSIISSLGTAKQNEGILNLIEAKWDDLVAHM  523

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVA  903
             PLKICYPALE E+WRIITGSDPKNTPWSYHNGGSWP LLWQFTLACIKMG+PELA KAVA
Sbjct  524   PLKICYPALENEEWRIITGSDPKNTPWSYHNGGSWPALLWQFTLACIKMGRPELARKAVA  583

Query  902   VAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDY  723
             +AEERL VD WPEYYDTR GRFIGKQ+RL QTWT+AG+LTSKMLL+NP+MASLL W EDY
Sbjct  584   LAEERLSVDHWPEYYDTRSGRFIGKQSRLYQTWTIAGFLTSKMLLENPEMASLLAWEEDY  643

Query  722   ELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             ELLE CVC L   GR+KCSR   RSQ+ V
Sbjct  644   ELLEICVCALSKTGRKKCSRSAARSQIPV  672



>ref|XP_011019331.1| PREDICTED: alkaline/neutral invertase CINV2 [Populus euphratica]
Length=692

 Score =   979 bits (2530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/693 (72%), Positives = 552/693 (80%), Gaps = 9/693 (1%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSY-NHSIFWYPFGRCNRQ--VMDNLSKSQQKIKDVhrmgg  2520
             M S SCIGISTMKPC RI+ SY + S F     R N    +  NLSKS  K    H    
Sbjct  1     MNSSSCIGISTMKPCCRIIISYRSFSHFGVSLSRSNNNSVIHTNLSKSHPKSVYNHEFHC  60

Query  2519  gryrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGR--SKNRLVFVVPKVASD  2346
                R          ++N +R  F     N    R     +L    S +R V V+PKVASD
Sbjct  61    CNKRSWSQDTGHKCIVNLDRRGFNVCDWNWGHARGFSSGFLADKGSSSRGVLVIPKVASD  120

Query  2345  MRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQK-DGGRVEITDD  2169
             +R+HSTS E  VN K F+  YIQGG+NVKPLVIE+ ET  D  +  +++    RVEI   
Sbjct  121   IRNHSTSVEGHVNKKGFENIYIQGGLNVKPLVIEKIETESDAAKEGKEETSSNRVEINGS  180

Query  2168  STVNK--NDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLP  1995
                 K    LN S+  K+  EREVS++EKEAW+LL+G +VNYCG PVGTVAANDPAD+ P
Sbjct  181   KVNTKFFKGLNESTTPKVV-EREVSKIEKEAWQLLRGTIVNYCGNPVGTVAANDPADRQP  239

Query  1994  LNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV  1815
             LNYDQVFIRDF+PSALAFLLNGE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV
Sbjct  240   LNYDQVFIRDFVPSALAFLLNGEMEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV  299

Query  1814  RTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQ  1635
             +T+PLDG +G F++VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQ
Sbjct  300   KTVPLDGSDGGFDEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQ  359

Query  1634  TGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIV  1455
             TGIRL LNLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC REMLIV
Sbjct  360   TGIRLGLNLCLSDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMLIV  419

Query  1454  NDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIP  1275
             ND TK+LVAAINNRLSALSFHIREYYWVDM+KINEIYRY TEEYS DA+NKFNIYPDQIP
Sbjct  420   NDETKNLVAAINNRLSALSFHIREYYWVDMRKINEIYRYNTEEYSTDAVNKFNIYPDQIP  479

Query  1274  PWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDL  1095
              W+V+WIPE GGYL+GNLQPAHMDFRFFTLGNLWAI+SSLGT +QN+ ILN IE +WDDL
Sbjct  480   SWLVDWIPEEGGYLIGNLQPAHMDFRFFTLGNLWAIVSSLGTSKQNEGILNLIEARWDDL  539

Query  1094  IAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAM  915
             +  MPLKICYPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELA 
Sbjct  540   MGHMPLKICYPALEYEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAQ  599

Query  914   KAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVW  735
             KAVA+AE RL +DQWPEYYDTR GRFIGKQ+RL QTWT++G+LTSKMLL+NPD ASLL  
Sbjct  600   KAVALAETRLSMDQWPEYYDTRSGRFIGKQSRLFQTWTISGFLTSKMLLENPDKASLLFL  659

Query  734   NEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
              EDYELLE CVC L   GR+KCSR   RSQ+ V
Sbjct  660   EEDYELLEICVCALSKTGRKKCSRIAARSQILV  692



>ref|XP_003550817.1| PREDICTED: alkaline/neutral invertase CINV2-like [Glycine max]
 gb|KHN03258.1| hypothetical protein glysoja_004284 [Glycine soja]
Length=680

 Score =   976 bits (2524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/693 (70%), Positives = 552/693 (80%), Gaps = 21/693 (3%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNH-SIFWY-PFGRCNRQVMDNLSKSQQKIKDVhrmggg  2517
             M S SCIGISTMKPC RIL +Y   SIF + P    +  +M  LS+S     +       
Sbjct  1     MTSGSCIGISTMKPCCRILCNYKSPSIFGFSPTKFSHSAIMGMLSRS--GYHNSTHCHRY  58

Query  2516  ryrhrHSVVTLTRVINSNRCAFCGSGSN---GDQHRDSFCNWLGRSKNRLVFVVPKVASD  2346
                +   +V    VI+ N   F  SGSN         S C  +G  + R+V + P VASD
Sbjct  59    NTCNNTQIVGYINVIHPNWRDFSVSGSNWGLAKNFSTSVCVNIGSFRPRVVSLTPHVASD  118

Query  2345  MRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDS  2166
              R+HSTS ++  ND SF+K YIQ G+NVKPL+IER            + D  ++E   + 
Sbjct  119   FRNHSTSVDSHSNDTSFEKIYIQSGLNVKPLIIERI-----------ETDQSKLEEVAEE  167

Query  2165  TVNKNDLNGSSISKLAP---EREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLP  1995
               N++++N  ++  L+    +REVSE+EKEAWKLLQ AVV YCG PVGTVAANDPADK P
Sbjct  168   RCNESNVNIDNLKDLSENKVQREVSEIEKEAWKLLQDAVVTYCGNPVGTVAANDPADKQP  227

Query  1994  LNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV  1815
             LNYDQVFIRDF+PSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV
Sbjct  228   LNYDQVFIRDFVPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV  287

Query  1814  RTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQ  1635
             RT+PLDG N  FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY K+TGDY LQERVDVQ
Sbjct  288   RTVPLDGSNEAFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYALQERVDVQ  347

Query  1634  TGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIV  1455
             TGIRLIL LCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REMLIV
Sbjct  348   TGIRLILKLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIV  407

Query  1454  NDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIP  1275
             ND+TKSLVAA++NRLSAL FH+REYYWVDMKKINEIYRYKTEEYS DA+NKFNIYP+QIP
Sbjct  408   NDATKSLVAAVSNRLSALCFHMREYYWVDMKKINEIYRYKTEEYSTDAVNKFNIYPEQIP  467

Query  1274  PWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDL  1095
              W+V+WI E GGY +GNLQPAHMDFRFF+LGNLWAI+SSLGT  QN+ ILN IE KWDD+
Sbjct  468   SWLVDWISEEGGYFIGNLQPAHMDFRFFSLGNLWAIVSSLGTTRQNQGILNLIEAKWDDI  527

Query  1094  IAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAM  915
             + QMPLKICYPALEGE+WRI TG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+P+LA 
Sbjct  528   VGQMPLKICYPALEGEEWRITTGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPDLAQ  587

Query  914   KAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVW  735
             KAV  AE+RL  D+WPEYYDT +GRFIGKQ+R+ QTWT+AG+LTSKMLL+NP+ ASLL W
Sbjct  588   KAVDSAEKRLSADRWPEYYDTPNGRFIGKQSRMVQTWTIAGFLTSKMLLENPERASLLFW  647

Query  734   NEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
              ED+ELL+NCVC L  +GRRKCSRF  RSQ  V
Sbjct  648   EEDFELLQNCVCMLSKSGRRKCSRFAARSQFIV  680



>emb|CAP59644.1| putative neutral invertase [Vitis vinifera]
Length=676

 Score =   976 bits (2523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/692 (72%), Positives = 544/692 (79%), Gaps = 24/692 (3%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGS-YNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggr  2514
             M S S IGI+TMKP  R+L S  N SIF +P  + N  + DN SK Q K+          
Sbjct  1     MNSSSYIGITTMKPYCRVLTSCRNSSIFKFPSSKSNHFIADNSSKFQSKLTQ----SRRF  56

Query  2513  yrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSH  2334
             +     ++     INSNR AF  S  N  Q R            R V V+  VASD R H
Sbjct  57    HCCSAQILGKKCGINSNRRAFRFSDPNWGQIRVYRSCSGAHGGRRGVLVISNVASDFRKH  116

Query  2333  STSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNK  2154
             STS E+ VN+K F+  YI GG+NVKPLVIE             + + G VE         
Sbjct  117   STSVESHVNEKGFESIYINGGLNVKPLVIE-------------RIERGHVEEESGLEFKD  163

Query  2153  NDLN---GSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
              D+N      ++K   EREV E+EKEAW+LL+ AVV+YCG PVGTVAANDP DK PLNYD
Sbjct  164   PDVNFDHSEGLNKEKVEREVPEIEKEAWRLLRSAVVDYCGNPVGTVAANDPGDKQPLNYD  223

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             QVFIRDF+PSALAFLL GEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+P
Sbjct  224   QVFIRDFVPSALAFLLKGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVP  283

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LDG NG FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGIR
Sbjct  284   LDGGNGAFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIR  343

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEI-QALFYSALRCTREMLIVNDS  1446
             LILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEI QALFYSALRC+REML VND 
Sbjct  344   LILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQQALFYSALRCSREMLTVNDG  403

Query  1445  TKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWI  1266
             TK+LV AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DAINKFNIYPDQIP W+
Sbjct  404   TKNLVRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPTWL  463

Query  1265  VNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQ  1086
             V+WIP+ GGYL+GNLQPAHMDFRFFTLGNLW+IISSLGT +QN+ ILN IE KWDDL+A 
Sbjct  464   VDWIPDQGGYLIGNLQPAHMDFRFFTLGNLWSIISSLGTAKQNEGILNLIEAKWDDLVAH  523

Query  1085  MPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLW--QFTLACIKMGKPELAMK  912
             MPLKICYPALE E+WRIITGSDPKNTPWSYHNGGSWP LLW  QFTLACIKMG+PELA K
Sbjct  524   MPLKICYPALENEEWRIITGSDPKNTPWSYHNGGSWPALLWQFQFTLACIKMGRPELARK  583

Query  911   AVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWN  732
             AVA+AEERL VD WPEYYDTR+GRFIGKQ+RL QTWT+AG+LTSKMLL+NP+MASLL W 
Sbjct  584   AVALAEERLSVDHWPEYYDTRNGRFIGKQSRLYQTWTIAGFLTSKMLLENPEMASLLAWE  643

Query  731   EDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             EDYELLE CVC L   GR+KCSR   RSQ+ V
Sbjct  644   EDYELLEICVCALSKTGRKKCSRSAARSQIPV  675



>emb|CAP59643.1| putative neutral invertase [Vitis vinifera]
Length=676

 Score =   975 bits (2521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/692 (72%), Positives = 545/692 (79%), Gaps = 24/692 (3%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGS-YNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggr  2514
             M S S IGI+TMKP  R+L S  N SIF +P  + N  + DN SK Q K+          
Sbjct  1     MNSSSYIGITTMKPYCRVLTSCRNSSIFKFPSSKSNHFIADNSSKFQSKL----IHSRRF  56

Query  2513  yrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSH  2334
             +     ++     INSNR AF  S  N  Q R            R V V+  VASD R H
Sbjct  57    HCCSAQILGKKCGINSNRRAFRLSDPNWGQIRVYRSCSGAHGGRRGVLVISNVASDFRKH  116

Query  2333  STSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNK  2154
             STS E+ VN+K F+  YI GG+NVKPLVIE             + + G VE         
Sbjct  117   STSVESHVNEKGFESIYINGGLNVKPLVIE-------------RIERGHVEEESGLEFKD  163

Query  2153  NDLN---GSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
              D+N      ++K   EREV E+EKEAW+LL+ AVV+YCG PVGTVAANDP DK PLNYD
Sbjct  164   PDVNFDHSEGLNKEKVEREVPEIEKEAWRLLRSAVVDYCGNPVGTVAANDPGDKQPLNYD  223

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             QVFIRDF+PSALAFLL GEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+P
Sbjct  224   QVFIRDFVPSALAFLLKGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVP  283

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LDG NG FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGIR
Sbjct  284   LDGGNGAFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIR  343

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEI-QALFYSALRCTREMLIVNDS  1446
             LILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEI QALFYSALRC+REM+ VND 
Sbjct  344   LILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQQALFYSALRCSREMITVNDG  403

Query  1445  TKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWI  1266
             TK+LV AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DAINKFNIYPDQIP W+
Sbjct  404   TKNLVRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPTWL  463

Query  1265  VNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQ  1086
             V+WIP+ GGYL+GNLQPAHMDFRFFTLGNLW+IISSLGT +QN+ ILN IE KWDDL+A 
Sbjct  464   VDWIPDQGGYLIGNLQPAHMDFRFFTLGNLWSIISSLGTAKQNEGILNLIEAKWDDLVAH  523

Query  1085  MPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLW--QFTLACIKMGKPELAMK  912
             MPLKICYPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLW  QFTLACIKMG+PELA K
Sbjct  524   MPLKICYPALENEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFQFTLACIKMGRPELARK  583

Query  911   AVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWN  732
             AVA+AEERL VD WPEYYDTR+GRFIGKQ+RL QTWT+AG+LTSKMLL+NP+MASLL W 
Sbjct  584   AVALAEERLSVDHWPEYYDTRNGRFIGKQSRLYQTWTIAGFLTSKMLLENPEMASLLAWE  643

Query  731   EDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             EDYELLE CVC L   GR+KCSR   RSQ+ V
Sbjct  644   EDYELLEICVCALSKTGRKKCSRSAARSQIPV  675



>gb|EYU45478.1| hypothetical protein MIMGU_mgv1a002360mg [Erythranthe guttata]
Length=684

 Score =   974 bits (2518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/689 (71%), Positives = 561/689 (81%), Gaps = 9/689 (1%)
 Frame = -3

Query  2690  MVSRSCIGISTMKP-CSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggr  2514
             M +R C+GIS MKP CS +    + SIF  P  +  R +  NL KSQ ++   +      
Sbjct  1     MNTRGCLGISYMKPSCSILTLGRSSSIFGCPLLKHGRCIKYNLPKSQLQL---YCWMETN  57

Query  2513  yrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSH  2334
                  + +     I+S+R  FCGSGSN  + R S  N + ++ N    V+  VAS+ R+H
Sbjct  58    CCPDKNALGFRSAIDSHRRVFCGSGSNSGRARVSSANGVKKT-NFFTSVIANVASNTRNH  116

Query  2333  STSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGG-RVEITDD-STV  2160
             S S E++VN+ SF+K YIQG  NVKPLVI++ E  +D++   E+K+   +V++ +D    
Sbjct  117   SDSVESRVNENSFEKLYIQGSFNVKPLVIKKIEEGQDLLGKDEEKNKEYKVQVNEDLKNA  176

Query  2159  NKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAAND-PADKLPLNYD  1983
             N + L+ S +S+     +VSEVEKEAWKLL+GAVVNYCG PVGT+A+ D PAD  PLNYD
Sbjct  177   NIDQLSKSEVSESTLGGDVSEVEKEAWKLLRGAVVNYCGNPVGTIASTDHPADNQPLNYD  236

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             QVFIRDF+PSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+P
Sbjct  237   QVFIRDFVPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTLP  296

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LDGR+GEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDYTLQERVDVQTGI+
Sbjct  297   LDGRDGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERVDVQTGIK  356

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             LILNLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML VN+ST
Sbjct  357   LILNLCLTDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVNEST  416

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
             K+LV AINNRLSALSFH+REYYWVDMKKINEIYRYKTEEYS +A NKFNIYPDQIP W+ 
Sbjct  417   KNLVVAINNRLSALSFHMREYYWVDMKKINEIYRYKTEEYSAEATNKFNIYPDQIPSWLA  476

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
             +WIP+TGGYL+GNLQP+HMDFRFFTLGNLW++ISSL T EQ++ I+N +E KWDDL+AQM
Sbjct  477   DWIPDTGGYLIGNLQPSHMDFRFFTLGNLWSVISSLSTSEQSEGIMNLVEEKWDDLVAQM  536

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVA  903
             PLKICYPALE E+WRIITG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ ELA KAV 
Sbjct  537   PLKICYPALEHEEWRIITGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRTELARKAVK  596

Query  902   VAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDY  723
             +AE+RL VD WPEYYDT+H  F+GKQARL QTWTVAGYLTS +LL NP++ASLL W EDY
Sbjct  597   LAEKRLLVDDWPEYYDTKHASFVGKQARLKQTWTVAGYLTSTILLDNPELASLLFWEEDY  656

Query  722   ELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             E+LENCVCGLK N  RKCS F  RS+  V
Sbjct  657   EVLENCVCGLK-NEPRKCSHFAARSRTAV  684



>ref|XP_002311370.2| hypothetical protein POPTR_0008s10090g [Populus trichocarpa]
 gb|EEE88737.2| hypothetical protein POPTR_0008s10090g [Populus trichocarpa]
Length=671

 Score =   972 bits (2512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/690 (72%), Positives = 550/690 (80%), Gaps = 24/690 (3%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSY-NHSIFWYPFGRCNRQ--VMDNLSKSQQKIKDVhrmgg  2520
             M S SCIGISTMKPC RI+ SY + S F     R N    +  NLSKS  K    H    
Sbjct  1     MNSSSCIGISTMKPCCRIIISYRSFSHFGVSLSRSNNNSVIHTNLSKSHPKSVYNHEFHC  60

Query  2519  gryrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWL--GRSKNRLVFVVPKVASD  2346
                R          ++N +R  F     N    R     +L    S +R V V+PKVASD
Sbjct  61    CNNRSWSQDTGHKCIVNLDRRGFNVCDWNWGHARGFSSGFLVDKGSSSRGVLVIPKVASD  120

Query  2345  MRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDS  2166
             +R+HSTS E  VN K F+  YIQGG+NVKPLVIE+ ET         + D  + E  +++
Sbjct  121   IRNHSTSVEGHVNTKGFESIYIQGGLNVKPLVIEKIET---------ESDVAK-EGKEET  170

Query  2165  TVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNY  1986
             + N+ ++NGS         EVS++EKEAW+LL+G +VNYCG PVGTVAANDPAD+ PLNY
Sbjct  171   SSNRVEINGS---------EVSKIEKEAWQLLRGTIVNYCGNPVGTVAANDPADRQPLNY  221

Query  1985  DQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTM  1806
             DQVFIRDF+PSALAFLLNGE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV+T+
Sbjct  222   DQVFIRDFVPSALAFLLNGEMEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVKTV  281

Query  1805  PLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGI  1626
             PLDG +G FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGI
Sbjct  282   PLDGSDGGFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGI  341

Query  1625  RLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDS  1446
             RL LNLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC REMLIVND 
Sbjct  342   RLGLNLCLSDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMLIVNDE  401

Query  1445  TKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWI  1266
             TK+LVAAINNRLSALSFHIREYYWVDM+KINEIYRY TEEYS DA+NKFNIYPDQIP W+
Sbjct  402   TKNLVAAINNRLSALSFHIREYYWVDMRKINEIYRYNTEEYSTDAVNKFNIYPDQIPSWL  461

Query  1265  VNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQ  1086
             V+WIPE GGYL+GNLQPAHMDFRFFTLGNLWAI+SSLGT +QN+ ILN IE +WDDL+  
Sbjct  462   VDWIPEEGGYLIGNLQPAHMDFRFFTLGNLWAIVSSLGTSKQNEGILNLIEARWDDLMGH  521

Query  1085  MPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAV  906
             MPLKICYPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELA KA+
Sbjct  522   MPLKICYPALEYEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAQKAI  581

Query  905   AVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNED  726
             A+AE RL +DQWPEYYDTR GRFIGKQ+RL QTWT++G+LTSKMLL+NPD ASLL   ED
Sbjct  582   ALAETRLSMDQWPEYYDTRSGRFIGKQSRLFQTWTISGFLTSKMLLENPDKASLLFLEED  641

Query  725   YELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             YELLE CVC L   GR+KCSRF  RSQ+ V
Sbjct  642   YELLEICVCALSKTGRKKCSRFAARSQILV  671



>ref|XP_010045364.1| PREDICTED: alkaline/neutral invertase CINV2 [Eucalyptus grandis]
 gb|KCW87538.1| hypothetical protein EUGRSUZ_B03984 [Eucalyptus grandis]
Length=671

 Score =   969 bits (2506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/672 (73%), Positives = 545/672 (81%), Gaps = 16/672 (2%)
 Frame = -3

Query  2657  MKPCSRILGSY-NHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggryrhrHSVVTLT  2481
             +KPC RIL  Y + SIF     +     ++NLSKSQ K          R   +       
Sbjct  12    VKPCCRILIRYRSSSIFGVSPLKSGSPSLNNLSKSQFK------HAFRRGCGKPGFSGHR  65

Query  2480  RVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSHSTSTEAQVNDK  2301
               +   R AFC S S+  Q R   C   GR   R + V+P+VASD R+HS+S EA VN K
Sbjct  66    CPVEPGRRAFCISDSSWGQSRVGSCRVNGR---RGLLVIPRVASDFRNHSSSVEAHVNQK  122

Query  2300  SFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNGSSISKL  2121
             SF+  YIQGG+NVKPLVIER ET   V +   ++D  R+E  D STVN + L G  + + 
Sbjct  123   SFESIYIQGGLNVKPLVIERIETDHGVAK---EEDRDRIE-ADSSTVNIDSLKG--LREK  176

Query  2120  APEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAF  1941
               EREVSE+EKEAWKLL+ AVVNYCG PVGTVAAND  DK  LNYDQVFIRDF+PSALAF
Sbjct  177   TAEREVSEIEKEAWKLLRSAVVNYCGNPVGTVAANDLTDKQALNYDQVFIRDFVPSALAF  236

Query  1940  LLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDP  1761
             LLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR +PL+G +G FE+VLDP
Sbjct  237   LLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRGVPLEGSDGAFEEVLDP  296

Query  1760  DFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMF  1581
             DFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERV+VQTGIRLILNLCL DGFDMF
Sbjct  297   DFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVEVQTGIRLILNLCLTDGFDMF  356

Query  1580  PTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSAL  1401
             PTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REMLIVND+T  LVAAINNRLSAL
Sbjct  357   PTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDATTKLVAAINNRLSAL  416

Query  1400  SFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNL  1221
             SFHIREYYWVDMKKINEIYRY TEEYS +AINKFNIYPDQIP W+V+WIPETGGYL+GNL
Sbjct  417   SFHIREYYWVDMKKINEIYRYNTEEYSTEAINKFNIYPDQIPSWLVDWIPETGGYLIGNL  476

Query  1220  QPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDW  1041
             QPAHMDFRFFTLGNLWAIISSLGT +QN+ ILN IE KWDDL+A MPLKICYPALE E+W
Sbjct  477   QPAHMDFRFFTLGNLWAIISSLGTQKQNEGILNLIEAKWDDLVAHMPLKICYPALESEEW  536

Query  1040  RIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEY  861
             R+ITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKP LA KAV +AE+RL  D WPEY
Sbjct  537   RLITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPGLAKKAVDLAEKRLSADDWPEY  596

Query  860   YDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNG  681
             YDTR GRFIGKQ+RL QTWT+AG+LTSKMLL+ P++AS+L W EDYELLE CVC L  +G
Sbjct  597   YDTRSGRFIGKQSRLFQTWTIAGFLTSKMLLEKPELASMLFWEEDYELLEICVCSLGKSG  656

Query  680   RRKCSRFGVRSQ  645
             R+KCSR   RSQ
Sbjct  657   RKKCSRRNARSQ  668



>ref|XP_010102907.1| hypothetical protein L484_005970 [Morus notabilis]
 gb|EXB94375.1| hypothetical protein L484_005970 [Morus notabilis]
Length=687

 Score =   965 bits (2494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/698 (71%), Positives = 557/698 (80%), Gaps = 24/698 (3%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRIL--GSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmggg  2517
             M + SCIGISTMKP  RIL  G  + S+F +   + N   + NL KSQ +        G 
Sbjct  1     MNTSSCIGISTMKPSRRILVVGCESCSLFRFSPLKLN---IRNLPKSQPE----SAFDGR  53

Query  2516  ryrhrHSVVTLTRVINSNRCAFCGSGSNGDQHR--------DSFCNWLGRSKNRLV---F  2370
                    +V   R+ + NR  F  S SN  + +        D   NW+    +R      
Sbjct  54    SGGSDSQIVGYIRLSDRNRKGFRVSDSNWVKSKIFKRNCIGDGGYNWVSSRSSRSRRSHL  113

Query  2369  VVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGG  2190
             +V  VASD R+HSTS +A VN+KSF++ Y+QGG+NVKPLVIER ET    V   E+  G 
Sbjct  114   IVRNVASDFRNHSTSVDAHVNEKSFERIYVQGGLNVKPLVIERIETGPSDVVKEEEASG-  172

Query  2189  RVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDP  2010
              +E   D +VN +  +  S+++   EREV E+EKEAWKLL  +VV YCG+PVGTVAAN P
Sbjct  173   -LEEVLDPSVNVD--SSKSLNETKVEREVPEIEKEAWKLLWDSVVMYCGHPVGTVAANVP  229

Query  2009  ADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMP  1830
              DK P+NYDQVFIRDF+PSALAFLLNGE EIVKNFLLHTLQLQSWEKTVDC+SPGQGLMP
Sbjct  230   VDKQPVNYDQVFIRDFVPSALAFLLNGEPEIVKNFLLHTLQLQSWEKTVDCHSPGQGLMP  289

Query  1829  ASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQE  1650
             ASFKVRT+PLDG +G FE++LDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQE
Sbjct  290   ASFKVRTVPLDGSDGAFEEILDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQE  349

Query  1649  RVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTR  1470
             RVDVQTGIRLILNLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFY+ALRC+R
Sbjct  350   RVDVQTGIRLILNLCLSDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYAALRCSR  409

Query  1469  EMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIY  1290
             EM+IVNDSTK+LVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DAINKFNIY
Sbjct  410   EMVIVNDSTKNLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIY  469

Query  1289  PDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEG  1110
             PDQIP W+V+WIPE GGYL+GNLQPAHMDFRFFTLGNLWAI+SSLGT +QN+ ILN IE 
Sbjct  470   PDQIPSWLVDWIPEEGGYLIGNLQPAHMDFRFFTLGNLWAIVSSLGTQKQNEGILNLIEA  529

Query  1109  KWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGK  930
             KWDDL+ QMPLKICYPALE E+WRI TG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+
Sbjct  530   KWDDLMGQMPLKICYPALEYEEWRITTGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGR  589

Query  929   PELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMA  750
             PELA KAV +AE+RL VDQWPEYYDT+ GRFIGKQ+RL QTWT+AG+L SKMLL+NP+ A
Sbjct  590   PELARKAVDLAEKRLAVDQWPEYYDTKSGRFIGKQSRLYQTWTIAGFLASKMLLENPEKA  649

Query  749   SLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             SLL+W EDYELLE CVC L    RRKCSRF  RSQ+ V
Sbjct  650   SLLLWEEDYELLETCVCVLNKTSRRKCSRFASRSQIQV  687



>ref|XP_007154423.1| hypothetical protein PHAVU_003G118400g [Phaseolus vulgaris]
 gb|ESW26417.1| hypothetical protein PHAVU_003G118400g [Phaseolus vulgaris]
Length=674

 Score =   965 bits (2494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/690 (70%), Positives = 550/690 (80%), Gaps = 21/690 (3%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNH-SIFWY-PFGRCNRQVMDNLSKSQQKIKDVhrmggg  2517
             M S S IGISTMKPC RIL +Y   SIF + P    +  +M  LS+S             
Sbjct  1     MTSGSSIGISTMKPCCRILCNYKSPSIFGFSPTKFSDSAIMGMLSRSGHH---KSTHCCR  57

Query  2516  ryrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRD---SFCNWLGRSKNRLVFVVPKVASD  2346
                    V     VI  NR  F  SGSN    RD   S C  +G  + R+V ++P VASD
Sbjct  58    YNTCDTQVAGYINVIKPNRRDFSVSGSNWGLARDFSTSVCVNIGSFRPRVVSLIPHVASD  117

Query  2345  MRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDS  2166
              R+ STS ++  +D SF+K YIQ G+NVKPLVIE+T           + D   +E   +S
Sbjct  118   FRNQSTSVDSHAHDTSFEKIYIQSGLNVKPLVIEKT-----------ETDQSILEEVSES  166

Query  2165  TVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNY  1986
              VN ++L   S +K+  + +VSEVEKEAWKLLQ AVV YCG PVGTVAAND ADK PLNY
Sbjct  167   NVNLDNLKDLSENKV--QSKVSEVEKEAWKLLQDAVVTYCGNPVGTVAANDSADKQPLNY  224

Query  1985  DQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTM  1806
             DQVFIRDF+PSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+
Sbjct  225   DQVFIRDFVPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTV  284

Query  1805  PLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGI  1626
             PLDG N   E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY K+TGDYTLQ+RVDVQTGI
Sbjct  285   PLDGSNEALEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYTLQDRVDVQTGI  344

Query  1625  RLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDS  1446
             RLIL LCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REMLIVND+
Sbjct  345   RLILKLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDA  404

Query  1445  TKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWI  1266
             TK+LVAA++NRLSAL FH+REYYWVDMKKINEIYRYKTEEYS DA+NKFNIYP+QIP W+
Sbjct  405   TKNLVAAVSNRLSALCFHMREYYWVDMKKINEIYRYKTEEYSTDAVNKFNIYPEQIPSWL  464

Query  1265  VNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQ  1086
             V+WI E GGY +GN+QPAHMDFRFFTLGNLWAI++SLGT  QN+ ILN IE KWDD++AQ
Sbjct  465   VDWISEDGGYFIGNVQPAHMDFRFFTLGNLWAIVTSLGTTRQNQGILNLIEAKWDDIVAQ  524

Query  1085  MPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAV  906
             MPLKICYPALEGE+WRIITG DPKNTPWSYHNGGSWPTLLWQFTLAC+KMG+P+LA KAV
Sbjct  525   MPLKICYPALEGEEWRIITGCDPKNTPWSYHNGGSWPTLLWQFTLACMKMGRPDLAQKAV  584

Query  905   AVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNED  726
               A +RL +D+WPEYYDTR+GRFIGKQ+RL QTWT+AG+LTSKMLL+NP+ ASLL W ED
Sbjct  585   DSAGKRLSLDKWPEYYDTRNGRFIGKQSRLKQTWTIAGFLTSKMLLENPEKASLLFWEED  644

Query  725   YELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             +E+L+NCVC L  +G RKCSRF  RSQ  V
Sbjct  645   FEVLQNCVCMLSKSGGRKCSRFSSRSQFLV  674



>ref|XP_004295043.1| PREDICTED: uncharacterized protein LOC101296189 [Fragaria vesca 
subsp. vesca]
Length=674

 Score =   962 bits (2487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/688 (70%), Positives = 554/688 (81%), Gaps = 17/688 (2%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M S +CIGI TM+PC RIL  Y +  +     R          KS   + D+ ++     
Sbjct  1     MSSSNCIGICTMRPCCRILMGYGYRSY-----RSASVFGSQGPKSSGAVVDLVKLRSTSR  55

Query  2510  rhrHSVVTLTRV--INSNRCAFCGSGSNGDQHRDSFCNWLGRSK-NRLVFVVPKVASDMR  2340
                 S  ++  +  I+ NR  F  + S+ D  R      +G ++  R V V+  VASD R
Sbjct  56    FGSCSGESVGYISGIDPNRRGF--NVSDSDWGRQPRVGNVGVNRVKRGVLVIRNVASDFR  113

Query  2339  SHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTV  2160
             +HSTS ++QVN KSF+  YIQGG+NVKPLVIER ET    V    +++  RVE+ + S V
Sbjct  114   NHSTSVDSQVNGKSFESIYIQGGLNVKPLVIERIETGNGDVV---KEEESRVEV-NGSNV  169

Query  2159  NKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQ  1980
             N N      ++    ERE+SE+EKEAW LL+ +VV YCG PVGT+AA DPADK PLNYDQ
Sbjct  170   NVNIGGTEGLNDSRAERELSEIEKEAWGLLRDSVVEYCGNPVGTLAAIDPADKTPLNYDQ  229

Query  1979  VFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPL  1800
             VFIRDF+PSALAFLLNGE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV+T PL
Sbjct  230   VFIRDFVPSALAFLLNGEAEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVKTAPL  289

Query  1799  DGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRL  1620
             DG +G+FE+VLDPDFGESAIGRVAPVDSGLWWII+LRAY KITGDYTLQERVDVQTGIRL
Sbjct  290   DGSDGKFEEVLDPDFGESAIGRVAPVDSGLWWIIMLRAYGKITGDYTLQERVDVQTGIRL  349

Query  1619  ILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTK  1440
             ILNLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REMLIVND TK
Sbjct  350   ILNLCLTDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDGTK  409

Query  1439  SLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVN  1260
             +LVAA+NNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DAINKFNIYPDQIP W+V+
Sbjct  410   NLVAAVNNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPSWLVD  469

Query  1259  WIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMP  1080
             WIP+ GGYL+GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN+ ILN +E KWDD +AQMP
Sbjct  470   WIPDEGGYLIGNLQPAHMDFRFFTLGNLWSIVSSLGTQQQNEGILNLMETKWDDFVAQMP  529

Query  1079  LKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAV  900
             LKICYPA+E E+WRIITG+DPKNTPWSYHNGGSWPTLLWQFTLACIKMGK ELA KAVA+
Sbjct  530   LKICYPAMEYEEWRIITGADPKNTPWSYHNGGSWPTLLWQFTLACIKMGKTELAEKAVAL  589

Query  899   AEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYE  720
             AE+RL +D WPEYYDT++GRFIGKQ+RL+QTWT+AGYLTSKMLL+NP+ ASLL W EDYE
Sbjct  590   AEKRLSIDHWPEYYDTKNGRFIGKQSRLHQTWTIAGYLTSKMLLENPEKASLLFWEEDYE  649

Query  719   LLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             LLE CVC L    R+KCSR   RSQ+ V
Sbjct  650   LLETCVCALNKTSRKKCSR---RSQIQV  674



>gb|KDP27968.1| hypothetical protein JCGZ_19048 [Jatropha curcas]
Length=584

 Score =   959 bits (2478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/590 (78%), Positives = 511/590 (87%), Gaps = 24/590 (4%)
 Frame = -3

Query  2381  RLVFVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVK-PLviertetredvvetyE  2205
             R V V+P+VASD R+HSTS E+ VN+K F+  +IQGG+N+K PLVIE             
Sbjct  5     RGVLVIPRVASDFRNHSTSVESHVNEKGFENIFIQGGLNLKKPLVIE-------------  51

Query  2204  QKDGGRVEITDDSTVNKNDLNGSSIS--------KLAP--EREVSEVEKEAWKLLQGAVV  2055
             + + G   +  D T N+ D+NG+S++        + +P  EREVSE+EKEAWKLLQGA+V
Sbjct  52    KIETGNNALKKDETSNRVDINGTSVNIDYLKGLNETSPNVEREVSEIEKEAWKLLQGAIV  111

Query  2054  NYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSW  1875
             NYCG PVGTVAANDPADK PLNYDQVFIRDF+PSALAFLLNGE EIVKNFLL+TLQLQSW
Sbjct  112   NYCGNPVGTVAANDPADKQPLNYDQVFIRDFVPSALAFLLNGEPEIVKNFLLYTLQLQSW  171

Query  1874  EKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIIL  1695
             EKTVDCYSPGQGLMPASFKVRT+PLDG +G FE+VLDPDFGESAIGRVAPVDSGLWWI+L
Sbjct  172   EKTVDCYSPGQGLMPASFKVRTVPLDGNDGAFEEVLDPDFGESAIGRVAPVDSGLWWIML  231

Query  1694  LRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHP  1515
             LRAY KITGDY+LQER+DVQTGIRLILNLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHP
Sbjct  232   LRAYGKITGDYSLQERIDVQTGIRLILNLCLSDGFDMFPTLLVTDGSCMIDRRMGIHGHP  291

Query  1514  LEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYK  1335
             LEIQALFYSALRC REMLI+ND TK LVAA+NNRLSALSFHIREYYWVD+KKINEIYRYK
Sbjct  292   LEIQALFYSALRCAREMLIINDGTKKLVAAVNNRLSALSFHIREYYWVDIKKINEIYRYK  351

Query  1334  TEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSL  1155
             TEEYS DA+NKFNIYPDQIP W+V+WIPE GGYL+GNLQPAHMDFRFFTLGNLWAI+SSL
Sbjct  352   TEEYSTDAVNKFNIYPDQIPSWLVDWIPEEGGYLIGNLQPAHMDFRFFTLGNLWAIVSSL  411

Query  1154  GTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWP  975
             GT +QN+ ILN IE KWDDL+A MPLKICYPALE E+WRIITGSDPKNTPWSYHNGGSWP
Sbjct  412   GTSKQNEGILNLIEAKWDDLMADMPLKICYPALENEEWRIITGSDPKNTPWSYHNGGSWP  471

Query  974   TLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVA  795
             TLLWQFTLACIKMG+PELA KAV++AE+RL VDQWPEYYD R GRFIGKQ+RL QTWT+A
Sbjct  472   TLLWQFTLACIKMGRPELAQKAVSLAEKRLSVDQWPEYYDMRRGRFIGKQSRLYQTWTIA  531

Query  794   GYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQ  645
             G+L SKMLLKNP+ ASLL W EDY+LLE CVC L    R+KCSRF  RSQ
Sbjct  532   GFLASKMLLKNPEKASLLYWEEDYDLLETCVCALSKTNRKKCSRFAARSQ  581



>ref|NP_001281053.1| alkaline/neutral invertase CINV2 [Malus domestica]
 gb|AFU56879.1| neutral invertase [Malus domestica]
Length=682

 Score =   957 bits (2474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/695 (70%), Positives = 549/695 (79%), Gaps = 23/695 (3%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNH---SIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgg  2520
             M + +CIGI T++PC RIL  Y +   SIF     + NR+V  NL K + +  D      
Sbjct  1     MSTSNCIGICTVRPCCRILMGYGYRGSSIFGSGQPKLNRKVTGNLWKLRSRSHD------  54

Query  2519  gryrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCN-----WLGRSKNRLVFVVPKV  2355
                     +    RVI+ N+  F    SN  + R    +       G S+ R V V+  V
Sbjct  55    --RGCSSQIGGCMRVIDPNQRDFSVFDSNWGRSRVYTASSRVGCGSGSSRRRCVLVISNV  112

Query  2354  ASDMRSHSTSTEAQVNDKS-FKKFYIQGGMNVKPLviertetredvvetyEQ-KDGGRVE  2181
             ASD+++HSTS E QVN KS F+  YIQGG+NVKPLVIERTET    +   E+ +      
Sbjct  113   ASDIKNHSTSVETQVNGKSSFESIYIQGGLNVKPLVIERTETDRGDLVKDEESRVEVNSS  172

Query  2180  ITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADK  2001
               + +  N   LN + I     ERE+S++EKEAW+LL+ + V+YCG PVGT+AA DPADK
Sbjct  173   NVNVNVGNSKGLNDNKI-----ERELSDIEKEAWRLLRDSAVSYCGTPVGTLAATDPADK  227

Query  2000  LPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASF  1821
              PLNYDQVF RDF+PSALAFLLNG+ EIVKNFLLHTLQLQSWEKTVDC+SPGQGLMPASF
Sbjct  228   TPLNYDQVFTRDFVPSALAFLLNGDAEIVKNFLLHTLQLQSWEKTVDCHSPGQGLMPASF  287

Query  1820  KVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVD  1641
             KVRT+PLDG  G FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERV+
Sbjct  288   KVRTVPLDGNPGAFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVE  347

Query  1640  VQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREML  1461
              QTGIRLILNLCL++GFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML
Sbjct  348   FQTGIRLILNLCLKNGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREML  407

Query  1460  IVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQ  1281
             IVND TK LVAA+NNRLSALSFHIREYYW DMKKINEIYRYKTEEYS DAINKFNIYPDQ
Sbjct  408   IVNDGTKDLVAAVNNRLSALSFHIREYYWADMKKINEIYRYKTEEYSTDAINKFNIYPDQ  467

Query  1280  IPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWD  1101
             IP W+V+WIPE GGYL+GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN+ ILN IE KWD
Sbjct  468   IPSWLVDWIPEEGGYLIGNLQPAHMDFRFFTLGNLWSIVSSLGTQKQNEGILNLIEAKWD  527

Query  1100  DLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPEL  921
             D +AQMPLKICYPALE E+WRIITG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ EL
Sbjct  528   DFVAQMPLKICYPALEYEEWRIITGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRTEL  587

Query  920   AMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLL  741
             A KAVA+AE+RL +D WPEYYDT+ GRFIGKQ+RL+QTWT+AGYLTSKMLL+NPD ASLL
Sbjct  588   AQKAVALAEKRLSMDNWPEYYDTKSGRFIGKQSRLHQTWTIAGYLTSKMLLENPDKASLL  647

Query  740   VWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
              W EDYELLE CVC L    R+KCSRF  +SQV V
Sbjct  648   FWEEDYELLETCVCALNKTSRKKCSRFAAKSQVAV  682



>gb|KHN28199.1| hypothetical protein glysoja_024017 [Glycine soja]
Length=637

 Score =   955 bits (2469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/616 (75%), Positives = 523/616 (85%), Gaps = 11/616 (2%)
 Frame = -3

Query  2474  INSNRCAFCGSGSNGDQHRD---SFCNWLGRSKNRLVFVVPKVASDMRSHSTSTEAQVND  2304
             I+ NR  F  SGSN    R+   SFC  +G  + R+V ++P VASD R+HSTS ++  ND
Sbjct  30    IHPNRRDFSVSGSNWGLARNFSTSFCVNIGSFRPRVVSLIPHVASDFRNHSTSVDSNAND  89

Query  2303  KSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNGSSISK  2124
              SF+K +IQ  +NVKPL+IER ET +  +E   +      E  D+S VN ++L   S +K
Sbjct  90    TSFEKIFIQSSLNVKPLIIERIETDQSKLEEVAE------ERCDESNVNIDNLKDLSENK  143

Query  2123  LAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALA  1944
             +  +REVSE EKEAWK LQ AVV YCG PVGTVAANDPADK PLNYDQVFIRDF+PSALA
Sbjct  144   V--QREVSETEKEAWKFLQDAVVTYCGNPVGTVAANDPADKQPLNYDQVFIRDFVPSALA  201

Query  1943  FLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLD  1764
             FLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+PLDG N  FE+VLD
Sbjct  202   FLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGSNEAFEEVLD  261

Query  1763  PDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDM  1584
             PDFGESAIGRVAPVDSGLWWIILLR Y K+TGDY LQERVDVQTGIRLIL LCL DGFDM
Sbjct  262   PDFGESAIGRVAPVDSGLWWIILLRVYGKLTGDYALQERVDVQTGIRLILKLCLTDGFDM  321

Query  1583  FPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSA  1404
             FP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REMLIVND+TKSLVAA++NRLSA
Sbjct  322   FPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDATKSLVAAVSNRLSA  381

Query  1403  LSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGN  1224
             L FH+REYYWVDMKKINEIYRYKTEEYS DA+NKFNIYP+QIP W+V+WI E GGY +GN
Sbjct  382   LCFHMREYYWVDMKKINEIYRYKTEEYSTDAVNKFNIYPEQIPSWLVDWISEEGGYFIGN  441

Query  1223  LQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGED  1044
             LQPAHMDFRFF+LGNLWAI+SSLGT  QN+ ILN IE KWDD++AQMPLKICYPALEGE+
Sbjct  442   LQPAHMDFRFFSLGNLWAIVSSLGTTRQNQGILNLIEAKWDDIVAQMPLKICYPALEGEE  501

Query  1043  WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPE  864
             WRI TG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+P+LA KAV  AE+RL  D+WPE
Sbjct  502   WRITTGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPDLAQKAVDSAEKRLSADRWPE  561

Query  863   YYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYN  684
             YYDTR+GRFIGKQ+RL QTWT+AG++TSKMLL+NP+ ASLL W ED+ELL+NCVC L  +
Sbjct  562   YYDTRNGRFIGKQSRLMQTWTIAGFVTSKMLLENPEKASLLFWEEDFELLQNCVCKLSKS  621

Query  683   GRRKCSRFGVRSQVGV  636
             GRRKCSRF  RSQ  V
Sbjct  622   GRRKCSRFAARSQFIV  637



>ref|XP_004508109.1| PREDICTED: uncharacterized protein LOC101491074 [Cicer arietinum]
Length=677

 Score =   951 bits (2458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/695 (68%), Positives = 548/695 (79%), Gaps = 28/695 (4%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M + S IGISTMKPC RI+  ++      P    +  +M  LS+S               
Sbjct  1     MTTGSYIGISTMKPCCRIISGFS------PIKFTDSTIMGILSRSCYHSSIHSHRYYKCS  54

Query  2510  rhrHSVVTLTRVINSNRCAFCGSGSNGDQHRD---SFCNWLGRSKNRLVFVVPKVASDMR  2340
              +   V  +  V + NR  F    SN  Q R+   SFC  +G  + R+V ++P VASD R
Sbjct  55    NNTKIVGYIHDVTSLNRRDFSVIDSNWAQSRNFSTSFCVNIGSVRPRVVSLIPNVASDFR  114

Query  2339  SHSTSTEAQVNDKSFKKFYIQGGMNVK-PLviertetredvvetyEQKDGGRVE-ITDDS  2166
             + STS ++ VNDKSF+  YIQ G+  K PLV E             + D G++E + D S
Sbjct  115   NESTSVDSNVNDKSFENIYIQSGLIAKNPLVFEGI-----------ETDQGKLEEVPDGS  163

Query  2165  TVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNY  1986
              VN +D N + +S+   ERE+SE+EKEAWKLL+GAVV YCG PVGTVAAND A+K PLNY
Sbjct  164   NVNLDD-NLNDLSENKAERELSEIEKEAWKLLRGAVVTYCGNPVGTVAANDSAEKQPLNY  222

Query  1985  DQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTM  1806
             DQVFIRDF+PSALAFLLNGE +IVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+
Sbjct  223   DQVFIRDFVPSALAFLLNGEEDIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTV  282

Query  1805  PLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGI  1626
             PLDG N  FE+V DPDFGESAIGRVAPVDSGLWWIILLRAY K+TGDY+LQERVDVQTGI
Sbjct  283   PLDGSNDAFEEVSDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYSLQERVDVQTGI  342

Query  1625  RLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDS  1446
             RLIL LCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQ LFYSALRC+REMLIVND+
Sbjct  343   RLILKLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQTLFYSALRCSREMLIVNDT  402

Query  1445  TKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWI  1266
             T++LVAA++NRLSALSFH+REYYWVDMKKINEIYRYKTEEYS DA+NKFNIYP+QIP W+
Sbjct  403   TRNLVAAVSNRLSALSFHMREYYWVDMKKINEIYRYKTEEYSTDAVNKFNIYPEQIPSWL  462

Query  1265  VNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQ  1086
             V+WI E GGY +GNLQPAHMDFRFFTLGNLWAI+SSLGT  QN+ ILN I+ KWDD+I Q
Sbjct  463   VDWISEEGGYFIGNLQPAHMDFRFFTLGNLWAIVSSLGTTRQNEGILNLIDAKWDDIIGQ  522

Query  1085  MPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAV  906
             MPLKICYPALEGE+WRIITG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ +LA KAV
Sbjct  523   MPLKICYPALEGEEWRIITGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRSDLAQKAV  582

Query  905   AVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNED  726
              +AE+RL +D+WPEYYDTR+G+FIGKQ+RL QTWT+AG+LTSKMLLKNP+ ASLL W ED
Sbjct  583   DLAEKRLCIDKWPEYYDTRNGKFIGKQSRLTQTWTIAGFLTSKMLLKNPEKASLLFWEED  642

Query  725   YELLENCVCGLKYNG-----RRKCSRFGVRSQVGV  636
             +E+L NCVC L   G     RRKCSRF  RS+V V
Sbjct  643   FEILHNCVCMLNKTGGGSSSRRKCSRFAARSKVLV  677



>ref|XP_009372083.1| PREDICTED: alkaline/neutral invertase CINV2 [Pyrus x bretschneideri]
Length=686

 Score =   948 bits (2450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/696 (69%), Positives = 551/696 (79%), Gaps = 21/696 (3%)
 Frame = -3

Query  2690  MVSRSCIGIST--MKPCSRIL---GSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrm  2526
             M S +CIGI T  ++PC RI+   G    SIF     + NR+V  NLSK + +  D    
Sbjct  1     MSSSNCIGICTVSLRPCCRIITGSGYRGSSIFGSGQPKLNRKVTGNLSKLRSRSHD----  56

Query  2525  gggryrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCN-----WLGRSKNRLVFVVP  2361
                       +V   RVI+ NR  F G  SN  + R    N       G S+ R V V+ 
Sbjct  57    ----RGCSSQIVRYIRVIDPNRRDFSGFDSNWGRSRVYSANSRVGCRRGSSRRRGVLVIL  112

Query  2360  KVASDMRSHSTSTEAQVNDK-SFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRV  2184
              VASD+R+HSTS E+QV  K SF+  YIQGG+NVKPLV+ER ET    V   E+      
Sbjct  113   NVASDIRNHSTSVESQVKGKTSFESIYIQGGLNVKPLVVERIETDRGDVVKEEESRVEVN  172

Query  2183  EITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPAD  2004
                 +  VN  +  G + SK+  ERE+S++E+EAW+LL+ +VV+YCG PVGT+AA DPAD
Sbjct  173   SPNVNVNVNVGNSKGLNDSKV--ERELSDIEEEAWRLLRDSVVSYCGNPVGTLAATDPAD  230

Query  2003  KLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPAS  1824
             K PLNYDQVF+RDF+PSALAFLLNG+ EIVKNFLLHTLQLQSWEKTVDC+SPGQGLMPAS
Sbjct  231   KTPLNYDQVFVRDFVPSALAFLLNGDAEIVKNFLLHTLQLQSWEKTVDCHSPGQGLMPAS  290

Query  1823  FKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERV  1644
             FKVRT+PLDG  GEFE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERV
Sbjct  291   FKVRTVPLDGSPGEFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERV  350

Query  1643  DVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREM  1464
             + QTGIRLIL+LCL++ FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REM
Sbjct  351   EFQTGIRLILHLCLKNRFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREM  410

Query  1463  LIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPD  1284
             LIVND TK LV A+NNRLSALSFHIREYYW DMKKINEIYRYKTEEYS DAINKFNIYPD
Sbjct  411   LIVNDGTKDLVTAVNNRLSALSFHIREYYWADMKKINEIYRYKTEEYSTDAINKFNIYPD  470

Query  1283  QIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKW  1104
             QIP W+V+WIPE GGYL+GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN+ ILN IE KW
Sbjct  471   QIPSWLVDWIPEEGGYLIGNLQPAHMDFRFFTLGNLWSIVSSLGTQKQNEGILNLIESKW  530

Query  1103  DDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPE  924
             DD +AQMPLKICYPALE E+WRI TG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ E
Sbjct  531   DDFVAQMPLKICYPALEYEEWRITTGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRTE  590

Query  923   LAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASL  744
             LA KAVA+AE+RL +D WPEYYDT+ GRF+GKQ+RL+QTWT+AGYL+SKMLL+NP+ ASL
Sbjct  591   LAEKAVALAEKRLSMDHWPEYYDTKSGRFVGKQSRLHQTWTIAGYLSSKMLLENPEKASL  650

Query  743   LVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             L W EDYELLE CVC L    R+KCSRF  +SQV V
Sbjct  651   LFWEEDYELLETCVCVLNKTSRKKCSRFAAKSQVAV  686



>ref|XP_010270854.1| PREDICTED: alkaline/neutral invertase CINV2 [Nelumbo nucifera]
Length=673

 Score =   947 bits (2448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/680 (70%), Positives = 542/680 (80%), Gaps = 14/680 (2%)
 Frame = -3

Query  2672  IGISTMKPCSRIL-GSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggryrhrHS  2496
              GISTM+PC R+L G    + F +    C   + +NLS  + K+          + +   
Sbjct  7     FGISTMRPCCRLLIGCRGSAFFGFLPPTCQHSLANNLSGFRYKL----LQHRQLHSNSPR  62

Query  2495  VVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSHSTSTEA  2316
             +     V N ++  F    SN  Q R  F       ++R    +  VASD+R HSTS ++
Sbjct  63    IFGFKCVANPDQRPFRSPDSNWGQSR-VFSRCCNVGQDRGTSFIANVASDVRHHSTSIDS  121

Query  2315  QVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNGS  2136
              VNDKSF+K YIQGG+ VKPLV+ER E   D  +  EQ++   V   + S      L  +
Sbjct  122   HVNDKSFEKIYIQGGIKVKPLVVERIERGVDEGKGQEQQE--HVHPVETS----EGLKET  175

Query  2135  SISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIP  1956
              IS    +REV+E+EKEAWKLLQ AVVNYCG P+GTVAANDPADK+PLNYDQVFIRDF+P
Sbjct  176   EIS--THKREVTEIEKEAWKLLQNAVVNYCGSPIGTVAANDPADKMPLNYDQVFIRDFVP  233

Query  1955  SALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFE  1776
             SALAFLL GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+PLDG  G FE
Sbjct  234   SALAFLLRGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGSTGTFE  293

Query  1775  DVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRD  1596
             +VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGI+LILNLCL D
Sbjct  294   EVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIKLILNLCLTD  353

Query  1595  GFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINN  1416
             GFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML V+D +K+LV AINN
Sbjct  354   GFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVDDGSKNLVTAINN  413

Query  1415  RLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGY  1236
             RLSALSFHIREYYWVDMKKINEIYRYKTEEYS DAINKFNIYPDQIP W+V WIPE GGY
Sbjct  414   RLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPSWLVEWIPEQGGY  473

Query  1235  LVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPAL  1056
             L+GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN+ ILN IE KWDDL+ QMPLKICYP+L
Sbjct  474   LIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEGILNLIEDKWDDLVGQMPLKICYPSL  533

Query  1055  EGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVD  876
             + E+WRIITG DPKNTPWSYHNGGSWPTLLWQFTLACIKM +PELA KA+ +AEERL +D
Sbjct  534   DYEEWRIITGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMKRPELARKAITLAEERLSMD  593

Query  875   QWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCG  696
             QWPEYYDTR+GRFIGKQ+RL QTWT+AGYLTSKMLL NP+MAS+L+ +EDYE+L+ C C 
Sbjct  594   QWPEYYDTRNGRFIGKQSRLYQTWTIAGYLTSKMLLDNPEMASMLLMDEDYEVLQTCRCA  653

Query  695   LKYNGRRKCSRFGVRSQVGV  636
             L   GR+KCSR   ++Q+ V
Sbjct  654   LSKTGRKKCSRGAAKAQILV  673



>ref|XP_008390412.1| PREDICTED: alkaline/neutral invertase CINV2-like, partial [Malus 
domestica]
Length=686

 Score =   946 bits (2444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/696 (70%), Positives = 550/696 (79%), Gaps = 21/696 (3%)
 Frame = -3

Query  2690  MVSRSCIGISTM--KPCSRILGSYNH---SIFWYPFGRCNRQVMDNLSKSQQKIKDVhrm  2526
             M S +CIGI T+  +PC RI+  Y +   SIF     + NR+V  NLSK + +  D    
Sbjct  1     MSSSNCIGICTVSVRPCCRIITGYGYRGSSIFGSGQPKLNRKVTGNLSKLRSRSHD----  56

Query  2525  gggryrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCN-----WLGRSKNRLVFVVP  2361
                        V   RVI+ NR  F G  SN  + R    N       G S+ R V V+P
Sbjct  57    ----RGCSSQXVRYJRVIDPNRRDFSGFDSNWGRSRVYTENSRVXCRRGSSRRRGVLVIP  112

Query  2360  KVASDMRSHSTSTEAQVNDK-SFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRV  2184
              VASD+R+HSTS E+QV  K SF+  YIQGG+NVKPLV+ER ET    V   E+      
Sbjct  113   NVASDIRNHSTSVESQVKGKTSFESIYIQGGLNVKPLVVERIETDXGDVVKEEESRVEVN  172

Query  2183  EITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPAD  2004
                 +  VN  +  G + +K+  ERE+S++E+EAW+LL+ +VV+YCG PVGT+AA DPAD
Sbjct  173   SSNVNVNVNVGNSKGLNDNKV--ERELSDIEEEAWRLLRDSVVSYCGNPVGTLAATDPAD  230

Query  2003  KLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPAS  1824
             K PLNYDQVFIRDF+PSALAFLLNG+ EIVKNFLLHTLQLQSWEKTVDC+SPGQGLMPAS
Sbjct  231   KTPLNYDQVFIRDFVPSALAFLLNGDAEIVKNFLLHTLQLQSWEKTVDCHSPGQGLMPAS  290

Query  1823  FKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERV  1644
             FKVRT+PLD   GEFE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERV
Sbjct  291   FKVRTVPLDXSPGEFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERV  350

Query  1643  DVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREM  1464
             + QTGIRLILNLCL++ FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REM
Sbjct  351   EFQTGIRLILNLCLKNRFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREM  410

Query  1463  LIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPD  1284
             LIVND TK LV A+NNRLSALSFHIREYYW DMKKINEIYRYKTEEYS DAINKFNIYPD
Sbjct  411   LIVNDGTKDLVTAVNNRLSALSFHIREYYWADMKKINEIYRYKTEEYSTDAINKFNIYPD  470

Query  1283  QIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKW  1104
             QIP W+V+WIPE GGYL+GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN+ ILN IE KW
Sbjct  471   QIPSWLVDWIPEEGGYLIGNLQPAHMDFRFFTLGNLWSIVSSLGTQKQNEGILNLIESKW  530

Query  1103  DDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPE  924
             DD +AQMPLKIC PALE E+WRI TG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ E
Sbjct  531   DDFVAQMPLKICXPALEYEEWRITTGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRTE  590

Query  923   LAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASL  744
             LA KAVA+AE+RL +D WPEYYDT+ GRF+GKQ+RL+QTWT+AGYLTSKMLL+NP+ ASL
Sbjct  591   LAEKAVALAEKRLSMDHWPEYYDTKSGRFVGKQSRLHQTWTIAGYLTSKMLLENPEKASL  650

Query  743   LVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             L W EDYELLE CVC L    R+KCSRF  +SQV V
Sbjct  651   LFWEEDYELLETCVCVLNKTSRKKCSRFAAKSQVAV  686



>ref|XP_007225679.1| hypothetical protein PRUPE_ppa002847mg [Prunus persica]
 gb|AFI57906.1| alkaline/neutral invertase C [Prunus persica]
 gb|EMJ26878.1| hypothetical protein PRUPE_ppa002847mg [Prunus persica]
Length=628

 Score =   943 bits (2438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/689 (69%), Positives = 536/689 (78%), Gaps = 65/689 (9%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRIL---GSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgg  2520
             M S +CIGI TM+PC RIL   GS + S+F  P               Q K+ D+     
Sbjct  1     MSSSNCIGIYTMRPCCRILMGYGSRSSSVFGSP---------------QPKLNDIVTH--  43

Query  2519  gryrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMR  2340
                        L+++ +  +   C S   G+                             
Sbjct  44    ----------NLSKLQSRRQKRSCNSQIVGN-----------------------------  64

Query  2339  SHSTSTEAQVNDK-SFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDST  2163
              HSTS E QVN K SF+  YIQGG+NVKPLVIE+ ET    V    +++  RVE+ + S 
Sbjct  65    -HSTSVETQVNGKTSFESIYIQGGLNVKPLVIEKIETDHGDVV---REEESRVEV-NGSN  119

Query  2162  VNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
             VN N  N   ++    ERE+S++EKEAW LL+ +VV+YCG PVGT+AA DPADK PLNYD
Sbjct  120   VNVNIGNSKGLNDTKDERELSDIEKEAWSLLRDSVVSYCGNPVGTLAATDPADKTPLNYD  179

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             QVFIRDF+PSALAFLLNGE +IVKNFLLHTLQLQSWEKTVDC+SPGQGLMPASFKV+T+P
Sbjct  180   QVFIRDFVPSALAFLLNGEADIVKNFLLHTLQLQSWEKTVDCHSPGQGLMPASFKVKTVP  239

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LDG NGEFE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVD QTGIR
Sbjct  240   LDGMNGEFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDFQTGIR  299

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             L+LNLCL++GFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REMLIVND T
Sbjct  300   LVLNLCLKNGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDGT  359

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
             K LVAAINNRLSALSFH+REYYWVDMKKINEIYRYKTEEYS DA+NKFNIYPDQIP W+V
Sbjct  360   KDLVAAINNRLSALSFHMREYYWVDMKKINEIYRYKTEEYSTDAVNKFNIYPDQIPSWLV  419

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
             +WIPE GG+L+GNLQPAHMDFRFFTLGNLW+I+SSLGTH+QN+ ILN IE KWDD +AQM
Sbjct  420   DWIPEEGGFLIGNLQPAHMDFRFFTLGNLWSIVSSLGTHKQNEDILNLIEAKWDDFVAQM  479

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVA  903
             PLKICYPALE E+WRIITG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ ELA KAV 
Sbjct  480   PLKICYPALEYEEWRIITGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRTELAQKAVD  539

Query  902   VAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDY  723
             +AE+RL  DQWPEYYDT+ GRFIGKQ+RL QTWT+AGYLTSKMLL+NP+ ASLL+W EDY
Sbjct  540   LAEKRLSADQWPEYYDTKSGRFIGKQSRLFQTWTIAGYLTSKMLLENPEKASLLLWEEDY  599

Query  722   ELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             ELLE CVC L   GR+KCSR   +SQ+ V
Sbjct  600   ELLETCVCALTKTGRKKCSRLAAKSQIVV  628



>gb|AGX27472.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27473.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27474.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27475.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27476.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27477.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27478.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27479.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27480.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27481.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27482.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27483.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27484.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27485.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27486.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27487.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27488.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27489.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27490.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27491.1| plant neutral invertase, partial [Populus angustifolia]
Length=555

 Score =   935 bits (2417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/574 (79%), Positives = 499/574 (87%), Gaps = 19/574 (3%)
 Frame = -3

Query  2357  VASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEI  2178
             VASD+R+HSTS E  VN K F+  YIQGG+NVKPLVIE+ ET         + D  + E 
Sbjct  1     VASDIRNHSTSVEGHVNTKGFESIYIQGGLNVKPLVIEKIET---------ESDVAK-EG  50

Query  2177  TDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKL  1998
              ++++ N+ ++NGS         EVS++EKEAW+LL+G +VNYCG PVGTVAANDPAD+ 
Sbjct  51    KEETSSNRVEINGS---------EVSKIEKEAWQLLRGTIVNYCGNPVGTVAANDPADRQ  101

Query  1997  PLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFK  1818
             PLNYDQVFIRDF+PSALAFLLNGE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFK
Sbjct  102   PLNYDQVFIRDFVPSALAFLLNGEMEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFK  161

Query  1817  VRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDV  1638
             V+T+PLDG +G FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDV
Sbjct  162   VKTVPLDGSDGGFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDV  221

Query  1637  QTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLI  1458
             QTGIRL LNLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC REMLI
Sbjct  222   QTGIRLGLNLCLSDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMLI  281

Query  1457  VNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQI  1278
             VND TK+LVAAINNRL ALSFHIREYYWVDM+KINEIYRY TEEYS DA+NKFNIYPDQI
Sbjct  282   VNDETKNLVAAINNRLCALSFHIREYYWVDMRKINEIYRYNTEEYSTDAVNKFNIYPDQI  341

Query  1277  PPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDD  1098
             P W+V+WIPE GGYL+GNLQPAHMDFRFFTLGNLWAI+SSLGT +QN+ ILN IE +WDD
Sbjct  342   PSWLVDWIPEEGGYLIGNLQPAHMDFRFFTLGNLWAIVSSLGTSKQNEGILNLIEARWDD  401

Query  1097  LIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELA  918
             L+  MPLKICYPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELA
Sbjct  402   LMGHMPLKICYPALEYEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELA  461

Query  917   MKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLV  738
              KAVA+AE RL +D+WPEYYDTR GRFIGKQ+RL QTWT++G+LTSKMLL+NPD ASLL 
Sbjct  462   QKAVALAETRLSMDEWPEYYDTRSGRFIGKQSRLFQTWTISGFLTSKMLLENPDKASLLF  521

Query  737   WNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
               EDYELLE CVC L   GR+KCSRF  RSQ+ V
Sbjct  522   LEEDYELLEICVCALSKTGRKKCSRFAARSQILV  555



>gb|KDP23366.1| hypothetical protein JCGZ_23199 [Jatropha curcas]
Length=678

 Score =   933 bits (2412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/681 (68%), Positives = 546/681 (80%), Gaps = 17/681 (2%)
 Frame = -3

Query  2663  STMKP-CSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggryrhrHSVVT  2487
             STMKP C  +L   +  IF Y   +    +  NLS++   +            +   ++ 
Sbjct  10    STMKPSCRFLLTRKSPGIFRYV--KYQHTLTANLSRNHLNLDH----NKRFSTYPSRILG  63

Query  2486  LTRVINSNRCAFCGSGSNGDQHR---DSFCNWLGRSK-NRLVFVVPKVASDMRSHSTSTE  2319
                + N+ +  FC   +N  Q R    S C    R + NR + V+  VAS+++ +STS E
Sbjct  64    FRSITNNTQRYFCIPDNNFTQSRLISGSACGPCARRRTNRGISVITSVASEVKKYSTSVE  123

Query  2318  AQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNG  2139
              +VNDK+F++ Y+Q G+ VKP+V+E+ +  E+VV     + G  + + DD      D+ G
Sbjct  124   TRVNDKNFERIYVQSGIGVKPVVVEKIDIDENVVGEEASRIG--IVVPDDDVNVLEDVKG  181

Query  2138  SSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFI  1959
               I  ++P RE S++EKEAWKLL  AVV YCG PVGTVAANDP DK PLNYDQVFIRDF+
Sbjct  182   VEI--VSPRREESDIEKEAWKLLNDAVVTYCGSPVGTVAANDPGDKQPLNYDQVFIRDFV  239

Query  1958  PSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEF  1779
             PSALAFLL GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+PLD  + +F
Sbjct  240   PSALAFLLRGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLD--DNKF  297

Query  1778  EDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLR  1599
             E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY+LQERVDVQTGI+LILNLCL 
Sbjct  298   EEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYSLQERVDVQTGIKLILNLCLT  357

Query  1598  DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAIN  1419
             DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML VND +++LV AIN
Sbjct  358   DGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVNDGSRNLVRAIN  417

Query  1418  NRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGG  1239
             NRLSALSFHIREYYWVD+KKINEIYRYKTEEYSMDA NKFNIYP+QIP W+++WIPE GG
Sbjct  418   NRLSALSFHIREYYWVDIKKINEIYRYKTEEYSMDATNKFNIYPEQIPSWLMDWIPEEGG  477

Query  1238  YLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPA  1059
             YL+GNLQPAHMDFRFFTLGNLW++ISSLGT +QNK+ILN IE KWDDL+ +MP+KICYPA
Sbjct  478   YLIGNLQPAHMDFRFFTLGNLWSVISSLGTPKQNKAILNLIEAKWDDLVGRMPMKICYPA  537

Query  1058  LEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPV  879
             LE EDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ ELA KAVA+AEERL V
Sbjct  538   LEHEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRFELAQKAVALAEERLSV  597

Query  878   DQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVC  699
             D+WPEYYDTR G+FIGKQ+RL+QTWT+AG+LTSK+LL+NP+ ASLL+W EDYELLE CVC
Sbjct  598   DRWPEYYDTRTGKFIGKQSRLHQTWTIAGFLTSKVLLENPEKASLLLWEEDYELLEICVC  657

Query  698   GLKYNGRRKCSRFGVRSQVGV  636
              L   GR+KCSR   +SQ+ V
Sbjct  658   ALSKTGRKKCSRGAAKSQILV  678



>emb|CDP15231.1| unnamed protein product [Coffea canephora]
Length=671

 Score =   925 bits (2391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/683 (68%), Positives = 546/683 (80%), Gaps = 19/683 (3%)
 Frame = -3

Query  2672  IGISTMKPCSRILGSYNHSIFW-YPFGRCNRQVMDNLSKSQQKIKDVhrmgggryrhrHS  2496
             I   TMKPC R+L S   S F   P  + ++    N S  Q                +  
Sbjct  4     INFMTMKPCCRVLISRKISPFLGIPLPKSHQFFAPNSSAFQ-------FNHSLHTAPKTR  56

Query  2495  VVTLTRVINSNRCAFCGSGSNGDQHR--DSFCNWLGRSKNRLVFVVPKVASDMRSHSTST  2322
             +V L  ++  N+  F    S   Q R   S C   G+  +R ++V+ +VAS +R++STS 
Sbjct  57    IVNLQSILKENQQPFFAPSSTRGQSRIFSSSC-LCGKLSHRGLYVIARVAS-VRNYSTSV  114

Query  2321  EAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLN  2142
             E +VNDK+F++ Y+QGG+NVKPLV+E+ +  E++V      +   V++ +DS  +K+   
Sbjct  115   ETRVNDKNFERIYVQGGLNVKPLVVEKIDLDENIV----SNEEPNVKVGEDSLDDKSSDG  170

Query  2141  GSSISKLAP-EREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRD  1965
              SS+  +    RE SEV+KEAW+LL+ AVV+YCG PVGT+AANDP DKLPLNYDQVFIRD
Sbjct  171   LSSVEAVKNVGREQSEVDKEAWRLLENAVVSYCGSPVGTLAANDPNDKLPLNYDQVFIRD  230

Query  1964  FIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNG  1785
             F+PSALAFLL G+ EIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+PLD    
Sbjct  231   FVPSALAFLLKGDSEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLD--EN  288

Query  1784  EFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLC  1605
             +FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGI+LILNLC
Sbjct  289   KFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIKLILNLC  348

Query  1604  LRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAA  1425
             L DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML V+D +K+L+ A
Sbjct  349   LSDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLRVDDGSKNLIRA  408

Query  1424  INNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPET  1245
             INNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS +A NKFNIYP+QIP W+++WIPE 
Sbjct  409   INNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTEATNKFNIYPEQIPHWLMDWIPEK  468

Query  1244  GGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICY  1065
             GGYL+GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN++ILN IE KWDDL+  MPLKICY
Sbjct  469   GGYLIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILNLIEAKWDDLVGLMPLKICY  528

Query  1064  PALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERL  885
             PALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLAC+KMG+ +LA KAV +AE RL
Sbjct  529   PALESEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACMKMGRMDLAKKAVDLAETRL  588

Query  884   PVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENC  705
             P D+WPEYYDTR+G+F+GKQARL QTWT+AGYLTSKMLL+NP+MASLL W EDY+LLE C
Sbjct  589   PADRWPEYYDTRYGKFVGKQARLYQTWTIAGYLTSKMLLENPEMASLLFWEEDYDLLEIC  648

Query  704   VCGLKYNGRRKCSRFGVRSQVGV  636
             VC L  +GR+KCSR   +SQ+ V
Sbjct  649   VCALSKSGRKKCSRGAAKSQILV  671



>ref|XP_010546951.1| PREDICTED: LOW QUALITY PROTEIN: alkaline/neutral invertase CINV2 
[Tarenaya hassleriana]
Length=659

 Score =   925 bits (2390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/678 (68%), Positives = 529/678 (78%), Gaps = 26/678 (4%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFG-RCNRQVMDNLSKSQQKIKDVhrmgggr  2514
             M +RSC+ I TMKPC RIL +Y  S     FG R     + N SK      D        
Sbjct  1     MNTRSCVCICTMKPCCRILINYGSSSL---FGIRARNSSIFNSSKLHCTKVDSRGCRSRI  57

Query  2513  yrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSH  2334
             +        L   I  +R AFC S     + R         S+ R V V+P+VASD R+H
Sbjct  58    HCRG----GLAPRIVQDRKAFCVSDPGWGRSR--VYRDFNSSRGRGVLVIPRVASDYRNH  111

Query  2333  STSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNK  2154
             STS +  VNDKSF++ YIQGG+N++PLV  +    +++ +   + D G V+++D      
Sbjct  112   STSLDHHVNDKSFERIYIQGGLNLEPLVFRKLGKPDEIAKEEGEGDVGAVDVSD------  165

Query  2153  NDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVF  1974
                      +LA +   ++ EKEAW+LL+ AVVNYCG+PVGTVAANDP DK PLNYDQVF
Sbjct  166   -------TKQLASQ---TKSEKEAWELLRSAVVNYCGFPVGTVAANDPGDKQPLNYDQVF  215

Query  1973  IRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDG  1794
             IRDF+PSALAFLL+GEGEIV+NFLLHTLQLQSWEKTVDC+SPG GLMPASFKV+ +PL+G
Sbjct  216   IRDFVPSALAFLLDGEGEIVRNFLLHTLQLQSWEKTVDCHSPGPGLMPASFKVKYVPLEG  275

Query  1793  RNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLIL  1614
              +G FE+VLDPDFGESAIGRV+PVDSGLWWIILLRAY K+TGDY LQERVDVQTGIRLIL
Sbjct  276   SDGLFEEVLDPDFGESAIGRVSPVDSGLWWIILLRAYGKLTGDYALQERVDVQTGIRLIL  335

Query  1613  NLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSL  1434
             NLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC REML VND TKSL
Sbjct  336   NLCLSDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMLNVNDGTKSL  395

Query  1433  VAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWI  1254
             VAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DAINKFNIYPDQIP W+V+W 
Sbjct  396   VAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPSWLVDWF  455

Query  1253  PETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLK  1074
             P  GGY +GNLQPAHMDFRFF LGNLWAI+SSLGT +QN+ I+N IE KWDDL+A MPLK
Sbjct  456   PNEGGYFIGNLQPAHMDFRFFMLGNLWAIVSSLGTRQQNEGIMNLIEEKWDDLVANMPLK  515

Query  1073  ICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAE  894
             IC+PALE ++WRIITG DPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELA +AVA AE
Sbjct  516   ICFPALEQDEWRIITGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELARRAVAKAE  575

Query  893   ERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELL  714
              RL  D+WPEYYDTR G F+GKQ+RL+QTWT+AG+L SK LL+ P+ A+LL W EDY+LL
Sbjct  576   ARLASDRWPEYYDTRSGXFVGKQSRLHQTWTIAGFLASKKLLEQPEKAALLFWEEDYQLL  635

Query  713   ENCVCGLKYNGRRKCSRF  660
             E CVCGL   GR+KCSRF
Sbjct  636   ETCVCGLGRTGRKKCSRF  653



>gb|KEH32364.1| alkaline/neutral invertase [Medicago truncatula]
Length=667

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/692 (67%), Positives = 536/692 (77%), Gaps = 32/692 (5%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M + S IGISTMKPC RIL        +      +  +M  LS+S               
Sbjct  1     MTTGSYIGISTMKPCCRILTKTPLISGFSSIKFSDSTMMSILSRSS--CSRSIHSYRYYR  58

Query  2510  rhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSHS  2331
              +   ++    V   NR  F  + SN  Q R+         + R+  ++P V SD R+ S
Sbjct  59    CNNTKILGYINVNGLNRSDFSVTDSNWVQSRNF--------RPRVGSLIPNVTSDFRNQS  110

Query  2330  TSTEAQVN---DKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTV  2160
             TS ++  N   DKSF+  +IQ  +N KPL+ +R ET           D  +VE  D S+V
Sbjct  111   TSVDSNSNVNNDKSFENIFIQSTLNPKPLLFDRIET----------DDQSKVEEVDKSSV  160

Query  2159  NKN----DLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPL  1992
             N +    DLN + +     E ++S++E+EAWK L+GAVV YC  PVGTVAANDP +K PL
Sbjct  161   NLDNKSYDLNENKV-----EDKLSKIEEEAWKFLRGAVVTYCSNPVGTVAANDPDEKQPL  215

Query  1991  NYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR  1812
             NYDQVFIRDF+PSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR
Sbjct  216   NYDQVFIRDFVPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR  275

Query  1811  TMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQT  1632
             T+PLDG N  FEDV DPDFGESAIGRVAPVDSGLWWIILLRAY K+TGDY+LQ+RVDVQT
Sbjct  276   TVPLDGSNEAFEDVSDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYSLQDRVDVQT  335

Query  1631  GIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVN  1452
             GIRLIL LCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REMLIVN
Sbjct  336   GIRLILKLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVN  395

Query  1451  DSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPP  1272
             D+T+ LVAA++NRLSALSFH+REYYWVD+KKINEIYRYKTEEYS DA+NKFNIYP+QIP 
Sbjct  396   DTTRDLVAAVSNRLSALSFHMREYYWVDIKKINEIYRYKTEEYSTDAVNKFNIYPEQIPS  455

Query  1271  WIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLI  1092
             W+V+WI E GGY +GNLQPAHMDFRFFTLGNLWAI+SSLGT  QN+ ILN I+ KWDD+I
Sbjct  456   WLVDWISEEGGYFIGNLQPAHMDFRFFTLGNLWAIVSSLGTTRQNEGILNLIDAKWDDII  515

Query  1091  AQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMK  912
              QMPLKICYPALEGE+W IITG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ +LA K
Sbjct  516   GQMPLKICYPALEGEEWCIITGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRSDLAQK  575

Query  911   AVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWN  732
             AV +AE+RL VD+WPEYYDTR+G+FIGKQ+RL QTWT+AG+LTSKMLLKNPD ASLL W 
Sbjct  576   AVGLAEKRLCVDKWPEYYDTRNGKFIGKQSRLMQTWTIAGFLTSKMLLKNPDKASLLFWE  635

Query  731   EDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             ED+E+L+NCVC L   GRRKCSRF  RS++ V
Sbjct  636   EDFEILQNCVCMLNKTGRRKCSRFAARSKILV  667



>gb|AHA82519.1| neutral/alkaline invertase [Manihot esculenta]
Length=679

 Score =   924 bits (2387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/691 (67%), Positives = 545/691 (79%), Gaps = 18/691 (3%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             MV+   I   TMKP  R L +   S+  + F +C+  +  NL+++    K          
Sbjct  1     MVTLGFIRNYTMKPSCRFLMT-RKSLGIFGFAKCHHSLTSNLARNHVHKKQFSAYPL---  56

Query  2510  rhrHSVVTLTRVINSNRCAFCGSGSNGDQHRD----SFCNWLGRSKNRLVFVVPKVASDM  2343
                  +      IN  +  FC   +N  Q R      + +   R  +R   VV   AS++
Sbjct  57    ----RIFGFGSAINDTQKIFCIPKTNFGQPRFISVFPYGDCTRRRASRGFSVVSSFASEV  112

Query  2342  RSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDD-S  2166
             + +STS E +VNDK+F++ Y+Q G+ VKPLV+E+ +  E+VV     + G  + + D+  
Sbjct  113   KGYSTSVETRVNDKNFERIYVQNGIGVKPLVVEKIDKDENVVGEEASRIG--IAVPDEGE  170

Query  2165  TVNKNDLNGSSISKLA-PEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLN  1989
              VN  ++ G    ++A P+R  S++EKEAWKLL  A+V+YCG PVGTVAANDP DK PLN
Sbjct  171   NVNAENVEGVKGVEIAGPKRVESDIEKEAWKLLNDAIVSYCGSPVGTVAANDPGDKQPLN  230

Query  1988  YDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT  1809
             YDQVFIRDF+PSALAFLL GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT
Sbjct  231   YDQVFIRDFVPSALAFLLRGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT  290

Query  1808  MPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTG  1629
             +PLDG   +FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGD TLQERVDVQ G
Sbjct  291   VPLDG--NKFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDCTLQERVDVQMG  348

Query  1628  IRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVND  1449
             I+LILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML VND
Sbjct  349   IKLILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVND  408

Query  1448  STKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPW  1269
              +K+LV A+NNRLSALSFHIREYYWVD+KKINEIYRYKTEEYS+DA NKFNIYP+QIP W
Sbjct  409   GSKNLVRAVNNRLSALSFHIREYYWVDIKKINEIYRYKTEEYSLDATNKFNIYPEQIPSW  468

Query  1268  IVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIA  1089
             +++WIPE GGYL+GNLQPAHMD RFFTLGNLW++ISSLGT +QNK+ILN IE KWDD++ 
Sbjct  469   LMDWIPEEGGYLIGNLQPAHMDLRFFTLGNLWSVISSLGTPKQNKAILNLIEAKWDDIVG  528

Query  1088  QMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKA  909
             +MPLKICYPA+E EDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ ELA KA
Sbjct  529   RMPLKICYPAIEDEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRLELAQKA  588

Query  908   VAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNE  729
             VA+AE+RL VD+WPEYYDTR G+FIGKQ+RL QTWT+AG+LTSK+LL+NP MAS+L+W E
Sbjct  589   VALAEKRLAVDRWPEYYDTRTGKFIGKQSRLYQTWTIAGFLTSKVLLENPRMASMLLWEE  648

Query  728   DYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             DYELLE CVCGL   GR+KCSR   +SQ+ V
Sbjct  649   DYELLEICVCGLSKTGRKKCSRGAAKSQILV  679



>ref|XP_011023805.1| PREDICTED: alkaline/neutral invertase CINV1-like [Populus euphratica]
Length=671

 Score =   922 bits (2382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/689 (67%), Positives = 548/689 (80%), Gaps = 22/689 (3%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M + S IG STMKP  R L S  + +F+    + +  ++ NLS +Q       +     +
Sbjct  1     MNTISIIGNSTMKPSCRFLISTKNPVFF----KRHHGLISNLSGNQFNFDKTKQFLTCPF  56

Query  2510  rhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSHS  2331
                  ++    + N +R +F     +  Q R      L    +R V VV  VAS  R  S
Sbjct  57    ----RILGFRTIFNESRKSFWVPSISSGQSR------LIAGDSRGVSVVASVASQFREFS  106

Query  2330  TSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKN  2151
             TS E +VNDK+F++ ++Q G++VKPLV+ER +  E+V+   E + G  V + D  +VN+ 
Sbjct  107   TSVETRVNDKNFERIFVQNGISVKPLVVERIDKDENVLGDEESRLG--VLVDDGESVNRQ  164

Query  2150  DLN-GSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVF  1974
             DL+ G  +  ++ +RE S++EKEAWKLL  AVV YCG PVGTVAANDP DK+PLNYDQVF
Sbjct  165   DLDVGQGVEIVSTKREESDMEKEAWKLLNDAVVMYCGSPVGTVAANDPGDKMPLNYDQVF  224

Query  1973  IRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDG  1794
             +RDF+PSALAFLL GEGEIVKNFLLH LQLQSWEKTVDCYSPGQGLMPASFKVRT+PLD 
Sbjct  225   VRDFVPSALAFLLRGEGEIVKNFLLHALQLQSWEKTVDCYSPGQGLMPASFKVRTVPLD-  283

Query  1793  RNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLIL  1614
              + + E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY K+TGDY LQERVDVQTGI+LIL
Sbjct  284   -DNKLEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYALQERVDVQTGIKLIL  342

Query  1613  NLCLRDGFDMFPTLLVTD---GSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             NLCL DGFDMFP+LLVTD   GSCMIDRRMGIHGHPLEIQALFYSALR +REML+VND +
Sbjct  343   NLCLADGFDMFPSLLVTDVTDGSCMIDRRMGIHGHPLEIQALFYSALRSSREMLVVNDGS  402

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
             K+LV AINNRLSALSFHIREYYWVDM+KINEIYRYKTEEYS +A NKFNIYP+QIP W++
Sbjct  403   KNLVRAINNRLSALSFHIREYYWVDMRKINEIYRYKTEEYSTEATNKFNIYPEQIPSWLM  462

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
             +WIPE GGYL+GNLQPAHMDFRFFTLGNLW+++SSLGT +QN++ILN IE KWDDL+  M
Sbjct  463   DWIPEEGGYLIGNLQPAHMDFRFFTLGNLWSVVSSLGTPKQNEAILNLIESKWDDLVGNM  522

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVA  903
             PLKICYPALE EDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLAC+KMG+ ELA KAVA
Sbjct  523   PLKICYPALESEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACMKMGRMELAQKAVA  582

Query  902   VAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDY  723
             +AE+RL VD WPEYYDTR G+FIGKQ+RL QTWTVAG+LTSK+LL+NP+ AS+L W+EDY
Sbjct  583   LAEKRLQVDHWPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKVLLENPEKASMLFWDEDY  642

Query  722   ELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             +LLE CVCGL  +GR++CSR   RSQ+ V
Sbjct  643   DLLEFCVCGLNTSGRKRCSRVAARSQILV  671



>ref|XP_002277312.2| PREDICTED: alkaline/neutral invertase CINV2 [Vitis vinifera]
Length=673

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/566 (78%), Positives = 496/566 (88%), Gaps = 6/566 (1%)
 Frame = -3

Query  2330  TSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKN  2151
             TS E +VNDK+F+K Y+QGGMNVKPLV+ER +  E +       +  R+E+ D + +N  
Sbjct  113   TSVETRVNDKNFEKIYVQGGMNVKPLVVERIDIDETIE----NNEESRIEV-DGNFLNGE  167

Query  2150  DLNGSSISK-LAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVF  1974
             ++ G   S+ L  +RE SE EKEAWKLLQ +VV YCG P+GT+AANDP DK PLNYDQVF
Sbjct  168   NVKGVDESEVLITKREESEAEKEAWKLLQDSVVMYCGSPIGTMAANDPGDKTPLNYDQVF  227

Query  1973  IRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDG  1794
             IRDF+PSALAFLL GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+PLDG
Sbjct  228   IRDFVPSALAFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDG  287

Query  1793  RNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLIL  1614
              N   E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDYTLQERVDVQTGI+LIL
Sbjct  288   NNEAHEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERVDVQTGIKLIL  347

Query  1613  NLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSL  1434
             NLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML  ND++ +L
Sbjct  348   NLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTQNDASINL  407

Query  1433  VAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWI  1254
             V AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DA NKFNIYPDQIP W+++W+
Sbjct  408   VRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDATNKFNIYPDQIPSWLMDWV  467

Query  1253  PETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLK  1074
             PE GGYL+GNLQPAHMDFRFFTLGNLW+IISSLGT +QN+ IL+ I+ KWDDL+  MPLK
Sbjct  468   PEEGGYLIGNLQPAHMDFRFFTLGNLWSIISSLGTPKQNQGILDTIQAKWDDLVGHMPLK  527

Query  1073  ICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAE  894
             ICYPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+PELA KAVA AE
Sbjct  528   ICYPALEYEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARKAVADAE  587

Query  893   ERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELL  714
             +RL VD+WPEYYDTR+GRFIGKQ+RL QTWT+AGYLTSKMLL+NP+MA+LL W EDY+LL
Sbjct  588   KRLAVDRWPEYYDTRNGRFIGKQSRLFQTWTIAGYLTSKMLLENPEMAALLFWEEDYDLL  647

Query  713   ENCVCGLKYNGRRKCSRFGVRSQVGV  636
             E CVCGL   GRRKCSRF  RSQ+ V
Sbjct  648   EICVCGLSKTGRRKCSRFAARSQILV  673



>ref|XP_010667189.1| PREDICTED: alkaline/neutral invertase CINV2-like [Beta vulgaris 
subsp. vulgaris]
Length=682

 Score =   919 bits (2376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/693 (69%), Positives = 553/693 (80%), Gaps = 25/693 (4%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSR-ILGSYNHSIFWYPFGRCNRQ-VMDNLSKSQQKIKDVhrmggg  2517
             M + S IG+STMKPC R ++ S N  IF     R +R  V+ N S +++  +  HR+   
Sbjct  1     MSTGSSIGVSTMKPCCRALISSRNPFIF-----RVSRNSVVINDSSTKRCYRPNHRLRWY  55

Query  2516  ryrhrHSVVTLTRVIN-SNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMR  2340
             RY H  S V   +  N SNR  F  SGSN  + R  F    G  + R V V+  VASD+R
Sbjct  56    RYDHCTSNVVGNKCRNDSNRRGFYDSGSNSGRAR-VFKRCRGNDRGRGVSVIVNVASDVR  114

Query  2339  SHSTSTEA-----QVNDKSFKKFYIQGGMNV--KPLviertetredvvetyEQK-DGGRV  2184
              HSTS  +     +VN KSF ++YIQGG+NV  KPLVIE+ E    +    ++K D  R+
Sbjct  115   DHSTSLPSSLCGSRVNGKSFGRYYIQGGVNVDLKPLVIEKIEDDAGLGVEEKEKEDRNRI  174

Query  2183  EITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPAD  2004
                    VNKND +   +S    ER++SE+E+EAW+LL+ ++VNYCG PVGTVAAND +D
Sbjct  175   ------GVNKNDTDEVEVS--PHERKLSEIEEEAWELLRSSIVNYCGNPVGTVAANDLSD  226

Query  2003  KLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPAS  1824
                LNYDQVFIRDF+PSALAFLLNGEG+IVKNFLLHTLQLQSWEKTVDCYSPGQGLMPAS
Sbjct  227   NQQLNYDQVFIRDFVPSALAFLLNGEGDIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPAS  286

Query  1823  FKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERV  1644
             FKVR +PLDG+ G F++VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY++QERV
Sbjct  287   FKVRPVPLDGKEGAFKEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYSVQERV  346

Query  1643  DVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREM  1464
             DVQTGIRLILNLCL +GFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+ EM
Sbjct  347   DVQTGIRLILNLCLTNGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSLEM  406

Query  1463  LIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPD  1284
             L VND TK+LVA INNRLSALSFHIRE+YWVD+KK+NEIYRY TEEYS DAINKFNIYP+
Sbjct  407   LAVNDGTKNLVATINNRLSALSFHIREHYWVDIKKLNEIYRYNTEEYSTDAINKFNIYPE  466

Query  1283  QIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKW  1104
             QIP W+ +WIPE GGYL+GNLQPAHMDFRFFTLGNLW+IISSLGT +QNKS+LN IE KW
Sbjct  467   QIPSWLGDWIPEHGGYLIGNLQPAHMDFRFFTLGNLWSIISSLGTPQQNKSVLNLIEAKW  526

Query  1103  DDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPE  924
             DDL+A MPLKICYPALE E+WRIITG DPKNTPWSYHNGGSWPTLLWQFTLACIKM +PE
Sbjct  527   DDLVADMPLKICYPALESEEWRIITGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMKRPE  586

Query  923   LAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASL  744
             LA KA+A+AE+RL VD+WPEYYDT+ GRFIGKQARL QTWTVAGYLTSK+LL+ PD AS 
Sbjct  587   LAEKAIALAEKRLSVDKWPEYYDTKKGRFIGKQARLFQTWTVAGYLTSKLLLEKPDAASA  646

Query  743   LVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQ  645
             L+++EDYELLE CVC L   GR+KCS    R Q
Sbjct  647   LIFDEDYELLEICVCSLSKGGRKKCSPGVTRRQ  679



>ref|XP_011038960.1| PREDICTED: alkaline/neutral invertase CINV2-like [Populus euphratica]
Length=657

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/675 (67%), Positives = 536/675 (79%), Gaps = 19/675 (3%)
 Frame = -3

Query  2657  MKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggryrhrHSVVTLTR  2478
             M+P  R   S  + +F+    + +  +  NLS +Q               +   ++    
Sbjct  1     MRPSCRFFLSKKNRVFF----KLHHSLTSNLSGNQFNFDK----NKQFLTYPFRILGSRT  52

Query  2477  VINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSHSTSTEAQVNDKS  2298
             + N  + +FC    +  Q R      L     R V VV  VAS +R  STS E +VND +
Sbjct  53    IFNEAQKSFCAPYISFGQSR------LITRDFRRVSVVASVASQVRKFSTSVETRVNDNN  106

Query  2297  FKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNG-SSISKL  2121
             F++ Y+Q G+ +KPLV+ER +  E+V+    ++ G  + + D  +VN+ +L+G   +  +
Sbjct  107   FERIYVQNGIGIKPLVVERIDKDENVLGD--EESGIGMLVDDCESVNRENLDGGQEVEIV  164

Query  2120  APEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAF  1941
             +P+RE SE+EKEAWKLL  AVV YCG PVGTVAANDP DK+PLNYDQVFIRDF+PSALAF
Sbjct  165   SPKREESEIEKEAWKLLNDAVVMYCGSPVGTVAANDPGDKMPLNYDQVFIRDFVPSALAF  224

Query  1940  LLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDP  1761
             LL GEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+P+D  + +FE+VLDP
Sbjct  225   LLRGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPID--DCKFEEVLDP  282

Query  1760  DFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMF  1581
             DFGESAIGRVAPVDSGLWWIILLRAY K+TGDY LQERVDVQTGI+LILNLCL DGFDMF
Sbjct  283   DFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYALQERVDVQTGIKLILNLCLTDGFDMF  342

Query  1580  PTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSAL  1401
             P+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REM++VND +K+LV AINNRLSAL
Sbjct  343   PSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMIVVNDGSKNLVRAINNRLSAL  402

Query  1400  SFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNL  1221
             SFHIREYYWVDM KINEIYRYKTEEYS +A NKFNIYP+QIP W+++WIPE GGYL+GNL
Sbjct  403   SFHIREYYWVDMNKINEIYRYKTEEYSTEATNKFNIYPEQIPSWLMDWIPEEGGYLIGNL  462

Query  1220  QPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDW  1041
             QPAHMDFRFFTLGNLW+++SSLGT + N++ILN IE KWDDL+  MPLKICYPALE EDW
Sbjct  463   QPAHMDFRFFTLGNLWSVLSSLGTPKHNEAILNLIEAKWDDLVGNMPLKICYPALEHEDW  522

Query  1040  RIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEY  861
             RIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKM + ELA KA+A+AE+RL VD WPEY
Sbjct  523   RIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMNRVELAQKAIALAEKRLQVDHWPEY  582

Query  860   YDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNG  681
             YDTRHG+FIGKQ+RL QTWTVAG+LTSK LL+NP  ASLL W+EDYELLE CVCGL  +G
Sbjct  583   YDTRHGKFIGKQSRLYQTWTVAGFLTSKTLLENPHRASLLFWDEDYELLEICVCGLNTSG  642

Query  680   RRKCSRFGVRSQVGV  636
             R++CSR   +SQ+ V
Sbjct  643   RKRCSRGAAKSQILV  657



>ref|XP_002318940.2| hypothetical protein POPTR_0013s00800g [Populus trichocarpa]
 gb|EEE94863.2| hypothetical protein POPTR_0013s00800g [Populus trichocarpa]
Length=668

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/686 (67%), Positives = 543/686 (79%), Gaps = 19/686 (3%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M + S IG STMKP  R L S  + +F+    + +  +  NLS +Q       +     +
Sbjct  1     MNTISIIGNSTMKPSCRFLISTKNPVFF----KRHHSLTSNLSGNQFNFDKTKQFLTCSF  56

Query  2510  rhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSHS  2331
                  ++    + N +R +FC       Q R      L    +R V VV  VAS  R  S
Sbjct  57    ----RILGFKTIFNESRKSFCVPNIRSGQSR------LIARDSRAVSVVASVASQFREFS  106

Query  2330  TSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKN  2151
             TS E +VNDK+F++ + Q G++VKPLV+ER +  E V+   E + G  V + D  +VN+ 
Sbjct  107   TSVETRVNDKNFERIFAQNGISVKPLVVERIDKDEHVLGDEESRLG--VLVDDGESVNRE  164

Query  2150  DLNGSS-ISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVF  1974
             DL+G   +  ++ +RE S++EKEAWKLL  AVV YCG PVGTVAANDP DK+PLNYDQVF
Sbjct  165   DLDGGQGVEIVSTKREESDIEKEAWKLLNDAVVMYCGSPVGTVAANDPGDKMPLNYDQVF  224

Query  1973  IRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDG  1794
             +RDF+PSALAFLL GEGEIVKNFLLH LQLQSWEKTVDCYSPGQGLMPASFKVRT+PLD 
Sbjct  225   VRDFVPSALAFLLRGEGEIVKNFLLHALQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDD  284

Query  1793  RNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLIL  1614
              N   E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY K+TGDY LQERVDVQTGI+LIL
Sbjct  285   NN--LEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYALQERVDVQTGIKLIL  342

Query  1613  NLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSL  1434
             NLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALR +REML+VND +K+L
Sbjct  343   NLCLADGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRSSREMLVVNDGSKNL  402

Query  1433  VAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWI  1254
             V AINNRLSALSFHIREYYWVDM+KINEIYRYKTEEYS +A NKFNIYP+QIP W+++WI
Sbjct  403   VRAINNRLSALSFHIREYYWVDMRKINEIYRYKTEEYSTEATNKFNIYPEQIPSWLMDWI  462

Query  1253  PETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLK  1074
             PE GGYL+GNLQPAHMDFRFFTLGNLW+++SSLGT +QN+++LN IE KWDDL+  MPLK
Sbjct  463   PEEGGYLIGNLQPAHMDFRFFTLGNLWSVVSSLGTPKQNEAVLNLIESKWDDLVGNMPLK  522

Query  1073  ICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAE  894
             ICYPALE EDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLAC+KM + ELA KA+A+AE
Sbjct  523   ICYPALESEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACMKMDRMELAQKAIALAE  582

Query  893   ERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELL  714
             +RL VD WPEYYDTR G+FIGKQ+RL QTWTVAG+LTSK+LL+NP+ ASLL W+EDY+LL
Sbjct  583   KRLQVDHWPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKVLLENPEKASLLFWDEDYDLL  642

Query  713   ENCVCGLKYNGRRKCSRFGVRSQVGV  636
             E CVCGL  +GR++CSR   RSQ+ V
Sbjct  643   EFCVCGLNTSGRKRCSRVAARSQILV  668



>gb|KGN61014.1| hypothetical protein Csa_2G034660 [Cucumis sativus]
Length=677

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/582 (75%), Positives = 506/582 (87%), Gaps = 10/582 (2%)
 Frame = -3

Query  2375  VFVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKD  2196
             V ++ ++AS +R  STS E +VND +F++ Y+QGG+N KPLV+E+ +  E++V     ++
Sbjct  104   VSIIARIASKVRDFSTSIETRVNDNNFERIYVQGGLNAKPLVVEKIDKDENIVG----EE  159

Query  2195  GGRVEITDDSTVNKN--DLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVA  2022
               R+E+  +    +N  DLN + +  +  +RE S++EKEAW+LL+ AVV YCG PVGT+A
Sbjct  160   DSRIEVGSEHVNGENLEDLNKAKV--ITSKREESDIEKEAWRLLREAVVTYCGSPVGTMA  217

Query  2021  ANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQ  1842
             ANDPADK PLNYDQVFIRDFIPSALAFLLNGEGEIV+NFLLHTLQLQSWEKTVDCYSPGQ
Sbjct  218   ANDPADKQPLNYDQVFIRDFIPSALAFLLNGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQ  277

Query  1841  GLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDY  1662
             GLMPASFKVRT+PLDG N  FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY
Sbjct  278   GLMPASFKVRTVPLDGNN--FEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDY  335

Query  1661  TLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL  1482
              LQ+RVDVQTG+++ILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL
Sbjct  336   ALQDRVDVQTGLKMILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL  395

Query  1481  RCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINK  1302
             RC+REML VND +K+LV AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDA NK
Sbjct  396   RCSREMLTVNDGSKNLVRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDATNK  455

Query  1301  FNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILN  1122
             FNIYPDQIP W+++W+PE GGYL+GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN++ILN
Sbjct  456   FNIYPDQIPQWLMDWVPEEGGYLIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILN  515

Query  1121  FIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACI  942
              IE KW DL+  MPLKICYPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACI
Sbjct  516   LIEAKWGDLVGHMPLKICYPALEYEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACI  575

Query  941   KMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKN  762
             KMG+ E+A KAVAVAE+R+  D+WPEYYDTR G+FIGKQ+RL QTWT+AG+LTSKML++N
Sbjct  576   KMGRFEMAKKAVAVAEKRISNDRWPEYYDTRTGKFIGKQSRLYQTWTIAGFLTSKMLVEN  635

Query  761   PDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             P++AS L W EDYELLE CVC L   GR+KCSR   RSQ+ V
Sbjct  636   PELASSLFWEEDYELLEICVCALSKTGRKKCSRGAARSQILV  677



>emb|CAP59645.1| putative neutral invertase [Vitis vinifera]
Length=674

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/567 (78%), Positives = 496/567 (87%), Gaps = 7/567 (1%)
 Frame = -3

Query  2330  TSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKN  2151
             TS E +VNDK+F+K Y+QGGMNVKPLV+ER +  E +       +  R+E+ D + +N  
Sbjct  113   TSVETRVNDKNFEKIYVQGGMNVKPLVVERIDIDETIE----NNEESRIEV-DGNFLNGE  167

Query  2150  DLNGSSISK-LAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVF  1974
             ++ G   S+ L  +RE SE EKEAWKLLQ +VV YCG P+GT+AANDP DK PLNYDQVF
Sbjct  168   NVKGVDESEVLITKREESEAEKEAWKLLQDSVVMYCGSPIGTMAANDPGDKTPLNYDQVF  227

Query  1973  IRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDG  1794
             IRDF+PSALAFLL GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+PLDG
Sbjct  228   IRDFVPSALAFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDG  287

Query  1793  RNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLIL  1614
              N   E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDYTLQERVDVQTGI+LIL
Sbjct  288   NNEAHEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERVDVQTGIKLIL  347

Query  1613  NLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSL  1434
             NLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML  ND++ +L
Sbjct  348   NLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTQNDASINL  407

Query  1433  VAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWI  1254
             V AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DA NKFNIYPDQIP W+++W+
Sbjct  408   VRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDATNKFNIYPDQIPSWLMDWV  467

Query  1253  PETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLK  1074
             PE GGYL+GNLQPAHMDFRFFTLGNLW+IISSLGT +QN+ IL+ I+ KWDDL+  MPLK
Sbjct  468   PEEGGYLIGNLQPAHMDFRFFTLGNLWSIISSLGTPKQNQGILDTIQAKWDDLVGHMPLK  527

Query  1073  ICYPALEGEDWRIITGSDPKNT-PWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVA  897
             ICYPALE E+WRIITGSDPKNT PWSYHNGGSWPTLLWQFTLACIKMG+PELA KAVA A
Sbjct  528   ICYPALEYEEWRIITGSDPKNTSPWSYHNGGSWPTLLWQFTLACIKMGRPELARKAVADA  587

Query  896   EERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYEL  717
             E+RL VD+WPEYYDTR+GRFIGKQ+RL QTWT+AGYLTSKMLL+NP+MA+LL W EDY+L
Sbjct  588   EKRLAVDRWPEYYDTRNGRFIGKQSRLFQTWTIAGYLTSKMLLENPEMAALLFWEEDYDL  647

Query  716   LENCVCGLKYNGRRKCSRFGVRSQVGV  636
             LE CVCGL   GRRKCSRF  RSQ+ V
Sbjct  648   LEICVCGLSKTGRRKCSRFAARSQILV  674



>ref|XP_009777348.1| PREDICTED: alkaline/neutral invertase CINV2 [Nicotiana sylvestris]
Length=665

 Score =   915 bits (2366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/680 (68%), Positives = 540/680 (79%), Gaps = 19/680 (3%)
 Frame = -3

Query  2672  IGISTMKPCSRIL-GSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggryrhrHS  2496
             + + TMKPC RIL  + ++S    PF + +     N S  +  ++         Y +   
Sbjct  4     MNLITMKPCCRILIATKSNSFLGLPFKKAHNSFSTNSSNFRLNLRQ----KSDFYSYPIR  59

Query  2495  VVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSHSTSTEA  2316
             ++   R+IN  +   C   S   Q R  F   +G SK R    +  VASD R++STS E 
Sbjct  60    ILGSGRIINGKQKLLCVPNSCWGQSR-VFSGPIGASK-RGFHAIASVASDFRNYSTSVET  117

Query  2315  QVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNGS  2136
             +VNDK+F++ Y+QGG+NVKPLV+E+ +  E         DG RV+  +D +V K +  G 
Sbjct  118   RVNDKNFERIYVQGGLNVKPLVVEKIDLDEHAAGV----DGERVK--NDESV-KEEGEGQ  170

Query  2135  SISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIP  1956
                +   E   SE  KEAWKLL+ AVV YCG P+GT+AANDP DKLPLNYDQVFIRDFIP
Sbjct  171   VEVRGGEE---SEAVKEAWKLLENAVVTYCGSPIGTLAANDPNDKLPLNYDQVFIRDFIP  227

Query  1955  SALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFE  1776
             SALAFLL G+ +IVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+PLD  + ++E
Sbjct  228   SALAFLLKGDKDIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLD--DNKYE  285

Query  1775  DVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRD  1596
             +VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGI+LILNLCL D
Sbjct  286   EVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYGLQERVDVQTGIKLILNLCLSD  345

Query  1595  GFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINN  1416
             GFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML +++ +K+LV AINN
Sbjct  346   GFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLSLDEGSKNLVNAINN  405

Query  1415  RLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGY  1236
             RLSALSFHIREYYWVDMKKINEIYRYKTEEYS DA NKFNIYP+QIP W+++WIPE GGY
Sbjct  406   RLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDATNKFNIYPEQIPHWLMDWIPEEGGY  465

Query  1235  LVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPAL  1056
             L+GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN++ILN IE KWDD++  MPLKICYPAL
Sbjct  466   LIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILNLIEAKWDDIVGSMPLKICYPAL  525

Query  1055  EGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVD  876
             E E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKM + +LA KAV +AE+RL VD
Sbjct  526   ENEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMNRTDLAKKAVDLAEKRLRVD  585

Query  875   QWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCG  696
             QWPEYYDTR+G+F GKQARL QTWT+AG+LTSKMLL+NP+MASLL W EDY+LLE CVC 
Sbjct  586   QWPEYYDTRYGKFTGKQARLYQTWTIAGFLTSKMLLENPEMASLLFWEEDYDLLEICVCA  645

Query  695   LKYNGRRKCSRFGVRSQVGV  636
             LK +GR+KCSR   +SQ+ V
Sbjct  646   LKKSGRKKCSRGAAKSQILV  665



>ref|XP_008453273.1| PREDICTED: alkaline/neutral invertase CINV1-like [Cucumis melo]
Length=677

 Score =   915 bits (2366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/594 (74%), Positives = 510/594 (86%), Gaps = 11/594 (2%)
 Frame = -3

Query  2408  CNW-LGRSKNRLVFVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertet  2232
             CN+ +     R V ++  +AS +R  STS E +VND +F++ Y+QGG+NVKPL +E+ + 
Sbjct  92    CNYSIFPKTKRGVSIIAGIASKVRDFSTSIETRVNDNNFERIYVQGGLNVKPLAVEKIDK  151

Query  2231  redvvetyEQKDGGRVEITDDSTVNKN--DLNGSSISKLAPEREVSEVEKEAWKLLQGAV  2058
              E++V     ++  R+E+  +    +N  DLN + I  +  +REVS++EKEAW+LL+ AV
Sbjct  152   DENIVG----EEDSRIEVGGEHVNGENLEDLNKAKI--ITSKREVSDIEKEAWRLLREAV  205

Query  2057  VNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQS  1878
             V YCG PVGT+AANDPADK PLNYDQVFIRDFIPSALAFLLNGEGEIV+NFLLHTLQLQS
Sbjct  206   VTYCGSPVGTMAANDPADKQPLNYDQVFIRDFIPSALAFLLNGEGEIVRNFLLHTLQLQS  265

Query  1877  WEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWII  1698
             WEKTVDCYSPGQGLMPASFKVRT+PLDG N  FE+VLDPDFGESAIGRVAPVDSGLWWII
Sbjct  266   WEKTVDCYSPGQGLMPASFKVRTVPLDGNN--FEEVLDPDFGESAIGRVAPVDSGLWWII  323

Query  1697  LLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGH  1518
             LLRAY KITGDY LQ+RVDVQTG+++ILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGH
Sbjct  324   LLRAYGKITGDYALQDRVDVQTGLKMILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGH  383

Query  1517  PLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRY  1338
             PLEIQALFYSALRC+REML VND +K+LV AINNRLSALSFHIREYYWVDMKKINEIYRY
Sbjct  384   PLEIQALFYSALRCSREMLTVNDGSKNLVRAINNRLSALSFHIREYYWVDMKKINEIYRY  443

Query  1337  KTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISS  1158
             KTEEYSMDA NKFNIYPDQIP W+++W+PE GGYL+GNLQPAHMDFRFFTLGNLW+I+SS
Sbjct  444   KTEEYSMDATNKFNIYPDQIPQWLMDWVPEEGGYLIGNLQPAHMDFRFFTLGNLWSIVSS  503

Query  1157  LGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSW  978
             LGT +QN++ILN IE KW DL+  MPLKICYPALE E+WRIITGSDPKNTPWSYHNGGSW
Sbjct  504   LGTPKQNEAILNLIEAKWGDLVGHMPLKICYPALEYEEWRIITGSDPKNTPWSYHNGGSW  563

Query  977   PTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTV  798
             PTLLWQFTLACIKMG+ E+A KAVAVAE+R+  D+WPEYYDTR G+FIGKQ+RL QTW++
Sbjct  564   PTLLWQFTLACIKMGRLEMAKKAVAVAEKRISGDRWPEYYDTRTGKFIGKQSRLYQTWSI  623

Query  797   AGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             AG+LTSKML++NP++AS L W EDYELLE CVC L   GR+KCSR   RS + V
Sbjct  624   AGFLTSKMLVENPELASSLFWEEDYELLEICVCALSKTGRKKCSRGAARSHILV  677



>emb|CAP59646.1| putative neutral invertase [Vitis vinifera]
Length=674

 Score =   915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/567 (78%), Positives = 495/567 (87%), Gaps = 7/567 (1%)
 Frame = -3

Query  2330  TSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKN  2151
             TS E +VNDK+F+K Y+QGGMNVKPLV+ER +  E +       +  R+E+ D + +N  
Sbjct  113   TSVETRVNDKNFEKIYVQGGMNVKPLVVERIDIDETIE----NNEESRIEV-DGNFLNGE  167

Query  2150  DLNGSSISK-LAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVF  1974
             ++ G   S+ L  +RE SE EKEAWKLLQ +VV YCG P+GT+AANDP DK PLNYDQVF
Sbjct  168   NVKGVDESEVLITKREESEAEKEAWKLLQDSVVMYCGSPIGTMAANDPGDKTPLNYDQVF  227

Query  1973  IRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDG  1794
             IRDF+PSALAFLL GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+PLDG
Sbjct  228   IRDFVPSALAFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDG  287

Query  1793  RNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLIL  1614
              N   E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDYTLQERVDVQTGI+LIL
Sbjct  288   NNEAHEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERVDVQTGIKLIL  347

Query  1613  NLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSL  1434
             NLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML  ND++ +L
Sbjct  348   NLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTQNDASINL  407

Query  1433  VAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWI  1254
             V AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DA NKFNIYPDQIP W+++W+
Sbjct  408   VRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDATNKFNIYPDQIPSWLMDWV  467

Query  1253  PETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLK  1074
             PE GGYL+GNLQPAHMDFRFFTLGNLW+IISSLGT +QN+ IL+ I+ KWDDL+  MPLK
Sbjct  468   PEEGGYLIGNLQPAHMDFRFFTLGNLWSIISSLGTPKQNQGILDTIQAKWDDLVGHMPLK  527

Query  1073  ICYPALEGEDWRIITGSDPKNT-PWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVA  897
             ICYPALE E+W IITGSDPKNT PWSYHNGGSWPTLLWQFTLACIKMG+PELA KAVA A
Sbjct  528   ICYPALEYEEWHIITGSDPKNTSPWSYHNGGSWPTLLWQFTLACIKMGRPELARKAVADA  587

Query  896   EERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYEL  717
             E+RL VD+WPEYYDTR+GRFIGKQ+RL QTWT+AGYLTSKMLL+NP+MA+LL W EDY+L
Sbjct  588   EKRLAVDRWPEYYDTRNGRFIGKQSRLFQTWTIAGYLTSKMLLENPEMAALLFWEEDYDL  647

Query  716   LENCVCGLKYNGRRKCSRFGVRSQVGV  636
             LE CVCGL   GRRKCSRF  RSQ+ V
Sbjct  648   LEICVCGLSKTGRRKCSRFAARSQILV  674



>ref|XP_010024149.1| PREDICTED: alkaline/neutral invertase CINV1 [Eucalyptus grandis]
 gb|KCW60578.1| hypothetical protein EUGRSUZ_H03308 [Eucalyptus grandis]
Length=676

 Score =   914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/629 (72%), Positives = 519/629 (83%), Gaps = 20/629 (3%)
 Frame = -3

Query  2480  RVINSNRCAFCGSGSNGDQHRDSFC---NWLGRSKNRLVFVVPK----------VASDMR  2340
             R++++NRC     G   ++ R  FC   +  GRS + L     +          VA+ +R
Sbjct  54    RLLHANRCRAVNVGRAVEEVRTGFCFAGSGFGRSGDLLKSHGLRGNVSHRGAVVVANAVR  113

Query  2339  SHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDST-  2163
             S STS E +VND +F++ Y+QGGMN KPLV+ER +  E++V      +   +E+ DD+  
Sbjct  114   SLSTSVETRVNDNNFERIYVQGGMNAKPLVVERIDKDENIVG----GEDSSIEVVDDNID  169

Query  2162  VNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
             + K+  + +  + +  +RE S+VEKEAW+LL+ A+V YCG PVGT+AANDP DK PLNYD
Sbjct  170   LEKSQASLNEFNDVGAKREESQVEKEAWRLLEEAIVMYCGSPVGTMAANDPGDKQPLNYD  229

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             QVFIRDF+PSALAFLL GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+P
Sbjct  230   QVFIRDFVPSALAFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVP  289

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LD    + E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGI+
Sbjct  290   LD--ENKVEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIK  347

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             LI+NLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFY+ALRC+REML VND +
Sbjct  348   LIMNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYNALRCSREMLSVNDGS  407

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
             K+LV AINNRLSALSFHIREYYWVDM+KINEIYRYKTEEYS DA NKFNIYPDQIP W++
Sbjct  408   KNLVRAINNRLSALSFHIREYYWVDMRKINEIYRYKTEEYSTDATNKFNIYPDQIPLWLM  467

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
             +WIPE GGYL+GNLQPAHMDFR FTLGNLW+I+SSLGT +QN++ILN IE KWDDLI  M
Sbjct  468   DWIPENGGYLIGNLQPAHMDFRLFTLGNLWSIVSSLGTPKQNEAILNLIEAKWDDLIGHM  527

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVA  903
             PLKICYPALE EDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+PELA KAVA
Sbjct  528   PLKICYPALENEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELAEKAVA  587

Query  902   VAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDY  723
             +AE+RL  D+WPEYYDTR GRFIGKQ+RL QTWT+AG+LTSKMLL+NP+ AS L W EDY
Sbjct  588   LAEKRLSEDRWPEYYDTRTGRFIGKQSRLFQTWTIAGFLTSKMLLENPETASNLFWEEDY  647

Query  722   ELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             ELLE CVC L  +GRRKCSR   RSQ+ V
Sbjct  648   ELLEICVCALSKSGRRKCSRGAARSQILV  676



>ref|XP_007031201.1| Neutral invertase isoform 1 [Theobroma cacao]
 gb|EOY11703.1| Neutral invertase isoform 1 [Theobroma cacao]
Length=669

 Score =   914 bits (2361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/676 (67%), Positives = 535/676 (79%), Gaps = 16/676 (2%)
 Frame = -3

Query  2663  STMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggryrhrHSVVTL  2484
             STMK  SR+L   N S     +        + L+   + I  +       + +    +  
Sbjct  10    STMKLPSRVLSLRNASFLGLRYSFNPPCCEEKLTCKSKAILLIFNQNSQFHAYPSRFLGF  69

Query  2483  TRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSHSTSTEAQVND  2304
              R++N+ +  +C   S   Q R         S+   V V  +VAS +R  STS E +VND
Sbjct  70    QRILNNTQRLYCLPSSGFAQPR-------AVSRPYRVSVEARVASRVRDLSTSVETRVND  122

Query  2303  KSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNGSSISK  2124
             K+F++ ++Q G+NVKPLV+ER +  E +V       G +V +T+D     N   G    K
Sbjct  123   KNFERIFVQDGINVKPLVVERIDKDESIV------GGDQVPLTEDENNVNNIRVGLEEGK  176

Query  2123  LAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALA  1944
                  E+ ++EKEAW LL+GAVV YCG PVGTVAANDPADKLPLNYDQVFIRDF+PSALA
Sbjct  177   AGISVEI-DIEKEAWNLLRGAVVTYCGTPVGTVAANDPADKLPLNYDQVFIRDFVPSALA  235

Query  1943  FLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLD  1764
             FLL GEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+PLD  + +FE+VLD
Sbjct  236   FLLKGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLD--DNKFEEVLD  293

Query  1763  PDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDM  1584
             PDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGI+LILNLCL DGFDM
Sbjct  294   PDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIKLILNLCLADGFDM  353

Query  1583  FPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSA  1404
             FP+LLVTDGSCMIDRRMGIHGHPLEIQALFY+ALRC+REML VND +K+LV AINNRLSA
Sbjct  354   FPSLLVTDGSCMIDRRMGIHGHPLEIQALFYAALRCSREMLTVNDGSKNLVRAINNRLSA  413

Query  1403  LSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGN  1224
             LSFHIREYYWVDMKKINEIYRYKTEEYS+DAINKFNIYP+QIP W+++WIP  GGYL+GN
Sbjct  414   LSFHIREYYWVDMKKINEIYRYKTEEYSLDAINKFNIYPEQIPSWLMDWIPGEGGYLLGN  473

Query  1223  LQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGED  1044
             LQPAHMDFRFFTLGNLW+++SSLGT +QN++ILN IE KWDD++ QMPLKICYPA+E E+
Sbjct  474   LQPAHMDFRFFTLGNLWSVVSSLGTPKQNEAILNLIEAKWDDIVGQMPLKICYPAVENEE  533

Query  1043  WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPE  864
             WRIITG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ ELA KAV++AE+RL +D+WPE
Sbjct  534   WRIITGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRLELAQKAVSLAEKRLAIDRWPE  593

Query  863   YYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYN  684
             YYDTR G+FIGKQ+RL QTWT+AG+LTS+++L+NP+MASLL W EDYELLE CVC L  +
Sbjct  594   YYDTRAGKFIGKQSRLYQTWTIAGFLTSRLMLENPEMASLLFWEEDYELLEICVCALSKS  653

Query  683   GRRKCSRFGVRSQVGV  636
             GR+KCSR   +SQ+ V
Sbjct  654   GRKKCSRGAAKSQILV  669



>ref|XP_002512536.1| beta-fructofuranosidase, putative [Ricinus communis]
 gb|EEF49988.1| beta-fructofuranosidase, putative [Ricinus communis]
Length=685

 Score =   912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/620 (72%), Positives = 515/620 (83%), Gaps = 8/620 (1%)
 Frame = -3

Query  2477  VINSNRCAFCGSGSNGDQHR---DSFCNWLGRSKNRLVFVVPKVASDMRSHSTSTEAQVN  2307
             +I S+  +FC +  N  Q R    S        + R +  +   AS++R +STS E ++N
Sbjct  68    IIKSSPKSFCIANINLGQSRLISGSPSGPCRTIRGRDLSFIASFASEVRDYSTSIETRIN  127

Query  2306  DKSFKKFYIQGGMNV--KPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNG-S  2136
             DK+F++ Y+Q G+ V  KPL +E+ +  E+VV     + G  V    +S +N+ DL G  
Sbjct  128   DKNFERIYVQNGIGVGVKPLAVEKIDKDENVVGEEASRIGIAVPDDVESPINREDLEGVK  187

Query  2135  SISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIP  1956
              +  ++P RE S +EKEAWKLL  AVV YCG PVGTVAANDP DK PLNYDQVFIRDF+P
Sbjct  188   GVDIVSPRREESNIEKEAWKLLNDAVVRYCGSPVGTVAANDPGDKQPLNYDQVFIRDFVP  247

Query  1955  SALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFE  1776
             SALAFLL GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+PLD    + E
Sbjct  248   SALAFLLRGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLD--ENKSE  305

Query  1775  DVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRD  1596
             ++LDPDFGESAIGRVAPVDSGLWWIILLRAY KIT DYTLQERVDVQTGI+LILNLCL D
Sbjct  306   EILDPDFGESAIGRVAPVDSGLWWIILLRAYGKITCDYTLQERVDVQTGIKLILNLCLAD  365

Query  1595  GFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINN  1416
             GFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML VND +K+LV AINN
Sbjct  366   GFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVNDGSKNLVRAINN  425

Query  1415  RLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGY  1236
             RLSALSFHIREYYWVD+KKINEIYRYKTEEYSMDA NKFNIYP+QIP W+++WIPE GGY
Sbjct  426   RLSALSFHIREYYWVDIKKINEIYRYKTEEYSMDATNKFNIYPEQIPAWLMDWIPEEGGY  485

Query  1235  LVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPAL  1056
             L+GNLQPAHMDFRFFTLGNLW+++SSLGT +QN++ILN IE KWDDL+  MPLKICYPAL
Sbjct  486   LIGNLQPAHMDFRFFTLGNLWSVVSSLGTPKQNEAILNLIEAKWDDLVGCMPLKICYPAL  545

Query  1055  EGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVD  876
             E EDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ ELA +AVA+AE+RL VD
Sbjct  546   EHEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRLELAHRAVAMAEKRLSVD  605

Query  875   QWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCG  696
             +WPEYYDTR G+FIGKQ+RL QTWT+AG+LTSK+LL+NP+MASLL+W EDYELLE CVC 
Sbjct  606   RWPEYYDTRTGKFIGKQSRLYQTWTIAGFLTSKVLLENPEMASLLLWEEDYELLEICVCA  665

Query  695   LKYNGRRKCSRFGVRSQVGV  636
             L   GR+KCSR   +SQ+ V
Sbjct  666   LSKTGRKKCSRGAAKSQILV  685



>ref|XP_004158710.1| PREDICTED: uncharacterized LOC101218389 [Cucumis sativus]
Length=601

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/582 (75%), Positives = 505/582 (87%), Gaps = 10/582 (2%)
 Frame = -3

Query  2375  VFVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKD  2196
             V ++ ++AS +R  STS E +VND +F++ Y+QGG+N KPLV+E+ +  E++V     ++
Sbjct  28    VSIIARIASKVRDFSTSIETRVNDNNFERIYVQGGLNAKPLVVEKIDKDENIVG----EE  83

Query  2195  GGRVEITDDSTVNKN--DLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVA  2022
               R+E+  +    +N  DLN + +  +  +RE S++EKEAW+LL+ AVV YCG PVGT+A
Sbjct  84    DSRIEVGSEHVNGENLEDLNKAKV--ITSKREESDIEKEAWRLLREAVVTYCGSPVGTMA  141

Query  2021  ANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQ  1842
             ANDPADK PLNYDQVFIRDFIPSALAFLLNGEGEIV+NFLLHTLQLQSWEKTVDCYSPGQ
Sbjct  142   ANDPADKQPLNYDQVFIRDFIPSALAFLLNGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQ  201

Query  1841  GLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDY  1662
             GLMPASFKVRT+PLDG N  FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KIT DY
Sbjct  202   GLMPASFKVRTVPLDGNN--FEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITRDY  259

Query  1661  TLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL  1482
              LQ+RVDVQTG+++ILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL
Sbjct  260   ALQDRVDVQTGLKMILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL  319

Query  1481  RCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINK  1302
             RC+REML VND +K+LV AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDA NK
Sbjct  320   RCSREMLTVNDGSKNLVRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDATNK  379

Query  1301  FNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILN  1122
             FNIYPDQIP W+++W+PE GGYL+GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN++ILN
Sbjct  380   FNIYPDQIPQWLMDWVPEEGGYLIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILN  439

Query  1121  FIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACI  942
              IE KW DL+  MPLKICYPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACI
Sbjct  440   LIEAKWGDLVGHMPLKICYPALEYEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACI  499

Query  941   KMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKN  762
             KMG+ E+A KAVAVAE+R+  D+WPEYYDTR G+FIGKQ+RL QTWT+AG+LTSKML++N
Sbjct  500   KMGRFEMAKKAVAVAEKRISNDRWPEYYDTRTGKFIGKQSRLYQTWTIAGFLTSKMLVEN  559

Query  761   PDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             P++AS L W EDYELLE CVC L   GR+KCSR   RSQ+ V
Sbjct  560   PELASSLFWEEDYELLEICVCALSKTGRKKCSRGAARSQILV  601



>ref|XP_004144808.1| PREDICTED: uncharacterized protein LOC101218389 [Cucumis sativus]
Length=589

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/582 (75%), Positives = 504/582 (87%), Gaps = 10/582 (2%)
 Frame = -3

Query  2375  VFVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKD  2196
             V ++ ++AS +R  STS E +VND +F++ Y+QGG+N KPLV+E+ +  E++V     ++
Sbjct  16    VSIIARIASKVRDFSTSIETRVNDNNFERIYVQGGLNAKPLVVEKIDKDENIVG----EE  71

Query  2195  GGRVEITDDSTVNKN--DLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVA  2022
               R+E+  +    +N  DLN + +  +  +RE S++EKEAW+LL+ AVV YCG PVGT+A
Sbjct  72    DSRIEVGSEHVNGENLEDLNKAKV--ITSKREESDIEKEAWRLLREAVVTYCGSPVGTMA  129

Query  2021  ANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQ  1842
             ANDPADK PLNYDQVFIRDFIPSALAFLLNGEGEIV+NFLLHTL  QSWEKTVDCYSPGQ
Sbjct  130   ANDPADKQPLNYDQVFIRDFIPSALAFLLNGEGEIVRNFLLHTLHFQSWEKTVDCYSPGQ  189

Query  1841  GLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDY  1662
             GLMPASFKVRT+PLDG N  FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY
Sbjct  190   GLMPASFKVRTVPLDGNN--FEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDY  247

Query  1661  TLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL  1482
              LQ+RVDVQTG+++ILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL
Sbjct  248   ALQDRVDVQTGLKMILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL  307

Query  1481  RCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINK  1302
             RC+REML VND +K+LV AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDA NK
Sbjct  308   RCSREMLTVNDGSKNLVRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDATNK  367

Query  1301  FNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILN  1122
             FNIYPDQIP W+++W+PE GGYL+GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN++ILN
Sbjct  368   FNIYPDQIPQWLMDWVPEEGGYLIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILN  427

Query  1121  FIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACI  942
              IE KW DL+  MPLKICYPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACI
Sbjct  428   LIEAKWGDLVGHMPLKICYPALEYEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACI  487

Query  941   KMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKN  762
             KMG+ E+A KAVAVAE+R+  D+WPEYYDTR G+FIGKQ+RL QTWT+AG+LTSKML++N
Sbjct  488   KMGRFEMAKKAVAVAEKRISNDRWPEYYDTRTGKFIGKQSRLYQTWTIAGFLTSKMLVEN  547

Query  761   PDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             P++AS L W EDYELLE CVC L   GR+KCSR   RSQ+ V
Sbjct  548   PELASSLFWEEDYELLEICVCALSKTGRKKCSRGAARSQILV  589



>gb|AFA46813.1| neutral/alkaline invertase [Manihot esculenta]
Length=682

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/620 (73%), Positives = 513/620 (83%), Gaps = 10/620 (2%)
 Frame = -3

Query  2477  VINSNRCAFCGSGSNGDQHR----DSFCNWLGRSKNRLVFVVPKVASDMRSHSTSTEAQV  2310
             +INS +  FC   +N    R     S  +   R  +R V VV  VAS+++ +STS E +V
Sbjct  67    IINSTQKIFCIPIANFGPPRLVSGSSCGDRTRRRASRGVSVVASVASEVKEYSTSVETRV  126

Query  2309  NDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDD-STVNKNDLNGSS  2133
             NDK+F++ Y+  G+ VKPLV+E+ +  EDV+     + G  V + D+   VN  +L G  
Sbjct  127   NDKNFERIYVHNGIGVKPLVVEKIDKDEDVLGEAASRIG--VVVPDEGEKVNTENLEGVK  184

Query  2132  ISKLAPE-REVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIP  1956
               ++    RE SE+EKEAWKLL  A+V YCG PVGTVAAND  DK PLNYDQVFIRDF+P
Sbjct  185   GVEIGNSWREESEIEKEAWKLLNDAIVTYCGSPVGTVAANDQGDKQPLNYDQVFIRDFVP  244

Query  1955  SALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFE  1776
             SALAFLL GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+PLDG   E  
Sbjct  245   SALAFLLRGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGNKSE--  302

Query  1775  DVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRD  1596
             +VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGD TLQERVDVQ GI+LILNLCL D
Sbjct  303   EVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDNTLQERVDVQIGIKLILNLCLTD  362

Query  1595  GFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINN  1416
             GFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML VND +K+LV  INN
Sbjct  363   GFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVNDGSKNLVRTINN  422

Query  1415  RLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGY  1236
             RLSALSFHIREYYWVD+KKINEIYRYKTEEYSMDA NKFNIYP+QIP W+++WIPE GGY
Sbjct  423   RLSALSFHIREYYWVDIKKINEIYRYKTEEYSMDATNKFNIYPEQIPSWLMDWIPEEGGY  482

Query  1235  LVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPAL  1056
             L+GNLQPAHMDFRFFTLGNLW++ISSLGT +QNK+ILN IE KWDDL+ +MPLKICYPAL
Sbjct  483   LIGNLQPAHMDFRFFTLGNLWSVISSLGTPKQNKAILNLIEAKWDDLVGRMPLKICYPAL  542

Query  1055  EGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVD  876
             E EDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ ELA KAVA+AEERL VD
Sbjct  543   EDEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRLELAQKAVALAEERLAVD  602

Query  875   QWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCG  696
              WPEYYDTR G+FIGKQ+RL QTWT+AG+LTSK+LL+NP MAS+L+W EDYELLE CVC 
Sbjct  603   HWPEYYDTRTGKFIGKQSRLYQTWTIAGFLTSKVLLENPQMASMLLWEEDYELLEICVCA  662

Query  695   LKYNGRRKCSRFGVRSQVGV  636
             L   GR+KCSR   ++Q+ V
Sbjct  663   LSKTGRKKCSRGAAKTQILV  682



>emb|CBI39621.3| unnamed protein product [Vitis vinifera]
Length=647

 Score =   910 bits (2353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/565 (78%), Positives = 484/565 (86%), Gaps = 30/565 (5%)
 Frame = -3

Query  2330  TSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKN  2151
             TS E +VNDK+F+K Y+QGGMNVKPLV+E                  R++I  D T+  N
Sbjct  113   TSVETRVNDKNFEKIYVQGGMNVKPLVVE------------------RIDI--DETIENN  152

Query  2150  DLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFI  1971
             +            R  SE EKEAWKLLQ +VV YCG P+GT+AANDP DK PLNYDQVFI
Sbjct  153   E----------ESRIESEAEKEAWKLLQDSVVMYCGSPIGTMAANDPGDKTPLNYDQVFI  202

Query  1970  RDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGR  1791
             RDF+PSALAFLL GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+PLDG 
Sbjct  203   RDFVPSALAFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGN  262

Query  1790  NGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILN  1611
             N   E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDYTLQERVDVQTGI+LILN
Sbjct  263   NEAHEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERVDVQTGIKLILN  322

Query  1610  LCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLV  1431
             LCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML  ND++ +LV
Sbjct  323   LCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTQNDASINLV  382

Query  1430  AAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIP  1251
              AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DA NKFNIYPDQIP W+++W+P
Sbjct  383   RAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDATNKFNIYPDQIPSWLMDWVP  442

Query  1250  ETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKI  1071
             E GGYL+GNLQPAHMDFRFFTLGNLW+IISSLGT +QN+ IL+ I+ KWDDL+  MPLKI
Sbjct  443   EEGGYLIGNLQPAHMDFRFFTLGNLWSIISSLGTPKQNQGILDTIQAKWDDLVGHMPLKI  502

Query  1070  CYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEE  891
             CYPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+PELA KAVA AE+
Sbjct  503   CYPALEYEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARKAVADAEK  562

Query  890   RLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLE  711
             RL VD+WPEYYDTR+GRFIGKQ+RL QTWT+AGYLTSKMLL+NP+MA+LL W EDY+LLE
Sbjct  563   RLAVDRWPEYYDTRNGRFIGKQSRLFQTWTIAGYLTSKMLLENPEMAALLFWEEDYDLLE  622

Query  710   NCVCGLKYNGRRKCSRFGVRSQVGV  636
              CVCGL   GRRKCSRF  RSQ+ V
Sbjct  623   ICVCGLSKTGRRKCSRFAARSQILV  647



>ref|XP_010092957.1| hypothetical protein L484_018894 [Morus notabilis]
 gb|EXB53010.1| hypothetical protein L484_018894 [Morus notabilis]
Length=622

 Score =   910 bits (2351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/585 (76%), Positives = 494/585 (84%), Gaps = 15/585 (3%)
 Frame = -3

Query  2390  SKNRLVFVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvet  2211
             +  R V ++  VASD R+ STS E +VN+ +F++ Y+QGGMNVKPLV+ER          
Sbjct  53    TTTRGVSLITNVASDFRNLSTSVETRVNENNFERIYVQGGMNVKPLVLERI---------  103

Query  2210  yEQKDGGRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVG  2031
                K+   V    +    K  LN   I   +P+RE SE+EKEAW+LLQ AVV YCG PVG
Sbjct  104   --DKEENIVGGEVEVGGEKEGLNEICIE--SPKREESEIEKEAWRLLQNAVVTYCGSPVG  159

Query  2030  TVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYS  1851
             TVAANDP DKLPLNYDQVFIRDF+PSALAFLL GEGEIV+NFLLHTLQLQSWEKTVDCYS
Sbjct  160   TVAANDPGDKLPLNYDQVFIRDFVPSALAFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYS  219

Query  1850  PGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKIT  1671
             PGQGLMPASFKVRT+PLD    + E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KIT
Sbjct  220   PGQGLMPASFKVRTVPLD--ENKLEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKIT  277

Query  1670  GDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFY  1491
             GDY LQERVDVQTG+++ILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFY
Sbjct  278   GDYALQERVDVQTGLKMILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFY  337

Query  1490  SALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDA  1311
             SALRC+REML VND +K+LV AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS+DA
Sbjct  338   SALRCSREMLSVNDGSKNLVRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSLDA  397

Query  1310  INKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKS  1131
              NKFNIYP+QIP W+++WIPE GGYL+GNLQPAHMDFRFFTLGNLW+I+SSLGT  QN++
Sbjct  398   TNKFNIYPEQIPSWLMDWIPEEGGYLIGNLQPAHMDFRFFTLGNLWSIVSSLGTPRQNEA  457

Query  1130  ILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTL  951
             ILN IE KWDDL+  MPLKICYPALE E+W IITGSDPKNTPWSYHNGGSWPTLLWQFTL
Sbjct  458   ILNLIEAKWDDLVGHMPLKICYPALESEEWHIITGSDPKNTPWSYHNGGSWPTLLWQFTL  517

Query  950   ACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKML  771
             ACIKMGK ELA KAVA+AE+RL  D WPEYYDTR G+FIGKQ+R  QTWT+AGYLTSKM 
Sbjct  518   ACIKMGKLELARKAVALAEKRLAKDHWPEYYDTRTGKFIGKQSRHYQTWTIAGYLTSKMF  577

Query  770   LKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             L+NP+MASLL W+EDYELLE CVC L   GR+KCSR   RSQ+ V
Sbjct  578   LENPEMASLLFWDEDYELLEICVCALSKTGRKKCSRGAARSQILV  622



>ref|XP_009587952.1| PREDICTED: alkaline/neutral invertase CINV2 [Nicotiana tomentosiformis]
Length=652

 Score =   909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/680 (67%), Positives = 534/680 (79%), Gaps = 32/680 (5%)
 Frame = -3

Query  2672  IGISTMKPCSRIL-GSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggryrhrHS  2496
             + + TMKPC RIL  S ++S    PF    ++   NLS  +  ++               
Sbjct  4     MNLITMKPCCRILIASKSNSFLGLPF----KEASTNLSNFRLNLRQKSDFDSYPR-----  54

Query  2495  VVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSHSTSTEA  2316
                  R+IN  +  +C    +  Q R  F + +GR     + V+  VASD R++STS E 
Sbjct  55    -----RIINRTQKLYCVPNLSWGQSR-VFSSPIGRG----LHVIASVASDFRNYSTSVET  104

Query  2315  QVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNGS  2136
             +VNDK+F++ Y+QGG+NVKPLV+E+ +  E           G   + +D ++ +      
Sbjct  105   RVNDKNFERIYVQGGLNVKPLVVEKIDLDEHAA------GAGGEHVKNDESLKEEGEGQV  158

Query  2135  SISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIP  1956
              +       E SE  KEAWKLL+ AVV YCG P+GT+AANDP DKLPLNYDQVFIRDFIP
Sbjct  159   EVRG----GEESEAVKEAWKLLENAVVTYCGSPIGTLAANDPNDKLPLNYDQVFIRDFIP  214

Query  1955  SALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFE  1776
             SALAFLL G+ +IVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+PLD  + ++E
Sbjct  215   SALAFLLKGDKDIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLD--DNKYE  272

Query  1775  DVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRD  1596
             +VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGI+LILNLCL D
Sbjct  273   EVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYGLQERVDVQTGIKLILNLCLSD  332

Query  1595  GFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINN  1416
             GFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML +++ +K+LV AINN
Sbjct  333   GFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLSLDEGSKNLVNAINN  392

Query  1415  RLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGY  1236
             RLSALSFHIREYYWVDMKKINEIYRYKTEEYS DA NKFNIYP+QIP W+++WIPE GGY
Sbjct  393   RLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDATNKFNIYPEQIPHWLMDWIPEEGGY  452

Query  1235  LVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPAL  1056
             L+GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN++ILN IE KWDD++  MPLKICYPAL
Sbjct  453   LIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILNLIEAKWDDIVGSMPLKICYPAL  512

Query  1055  EGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVD  876
             E E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKM + +LA KAV +AE+RL VD
Sbjct  513   ENEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMNRTDLAKKAVDLAEKRLRVD  572

Query  875   QWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCG  696
             QWPEYYDTR+G+F GKQARL QTWT+AG+LTSKMLL+NP+MASLL W EDY+LLE CVC 
Sbjct  573   QWPEYYDTRYGKFTGKQARLYQTWTIAGFLTSKMLLENPEMASLLFWEEDYDLLEICVCA  632

Query  695   LKYNGRRKCSRFGVRSQVGV  636
             LK +GR+KCSR   +SQ+ V
Sbjct  633   LKKSGRKKCSRGAAKSQILV  652



>ref|XP_008246215.1| PREDICTED: alkaline/neutral invertase CINV2 [Prunus mume]
Length=678

 Score =   909 bits (2349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/686 (66%), Positives = 539/686 (79%), Gaps = 13/686 (2%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGS-YNHSIFWYPFGRCNRQVMD--NLSKSQQKIKDVhrmgg  2520
             M S S +   TMKP  RIL S  N ++F +P  +C   +    NLS    KI+ + +   
Sbjct  1     MNSLSLLCHWTMKPTCRILTSCRNSALFGFPPAKCYHGLAKKGNLSNFCVKIEQICQFQT  60

Query  2519  gryrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMR  2340
               +R   S       + +++      G +G   R         +  R V V+ ++AS+ R
Sbjct  61    NAFRVSGSGHVFNDALKASQVPSWSFGQSGVISRSYSVG----TTRRGVSVIARLASNFR  116

Query  2339  SHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTV  2160
             + STS E +VN+ +F++ Y+QGG+NVKP+ +ER +  E+VV    +++  R+E++D+   
Sbjct  117   NLSTSIETRVNENNFERIYVQGGINVKPVTVERIDKDENVV----REEESRIEVSDEKQN  172

Query  2159  NKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQ  1980
               N         +  +RE S++EK+AWKLL+ +VV YCG PVGTVAANDP DK  LNYDQ
Sbjct  173   VSNQEGLDEAKVVNAQREYSDIEKDAWKLLRDSVVTYCGTPVGTVAANDPGDKQTLNYDQ  232

Query  1979  VFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPL  1800
             VFIRDF+PSALAFLL GEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+PL
Sbjct  233   VFIRDFVPSALAFLLKGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPL  292

Query  1799  DGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRL  1620
             DG   ++E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTG+++
Sbjct  293   DG--NKYEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGLKM  350

Query  1619  ILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTK  1440
             ILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML +ND +K
Sbjct  351   ILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLALNDGSK  410

Query  1439  SLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVN  1260
              LV AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS +A NKFNIYP+QIP W+++
Sbjct  411   ILVRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTEATNKFNIYPEQIPLWLMD  470

Query  1259  WIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMP  1080
             WIPE GGY +GNLQPAHMDFRFFTLGNLWAI+SSLGT +QN S+LN IE KWDDL+  MP
Sbjct  471   WIPEEGGYFIGNLQPAHMDFRFFTLGNLWAIVSSLGTPKQNDSVLNLIEAKWDDLVGHMP  530

Query  1079  LKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAV  900
             LKICYPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLAC+KMG+ +LA KA  +
Sbjct  531   LKICYPALEFEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACLKMGRIDLAQKAADL  590

Query  899   AEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYE  720
             AE+RL  D+WPEYYDTR G+FIGKQ+RL QTWT+AGYLT+KMLL+NP+ A+LL W+EDYE
Sbjct  591   AEKRLRSDRWPEYYDTRTGKFIGKQSRLYQTWTIAGYLTTKMLLENPEKAALLFWDEDYE  650

Query  719   LLENCVCGLKYNGRRKCSRFGVRSQV  642
             LLE CVC L  +GR+KCSR   +SQ+
Sbjct  651   LLEICVCALSKSGRKKCSRGAAKSQI  676



>ref|XP_006433565.1| hypothetical protein CICLE_v10000500mg [Citrus clementina]
 gb|ESR46805.1| hypothetical protein CICLE_v10000500mg [Citrus clementina]
Length=677

 Score =   909 bits (2349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/619 (72%), Positives = 517/619 (84%), Gaps = 15/619 (2%)
 Frame = -3

Query  2480  RVINSNRCAFCGSGSNGDQHR-DSFCNWLGRSKNR-LVFVVPKVASDMRSHSTSTEAQVN  2307
             R++   +   C  G +  Q R +S    +  +K+R L  V  +VAS++ S STS E +VN
Sbjct  70    RILKDTQKPLCVFGPSCGQIRVNSRPFSVVSTKSRGLYLVASRVASNVSSFSTSVETRVN  129

Query  2306  DKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNGSSIS  2127
             D +F++ Y+Q G+NVKPLV+ER +  E++V     ++   VE+ DD  V K++L G    
Sbjct  130   DGNFERIYVQNGLNVKPLVVERIDKDENIVG----QEESCVEVNDDEKVGKDNLEG----  181

Query  2126  KLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSAL  1947
              +  +RE +E+EKEAW+LLQ AVV YC  P+GTVAANDP DK PLNYDQVFIRDF+PSAL
Sbjct  182   -VRTKREETEIEKEAWRLLQEAVVTYCESPIGTVAANDPGDKQPLNYDQVFIRDFVPSAL  240

Query  1946  AFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVL  1767
             AFLL GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR +PL+  + +FE+VL
Sbjct  241   AFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRNVPLE--SNKFEEVL  298

Query  1766  DPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFD  1587
             DPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGI+LI+NLCL DGFD
Sbjct  299   DPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIKLIMNLCLADGFD  358

Query  1586  MFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKS--LVAAINNR  1413
             MFP+LLVTDGSCMIDRRMGIHGHPLEIQALFY+ALRC+REML V+D + S  LV AINNR
Sbjct  359   MFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYTALRCSREMLTVSDGSGSNNLVRAINNR  418

Query  1412  LSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYL  1233
             LSALSFHIREYYWVDMKKINEIYRYKTEEYS DA NKFNIYP+QIP W+++WIPE GGYL
Sbjct  419   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTDATNKFNIYPEQIPSWLMDWIPEEGGYL  478

Query  1232  VGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALE  1053
             +GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN+SILN IE KWDDL+  MPLKICYPALE
Sbjct  479   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNESILNLIEAKWDDLVGHMPLKICYPALE  538

Query  1052  GEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQ  873
              EDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+  LA KAVA+AE RLP+D 
Sbjct  539   SEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRLGLAQKAVALAENRLPLDH  598

Query  872   WPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGL  693
             WPEYYDTR GRFIGKQ+RL QTWT+AG+LTSKML++NP+MAS+L W EDYELLE CVC L
Sbjct  599   WPEYYDTRTGRFIGKQSRLFQTWTIAGFLTSKMLVENPEMASVLFWEEDYELLEICVCAL  658

Query  692   KYNGRRKCSRFGVRSQVGV  636
               +GR+KCSR   +SQ+ V
Sbjct  659   SKSGRKKCSRGAAKSQILV  677



>gb|KDO81624.1| hypothetical protein CISIN_1g005783mg [Citrus sinensis]
Length=677

 Score =   908 bits (2346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/619 (72%), Positives = 516/619 (83%), Gaps = 15/619 (2%)
 Frame = -3

Query  2480  RVINSNRCAFCGSGSNGDQHR-DSFCNWLGRSKNR-LVFVVPKVASDMRSHSTSTEAQVN  2307
             R++   +   C  G +  Q R +S    +  +K+R L  V  +VAS++ S STS E +VN
Sbjct  70    RILKDTQKPLCVFGPSCGQIRVNSRPFSVVSTKSRGLYLVASRVASNVSSFSTSVETRVN  129

Query  2306  DKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNGSSIS  2127
             D +F++ Y+Q G+NVKPLV+ER +  E++V     ++   VE+ DD  V K++L G    
Sbjct  130   DGNFERIYVQNGLNVKPLVVERIDKDENIVG----QEESCVEVNDDEKVGKDNLEG----  181

Query  2126  KLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSAL  1947
              +  +RE +E+EKEAW+LLQ AVV YC  P+GTVAANDP DK PLNYDQVFIRDF+PSAL
Sbjct  182   -VRTKREETEIEKEAWRLLQEAVVTYCESPIGTVAANDPGDKQPLNYDQVFIRDFVPSAL  240

Query  1946  AFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVL  1767
             AFLL GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR +PL+  + +FE+VL
Sbjct  241   AFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRNVPLE--SNKFEEVL  298

Query  1766  DPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFD  1587
             DPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGI+LI+NLCL DGFD
Sbjct  299   DPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIKLIMNLCLADGFD  358

Query  1586  MFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKS--LVAAINNR  1413
             MFP+LLVTDGSCMIDRRMGIHGHPLEIQALFY+ALRC+REML V+D + S  LV AINNR
Sbjct  359   MFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYTALRCSREMLTVSDGSGSNNLVRAINNR  418

Query  1412  LSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYL  1233
             LSALSFHIREYYWVDMKKINEIYRYKTEEYS DA NKFNIYP+QIP W+++WIPE GGYL
Sbjct  419   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTDATNKFNIYPEQIPSWLMDWIPEEGGYL  478

Query  1232  VGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALE  1053
             +GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN+SILN IE KWDDL+  MPLKICYPALE
Sbjct  479   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNESILNLIEAKWDDLVGHMPLKICYPALE  538

Query  1052  GEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQ  873
              EDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+  LA KAVA+AE RLP+D 
Sbjct  539   SEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRLGLAQKAVALAENRLPLDH  598

Query  872   WPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGL  693
             WPEYYDTR GRF GKQ+RL QTWT+AG+LTSKML++NP+MAS+L W EDYELLE CVC L
Sbjct  599   WPEYYDTRTGRFTGKQSRLFQTWTIAGFLTSKMLVENPEMASVLFWEEDYELLEICVCAL  658

Query  692   KYNGRRKCSRFGVRSQVGV  636
               +GR+KCSR   +SQ+ V
Sbjct  659   SKSGRKKCSRGAAKSQILV  677



>ref|XP_006472236.1| PREDICTED: alkaline/neutral invertase CINV2-like [Citrus sinensis]
Length=677

 Score =   907 bits (2345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/619 (72%), Positives = 516/619 (83%), Gaps = 15/619 (2%)
 Frame = -3

Query  2480  RVINSNRCAFCGSGSNGDQHR-DSFCNWLGRSKNR-LVFVVPKVASDMRSHSTSTEAQVN  2307
             R++   +   C  G +  Q R +S    +  +K+R L  V  +VAS++ S STS E +VN
Sbjct  70    RILKDTQKPLCVFGPSCGQIRVNSRPFSVVSTKSRGLYLVASRVASNVSSFSTSVETRVN  129

Query  2306  DKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNGSSIS  2127
             D +F++ Y+Q G+NVKPLV+ER +  E++V     ++   VE+ DD  V K++L G    
Sbjct  130   DGNFERIYVQNGLNVKPLVVERIDKDENIVG----QEESCVEVNDDEKVGKDNLEG----  181

Query  2126  KLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSAL  1947
              +  +RE +E+EKEAW+LLQ AVV YC  P+GTVAANDP DK PLNYDQVFIRDF+PSAL
Sbjct  182   -VRTKREETEIEKEAWRLLQEAVVTYCESPIGTVAANDPGDKQPLNYDQVFIRDFVPSAL  240

Query  1946  AFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVL  1767
             AFLL GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR +PL+  + +FE+VL
Sbjct  241   AFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRNVPLE--SNKFEEVL  298

Query  1766  DPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFD  1587
             DPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGI+LI+NLCL DGFD
Sbjct  299   DPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIKLIMNLCLADGFD  358

Query  1586  MFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKS--LVAAINNR  1413
             MFP+LLVTDGSCMIDRRMGIHGHPLEIQALFY+ALRC+REML V+D + S  LV AINNR
Sbjct  359   MFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYTALRCSREMLTVSDGSGSNNLVRAINNR  418

Query  1412  LSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYL  1233
             LSALSFHIREYYWVDMKKINEIYRYKTEEYS DA NKFNIYP+QIP W+++WIPE GGYL
Sbjct  419   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTDATNKFNIYPEQIPSWLMDWIPEEGGYL  478

Query  1232  VGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALE  1053
             +GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN+SILN IE KWDDL+  MPLKICYPALE
Sbjct  479   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNESILNLIEAKWDDLVGHMPLKICYPALE  538

Query  1052  GEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQ  873
              EDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+  LA KAVA+AE RLP+D 
Sbjct  539   SEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRLGLAQKAVALAENRLPLDH  598

Query  872   WPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGL  693
             WPEYYDTR GRF GKQ+RL QTWT+AG+LTSKML++NP+MAS+L W EDYELLE CVC L
Sbjct  599   WPEYYDTRTGRFTGKQSRLFQTWTIAGFLTSKMLVENPEMASVLFWEEDYELLEICVCAL  658

Query  692   KYNGRRKCSRFGVRSQVGV  636
               +GR+KCSR   +SQ+ V
Sbjct  659   SKSGRKKCSRGAAKSQILV  677



>ref|XP_008438972.1| PREDICTED: alkaline/neutral invertase CINV2 [Cucumis melo]
Length=656

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/680 (66%), Positives = 524/680 (77%), Gaps = 40/680 (6%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M + S +GIST+KPC  ++G  + S+F              ++  + K K + R      
Sbjct  1     MHTCSSLGISTIKPCRILIGFKSSSMF------------GTIASPKLKYKRIGRFSKLEP  48

Query  2510  rhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSHS  2331
                  + ++  V   +R  FC S  NG +           S +R   ++  VASD R+ S
Sbjct  49    NGCKVIGSVQVVDKLSRRCFCFS--NGYRLYKG-------SSDRNRHLIANVASDFRNQS  99

Query  2330  TSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNK-  2154
             TS E+ V  KSF   YI GG  VKPL IE               + G   + +D  V++ 
Sbjct  100   TSAESYVKQKSFDAIYINGGFKVKPLEIESI-------------ETGHDIVKEDKKVSEV  146

Query  2153  ---NDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
                  L GS+ S++  ERE+S++EKEAW LL+ +VV YCG+PVGTVAANDPAD  PLNYD
Sbjct  147   EGLGSLKGSNYSRV--ERELSKIEKEAWDLLRNSVVFYCGHPVGTVAANDPADAQPLNYD  204

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             QVF+RDF+PSALAFLLNGE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR+ P
Sbjct  205   QVFVRDFVPSALAFLLNGEEEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSQP  264

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LDG +G FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDYTLQERVDVQTGIR
Sbjct  265   LDGSDGAFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERVDVQTGIR  324

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             LILNLCL +GFDMFPTLLV+DGSCMIDRRMGIHGHPLEIQALFYSALRC+REMLIVNDST
Sbjct  325   LILNLCLTNGFDMFPTLLVSDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDST  384

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
             K+LV  +NNRLSALSFHIREYYWVD  KINEIYRYKTEEYS DA+NKFNIYP+QIP W+V
Sbjct  385   KNLVVELNNRLSALSFHIREYYWVDKNKINEIYRYKTEEYSTDAVNKFNIYPEQIPSWLV  444

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
             +WIPE GGY +GNLQPAHMDFRFFTLGNLW+++SSLGT +QN+ ILN IE KWDDL+A M
Sbjct  445   DWIPEEGGYFIGNLQPAHMDFRFFTLGNLWSVVSSLGTPKQNEGILNLIEAKWDDLVANM  504

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVA  903
             PLKIC+PA+E E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+PELA  A+A
Sbjct  505   PLKICFPAMEYEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARNAIA  564

Query  902   VAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDY  723
             VAE++L VD+WPEYYD R  R IGKQ+RL QTWT+AG+LTSK+LL+NP+ ASLL W EDY
Sbjct  565   VAEKKLSVDRWPEYYDMRSARLIGKQSRLFQTWTIAGFLTSKLLLENPEKASLLFWEEDY  624

Query  722   ELLENCVCGLKYNGRRKCSR  663
             E+L+NCVC L      KCSR
Sbjct  625   EILQNCVCALGKGNGNKCSR  644



>ref|XP_004302290.1| PREDICTED: uncharacterized protein LOC101304591 [Fragaria vesca 
subsp. vesca]
Length=671

 Score =   902 bits (2332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/691 (66%), Positives = 537/691 (78%), Gaps = 26/691 (4%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M+S SC+  S MKP  RI+ S   S     FG    ++ +  +K+    K          
Sbjct  1     MISLSCLCHSAMKPSCRIMSSIRKSTL---FGFSPVKIHNGSAKNGNLSKFCVNFEQKSQ  57

Query  2510  rhrH--SVVTLTRVINSNRCAFC----GSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVAS  2349
              H +   V+    V++  + AF       G +G   R SF         R   V+  +  
Sbjct  58    YHTYPGRVLGFGSVLSDTQKAFKVPNWSFGQSGVVSR-SF-------STRGGCVIAGIEY  109

Query  2348  DMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDD  2169
               R  STS E +VN+ +F++ Y+QGG+NVKPLV+ER +  E+VV     ++  R+E+  D
Sbjct  110   KGREFSTSVETRVNENNFERIYVQGGVNVKPLVVERIDKDENVVG----EEQSRIEVAID  165

Query  2168  STVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLN  1989
               V   D     +S    ERE S++EKEAW+LL+ +VV YCG PVGTVAANDP DKLPLN
Sbjct  166   ENVEGVDEQAKVLSS---EREFSDIEKEAWRLLRESVVTYCGSPVGTVAANDPNDKLPLN  222

Query  1988  YDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT  1809
             YDQVFIRDF+PSALAFLL GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR 
Sbjct  223   YDQVFIRDFVPSALAFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRI  282

Query  1808  MPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTG  1629
             +PLD    +FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTG
Sbjct  283   VPLD--ENKFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYGLQERVDVQTG  340

Query  1628  IRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVND  1449
             +++ILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML VND
Sbjct  341   LKMILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLAVND  400

Query  1448  STKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPW  1269
              +K+LV AINNRLSALSFHIREYYWVDM+K+NEIYRYKTEEYS +A NKFNIYPDQIP W
Sbjct  401   GSKNLVRAINNRLSALSFHIREYYWVDMRKMNEIYRYKTEEYSTEATNKFNIYPDQIPLW  460

Query  1268  IVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIA  1089
             +++WIPE GGY +GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN++ILN +E KWDDL+ 
Sbjct  461   LMDWIPEEGGYFIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILNLVEAKWDDLVG  520

Query  1088  QMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKA  909
              MPLKICYPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ ELA KA
Sbjct  521   HMPLKICYPALEYEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRTELAEKA  580

Query  908   VAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNE  729
             VA+AE++L  D+WPEYYDTR G+FIGKQ+RL+QTWT+AG+LT+KML++NP+ A+LL W E
Sbjct  581   VALAEKKLRADRWPEYYDTRTGKFIGKQSRLHQTWTIAGFLTTKMLVQNPEKAALLFWEE  640

Query  728   DYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             DYELLE CVC L  +GR+KCSR   RSQ+ V
Sbjct  641   DYELLEICVCALSKSGRKKCSRGAARSQILV  671



>ref|XP_004165515.1| PREDICTED: uncharacterized protein LOC101231486 [Cucumis sativus]
Length=656

 Score =   902 bits (2332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/680 (66%), Positives = 524/680 (77%), Gaps = 40/680 (6%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M + S +GISTMKPC  ++G  + S+F              ++  + K K + R      
Sbjct  1     MHTCSSLGISTMKPCRILIGFKSSSMF------------GTIASPKLKYKRIGRFSKLEP  48

Query  2510  rhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSHS  2331
                    ++  V N +R   C S  NG +           S +R   ++  VASD R+ S
Sbjct  49    NGCKITGSVEVVDNLSRRCICFS--NGYRLYKG-------SNDRNRCLIANVASDFRNQS  99

Query  2330  TSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNK-  2154
             TS+E+ V  KSF   YI GG  VKPL IE               + G   + +D  V++ 
Sbjct  100   TSSESYVKQKSFDTIYINGGFKVKPLEIESI-------------ETGHDIVKEDKKVSEV  146

Query  2153  ---NDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
                  L GS+ S++  EREVS++EKEAW LL+ +VV YCG+PVGTVAANDPAD  PLNYD
Sbjct  147   EGLGSLKGSNYSRV--EREVSKIEKEAWDLLRNSVVFYCGHPVGTVAANDPADSQPLNYD  204

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             QVF+RDFIPSALAFLLNGE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR+ P
Sbjct  205   QVFVRDFIPSALAFLLNGEEEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSQP  264

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LDG +G FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDYTLQERVDVQTGIR
Sbjct  265   LDGSDGAFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERVDVQTGIR  324

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             LILNLCL +GFDMFPTLLV+DGSCMIDRRMGIHGHPLEIQALFYSALRC+REMLIVNDST
Sbjct  325   LILNLCLTNGFDMFPTLLVSDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDST  384

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
             K+LV  +NNRLSALSFHIREYYWVD  KINEIYRYKTEEYS DA+NKFNIYP+QIP W+V
Sbjct  385   KNLVVELNNRLSALSFHIREYYWVDKNKINEIYRYKTEEYSSDAVNKFNIYPEQIPSWLV  444

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
             +WIPE GGY +GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN+ ILN IE KWDDL+A M
Sbjct  445   DWIPEEGGYFMGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEGILNLIEAKWDDLVANM  504

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVA  903
             PLKIC+PA+E E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+PE+A  A+A
Sbjct  505   PLKICFPAMEYEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPEVARNAIA  564

Query  902   VAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDY  723
             VAE++L +D+WPEYYD R  R IGKQ+RL QTWT+AG+LTSK+LL+NP+ ASLL W EDY
Sbjct  565   VAEKKLSIDRWPEYYDMRSARLIGKQSRLFQTWTIAGFLTSKLLLENPEKASLLFWEEDY  624

Query  722   ELLENCVCGLKYNGRRKCSR  663
             ++L+NC+C L      KCSR
Sbjct  625   DILQNCICALSKGNGNKCSR  644



>gb|KGN57182.1| hypothetical protein Csa_3G168930 [Cucumis sativus]
Length=651

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/680 (66%), Positives = 524/680 (77%), Gaps = 40/680 (6%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M + S +GISTMKPC  ++G  + S+F              ++  + K K + R      
Sbjct  1     MHTCSSLGISTMKPCRILIGFKSSSMF------------GTIASPKLKYKRIGRFSKLEP  48

Query  2510  rhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSHS  2331
                    ++  V N +R   C S  NG +           S +R   ++  VASD R+ S
Sbjct  49    NGCKITGSVQVVDNLSRRCICFS--NGYRLYKG-------SNDRNRCLIANVASDFRNQS  99

Query  2330  TSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNK-  2154
             TS+E+ V  KSF   YI GG  VKPL IE               + G   + +D  V++ 
Sbjct  100   TSSESYVKQKSFDTIYINGGFKVKPLEIESI-------------ETGHDIVKEDKKVSEV  146

Query  2153  ---NDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
                  L GS+ S++  EREVS++EKEAW LL+ +VV YCG+PVGTVAANDPAD  PLNYD
Sbjct  147   EGLGSLKGSNYSRV--EREVSKIEKEAWDLLRNSVVFYCGHPVGTVAANDPADSQPLNYD  204

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             QVF+RDFIPSALAFLLNGE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR+ P
Sbjct  205   QVFVRDFIPSALAFLLNGEEEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSQP  264

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LDG +G FE+VLDPDFGESAIGRVAPVDSGLWWIIL+RAY KITGDYTLQERVDVQTGIR
Sbjct  265   LDGSDGAFEEVLDPDFGESAIGRVAPVDSGLWWIILVRAYGKITGDYTLQERVDVQTGIR  324

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             LILNLCL +GFDMFPTLLV+DGSCMIDRRMGIHGHPLEIQALFYSALRC+REMLIVNDST
Sbjct  325   LILNLCLTNGFDMFPTLLVSDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDST  384

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
             K+LV  +NNRLSALSFHIREYYWVD  KINEIYRYKTEEYS DA+NKFNIYP+QIP W+V
Sbjct  385   KNLVVELNNRLSALSFHIREYYWVDKNKINEIYRYKTEEYSSDAVNKFNIYPEQIPSWLV  444

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
             +WIPE GGY +GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN+ ILN IE KWDDL+A M
Sbjct  445   DWIPEEGGYFMGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEGILNLIEAKWDDLVANM  504

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVA  903
             PLKIC+PA+E E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+PE+A  A+A
Sbjct  505   PLKICFPAMEYEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPEVARNAIA  564

Query  902   VAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDY  723
             VAE++L +D+WPEYYD R  R IGKQ+RL QTWT+AG+LTSK+LL+NP+ ASLL W EDY
Sbjct  565   VAEKKLSIDRWPEYYDMRSARLIGKQSRLFQTWTIAGFLTSKLLLENPEKASLLFWEEDY  624

Query  722   ELLENCVCGLKYNGRRKCSR  663
             ++L+NC+C L      KCSR
Sbjct  625   DILQNCICALSKGNGNKCSR  644



>ref|XP_007208331.1| hypothetical protein PRUPE_ppa002385mg [Prunus persica]
 gb|EMJ09530.1| hypothetical protein PRUPE_ppa002385mg [Prunus persica]
Length=678

 Score =   900 bits (2325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/686 (65%), Positives = 535/686 (78%), Gaps = 13/686 (2%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGS-YNHSIFWYPFGRCNRQVMDN--LSKSQQKIKDVhrmgg  2520
             M S S +   TMKP  RIL S  N ++F +P  +C   +  N  LS      + + +   
Sbjct  1     MNSLSLLCHWTMKPTCRILTSCRNSALFGFPPAKCYHGLAKNGNLSNFCVNFEQISQFHT  60

Query  2519  gryrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMR  2340
               +R   S       + +++      G +G   R         + +R V V+ ++AS  R
Sbjct  61    NPFRVSASGHVFDDALKASQVPSWSFGQSGVISRSYSVG----TTSRGVSVIARLASKFR  116

Query  2339  SHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTV  2160
             + STS E +VN+ +F++ Y+QGG+NVKP+ +ER +  E+VV    +++  R+E++D+   
Sbjct  117   NLSTSIETRVNENNFERIYVQGGINVKPVTVERIDKDENVV----REEESRIEVSDEKQN  172

Query  2159  NKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQ  1980
               N         +  +RE S++EK+AWKLL+ +VV YCG PVGTVAANDP DK  LNYDQ
Sbjct  173   ISNQEGLDEAKVVNAQREYSDIEKDAWKLLRDSVVTYCGTPVGTVAANDPGDKQTLNYDQ  232

Query  1979  VFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPL  1800
             VFIRDF+PSALAFLL GEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+PL
Sbjct  233   VFIRDFVPSALAFLLKGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPL  292

Query  1799  DGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRL  1620
             DG   ++E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTG+++
Sbjct  293   DG--NKYEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGLKM  350

Query  1619  ILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTK  1440
             ILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML +ND + 
Sbjct  351   ILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLALNDGSN  410

Query  1439  SLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVN  1260
              LV AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS +A NKFNIYP+QIP W+++
Sbjct  411   ILVRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTEATNKFNIYPEQIPLWLMD  470

Query  1259  WIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMP  1080
             WIPE GGY +GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN S+LN IE KWDDL+  MP
Sbjct  471   WIPEEGGYFIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNDSVLNLIEAKWDDLVGHMP  530

Query  1079  LKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAV  900
             LKICYPALE E+WRIITGSDPKNTPWSYHN GSWPTLLWQFTLAC+KMG+ +LA KA  +
Sbjct  531   LKICYPALEFEEWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACLKMGRIDLAQKAADL  590

Query  899   AEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYE  720
             AE+RL  D+WPEYYDTR G+FIGKQ+RL QTWT+AGYLT+KMLL+NP+ A+LL W+EDYE
Sbjct  591   AEKRLRSDRWPEYYDTRTGKFIGKQSRLYQTWTIAGYLTTKMLLENPEKAALLFWDEDYE  650

Query  719   LLENCVCGLKYNGRRKCSRFGVRSQV  642
             LLE CVC L  +GR+KCSR   +SQ+
Sbjct  651   LLEICVCALSKSGRKKCSRGAAKSQI  676



>ref|XP_011087506.1| PREDICTED: LOW QUALITY PROTEIN: alkaline/neutral invertase CINV2 
[Sesamum indicum]
Length=670

 Score =   898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/678 (66%), Positives = 526/678 (78%), Gaps = 20/678 (3%)
 Frame = -3

Query  2657  MKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggryrhrHSVVTLTR  2478
             MKPC RIL    ++    PF         N +     + D H            V     
Sbjct  9     MKPCCRILLPCRNT----PFLGVPIPKSSNFASHTNCLFDSHFSAPNDRTSSPRVFVFKT  64

Query  2477  VINSNRCAFCGSGSNGDQHR----DSFCNWLGRSKNRLVFVVPKVASDMRSHSTSTEAQV  2310
             ++  ++       SN  Q R       CN+  R+     ++V  VAS+++S STS E +V
Sbjct  65    ILGQSQKPNSAPNSNWSQSRIFSTTCGCNFSKRAH----YLVGSVASNVKSFSTSIETRV  120

Query  2309  NDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNGSSI  2130
             NDK+F++ Y+QGG+NVKPLV +     + V     +K+  R+E+ D     KN+ N    
Sbjct  121   NDKNFERIYVQGGLNVKPLVEKIDLDEDAV-----KKEDDRIEVKDVENDVKNE-NLKEA  174

Query  2129  SKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSA  1950
                   +E SE+EK+AWKLL+ +VV YCG PVGT+AANDP DK PLNYDQVFIRDF+PSA
Sbjct  175   ESADAAKEESEIEKDAWKLLRDSVVTYCGSPVGTLAANDPNDKQPLNYDQVFIRDFVPSA  234

Query  1949  LAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDV  1770
              AFLL GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR++ LD  + +FE+V
Sbjct  235   FAFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSVALD--DNKFEEV  292

Query  1769  LDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGF  1590
             LDPDFGESAIGRVAPVDSGLWWIILLRAYVK+TGD  L ER DVQTGI+LI+NLCL DGF
Sbjct  293   LDPDFGESAIGRVAPVDSGLWWIILLRAYVKLTGDSGLNERGDVQTGIKLIINLCLSDGF  352

Query  1589  DMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRL  1410
             DMFP+LLVTDGSCMIDRRMGIHGHPLEIQ+LFYSALRC REML ++D +K+LV AINNRL
Sbjct  353   DMFPSLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCAREMLALDDGSKNLVRAINNRL  412

Query  1409  SALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLV  1230
             SALSFHIREYYWVD+KKINEIYRYKTEEYS +A NKFNIYP+QIP W+++WIPE GGYL+
Sbjct  413   SALSFHIREYYWVDLKKINEIYRYKTEEYSTEATNKFNIYPEQIPHWLMHWIPEEGGYLI  472

Query  1229  GNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEG  1050
             GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN++ILN IE KWDDLIAQMPLKIC+PALE 
Sbjct  473   GNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILNLIEAKWDDLIAQMPLKICFPALES  532

Query  1049  EDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQW  870
             EDWRIITG DPKNTPWSYHNGGSWPTLLWQFTLAC+KMG+ +LA KA+ +AE RLP+D+W
Sbjct  533   EDWRIITGCDPKNTPWSYHNGGSWPTLLWQFTLACMKMGRTDLAKKAIDIAERRLPLDRW  592

Query  869   PEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLK  690
             PEYYDTR+G+FIGKQARL QTW+VAGYLTSK+LL+NP+MASLL W EDY+LLE CVC L 
Sbjct  593   PEYYDTRNGKFIGKQARLYQTWSVAGYLTSKLLLENPNMASLLFWEEDYDLLEICVCALS  652

Query  689   YNGRRKCSRFGVRSQVGV  636
              + R+KCSR   +SQ+ V
Sbjct  653   NSSRKKCSRRLAKSQILV  670



>ref|XP_009373311.1| PREDICTED: alkaline/neutral invertase CINV2-like [Pyrus x bretschneideri]
Length=679

 Score =   898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/585 (74%), Positives = 499/585 (85%), Gaps = 11/585 (2%)
 Frame = -3

Query  2390  SKNRLVFVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvet  2211
             + +R V V+  +AS  R+ STS E +VND +F++ Y+QGG+NVKPLV    +    V   
Sbjct  106   TTSRGVSVIASLASRFRNLSTSIETRVNDNNFERIYVQGGINVKPLVERIDKGENIVG--  163

Query  2210  yEQKDGGRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVG  2031
                ++  R+E+ D+       LN +++  ++PERE S++EKEAW+LL+ +VV YCG PVG
Sbjct  164   ---EEESRIEVGDEK--KSESLNEATV--VSPEREYSDIEKEAWRLLRDSVVMYCGNPVG  216

Query  2030  TVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYS  1851
             TVAAN+P DK  LNYDQVFIRDF+PSALAFLL GEGEIV+NFLLHTLQLQSWEKTVDCYS
Sbjct  217   TVAANEPGDKQLLNYDQVFIRDFVPSALAFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYS  276

Query  1850  PGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKIT  1671
             PGQGLMPASFKVRT+PLDG   + E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KIT
Sbjct  277   PGQGLMPASFKVRTVPLDG--NKIEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKIT  334

Query  1670  GDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFY  1491
             GDY LQERVDVQTG+++ILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFY
Sbjct  335   GDYGLQERVDVQTGLKMILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFY  394

Query  1490  SALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDA  1311
             SALRC+REML VND +K+LV AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS +A
Sbjct  395   SALRCSREMLGVNDGSKNLVRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTEA  454

Query  1310  INKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKS  1131
              NKFNIYPDQIP W+++WIPE GGYL+GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN +
Sbjct  455   TNKFNIYPDQIPLWLMDWIPEEGGYLIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNDA  514

Query  1130  ILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTL  951
             ILN IE KWDDL+  MPLKI YPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTL
Sbjct  515   ILNLIEAKWDDLVGHMPLKISYPALEFEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTL  574

Query  950   ACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKML  771
             ACIKMG+ ELA KA A+AE+RL  D+WPEYYDTR G+FIGKQ+RL QTWT+AG+LT+KML
Sbjct  575   ACIKMGRIELAQKAAALAEKRLRSDRWPEYYDTRTGKFIGKQSRLYQTWTIAGFLTTKML  634

Query  770   LKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             L+NP+ A+LL W+EDYELLE CVC L  +GR+KCSR   +SQ+ V
Sbjct  635   LENPEKAALLFWDEDYELLEICVCALSKSGRKKCSRGAAKSQILV  679



>gb|KHN02814.1| Cell cycle checkpoint protein RAD1 [Glycine soja]
Length=955

 Score =   898 bits (2320),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/571 (75%), Positives = 484/571 (85%), Gaps = 22/571 (4%)
 Frame = -3

Query  2345  MRSHSTSTEAQVNDKSFKKFYIQGGMN-VKPLviertetredvvetyEQKDGGRVEITDD  2169
             +R+ S S E ++ND +F++ Y+QGGMN VKPLV+E                   V   D+
Sbjct  90    VRNFSNSVETRINDNNFERIYVQGGMNNVKPLVVEG------------------VHKDDE  131

Query  2168  STVNKNDLNGSSISKLAPER-EVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPL  1992
             S   + +L G   + +   + E SEVEKEAWKLLQGAVV YCG PVGT+AANDP DKLPL
Sbjct  132   SVAGEKNLGGDVNASVGKSKGEDSEVEKEAWKLLQGAVVTYCGNPVGTMAANDPGDKLPL  191

Query  1991  NYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR  1812
             NYDQVFIRDFIPSALAFLL GE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR
Sbjct  192   NYDQVFIRDFIPSALAFLLRGESEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR  251

Query  1811  TMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQT  1632
             T+ LD  N   E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY K+TGDY+LQER DVQT
Sbjct  252   TVALDEDN--HEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYSLQERADVQT  309

Query  1631  GIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVN  1452
             G+++ILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML+  
Sbjct  310   GLKMILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVAT  369

Query  1451  DSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPP  1272
             D TK+L+ AINNRLSALSFHIREYYWVDMKK+NEIYRYKTEEYSMDAINKFNIYP+QIP 
Sbjct  370   DGTKNLIRAINNRLSALSFHIREYYWVDMKKMNEIYRYKTEEYSMDAINKFNIYPEQIPL  429

Query  1271  WIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLI  1092
             W+++WIPE GGYL+GNLQPAHMDFRFF+LGNLW+I+SSLGT  QN +ILN IE KWDDL+
Sbjct  430   WLMDWIPEEGGYLIGNLQPAHMDFRFFSLGNLWSIVSSLGTPRQNHAILNLIEAKWDDLV  489

Query  1091  AQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMK  912
               MPLKICYPAL+ E+WRI+TG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ ELA K
Sbjct  490   GHMPLKICYPALDNEEWRIVTGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRIELAQK  549

Query  911   AVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWN  732
             AVA+A++RLPVD WPEYYDTR G+FIGKQAR+ QTWT+AG+LTSKMLLKNP+MAS+L W 
Sbjct  550   AVALADKRLPVDSWPEYYDTRTGKFIGKQARMYQTWTIAGFLTSKMLLKNPEMASMLFWE  609

Query  731   EDYELLENCVCGLKYNGRRKCSRFGVRSQVG  639
             EDYELL+ CVCGL  +GR++CSR    S+ G
Sbjct  610   EDYELLDICVCGLSKSGRKRCSRGAASSRKG  640



>ref|XP_009337633.1| PREDICTED: alkaline/neutral invertase CINV2 [Pyrus x bretschneideri]
Length=676

 Score =   897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/585 (74%), Positives = 496/585 (85%), Gaps = 11/585 (2%)
 Frame = -3

Query  2390  SKNRLVFVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvet  2211
             + +R V V+  +AS  R+ STS E +VND +F+K Y+QGG+NVKPLV    +    V   
Sbjct  103   TASRGVSVIASLASRFRNLSTSIETRVNDNNFEKIYVQGGINVKPLVERIDKDENIV---  159

Query  2210  yEQKDGGRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVG  2031
               +++  R+E+ D        LN +++  +  ERE S++EKEAW+LL+ +VV YCG PVG
Sbjct  160   --REEESRIEVGDGK--KSESLNEATV--VTSEREYSDIEKEAWRLLRDSVVTYCGNPVG  213

Query  2030  TVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYS  1851
             TVAANDP DK  LNYDQVFIRDF+PSALAFLL GEGEIV+NFLLHTLQLQSWEKTVDCYS
Sbjct  214   TVAANDPGDKQLLNYDQVFIRDFVPSALAFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYS  273

Query  1850  PGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKIT  1671
             PGQGLMPASFKVRT+PLDG   + E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KIT
Sbjct  274   PGQGLMPASFKVRTVPLDG--NKTEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKIT  331

Query  1670  GDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFY  1491
             GDY LQERVDVQTG+++ILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFY
Sbjct  332   GDYGLQERVDVQTGLKMILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFY  391

Query  1490  SALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDA  1311
             SALRC+REML VND +K+LV AINNRLSALSFHIREYYWVDMKK+NEIYRYKTEEYS +A
Sbjct  392   SALRCSREMLAVNDGSKNLVRAINNRLSALSFHIREYYWVDMKKMNEIYRYKTEEYSTEA  451

Query  1310  INKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKS  1131
              NKFNIYPDQIP W+++WIPE GGY +GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN +
Sbjct  452   TNKFNIYPDQIPLWLMDWIPEEGGYFIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNDA  511

Query  1130  ILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTL  951
             +LN IE KWDDL+  MPLKI YPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTL
Sbjct  512   VLNLIEAKWDDLVGHMPLKISYPALEFEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTL  571

Query  950   ACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKML  771
             ACIKMG+ ELA KA A+AE+RL  D+WPEYYDTR G+FIGKQARL QTWT+AG+LT+KML
Sbjct  572   ACIKMGRIELAQKAAALAEKRLRSDRWPEYYDTRTGKFIGKQARLYQTWTIAGFLTTKML  631

Query  770   LKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             L+NP+ A+LL W+EDYELLE CVC L  +GR+KCSR   +SQ+ V
Sbjct  632   LENPEKAALLFWDEDYELLEICVCALSKSGRKKCSRGAAKSQILV  676



>ref|XP_003555178.1| PREDICTED: alkaline/neutral invertase CINV2-like [Glycine max]
Length=652

 Score =   897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/572 (75%), Positives = 485/572 (85%), Gaps = 22/572 (4%)
 Frame = -3

Query  2345  MRSHSTSTEAQVNDKSFKKFYIQGGMN-VKPLviertetredvvetyEQKDGGRVEITDD  2169
             +R+ S S E ++ND +F++ Y+QGGMN VKPLV+E                   V   D+
Sbjct  101   VRNFSNSVETRINDNNFERIYVQGGMNNVKPLVVEG------------------VHKDDE  142

Query  2168  STVNKNDLNGSSISKLAPER-EVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPL  1992
             S   + +L G   + +   + E SEVEKEAWKLLQGAVV YCG PVGT+AANDP DKLPL
Sbjct  143   SVAGEKNLGGDVNASVGKSKGEDSEVEKEAWKLLQGAVVTYCGNPVGTMAANDPGDKLPL  202

Query  1991  NYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR  1812
             NYDQVFIRDFIPSALAFLL GE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR
Sbjct  203   NYDQVFIRDFIPSALAFLLRGESEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR  262

Query  1811  TMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQT  1632
             T+ LD  N   E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY K+TGD +LQER DVQT
Sbjct  263   TVALDEDN--HEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDCSLQERADVQT  320

Query  1631  GIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVN  1452
             G+++ILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML+  
Sbjct  321   GLKMILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVAT  380

Query  1451  DSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPP  1272
             D TK+L+ AINNRLSALSFHIREYYWVDMKK+NEIYRYKTEEYSMDAINKFNIYP+QIP 
Sbjct  381   DGTKNLIRAINNRLSALSFHIREYYWVDMKKMNEIYRYKTEEYSMDAINKFNIYPEQIPL  440

Query  1271  WIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLI  1092
             W+++WIPE GGYL+GNLQPAHMDFRFF+LGNLW+I+SSLGT  QN +ILN IE KWDDL+
Sbjct  441   WLMDWIPEEGGYLIGNLQPAHMDFRFFSLGNLWSIVSSLGTPRQNHAILNLIEAKWDDLV  500

Query  1091  AQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMK  912
               MPLKICYPAL+ E+WRI+TG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ ELA K
Sbjct  501   GHMPLKICYPALDNEEWRIVTGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRIELAQK  560

Query  911   AVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWN  732
             AVA+AE+RLPVD WPEYYDTR G+FIGKQAR+ QTWT+AG+LTSKMLLKNP+MAS+L W 
Sbjct  561   AVALAEKRLPVDSWPEYYDTRTGKFIGKQARMYQTWTIAGFLTSKMLLKNPEMASMLFWE  620

Query  731   EDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             EDYELL+ CVCGL  +GR++CSR   RSQ+ V
Sbjct  621   EDYELLDICVCGLSKSGRKRCSRGAARSQIRV  652



>ref|XP_009335501.1| PREDICTED: alkaline/neutral invertase CINV2-like [Pyrus x bretschneideri]
Length=679

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/585 (74%), Positives = 497/585 (85%), Gaps = 11/585 (2%)
 Frame = -3

Query  2390  SKNRLVFVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvet  2211
             + +R V V+  +AS  R+ STS E +VND +F++ Y+QGG+NVKPLV    +    V   
Sbjct  106   TTSRGVSVIASLASRFRNLSTSIETRVNDNNFERIYVQGGINVKPLVERIDKGENIVG--  163

Query  2210  yEQKDGGRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVG  2031
                ++  R+E+ D+       LN +++  L  ERE S++EKEAW+LL+ +VV YCG PVG
Sbjct  164   ---EEESRIEVGDEK--KSESLNEATVVSL--EREYSDIEKEAWRLLRDSVVMYCGNPVG  216

Query  2030  TVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYS  1851
             TVAAN+P DK  LNYDQVFIRDF+PSALAFLL GEGEIV+NFLLHTLQLQSWEKTVDCYS
Sbjct  217   TVAANEPGDKQLLNYDQVFIRDFVPSALAFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYS  276

Query  1850  PGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKIT  1671
             PGQGLMPASFKVRT+PLDG   + E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KIT
Sbjct  277   PGQGLMPASFKVRTVPLDG--NKIEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKIT  334

Query  1670  GDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFY  1491
             GDY LQERVDVQTG+++ILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFY
Sbjct  335   GDYGLQERVDVQTGLKMILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFY  394

Query  1490  SALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDA  1311
             SALRC+REML VND +K+LV AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS +A
Sbjct  395   SALRCSREMLGVNDGSKNLVRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTEA  454

Query  1310  INKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKS  1131
              NKFNIYPDQIP W+++WIPE GGYL+GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN +
Sbjct  455   TNKFNIYPDQIPLWLMDWIPEEGGYLIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNDA  514

Query  1130  ILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTL  951
             +LN IE KWDDL+  MPLKI YPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTL
Sbjct  515   VLNLIEAKWDDLVGHMPLKISYPALEFEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTL  574

Query  950   ACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKML  771
             ACIKMG+ ELA KA A+AE+RL  D+WPEYYDTR G+FIGKQ+RL QTWT+AG+LT+KML
Sbjct  575   ACIKMGRIELAQKAAALAEKRLRSDRWPEYYDTRTGKFIGKQSRLYQTWTIAGFLTTKML  634

Query  770   LKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             L+NP+ A+LL W+EDYELLE CVC L  +GR+KCSR   +SQ+ V
Sbjct  635   LENPEKAALLFWDEDYELLEICVCALSKSGRKKCSRGAAKSQILV  679



>ref|XP_008370364.1| PREDICTED: alkaline/neutral invertase CINV2-like [Malus domestica]
Length=676

 Score =   894 bits (2311),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/585 (74%), Positives = 494/585 (84%), Gaps = 11/585 (2%)
 Frame = -3

Query  2390  SKNRLVFVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvet  2211
             + +R V V+  +AS  R+ STS E +VND +F+K Y+QGG+NVKPLV    +    V   
Sbjct  103   TASRGVSVIASLASRFRNLSTSIETRVNDNNFEKIYVQGGINVKPLVERIDKDENIVGG-  161

Query  2210  yEQKDGGRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVG  2031
                 +  R+E+ D        LN +++  +  ERE S++EKEAW+LL+ +VV YCG PVG
Sbjct  162   ----EESRIEVGDGK--KSESLNEATV--VTSEREYSDIEKEAWRLLRDSVVTYCGNPVG  213

Query  2030  TVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYS  1851
             TVAANDP DK  LNYDQVFIRDF+PSALAFLL GEGEIV+NFLLHTLQLQSWEKTVDCYS
Sbjct  214   TVAANDPGDKQLLNYDQVFIRDFVPSALAFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYS  273

Query  1850  PGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKIT  1671
             PGQGLMPASFKVRT+PLDG   + E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KIT
Sbjct  274   PGQGLMPASFKVRTVPLDG--NKTEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKIT  331

Query  1670  GDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFY  1491
             GDY LQERVDVQTG+++ILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFY
Sbjct  332   GDYGLQERVDVQTGLKMILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFY  391

Query  1490  SALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDA  1311
             SALRC+REML VND +K+LV AINNRLSALSFHIREYYWVDMKK+NEIYRYKTEEYS +A
Sbjct  392   SALRCSREMLAVNDGSKNLVRAINNRLSALSFHIREYYWVDMKKMNEIYRYKTEEYSTEA  451

Query  1310  INKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKS  1131
              NKFNIYPDQIP W+++WIPE GGY +GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN +
Sbjct  452   TNKFNIYPDQIPLWLMDWIPEEGGYFIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNDA  511

Query  1130  ILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTL  951
             +LN IE KWDDL+  MPLKI YPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTL
Sbjct  512   VLNLIEAKWDDLVGHMPLKISYPALEFEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTL  571

Query  950   ACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKML  771
             ACIKMG+ ELA KA A+AE+RL  D+WPEYYDTR G+FIGKQARL QTWT+AG+LT+KML
Sbjct  572   ACIKMGRIELAQKAAALAEKRLRSDRWPEYYDTRTGKFIGKQARLYQTWTIAGFLTTKML  631

Query  770   LKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             L+NP+ A+LL W+EDYELLE CVC L  +GR+KCSR   +SQ+ V
Sbjct  632   LENPEKAALLFWDEDYELLEICVCALSKSGRKKCSRGAAKSQILV  676



>ref|XP_010553709.1| PREDICTED: alkaline/neutral invertase CINV2 [Tarenaya hassleriana]
Length=659

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/578 (74%), Positives = 495/578 (86%), Gaps = 13/578 (2%)
 Frame = -3

Query  2345  MRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDS  2166
             +R  STS E  V DK+F++ Y+Q G++ KPLV+ER +  E++V     ++  R EI ++ 
Sbjct  86    VREFSTSVETHVGDKNFERIYVQNGISSKPLVVERIDKDEEIVGG---QEESRAEIDNNG  142

Query  2165  TVNKNDLNGSSISKLAPE--------REVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDP  2010
                KN ++ +  S    E        RE S+ EKEAW+LL+ AVV YCG PVGTVAANDP
Sbjct  143   DSAKNSVSSAGFSLENVETLRGKKNTREESDAEKEAWRLLENAVVRYCGSPVGTVAANDP  202

Query  2009  ADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMP  1830
             ADK PLNYDQVFIRDF+PSALAFLL GE EIV+NFLLHTLQLQSWEKTVDCYSPGQGLMP
Sbjct  203   ADKQPLNYDQVFIRDFVPSALAFLLKGEREIVRNFLLHTLQLQSWEKTVDCYSPGQGLMP  262

Query  1829  ASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQE  1650
             ASFKVRT+P+D  N E  DVLDPDFGESAIGRVAPVDSGLWWIILLRAY K+TGDY+LQE
Sbjct  263   ASFKVRTVPIDENNTE--DVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYSLQE  320

Query  1649  RVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTR  1470
             R+DVQTGI+L++ LCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+R
Sbjct  321   RIDVQTGIKLVMKLCLADGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSR  380

Query  1469  EMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIY  1290
             EML +N+S++ L  AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS +A NKFNIY
Sbjct  381   EMLSINESSQDLTRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTEATNKFNIY  440

Query  1289  PDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEG  1110
             PDQIPPW+++WIPE GGYL+GNLQPAHMDFRFFTLGNLW+IISSLGT +QN++ILN IE 
Sbjct  441   PDQIPPWLMDWIPEQGGYLIGNLQPAHMDFRFFTLGNLWSIISSLGTPKQNEAILNLIEA  500

Query  1109  KWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGK  930
             KW+D+I  MPLKICYPALE ++WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLAC+KMG+
Sbjct  501   KWEDIIGHMPLKICYPALEYDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACMKMGR  560

Query  929   PELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMA  750
             PELA KA++VAE+RLP D+WPEYYDTR G+FIGKQ+RL+QTWT++G+LTSK+LL+NP+MA
Sbjct  561   PELAEKALSVAEKRLPGDRWPEYYDTRTGKFIGKQSRLHQTWTISGFLTSKLLLENPEMA  620

Query  749   SLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             SLL W+EDYELLE CVC L   GR+KCSR   ++Q+ V
Sbjct  621   SLLFWDEDYELLEICVCALSKTGRKKCSRVAAKTQILV  658



>ref|XP_004495636.1| PREDICTED: uncharacterized protein LOC101503498 [Cicer arietinum]
Length=635

 Score =   893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/620 (70%), Positives = 493/620 (80%), Gaps = 40/620 (6%)
 Frame = -3

Query  2495  VVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSHSTSTEA  2316
             +    R +N +   F    SN    R    ++   S+NR+V  + +V   ++S STS E 
Sbjct  56    IFRFQRELNGSHKLFNSPSSNSITSR----SFRLSSENRVVSTIARVGFKLQSFSTSIET  111

Query  2315  QVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNGS  2136
             +VND +F++  IQGGMNVKPLV                     VE   ++ V +      
Sbjct  112   RVNDNNFERIIIQGGMNVKPLV---------------------VESVHENVVRE------  144

Query  2135  SISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIP  1956
                    E   S VEK+AWKLL+ AVV YCG PVGTVAANDP DKLPLNYDQVFIRDFIP
Sbjct  145   -------EESQSNVEKQAWKLLKDAVVTYCGNPVGTVAANDPGDKLPLNYDQVFIRDFIP  197

Query  1955  SALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFE  1776
             SALAFLL G+ EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+ LDG     E
Sbjct  198   SALAFLLKGDNEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVALDGDTR--E  255

Query  1775  DVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRD  1596
             +VLDPDFGESAIGRVAPVDSGLWWIILLRAY K+TGDY+LQERVDVQTG+++IL LCL D
Sbjct  256   EVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYSLQERVDVQTGLKMILKLCLTD  315

Query  1595  GFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINN  1416
             GFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+RE+L V D T  LV AINN
Sbjct  316   GFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREVLAVTDGTNDLVRAINN  375

Query  1415  RLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGY  1236
             RLSALSFHIR+YYWVDMKKINEIYRYKTEEYSMDAINKFNIYP+QIP W+++WIPE GGY
Sbjct  376   RLSALSFHIRQYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPEQIPFWVMDWIPEKGGY  435

Query  1235  LVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPAL  1056
             L+GNLQPAHMDFRFFTLGNLW+I+SSL T  QN++ILN IE KWDDL+  MPLKICYPAL
Sbjct  436   LIGNLQPAHMDFRFFTLGNLWSIVSSLSTPRQNEAILNLIEAKWDDLVGHMPLKICYPAL  495

Query  1055  EGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVD  876
             + E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ ELA KAV +AE+RLPVD
Sbjct  496   DNEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRIELAQKAVDLAEKRLPVD  555

Query  875   QWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCG  696
              WPEYYDTR G+FIGKQARL QTWT+AG+LTSKMLLKNP MAS+L   EDYELL+ CVCG
Sbjct  556   SWPEYYDTRSGKFIGKQARLYQTWTIAGFLTSKMLLKNPKMASMLFCEEDYELLDICVCG  615

Query  695   LKYNGRRKCSRFGVRSQVGV  636
             L  +GR+KCSR   +SQ+ V
Sbjct  616   LSKSGRKKCSRVAAKSQILV  635



>ref|XP_010486160.1| PREDICTED: alkaline/neutral invertase CINV2-like [Camelina sativa]
 ref|XP_010486161.1| PREDICTED: alkaline/neutral invertase CINV2-like [Camelina sativa]
Length=667

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/680 (67%), Positives = 525/680 (77%), Gaps = 26/680 (4%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M SRSCI +S MKPC R L S+  S   + F   N   + N SK       +H    G  
Sbjct  1     MNSRSCICVSAMKPCCRFLISFKSSSL-FGFSPPNSGRLINSSK-------LHCTKIGSR  52

Query  2510  rhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSHS  2331
               R  +       + +     G GS   + R S  +  GR   R V ++P+VASD R+HS
Sbjct  53    SIRSGIHCRRNAFSDSDSIILGGGSRVLKARGSSSSSRGRGCRRGVLLIPRVASDFRNHS  112

Query  2330  TST-EAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNK  2154
             +S+ ++ VNDKSF++ +      VKPLV +  E  E++        GG+     +  V +
Sbjct  113   SSSLDSHVNDKSFERMF------VKPLVFKDVEKSEEIFNKESGNGGGKDANFGNVGVRR  166

Query  2153  NDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVF  1974
                 GSS          +EVEKEAWKLL+GAVVNYCG+PVGTVAANDP DK  LNYDQVF
Sbjct  167   ETERGSS---------QTEVEKEAWKLLRGAVVNYCGFPVGTVAANDPGDKQTLNYDQVF  217

Query  1973  IRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDG  1794
             IRDF+PSA AFLL+GEGEIV+NFLLHTLQLQSWEKTVDC+SPG GLMPASFKV++ PL+G
Sbjct  218   IRDFVPSAYAFLLDGEGEIVRNFLLHTLQLQSWEKTVDCHSPGPGLMPASFKVKSAPLEG  277

Query  1793  RNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLIL  1614
              +G FED LDPDFG SAIGRV+PVDSGLWWIILLRAY K+TGDYTLQER+DVQTGI+LIL
Sbjct  278   NDGSFEDFLDPDFGGSAIGRVSPVDSGLWWIILLRAYGKLTGDYTLQERIDVQTGIKLIL  337

Query  1613  NLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSL  1434
              LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC REMLIVND TK+L
Sbjct  338   KLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMLIVNDGTKNL  397

Query  1433  VAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWI  1254
             VAA+NNRLSALSFHIREYYWVD+KKINEIYRY TEEYS DA NKFNIYPDQIP W+V+WI
Sbjct  398   VAAVNNRLSALSFHIREYYWVDIKKINEIYRYNTEEYSADATNKFNIYPDQIPTWLVDWI  457

Query  1253  PETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLK  1074
             P+ GGY +GNLQPAHMDFRFFTLGNLWA+ISSLG+ EQN+ ++  IE KWDDL+A MPLK
Sbjct  458   PDKGGYFIGNLQPAHMDFRFFTLGNLWAVISSLGSQEQNEGVMTLIEEKWDDLVANMPLK  517

Query  1073  ICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAE  894
             IC+PALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGK ELA KAVAVAE
Sbjct  518   ICFPALEKEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKLELAKKAVAVAE  577

Query  893   ERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELL  714
             +RL  D+WPEYYDT+ GRF+GKQ+RL QTWT+AG+L SK L++ P+ ASLL W EDY+LL
Sbjct  578   KRLKEDEWPEYYDTKSGRFVGKQSRLYQTWTIAGFLASKKLIEQPEKASLLFWEEDYQLL  637

Query  713   ENCVCGL-KYNGRR-KCSRF  660
             E CVCGL K  GR+ KCSRF
Sbjct  638   ETCVCGLSKSRGRKNKCSRF  657



>ref|XP_008388459.1| PREDICTED: alkaline/neutral invertase CINV2 [Malus domestica]
Length=676

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/585 (73%), Positives = 497/585 (85%), Gaps = 11/585 (2%)
 Frame = -3

Query  2390  SKNRLVFVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvet  2211
             + +R V V+  +AS  R+ STS E +VN+ +F++ Y+QGG+NVKPLV    +    V   
Sbjct  103   TTSRGVSVIASLASRFRNLSTSIETRVNENNFERIYVQGGINVKPLVERXDKDENIVG--  160

Query  2210  yEQKDGGRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVG  2031
                ++  R+E++D+       LN +++  ++PERE S++EKEAW+LL+ +VV YCG PVG
Sbjct  161   ---EEESRIEVSDEK--KSESLNEATV--VSPEREYSDIEKEAWRLLRDSVVTYCGNPVG  213

Query  2030  TVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYS  1851
             TVAAN+P DK  LNYDQVFIRDF+PSALAFLL GEGEIV+NFLLHTLQLQSWEKTVDCYS
Sbjct  214   TVAANEPGDKQLLNYDQVFIRDFVPSALAFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYS  273

Query  1850  PGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKIT  1671
             PGQGLMPASFKV T+PLDG   + E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KIT
Sbjct  274   PGQGLMPASFKVXTVPLDG--NKIEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKIT  331

Query  1670  GDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFY  1491
             GDY LQERVDVQTG+++ILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQ LFY
Sbjct  332   GDYGLQERVDVQTGLKMILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQTLFY  391

Query  1490  SALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDA  1311
             SALRC+REML VND +K+LV AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS +A
Sbjct  392   SALRCSREMLGVNDGSKNLVRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTEA  451

Query  1310  INKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKS  1131
              NKFNIYPDQIP W+++WIPE GGY +GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN +
Sbjct  452   TNKFNIYPDQIPLWLMDWIPEEGGYFIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNDA  511

Query  1130  ILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTL  951
             +LNFIE KWDDL+  MPLKI YPALE  +WRIITGSDPKNTPWSYHNGGSWPTLLWQFTL
Sbjct  512   VLNFIEAKWDDLVGHMPLKISYPALEFXEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTL  571

Query  950   ACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKML  771
             ACIKMG+ ELA KA A+AE+RL  D+WPEYYDTR G+FIGKQ+RL QTWT+AG+LT+KML
Sbjct  572   ACIKMGRIELAQKAAALAEKRLRSDRWPEYYDTRTGKFIGKQSRLYQTWTIAGFLTTKML  631

Query  770   LKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             L+NP+ A+LL W+EDYELLE CVC L  +GR+KCSR   +SQ+ V
Sbjct  632   LENPEKAALLFWDEDYELLEICVCALSKSGRKKCSRGAAKSQILV  676



>gb|KCW60577.1| hypothetical protein EUGRSUZ_H03308 [Eucalyptus grandis]
Length=669

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/629 (70%), Positives = 512/629 (81%), Gaps = 27/629 (4%)
 Frame = -3

Query  2480  RVINSNRCAFCGSGSNGDQHRDSFC---NWLGRSKNRLVFVVPK----------VASDMR  2340
             R++++NRC     G   ++ R  FC   +  GRS + L     +          VA+ +R
Sbjct  54    RLLHANRCRAVNVGRAVEEVRTGFCFAGSGFGRSGDLLKSHGLRGNVSHRGAVVVANAVR  113

Query  2339  SHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDST-  2163
             S STS E +VND +F++ Y+QGGMN KPLV+ER +  E++V      +   +E+ DD+  
Sbjct  114   SLSTSVETRVNDNNFERIYVQGGMNAKPLVVERIDKDENIVG----GEDSSIEVVDDNID  169

Query  2162  VNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
             + K+  + +  + +  +RE S+VEKEAW+LL+ A+V YCG PVGT+AANDP DK PLNYD
Sbjct  170   LEKSQASLNEFNDVGAKREESQVEKEAWRLLEEAIVMYCGSPVGTMAANDPGDKQPLNYD  229

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             QVFIRDF+PSALAFLL GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+P
Sbjct  230   QVFIRDFVPSALAFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVP  289

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LD    + E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGI+
Sbjct  290   LD--ENKVEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIK  347

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             LI+NLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFY+ALRC+REML VND +
Sbjct  348   LIMNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYNALRCSREMLSVNDGS  407

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
             K+LV AINNRLSALSFHIREYYWVDM+KINEIYRYKTEEYS DA NKFNIYPDQIP W++
Sbjct  408   KNLVRAINNRLSALSFHIREYYWVDMRKINEIYRYKTEEYSTDATNKFNIYPDQIPLWLM  467

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
             +WIPE GGYL+GNLQPAHMDFR FTLGNLW+I+SSLGT +QN++ILN IE KWDDLI  M
Sbjct  468   DWIPENGGYLIGNLQPAHMDFRLFTLGNLWSIVSSLGTPKQNEAILNLIEAKWDDLIGHM  527

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVA  903
             PLKICYPALE EDWRIITGSDPKNTPWSYHNGGSWPTLLWQ       MG+PELA KAVA
Sbjct  528   PLKICYPALENEDWRIITGSDPKNTPWSYHNGGSWPTLLWQ-------MGRPELAEKAVA  580

Query  902   VAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDY  723
             +AE+RL  D+WPEYYDTR GRFIGKQ+RL QTWT+AG+LTSKMLL+NP+ AS L W EDY
Sbjct  581   LAEKRLSEDRWPEYYDTRTGRFIGKQSRLFQTWTIAGFLTSKMLLENPETASNLFWEEDY  640

Query  722   ELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             ELLE CVC L  +GRRKCSR   RSQ+ V
Sbjct  641   ELLEICVCALSKSGRRKCSRGAARSQILV  669



>gb|ADF27783.1| neutral/alkaline invertase 2 [Orobanche ramosa]
Length=666

 Score =   889 bits (2296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/582 (73%), Positives = 502/582 (86%), Gaps = 16/582 (3%)
 Frame = -3

Query  2387  KNRLVFVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvety  2208
             K R  F    +AS ++++STS E +VND  F++ Y+QGG+N+KP+V+E+ E  E+VV+  
Sbjct  99    KPRYTFTA--LASHVKNYSTSVETRVNDSKFERIYVQGGVNLKPVVVEKVELDENVVKKD  156

Query  2207  EQKDGGRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGT  2028
             +     R+E+  + +           +++   RE S VEKEAW+LL+ AVV+YCG PVGT
Sbjct  157   DDD-DVRIEVEYEKS-----------NEIRVCREESGVEKEAWRLLRNAVVSYCGSPVGT  204

Query  2027  VAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSP  1848
             +AANDP DKLPLNYDQVFIRDF+PSA AFLL GEGEIV+NFLLHTLQLQSWEKTVDCYSP
Sbjct  205   LAANDPNDKLPLNYDQVFIRDFVPSAFAFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYSP  264

Query  1847  GQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITG  1668
             GQGLMPASFKVRT+ LD  + +FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY K+TG
Sbjct  265   GQGLMPASFKVRTVALD--DNKFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTG  322

Query  1667  DYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYS  1488
             DY LQERVDVQTG++LILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHG+PLEIQALFYS
Sbjct  323   DYALQERVDVQTGMKLILNLCLSDGFDMFPSLLVTDGSCMIDRRMGIHGYPLEIQALFYS  382

Query  1487  ALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAI  1308
             ALRC+REML + DS+K+LV AINNRLSALSFHIREYYWVD+KKINEIYRYKTEEYS +A 
Sbjct  383   ALRCSREMLALEDSSKNLVRAINNRLSALSFHIREYYWVDLKKINEIYRYKTEEYSTEAT  442

Query  1307  NKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSI  1128
             NKFNIYP+QIP W+++WIPE GGYL+GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN++I
Sbjct  443   NKFNIYPEQIPDWLMHWIPERGGYLIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAI  502

Query  1127  LNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLA  948
             LN +E KWDDLI QMPLKICYPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLA
Sbjct  503   LNLVEAKWDDLIGQMPLKICYPALESEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLA  562

Query  947   CIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLL  768
             C+KMG+ +LA KA+  AE+RLPVDQWPEYYDTR+G+FIGKQARL QTW++AGYLTSKMLL
Sbjct  563   CMKMGRTDLAEKAINSAEKRLPVDQWPEYYDTRNGKFIGKQARLYQTWSIAGYLTSKMLL  622

Query  767   KNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQV  642
             +NP+MAS+L W+EDY+LLE CVC L  + R+KCSR   +SQ+
Sbjct  623   ENPEMASVLFWDEDYDLLEICVCALSSSTRKKCSRMLAKSQI  664



>gb|EYU38407.1| hypothetical protein MIMGU_mgv1a002478mg [Erythranthe guttata]
Length=668

 Score =   889 bits (2296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/581 (73%), Positives = 501/581 (86%), Gaps = 4/581 (1%)
 Frame = -3

Query  2372  FVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGG-MNVKPLviertetredvvetyEQ-K  2199
             +VV  +ASD+R+ STS E +VNDK+F++ Y+ GG +NVKP+V+E+ +  E++V+  E+ K
Sbjct  90    YVVATLASDIRNFSTSIETRVNDKNFERIYVHGGDLNVKPVVVEKIDLDENIVKNEEEGK  149

Query  2198  DGGRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAA  2019
              G   E   +  +    LNG   S     RE SEVEKEAW+LL+ AVV+YCG PVGTVAA
Sbjct  150   KGIEFEEIGNCELKNEGLNGEIESVEVIGREESEVEKEAWRLLRNAVVSYCGSPVGTVAA  209

Query  2018  NDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQG  1839
             NDP DK+PLNYDQVFIRDFIPSA AFLL GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQG
Sbjct  210   NDPNDKMPLNYDQVFIRDFIPSAFAFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQG  269

Query  1838  LMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYT  1659
             LMPASFKVRT+ LD  + +FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY K+TGDYT
Sbjct  270   LMPASFKVRTVALD--DNKFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYT  327

Query  1658  LQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALR  1479
             LQERVDVQTGI+LILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQ+LFYS+LR
Sbjct  328   LQERVDVQTGIKLILNLCLSDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQSLFYSSLR  387

Query  1478  CTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKF  1299
             C REML   + +K+LV A+NNRLSALSFHIREYYWVD+KKINEIYRYKTEEYS +A NKF
Sbjct  388   CAREMLTPEEGSKNLVRAVNNRLSALSFHIREYYWVDLKKINEIYRYKTEEYSTEATNKF  447

Query  1298  NIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNF  1119
             NIYP+QIP W+++WIPE GGY++GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN++ILN 
Sbjct  448   NIYPEQIPDWLMHWIPEEGGYMIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILNM  507

Query  1118  IEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIK  939
             IE KWDDLI QMPLKICYPAL+ E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLAC+K
Sbjct  508   IEAKWDDLIGQMPLKICYPALKKEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACMK  567

Query  938   MGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNP  759
             MG+ +LA KA+ +AE+RL  D WPEYYDT++G+FIGKQARL QTW++AG+LTSKMLL+ P
Sbjct  568   MGRQDLAKKAIDLAEKRLSADHWPEYYDTKNGKFIGKQARLYQTWSIAGFLTSKMLLEKP  627

Query  758   DMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             ++AS+L W EDY+LLENC+C L  + R+KCSR   +SQ+ V
Sbjct  628   ELASVLYWEEDYDLLENCICALSSSTRKKCSRMLAKSQILV  668



>ref|XP_010674559.1| PREDICTED: alkaline/neutral invertase CINV2 [Beta vulgaris subsp. 
vulgaris]
Length=667

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/684 (65%), Positives = 534/684 (78%), Gaps = 20/684 (3%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGR-CNRQVMDNLSKSQQKIKDVhrmgggr  2514
             M+  +      MKPC RIL +  +   + P  + C      NL        +        
Sbjct  1     MIPNNGFLFGKMKPCCRILSTCRNLTSFVPQPQICPHLTSGNLLNFGYNFVN----NHKI  56

Query  2513  yrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSH  2334
             + +   +   + VI+  +   C + ++  Q R   C+ +G  +N L+  V   A D+R+ 
Sbjct  57    HSYPFQLPGFSCVIHHTQKNSCLNQASIGQFR--LCSRVGLGRNGLL--VGCAAYDVRNC  112

Query  2333  STSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNK  2154
             ST  +++VNDK+F+  YI+GG+NV+PLV+E+T+  E  +   + + GG VE        K
Sbjct  113   STKVDSKVNDKNFESVYIKGGVNVEPLVVEKTDEDEGHLREKQGEVGGDVE------GEK  166

Query  2153  NDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVF  1974
              DLN         +RE SE+EKEAW+LL+ AVV YC  P GTVAANDP DK PLNYDQVF
Sbjct  167   GDLNVE-----GRKREESEIEKEAWRLLRNAVVTYCNSPCGTVAANDPNDKTPLNYDQVF  221

Query  1973  IRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDG  1794
             +RDFIPSALAFL+ GEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV+T+PLDG
Sbjct  222   LRDFIPSALAFLMKGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVKTLPLDG  281

Query  1793  RNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLIL  1614
              NG+FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY K+TGD+TLQERVDVQTGIRL+L
Sbjct  282   DNGKFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDFTLQERVDVQTGIRLVL  341

Query  1613  NLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSL  1434
             NLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML  ++ +K+L
Sbjct  342   NLCLSDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLAEDEGSKNL  401

Query  1433  VAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWI  1254
             + AINNRLSALSFHIREYYWVD+KKINEIYRYKTEEYS DA NKFNIYP+QIP W+++WI
Sbjct  402   IRAINNRLSALSFHIREYYWVDVKKINEIYRYKTEEYSTDATNKFNIYPEQIPHWLMDWI  461

Query  1253  PETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLK  1074
             P  GGY++GNLQPAHMDFRFFTLGNLW+IISSLGT +QN+++LN IE KWDDLI  MPLK
Sbjct  462   PSEGGYMLGNLQPAHMDFRFFTLGNLWSIISSLGTPKQNQAVLNLIEVKWDDLIGHMPLK  521

Query  1073  ICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAE  894
             ICYPA+E E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ +LA KAV +AE
Sbjct  522   ICYPAVENEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRTDLAEKAVEMAE  581

Query  893   ERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELL  714
             ++L  D+WPEYYDTR+G+F+GKQARL QTWT+AG+LTSKMLL++P MASLL W+EDY+LL
Sbjct  582   KQLRADRWPEYYDTRYGKFVGKQARLYQTWTIAGFLTSKMLLQDPHMASLLYWDEDYDLL  641

Query  713   ENCVCGLKYNGRRKCSRFGVRSQV  642
             E CVC L  + R KCSR   +S +
Sbjct  642   EICVCALTKSSRTKCSRGVAKSHI  665



>gb|KHN16041.1| hypothetical protein glysoja_012017 [Glycine soja]
Length=651

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/573 (75%), Positives = 484/573 (84%), Gaps = 27/573 (5%)
 Frame = -3

Query  2345  MRSHSTSTEAQVNDKS-FKKFYIQGGMN-VKPLviertetredvvetyEQKD-GGRVEIT  2175
             +R+ STS E +V D + F++ Y+QGGMN VKPLV+E     +       ++D GG V ++
Sbjct  103   VRNFSTSVETRVKDNNNFERIYVQGGMNNVKPLVVESVHKED-------ERDLGGDVNVS  155

Query  2174  DDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLP  1995
                T  + D               SEVEKEAWKLLQGAVV YCG PVGT+AANDP DK+P
Sbjct  156   VGKTKGEED---------------SEVEKEAWKLLQGAVVTYCGNPVGTMAANDPGDKIP  200

Query  1994  LNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV  1815
             LNYDQVFIRDFIPSALAFLL GE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV
Sbjct  201   LNYDQVFIRDFIPSALAFLLRGESEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV  260

Query  1814  RTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQ  1635
             RT+ LD  N   E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY K+TGD +LQER DVQ
Sbjct  261   RTVALDEDN--HEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDCSLQERADVQ  318

Query  1634  TGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIV  1455
             TG+++ILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML+ 
Sbjct  319   TGLKMILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVA  378

Query  1454  NDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIP  1275
              D TK+L+ AINNRLSALSFHIREYYWVDMKK+NEIYRYKTEEYS DAINKFNIYP+QIP
Sbjct  379   TDGTKNLIRAINNRLSALSFHIREYYWVDMKKMNEIYRYKTEEYSTDAINKFNIYPEQIP  438

Query  1274  PWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDL  1095
              W+++WIPE GGYL+GNLQPAHMDFRFF+LGNLW+I+SSLGT  QN +ILN IE KWDDL
Sbjct  439   LWLMDWIPEEGGYLIGNLQPAHMDFRFFSLGNLWSIVSSLGTPRQNHAILNLIEAKWDDL  498

Query  1094  IAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAM  915
             +  MPLKICYPAL+ E+WRI+TG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ ELA 
Sbjct  499   VGHMPLKICYPALDNEEWRIVTGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRIELAQ  558

Query  914   KAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVW  735
             KAVA+AE+RLPVD WPEYYDTR G+FIGKQAR+ QTWT+AG+LTSKMLLKNP+MAS+L W
Sbjct  559   KAVALAEKRLPVDSWPEYYDTRTGKFIGKQARMYQTWTIAGFLTSKMLLKNPEMASMLFW  618

Query  734   NEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
              EDYELL+ CVCGL  +GR++CSR   RSQ+ V
Sbjct  619   EEDYELLDICVCGLSKSGRKRCSRGAARSQILV  651



>ref|XP_007145019.1| hypothetical protein PHAVU_007G203100g [Phaseolus vulgaris]
 gb|ESW17013.1| hypothetical protein PHAVU_007G203100g [Phaseolus vulgaris]
Length=651

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/572 (74%), Positives = 483/572 (84%), Gaps = 25/572 (4%)
 Frame = -3

Query  2345  MRSHSTSTEAQVNDKSFKKFYIQGGMN-VKPLviertetredvvetyEQKDGGRVEITDD  2169
              R+ STS E + +D +F++ Y+QGGMN VKPLV                     VE + +
Sbjct  103   FRNCSTSVETRGHDNNFERIYVQGGMNNVKPLV---------------------VESSHE  141

Query  2168  STVNKNDLNGS-SISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPL  1992
               V++ +L G  ++S    + E SEVEK+AWKLLQGAVV YCG PVGTVAANDP DKLPL
Sbjct  142   DVVDERNLGGEVNVSVGKSKWEESEVEKQAWKLLQGAVVTYCGNPVGTVAANDPGDKLPL  201

Query  1991  NYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR  1812
             NYDQVF+RDFIPSALAFLL GE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR
Sbjct  202   NYDQVFLRDFIPSALAFLLRGESEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR  261

Query  1811  TMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQT  1632
             ++ LD  N   E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY K+TGD TLQER DVQT
Sbjct  262   SVALDEDN--HEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDCTLQERADVQT  319

Query  1631  GIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVN  1452
             G+++ILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML+V 
Sbjct  320   GLKMILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVVT  379

Query  1451  DSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPP  1272
             + T +L+ AINNRLSALSFHIREYYWVDMKK+NEIYRYKTEEYSMDAINKFNIYP+QIP 
Sbjct  380   EGTNNLIRAINNRLSALSFHIREYYWVDMKKMNEIYRYKTEEYSMDAINKFNIYPEQIPL  439

Query  1271  WIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLI  1092
             W+++WIPE GGYL+GNLQPAHMDFRFFTLGN W+I+SSLGT  QN++ILN +E KWDDL+
Sbjct  440   WLMDWIPEEGGYLIGNLQPAHMDFRFFTLGNFWSIVSSLGTPRQNQAILNLVEAKWDDLV  499

Query  1091  AQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMK  912
               MPLKICYPAL+ E+WRI TG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ ELA K
Sbjct  500   GHMPLKICYPALDNEEWRITTGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRIELAQK  559

Query  911   AVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWN  732
             AVA+AE+RLPVD WPEYYDTR G+FIGKQAR+ QTWT+AG+LTSKMLLK+P+MAS L W 
Sbjct  560   AVALAEKRLPVDSWPEYYDTRTGKFIGKQARMYQTWTIAGFLTSKMLLKDPEMASRLFWE  619

Query  731   EDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             EDYELL+ CVCGL  NGR++CSR   RSQ+ V
Sbjct  620   EDYELLDICVCGLSKNGRKRCSRGAARSQILV  651



>ref|XP_003535315.1| PREDICTED: alkaline/neutral invertase CINV2-like [Glycine max]
Length=651

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/573 (75%), Positives = 484/573 (84%), Gaps = 27/573 (5%)
 Frame = -3

Query  2345  MRSHSTSTEAQVNDKS-FKKFYIQGGMN-VKPLviertetredvvetyEQKD-GGRVEIT  2175
             +R+ STS E +V D + F++ Y+QGGMN VKPLV+E     +       ++D GG V ++
Sbjct  103   VRNFSTSVETRVKDNNNFERIYVQGGMNNVKPLVVESVHKED-------ERDLGGDVNVS  155

Query  2174  DDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLP  1995
                T  + D               SEVEKEAWKLLQGAVV YCG PVGT+AANDP DK+P
Sbjct  156   VGKTKGEED---------------SEVEKEAWKLLQGAVVTYCGNPVGTMAANDPGDKIP  200

Query  1994  LNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV  1815
             LNYDQVFIRDFIPSALAFLL GE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV
Sbjct  201   LNYDQVFIRDFIPSALAFLLRGESEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV  260

Query  1814  RTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQ  1635
             RT+ LD  N   E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY K+TGD +LQER DVQ
Sbjct  261   RTVALDEDN--HEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDCSLQERADVQ  318

Query  1634  TGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIV  1455
             TG+++ILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML+ 
Sbjct  319   TGLKMILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVA  378

Query  1454  NDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIP  1275
              D T +L+ AINNRLSALSFHIREYYWVDMKK+NEIYRYKTEEYS DAINKFNIYP+QIP
Sbjct  379   TDGTNNLIRAINNRLSALSFHIREYYWVDMKKMNEIYRYKTEEYSTDAINKFNIYPEQIP  438

Query  1274  PWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDL  1095
              W+++WIPE GGYL+GNLQPAHMDFRFF+LGNLW+I+SSLGT  QN++ILN IE KWDDL
Sbjct  439   LWLMDWIPEEGGYLIGNLQPAHMDFRFFSLGNLWSIVSSLGTPRQNQAILNLIEAKWDDL  498

Query  1094  IAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAM  915
             +  MPLKICYPAL+ E+WRI+TG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ ELA 
Sbjct  499   VGHMPLKICYPALDNEEWRIVTGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRIELAQ  558

Query  914   KAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVW  735
             KAVA+AE+RLPVD WPEYYDTR G+FIGKQAR+ QTWT+AG+LTSKMLLKNP+MAS+L W
Sbjct  559   KAVALAEKRLPVDSWPEYYDTRTGKFIGKQARMYQTWTIAGFLTSKMLLKNPEMASMLFW  618

Query  734   NEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
              EDYELL+ CVCGL  +GR++CSR   RSQ+ V
Sbjct  619   EEDYELLDICVCGLSKSGRKRCSRGAARSQILV  651



>ref|XP_004230329.1| PREDICTED: alkaline/neutral invertase CINV1 [Solanum lycopersicum]
Length=653

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/689 (66%), Positives = 525/689 (76%), Gaps = 49/689 (7%)
 Frame = -3

Query  2672  IGISTMKPCSRIL-GSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggryrhrHS  2496
             I + TM PC RIL    ++S    PF + +     NLS  +QK           Y +   
Sbjct  4     INLITMTPCCRILIPCRSNSFLGLPFKKTH-----NLSNFRQKCD--------FYSYPSR  50

Query  2495  VVTLTRVINSNRCAFCGSGSNGDQHRDSFC------NWLGRSKNRLVFVVPKVASDMRSH  2334
             ++   R+IN  +  FC   ++       F       N +G SK R   V+  VASD R+H
Sbjct  51    ILGNGRIINRTQKLFCVMRNSSCGQSRVFSRNFNGINPMGTSK-RGFRVIASVASDFRNH  109

Query  2333  STSTEAQV--NDKSFKKFYIQGGMNVK-PLviertetredvvetyEQKDGGRVEITDDST  2163
             STS E     NDK+F++ Y+QGG N K PL +E                    ++ + + 
Sbjct  110   STSIEKTRVNNDKNFERIYVQGGFNAKKPLGLE------------------NADLDEHAA  151

Query  2162  VNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
               +++   S       E E S+  KEAWKLL+ AVV YCG P+GT+AANDP DKLPLNYD
Sbjct  152   TGQHEKVES-----VKEGEESQTVKEAWKLLENAVVKYCGSPIGTLAANDPNDKLPLNYD  206

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             QVFIRDFIPSALAFLL GE EIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+P
Sbjct  207   QVFIRDFIPSALAFLLKGEKEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVP  266

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LD  + ++E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGI+
Sbjct  267   LD--DNKYEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYGLQERVDVQTGIK  324

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             LI+NLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+ E+L ++D +
Sbjct  325   LIINLCLSDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSHELLSLDDGS  384

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
             K+LV AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS +A NKFNIYP+QIP W++
Sbjct  385   KNLVNAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTEATNKFNIYPEQIPHWLM  444

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
             +WIPE GGYL+GNLQPAHMDFRFFTLGNLW+I+SSL T +QN++ILN IE KW DL+  M
Sbjct  445   DWIPEEGGYLIGNLQPAHMDFRFFTLGNLWSIVSSLSTPKQNEAILNLIEAKWYDLVGLM  504

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVA  903
             PLKICYPALE EDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKM + +LA KAV 
Sbjct  505   PLKICYPALESEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMNRLDLAKKAVD  564

Query  902   VAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDY  723
              AE+RL VDQWPEYYDTR+G+F GKQARL QTWT+AG+LTSKMLL+NP+ ASLL W EDY
Sbjct  565   SAEKRLGVDQWPEYYDTRYGKFTGKQARLYQTWTIAGFLTSKMLLENPETASLLFWEEDY  624

Query  722   ELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             +LLENCVC LK +GR+KCSR   +SQ+ V
Sbjct  625   DLLENCVCALKKSGRKKCSRGAAKSQILV  653



>ref|XP_010914649.1| PREDICTED: LOW QUALITY PROTEIN: alkaline/neutral invertase CINV2 
[Elaeis guineensis]
Length=628

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/569 (75%), Positives = 475/569 (83%), Gaps = 21/569 (4%)
 Frame = -3

Query  2345  MRSHSTSTEAQVNDKSFKKFYIQGGM-NVKPLviertetredvvetyEQKDGGRVEITDD  2169
             +R  STS +   +DK+F++ YIQGG+  VKPL               E+K  G V+    
Sbjct  78    LRRLSTSVDPVSSDKAFERIYIQGGLAAVKPL-------------VIERKQEGEVKEPAP  124

Query  2168  STVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLN  1989
                       ++ ++ AP RE SE+EKEAW+LL+ AVVNYCG PVGTVAA+DP  + PLN
Sbjct  125   VAPV------AAPTEAAPVREESELEKEAWRLLKRAVVNYCGNPVGTVAADDPGAQ-PLN  177

Query  1988  YDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT  1809
             YDQVFIRDF+PSALAFLL GE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT
Sbjct  178   YDQVFIRDFVPSALAFLLKGESEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT  237

Query  1808  MPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTG  1629
             MP+DG N  +E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTG
Sbjct  238   MPMDGSNEAYEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTG  297

Query  1628  IRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVND  1449
             IRLILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REM+ VND
Sbjct  298   IRLILNLCLSDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMITVND  357

Query  1448  STKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPW  1269
              +K+L+ AINNRLSALSFHIREYYWVDM KINEIYRYKTEEYS DA NKFNIYP+QIP W
Sbjct  358   GSKNLLRAINNRLSALSFHIREYYWVDMNKINEIYRYKTEEYSQDATNKFNIYPEQIPSW  417

Query  1268  IVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIA  1089
             +VNWIPE GGYL+GN+QPAHMDFRFF+LGNLWAI+SSL T  Q + ILN IE KWDDL+ 
Sbjct  418   LVNWIPEKGGYLIGNVQPAHMDFRFFSLGNLWAIVSSLSTPRQAEGILNLIEDKWDDLLG  477

Query  1088  QMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKA  909
              MPLKICYPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+PELA KA
Sbjct  478   NMPLKICYPALEFEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARKA  537

Query  908   VAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNE  729
             VAVAE+RL  D+WPEYYDTR GRFIGKQARL QTWTV+GYLTSKMLL+NP+MAS+L   E
Sbjct  538   VAVAEKRLSNDKWPEYYDTRTGRFIGKQARLYQTWTVSGYLTSKMLLENPEMASILTCEE  597

Query  728   DYELLENCVCGLKYNGRRKCSRFGVRSQV  642
             D ELLE C C L  + R KCSRF  +SQV
Sbjct  598   DLELLEGCACSLTKSARTKCSRFAAKSQV  626



>ref|XP_006344790.1| PREDICTED: alkaline/neutral invertase CINV2-like [Solanum tuberosum]
Length=653

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/689 (65%), Positives = 527/689 (76%), Gaps = 49/689 (7%)
 Frame = -3

Query  2672  IGISTMKPCSRIL-GSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggryrhrHS  2496
             I + TM PC RIL    ++S    PF + +     N+S  +QK           + +   
Sbjct  4     INLITMTPCCRILIPCRSNSFLGLPFKKTH-----NMSNFRQKCD--------FHSYPSR  50

Query  2495  VVTLTRVINSNRCAFCGSGSNGDQHRDSF---CNWL---GRSKNRLVFVVPKVASDMRSH  2334
             ++   R+IN  +  FC   ++       F   CN +   G SK R   V+  VASD R+H
Sbjct  51    ILGNGRIINRTQKLFCVVRNSSCGQSRVFSRNCNGINPIGASK-RGFHVIASVASDFRNH  109

Query  2333  STSTEAQV--NDKSFKKFYIQGGMNVK-PLviertetredvvetyEQKDGGRVEITDDST  2163
             STS E     NDK+F++ Y+QGG+N K PL +E                    ++ + + 
Sbjct  110   STSVEKTRVNNDKNFERIYVQGGLNAKKPLGLE------------------NADLDEHAA  151

Query  2162  VNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
               +++   S       E E S+  KEAW+LL+ AVV YCG P+GT+AANDP DKLPLNYD
Sbjct  152   TGQHEKVES-----VKEGEESQTVKEAWRLLENAVVTYCGSPIGTLAANDPNDKLPLNYD  206

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             QVFIRDFIPSALAFLL GE EIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+P
Sbjct  207   QVFIRDFIPSALAFLLKGEKEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVP  266

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LD  + ++E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGI+
Sbjct  267   LD--DNKYEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYGLQERVDVQTGIK  324

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             LI+NLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+RE+L +++ +
Sbjct  325   LIINLCLSDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSRELLSLDEGS  384

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
             K+LV AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS +A NKFNIYP+QIP W++
Sbjct  385   KNLVNAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTEATNKFNIYPEQIPHWLM  444

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
             +WIPE GGYL+GNLQPAHMDFRFFTLGNLW+I+SSL T +QN++ILN IE KW DL+  M
Sbjct  445   DWIPEEGGYLIGNLQPAHMDFRFFTLGNLWSIVSSLSTPKQNEAILNLIEAKWYDLVGLM  504

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVA  903
             PLKICYPALE EDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKM + +LA KAV 
Sbjct  505   PLKICYPALESEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMNRLDLAKKAVD  564

Query  902   VAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDY  723
              AE+RL VDQWPEYYDTR+G+F GKQARL QTWT+AG+LTSKMLL+NP+ ASLL W EDY
Sbjct  565   SAEKRLRVDQWPEYYDTRYGKFTGKQARLYQTWTIAGFLTSKMLLENPETASLLFWEEDY  624

Query  722   ELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             +LLE CVC LK +GR+KCSR   +SQ+ V
Sbjct  625   DLLEICVCALKKSGRKKCSRGAAKSQILV  653



>dbj|BAE98459.1| putative neutral invertase [Arabidopsis thaliana]
Length=664

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/685 (66%), Positives = 523/685 (76%), Gaps = 34/685 (5%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M SRSCI IS MKPC R L S+  S   + F   N     N SK      D         
Sbjct  1     MNSRSCICISAMKPCCRFLISFRSSSL-FGFSPPNSGKFINSSKLHCTKID--------S  51

Query  2510  rhrHSVVTLTRVINSNRCAFCGSGS---NGDQHRDSFCNWLGRSKNRLVFVVPKVASDMR  2340
             R   S +   R++  +R AFC S S    G   R        R + R V V+P VASD R
Sbjct  52    RSIRSGIHCRRIV-LDRNAFCDSDSISWGGGGSRVLRARGSSRGRGRGVLVIPHVASDFR  110

Query  2339  SHSTST-EAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDST  2163
             ++STS+ ++ VNDKSF+  +      VKPLV +  E  E + +      GG         
Sbjct  111   NYSTSSLDSHVNDKSFESMF------VKPLVFKEVEKTEGIPKRERGNVGG---------  155

Query  2162  VNKNDLNGSSISKLAPEREVS--EVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLN  1989
               K+   G+   +   ER +S  EVEKEAWKLL+GAVVNYCG+PVGTVAANDP D   LN
Sbjct  156   -GKDANFGNVGVRKETERCLSQTEVEKEAWKLLRGAVVNYCGFPVGTVAANDPGDTQTLN  214

Query  1988  YDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT  1809
             YDQVFIRDF+PSA AF+L+GEGEIV+NFLLHTLQLQSWEKTVDC+SPG GLMPASFKV++
Sbjct  215   YDQVFIRDFVPSAYAFMLDGEGEIVRNFLLHTLQLQSWEKTVDCHSPGPGLMPASFKVKS  274

Query  1808  MPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTG  1629
              PL+G +G FE+ LDPDFG SAIGRV+PVDSGLWWIILLRAY K+TGDYTLQER+DVQTG
Sbjct  275   APLEGNDGSFEEFLDPDFGGSAIGRVSPVDSGLWWIILLRAYGKLTGDYTLQERIDVQTG  334

Query  1628  IRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVND  1449
             I+LIL LCL DGFDMFPTLLVTDGSCM+DRRMGIHGHPLEIQALFYSALRC REMLIVND
Sbjct  335   IKLILKLCLADGFDMFPTLLVTDGSCMVDRRMGIHGHPLEIQALFYSALRCAREMLIVND  394

Query  1448  STKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPW  1269
              TKSLV A+NNRLSALSFHIREYYWVD+KKINEIYRY TEEYS DA NKFNIYP+QIP W
Sbjct  395   GTKSLVTAVNNRLSALSFHIREYYWVDIKKINEIYRYNTEEYSADATNKFNIYPEQIPTW  454

Query  1268  IVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIA  1089
             +V+WIP+ GGY +GNLQPAHMDFRFFTLGNLWA+ISSLG  EQN+ ++  IE KWDDL+A
Sbjct  455   LVDWIPDKGGYFIGNLQPAHMDFRFFTLGNLWAVISSLGNQEQNEGVMTLIEEKWDDLVA  514

Query  1088  QMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKA  909
              MPLKIC+PALE ++WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGK ELA KA
Sbjct  515   NMPLKICFPALEKDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKLELAKKA  574

Query  908   VAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNE  729
             VAVAE+RL  D+WPEYYDT+ GRF+GKQ+RL QTWT+AG+L +K L++ P+ ASLL W E
Sbjct  575   VAVAEKRLKEDEWPEYYDTKSGRFVGKQSRLYQTWTIAGFLAAKKLIEQPEKASLLFWEE  634

Query  728   DYELLENCVCGL-KYNGRR-KCSRF  660
             DY+LLE CVCGL K +GR+ KCSRF
Sbjct  635   DYQLLETCVCGLSKSSGRKNKCSRF  659



>ref|NP_187302.2| protein alkaline/neutral invertase C [Arabidopsis thaliana]
 sp|B9DFA8.1|INVC_ARATH RecName: Full=Alkaline/neutral invertase C, mitochondrial; Short=A/N-INVC; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAH19425.1| AT3G06500 [Arabidopsis thaliana]
 gb|AEE74403.1| putative neutral invertase [Arabidopsis thaliana]
Length=664

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/685 (66%), Positives = 523/685 (76%), Gaps = 34/685 (5%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M SRSCI +S MKPC R L S+  S   + F   N     N SK      D         
Sbjct  1     MNSRSCICVSAMKPCCRFLISFRSSSL-FGFSPPNSGKFINSSKLHCTKID--------S  51

Query  2510  rhrHSVVTLTRVINSNRCAFCGSGS---NGDQHRDSFCNWLGRSKNRLVFVVPKVASDMR  2340
             R   S +   R++  +R AFC S S    G   R        R + R V V+P VASD R
Sbjct  52    RSIRSGIHCRRIV-LDRNAFCDSDSISWGGGGSRVLRARGSSRGRGRGVLVIPHVASDFR  110

Query  2339  SHSTST-EAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDST  2163
             ++STS+ ++ VNDKSF+  +      VKPLV +  E  E + +      GG         
Sbjct  111   NYSTSSLDSHVNDKSFESMF------VKPLVFKEVEKTEGIPKRERGNVGG---------  155

Query  2162  VNKNDLNGSSISKLAPEREVS--EVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLN  1989
               K+   G+   +   ER +S  EVEKEAWKLL+GAVVNYCG+PVGTVAANDP D   LN
Sbjct  156   -GKDANFGNVGVRKETERCLSQTEVEKEAWKLLRGAVVNYCGFPVGTVAANDPGDTQTLN  214

Query  1988  YDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT  1809
             YDQVFIRDF+PSA AF+L+GEGEIV+NFLLHTLQLQSWEKTVDC+SPG GLMPASFKV++
Sbjct  215   YDQVFIRDFVPSAYAFMLDGEGEIVRNFLLHTLQLQSWEKTVDCHSPGPGLMPASFKVKS  274

Query  1808  MPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTG  1629
              PL+G +G FE+ LDPDFG SAIGRV+PVDSGLWWIILLRAY K+TGDYTLQER+DVQTG
Sbjct  275   APLEGNDGSFEEFLDPDFGGSAIGRVSPVDSGLWWIILLRAYGKLTGDYTLQERIDVQTG  334

Query  1628  IRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVND  1449
             I+LIL LCL DGFDMFPTLLVTDGSCM+DRRMGIHGHPLEIQALFYSALRC REMLIVND
Sbjct  335   IKLILKLCLADGFDMFPTLLVTDGSCMVDRRMGIHGHPLEIQALFYSALRCAREMLIVND  394

Query  1448  STKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPW  1269
              TKSLV A+NNRLSALSFHIREYYWVD+KKINEIYRY TEEYS DA NKFNIYP+QIP W
Sbjct  395   GTKSLVTAVNNRLSALSFHIREYYWVDIKKINEIYRYNTEEYSADATNKFNIYPEQIPTW  454

Query  1268  IVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIA  1089
             +V+WIP+ GGY +GNLQPAHMDFRFFTLGNLWA+ISSLG  EQN+ ++  IE KWDDL+A
Sbjct  455   LVDWIPDKGGYFIGNLQPAHMDFRFFTLGNLWAVISSLGNQEQNEGVMTLIEEKWDDLVA  514

Query  1088  QMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKA  909
              MPLKIC+PALE ++WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGK ELA KA
Sbjct  515   NMPLKICFPALEKDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKLELAKKA  574

Query  908   VAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNE  729
             VAVAE+RL  D+WPEYYDT+ GRF+GKQ+RL QTWT+AG+L +K L++ P+ ASLL W E
Sbjct  575   VAVAEKRLKEDEWPEYYDTKSGRFVGKQSRLYQTWTIAGFLAAKKLIEQPEKASLLFWEE  634

Query  728   DYELLENCVCGL-KYNGRR-KCSRF  660
             DY+LLE CVCGL K +GR+ KCSRF
Sbjct  635   DYQLLETCVCGLSKSSGRKNKCSRF  659



>gb|KFK38110.1| hypothetical protein AALP_AA3G070900 [Arabis alpina]
Length=647

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/685 (66%), Positives = 518/685 (76%), Gaps = 52/685 (8%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M S+SCI +S MKPC + L SY  S     FG  +   M N SK Q +  D         
Sbjct  2     MNSKSCISVSAMKPCCKFLISYRSSSL---FGFYSPNSM-NSSKLQYRNID--------S  49

Query  2510  rhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSHS  2331
             R   S +   R++  +R  FC S S   + R S      + + R V V+P+VASD R+HS
Sbjct  50    RSIRSGIQRRRIV-LDRNGFCDSDSMVLRARGS------KGRGRGVLVIPRVASDFRNHS  102

Query  2330  TSTEAQV--NDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVN  2157
             +S+      NDK  +  +      VKPLV +                   +E T++ T  
Sbjct  103   SSSLGSHVNNDKRLESIF------VKPLVFK------------------ELEKTEEIT-K  137

Query  2156  KNDLNGSSISKLAPEREV---SEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNY  1986
             K   N    +K   +  V   SE EKEAWKLL+GAVVNYCG+PVGTVAANDP DK  LNY
Sbjct  138   KESGNVGEDAKFGEKEGVLSQSEAEKEAWKLLRGAVVNYCGFPVGTVAANDPGDKQTLNY  197

Query  1985  DQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTM  1806
             DQVFIRDF+PSA AFLL+GEGEIV+NFLLHTLQLQSWEKTVDC+SPG GLMPASFKV++ 
Sbjct  198   DQVFIRDFVPSAYAFLLDGEGEIVRNFLLHTLQLQSWEKTVDCHSPGPGLMPASFKVKSA  257

Query  1805  PLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGI  1626
             PL+G +G FE+ LDPDFG SAIGRV+PVDSGLWWIILLRAY K+TGDYTLQER+DVQTGI
Sbjct  258   PLEGNDGSFEEFLDPDFGGSAIGRVSPVDSGLWWIILLRAYGKLTGDYTLQERIDVQTGI  317

Query  1625  RLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDS  1446
             +LIL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC REML VND 
Sbjct  318   KLILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMLNVNDG  377

Query  1445  TKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWI  1266
             TK+LVAAINNRLSALSFHIREYYWVD+KKINEIYRY TEEYS DA NKFNIYP+QIP W+
Sbjct  378   TKNLVAAINNRLSALSFHIREYYWVDIKKINEIYRYNTEEYSADATNKFNIYPEQIPTWL  437

Query  1265  VNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQ  1086
             V+WIP  GGY +GNLQPAHMDFRFFTLGNLWA+ISSLG  EQN+ ++  IE KWDDL+A 
Sbjct  438   VDWIPNKGGYFIGNLQPAHMDFRFFTLGNLWAVISSLGNQEQNEGVMTLIEEKWDDLVAN  497

Query  1085  MPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAV  906
             MPLKIC+PALE ++WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGK ELA KAV
Sbjct  498   MPLKICFPALEQDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKLELAKKAV  557

Query  905   AVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNED  726
             AVAE+RL  D+WPEYYDT+ GRF+GKQ+RL QTWT+AG+L SK L++ P+ ASLL W ED
Sbjct  558   AVAEKRLKEDEWPEYYDTKSGRFVGKQSRLYQTWTIAGFLASKKLIEQPEKASLLFWEED  617

Query  725   YELLENCVCGL-KYNGRR--KCSRF  660
             Y+LLE CVC L + +GR+  KCSRF
Sbjct  618   YQLLETCVCALSRSSGRKKNKCSRF  642



>ref|XP_006392417.1| hypothetical protein EUTSA_v10023341mg [Eutrema salsugineum]
 gb|ESQ29703.1| hypothetical protein EUTSA_v10023341mg [Eutrema salsugineum]
Length=637

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/570 (74%), Positives = 479/570 (84%), Gaps = 20/570 (4%)
 Frame = -3

Query  2345  MRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDS  2166
             +R  STS E    DKSF++ ++Q  +N  PLVIER             KD   V     S
Sbjct  87    VRGFSTSVETITGDKSFERIHVQSSLNSNPLVIERI-----------HKDEETVG-EPVS  134

Query  2165  TVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNY  1986
              V  N++    +      RE SE EKEAW++L+ AVV YCG PVGTVAANDP DKLPLNY
Sbjct  135   RVEVNEIRSGEV------REESEAEKEAWRILEDAVVRYCGSPVGTVAANDPGDKLPLNY  188

Query  1985  DQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTM  1806
             DQVFIRDF+PSALAFLL GEG+IV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+
Sbjct  189   DQVFIRDFVPSALAFLLKGEGDIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTV  248

Query  1805  PLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGI  1626
              LD    E  +VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGD++LQER+DVQTGI
Sbjct  249   ALDENTAE--EVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDFSLQERIDVQTGI  306

Query  1625  RLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDS  1446
             +LI+NLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSALRC+REML VNDS
Sbjct  307   KLIMNLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLSVNDS  366

Query  1445  TKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWI  1266
             +K+LV AINNRLSALSFHIREYYWVD+KKINEIYRYKTEEYS DA NKFNIYP+QIPPW+
Sbjct  367   SKNLVRAINNRLSALSFHIREYYWVDIKKINEIYRYKTEEYSTDATNKFNIYPEQIPPWL  426

Query  1265  VNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQ  1086
             ++WIPE GGYL+GNLQPAHMDFRFFTLGN W+++SSL T +QN++ILN IE KWDD+I  
Sbjct  427   MDWIPEQGGYLLGNLQPAHMDFRFFTLGNFWSVVSSLSTPKQNEAILNLIEAKWDDIIGN  486

Query  1085  MPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAV  906
             MPLKICYPALE +DWRIITGSDPKNTPWSYHN GSWPTLLWQFTLAC+KMG+PELA KA+
Sbjct  487   MPLKICYPALEYDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMGRPELAEKAL  546

Query  905   AVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNED  726
             A+AE+RL  D+WPEYYDTR G+FIGKQ+RL QTWTVAG+LTSK+LL NP+MASLL W ED
Sbjct  547   ALAEKRLMADRWPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKLLLANPEMASLLFWEED  606

Query  725   YELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             YELL+ CVCGL  +GR+KCSR   ++Q+ V
Sbjct  607   YELLDICVCGLSKSGRKKCSRIAAKTQILV  636



>gb|AAP40464.1| putative neutral invertase [Arabidopsis thaliana]
Length=664

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/685 (66%), Positives = 522/685 (76%), Gaps = 34/685 (5%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M SRSCI +S MKPC R L S+  S   + F   N     N SK      D         
Sbjct  1     MNSRSCICVSAMKPCCRFLISFRSSSL-FGFSPPNSGKFINSSKLHCTKID--------S  51

Query  2510  rhrHSVVTLTRVINSNRCAFCGSGS---NGDQHRDSFCNWLGRSKNRLVFVVPKVASDMR  2340
             R   S +   R++  +R AFC S S    G   R        R + R V V+P VASD R
Sbjct  52    RSIRSGIHCRRIV-LDRNAFCDSDSISWGGGGSRVLRARGSSRGRGRGVLVIPHVASDFR  110

Query  2339  SHSTST-EAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDST  2163
             ++STS+ ++ VNDKSF+  +      VKPLV +  E  E + +      GG         
Sbjct  111   NYSTSSLDSHVNDKSFESMF------VKPLVFKEVEKTEGIPKRERGNVGG---------  155

Query  2162  VNKNDLNGSSISKLAPEREVS--EVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLN  1989
               K+   G+   +   ER +S  EVEKEAWKLL+GAVVNYCG+PVGTVAANDP D   LN
Sbjct  156   -GKDANFGNVGVRKETERCLSQTEVEKEAWKLLRGAVVNYCGFPVGTVAANDPGDTQTLN  214

Query  1988  YDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT  1809
             YDQVFIRDF+PSA AF+L+GEGEIV+NFLLHTLQLQSWEKTVDC+SPG GLMPASFKV++
Sbjct  215   YDQVFIRDFVPSAYAFMLDGEGEIVRNFLLHTLQLQSWEKTVDCHSPGPGLMPASFKVKS  274

Query  1808  MPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTG  1629
              PL+G +G FE+ LDPDFG SAIGRV+PVDSGLWWIILLRAY K+TGDYTLQER+DVQTG
Sbjct  275   APLEGNDGSFEEFLDPDFGGSAIGRVSPVDSGLWWIILLRAYGKLTGDYTLQERIDVQTG  334

Query  1628  IRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVND  1449
             I+LIL LCL DGFDMFPTLLVTDGSCM+DRRMGIHGHPLEIQALFYSALRC REMLIVND
Sbjct  335   IKLILKLCLADGFDMFPTLLVTDGSCMVDRRMGIHGHPLEIQALFYSALRCAREMLIVND  394

Query  1448  STKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPW  1269
              TKSLV A+NNRLSALSFHIREYYWVD+KKINEIYRY TEEYS DA NKFNIYP+QIP W
Sbjct  395   GTKSLVTAVNNRLSALSFHIREYYWVDIKKINEIYRYNTEEYSADATNKFNIYPEQIPTW  454

Query  1268  IVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIA  1089
             +V+WIP+ GGY +GNLQPAHMDFRFFTLGNLWA+ISSLG  EQN+ ++  IE KWDDL+A
Sbjct  455   LVDWIPDKGGYFIGNLQPAHMDFRFFTLGNLWAVISSLGNQEQNEGVMTLIEEKWDDLVA  514

Query  1088  QMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKA  909
              MPLKIC+PALE ++WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGK ELA KA
Sbjct  515   NMPLKICFPALEKDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKLELAKKA  574

Query  908   VAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNE  729
              AVAE+RL  D+WPEYYDT+ GRF+GKQ+RL QTWT+AG+L +K L++ P+ ASLL W E
Sbjct  575   FAVAEKRLKEDEWPEYYDTKSGRFVGKQSRLYQTWTIAGFLAAKKLIEQPEKASLLFWEE  634

Query  728   DYELLENCVCGL-KYNGRR-KCSRF  660
             DY+LLE CVCGL K +GR+ KCSRF
Sbjct  635   DYQLLETCVCGLSKSSGRKNKCSRF  659



>ref|XP_006407938.1| hypothetical protein EUTSA_v10020219mg [Eutrema salsugineum]
 gb|ESQ49391.1| hypothetical protein EUTSA_v10020219mg [Eutrema salsugineum]
Length=668

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/691 (66%), Positives = 521/691 (75%), Gaps = 43/691 (6%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M SRSCI +S MKP  R L S+  S     F   +   + N SK Q +  D   +  G  
Sbjct  2     MNSRSCICVSAMKPYCRFLISFRSSSI-SGFSPPSSAKLLNSSKLQCRKIDSRSIRSG--  58

Query  2510  rhrHSVVTLTRVINSNRCAFC-------GSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVA  2352
                    T  R I  +R AFC       G GS   + R S     GR + R V V+P+VA
Sbjct  59    -------TQCRRIVLDRKAFCDSDSISWGGGSRVLRARVSIGRGRGRGRERGVLVIPRVA  111

Query  2351  SDMRSHSTST-EAQVN-DKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEI  2178
             SD R+HSTS+  + VN D+SF+  +      VKPLV +  E  E++ +    K G     
Sbjct  112   SDFRNHSTSSLGSHVNSDQSFESIF------VKPLVFKELEKTEEIPKKESGKGG-----  160

Query  2177  TDDSTVNKNDLNGSSISKLAPEREV---SEVEKEAWKLLQGAVVNYCGYPVGTVAANDPA  2007
                      D    ++   + + +V   SE EKEAWKLL+GAVVNYCG+PVGTVAANDP 
Sbjct  161   --------EDAKSGNVGVRSEKEQVLSQSEAEKEAWKLLRGAVVNYCGFPVGTVAANDPG  212

Query  2006  DKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPA  1827
             DK  LNYDQVFIRDF+PSA AFLL+GEGEIV+NFLLHTLQLQSWEKTVDC+SPG GLMPA
Sbjct  213   DKQTLNYDQVFIRDFVPSAYAFLLDGEGEIVRNFLLHTLQLQSWEKTVDCHSPGPGLMPA  272

Query  1826  SFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQER  1647
             SFKV+ +PL+G +G FE+VLD DFGESAIGRV+PVDSGLWWIILLRAY K+TGDYTLQER
Sbjct  273   SFKVKPVPLEGNDGSFEEVLDADFGESAIGRVSPVDSGLWWIILLRAYGKLTGDYTLQER  332

Query  1646  VDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTRE  1467
             +DVQTGI+LIL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC RE
Sbjct  333   IDVQTGIKLILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCARE  392

Query  1466  MLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYP  1287
             ML VND TK+LVAA+NNRLSALSFHIREYYWVD+KKINEIYRY TEEYS DA NKFNIYP
Sbjct  393   MLNVNDGTKNLVAAVNNRLSALSFHIREYYWVDIKKINEIYRYNTEEYSADATNKFNIYP  452

Query  1286  DQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGK  1107
             DQIP W+V WIP  GGY +GNLQPAHMDFRFFTLGNLWA+ISSLG  EQN+ ++  IE K
Sbjct  453   DQIPSWLVGWIPNQGGYFIGNLQPAHMDFRFFTLGNLWAVISSLGNQEQNEGVMTLIEEK  512

Query  1106  WDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKP  927
             W DL+A MPLKIC+PALE ++WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIK+GK 
Sbjct  513   WGDLVANMPLKICFPALEQDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKVGKL  572

Query  926   ELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMAS  747
             ELA KAVAVAE+RL  D+WPEYYDTR GRF+GKQ+RL QTWT+AG+L SK L++ P+ AS
Sbjct  573   ELAKKAVAVAEKRLKEDEWPEYYDTRSGRFVGKQSRLYQTWTIAGFLASKKLIEQPEKAS  632

Query  746   LLVWNEDYELLENCVCGLKYNGRR--KCSRF  660
             LL W EDY+LLE CVCGL  +  R  KCSRF
Sbjct  633   LLFWQEDYQLLETCVCGLSKSSARKNKCSRF  663



>ref|XP_002891983.1| hypothetical protein ARALYDRAFT_474815 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68242.1| hypothetical protein ARALYDRAFT_474815 [Arabidopsis lyrata subsp. 
lyrata]
Length=606

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/569 (73%), Positives = 476/569 (84%), Gaps = 29/569 (5%)
 Frame = -3

Query  2342  RSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDST  2163
             R  STS E   +DKSF++ ++Q G  ++ +                       +I ++ T
Sbjct  66    RKFSTSVETNSSDKSFERIHVQSGAILERIH----------------------KIEEEET  103

Query  2162  VNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
             V+K ++    +      RE SE EKEAW++L+ AVV YCG PVGTVAANDP DK+PLNYD
Sbjct  104   VSKVNVETERVV-----REESEAEKEAWRILENAVVRYCGSPVGTVAANDPGDKMPLNYD  158

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             QVFIRDF+PSALAFLL GEG+IV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+ 
Sbjct  159   QVFIRDFVPSALAFLLKGEGDIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVA  218

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LD    E  +VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGD++LQER+DVQTGI+
Sbjct  219   LDENTTE--EVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDFSLQERIDVQTGIK  276

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             LI+NLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSALRC+REML VNDS+
Sbjct  277   LIMNLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLSVNDSS  336

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
             K+LV AINNRLSALSFHIREYYWVD+KKINEIYRYKTEEYS DA NKFNIYP+QIPPW++
Sbjct  337   KNLVRAINNRLSALSFHIREYYWVDIKKINEIYRYKTEEYSTDATNKFNIYPEQIPPWLM  396

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
             +WIPE GGYL+GNLQPAHMDFRFFTLGN W+I+SSL T +QN++ILN IE KWDD+I  M
Sbjct  397   DWIPEQGGYLLGNLQPAHMDFRFFTLGNFWSIVSSLATPKQNEAILNLIEAKWDDIIGNM  456

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVA  903
             PLKICYPALE +DWRIITGSDPKNTPWSYHN GSWPTLLWQFTLAC+KMG+PELA KA+A
Sbjct  457   PLKICYPALEYDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMGRPELAEKALA  516

Query  902   VAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDY  723
             VAE+RL  D+WPEYYDTR G+FIGKQ+RL QTWTVAG+LTSK+LL NP+MASLL W EDY
Sbjct  517   VAEKRLLADRWPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKLLLANPEMASLLFWEEDY  576

Query  722   ELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             ELL+ C CGL+ + R+KCSR   ++Q+ V
Sbjct  577   ELLDICACGLRKSDRKKCSRVAAKTQILV  605



>ref|XP_002882475.1| hypothetical protein ARALYDRAFT_896781 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58734.1| hypothetical protein ARALYDRAFT_896781 [Arabidopsis lyrata subsp. 
lyrata]
Length=656

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/685 (66%), Positives = 522/685 (76%), Gaps = 42/685 (6%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSY-NHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggr  2514
             M SRSCI +S MKPC R L S+ + S+F   F          +S S+ +   +       
Sbjct  1     MNSRSCICVSAMKPCCRFLISFTSSSLFGGKF----------ISSSKLRCTKIDSRSIRS  50

Query  2513  yrhrHSVVTLTRVINSNRCAFCGSGSN--GDQHRDSFCNWLGRSKNRLVFVVPKVASDMR  2340
               H   +V        +R  FC S S   G            R + R V  +P+VASD R
Sbjct  51    GIHCRRIVL-------DRDGFCDSDSISWGGGGSRVLRARGSRGRGRGVLAIPRVASDFR  103

Query  2339  SHSTST-EAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDST  2163
             +HSTS+ ++ VNDKSF+  +      VKPLV +  E  E + +      GG+     +  
Sbjct  104   NHSTSSLDSHVNDKSFESMF------VKPLVFKDVEKTERIPKRESGNGGGQDANFGNVG  157

Query  2162  VNKNDLNGSSISKLAPEREVS--EVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLN  1989
             V K            PER +S  EVEKEAWKLL+GAVVNYCG+PVGTVAANDP D   LN
Sbjct  158   VRKE-----------PERGLSQTEVEKEAWKLLRGAVVNYCGFPVGTVAANDPVDTQTLN  206

Query  1988  YDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT  1809
             YDQVFIRDF+PSA AF+L+GEGEIV+NFLL+TLQLQSWEKTVDC+SPG GL+PASFKV++
Sbjct  207   YDQVFIRDFVPSAYAFMLDGEGEIVRNFLLYTLQLQSWEKTVDCHSPGPGLIPASFKVKS  266

Query  1808  MPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTG  1629
              PL+G +G FE+ LDPDFG SAIGRV+PVDSGLWWIILLRAY K+TGDYTLQER+DVQTG
Sbjct  267   GPLEGNDGSFEEFLDPDFGGSAIGRVSPVDSGLWWIILLRAYGKLTGDYTLQERIDVQTG  326

Query  1628  IRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVND  1449
             I+LIL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC REMLIVND
Sbjct  327   IKLILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMLIVND  386

Query  1448  STKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPW  1269
              TK+LVAA+NNRLSALSFHIREYYWVD+KKINEIYRY TEEYS DA NKFNIYPDQIP W
Sbjct  387   GTKNLVAAVNNRLSALSFHIREYYWVDIKKINEIYRYNTEEYSADATNKFNIYPDQIPTW  446

Query  1268  IVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIA  1089
             +V+WIPE GGY +GNLQPAHMDFRFFTLGNLWA+ISSLG  EQN+ ++  IE KWDDL+A
Sbjct  447   LVDWIPEKGGYFIGNLQPAHMDFRFFTLGNLWAVISSLGNQEQNEGVMTLIEEKWDDLVA  506

Query  1088  QMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKA  909
              MPLKIC+PALE ++WRIITGSDPKN PWSYHNGGSWPTLLWQFTLACIKMG+ ELA KA
Sbjct  507   NMPLKICFPALEKDEWRIITGSDPKNMPWSYHNGGSWPTLLWQFTLACIKMGRLELAKKA  566

Query  908   VAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNE  729
             VAVAE+RL  D+WPEYYDT++GRF+GKQ+RL QTWT+AG+L +K L++ P+ ASLL W E
Sbjct  567   VAVAEKRLKEDEWPEYYDTKNGRFVGKQSRLYQTWTIAGFLAAKKLIEQPEKASLLFWEE  626

Query  728   DYELLENCVCGL-KYNGRR-KCSRF  660
             DY+LLE CVCGL K +GR+ KCSRF
Sbjct  627   DYQLLETCVCGLSKSSGRKNKCSRF  651



>ref|XP_010441142.1| PREDICTED: alkaline/neutral invertase CINV2-like [Camelina sativa]
Length=664

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/688 (66%), Positives = 524/688 (76%), Gaps = 40/688 (6%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M SRSCI +S MKPC R L S+  S   + F   N   + N SK                
Sbjct  1     MNSRSCICVSAMKPCCRFLISFKSSSL-FGFSPPNSGRLINSSKLH--------------  45

Query  2510  rhrHSVVTLTRVINSNRCAFCGSGS--NGDQHR------DSFCNWLGRSKNRLVFVVPKV  2355
               +    ++   ++  R AF  S S   G++ R          +  GR  +R V ++P+V
Sbjct  46    CTKIGSRSIRSGVHCRRNAFSDSDSISFGERSRVFKARGSISSSSRGRGCSRGVLLIPRV  105

Query  2354  ASDMRSHSTST-EAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEI  2178
             ASD R+HS+S+ ++ VND   K+F     M VKPLV +  E  E++ +      GG+   
Sbjct  106   ASDFRNHSSSSLDSHVNDN--KRFE---SMFVKPLVFKDVEKSEEIFKKESGNGGGKDTN  160

Query  2177  TDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKL  1998
               +  V +    GSS          +E +KEAWKLL+GAVVNYCG+PVGTVAA DP DK 
Sbjct  161   FGNVGVRRETERGSS---------QTEDDKEAWKLLRGAVVNYCGFPVGTVAAKDPGDKQ  211

Query  1997  PLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFK  1818
              LNYDQVFIRDF+PSA AFLL+GEG IV+NFLLHTLQLQSWEKTVDC+SPG GLMPASFK
Sbjct  212   TLNYDQVFIRDFVPSAYAFLLDGEGAIVRNFLLHTLQLQSWEKTVDCHSPGPGLMPASFK  271

Query  1817  VRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDV  1638
             V++ PL+G +G FE+ LDPDFG SAIGRV+PVDSGLWWIILLRAY K+TGDYTLQERVDV
Sbjct  272   VKSAPLEGNDGSFEEFLDPDFGGSAIGRVSPVDSGLWWIILLRAYGKLTGDYTLQERVDV  331

Query  1637  QTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLI  1458
             QTGI+LIL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC REMLI
Sbjct  332   QTGIKLILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMLI  391

Query  1457  VNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQI  1278
             VND TK+LVAA+NNRLSALSFHIREYYWVD+KKINEIYRY TEEYS DA NKFNIYPDQI
Sbjct  392   VNDGTKNLVAAVNNRLSALSFHIREYYWVDIKKINEIYRYNTEEYSADATNKFNIYPDQI  451

Query  1277  PPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDD  1098
             P W+V+WIP+ GGY +GNLQPAHMDFRFFTLGNLWA+ISSLG+ EQN+ ++  IE KWDD
Sbjct  452   PTWLVDWIPDKGGYFIGNLQPAHMDFRFFTLGNLWAVISSLGSQEQNEGVMTLIEEKWDD  511

Query  1097  LIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELA  918
             L+A MPLKIC+PALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGK ELA
Sbjct  512   LVANMPLKICFPALEKEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKLELA  571

Query  917   MKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLV  738
              KAVAVAE+RL  D+WPEYYDT+ GRF+GKQ+RL QTWT+AG+L SK L++ P+ ASLL 
Sbjct  572   KKAVAVAEKRLKEDEWPEYYDTKSGRFVGKQSRLYQTWTIAGFLASKKLIEQPEKASLLF  631

Query  737   WNEDYELLENCVCGL-KYNGRR-KCSRF  660
             W EDY+LLE CVCGL K +GR+ KCSRF
Sbjct  632   WEEDYQLLETCVCGLSKSSGRKNKCSRF  659



>ref|XP_010511297.1| PREDICTED: alkaline/neutral invertase CINV2-like [Camelina sativa]
Length=607

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/609 (69%), Positives = 492/609 (81%), Gaps = 30/609 (5%)
 Frame = -3

Query  2456  AFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVP--KVASDMRSHSTSTEAQVNDKSFKKFY  2283
              F    S  D  R +   +  RS +  ++  P  K++ + R  STS E     KSF+K +
Sbjct  26    TFSKESSPPDLSRTTRTIFTQRSVSSSIWFFPQSKISPNRREFSTSVETNPTVKSFEKIH  85

Query  2282  IQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNGSSISKLAPEREV  2103
             +Q G+ V+ +                     + E  ++ TV++ ++   ++      RE 
Sbjct  86    VQSGVIVERIH--------------------KNEEEEEETVSRVNVERKAL------REE  119

Query  2102  SEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEG  1923
             SE EKEAW++L+ A+V YCG PVGTVAANDP DK PLNYDQVFIRDF+PSALAFLL GEG
Sbjct  120   SEAEKEAWRILENAIVRYCGSPVGTVAANDPGDKTPLNYDQVFIRDFVPSALAFLLKGEG  179

Query  1922  EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESA  1743
             EIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+ LD    E  +VLDPDFGESA
Sbjct  180   EIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVALDENTTE--EVLDPDFGESA  237

Query  1742  IGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVT  1563
             IGRVAPVDSGLWWIILLRAY KITGD++LQER+DVQTGI+LI+NLCL DGFDMFPTLLVT
Sbjct  238   IGRVAPVDSGLWWIILLRAYGKITGDFSLQERIDVQTGIKLIMNLCLADGFDMFPTLLVT  297

Query  1562  DGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIRE  1383
             DGSCMIDRRMGIHGHPLEIQ+LFYSALRC+REML VNDS+K+LV AINNRLSALSFHIRE
Sbjct  298   DGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLSVNDSSKNLVRAINNRLSALSFHIRE  357

Query  1382  YYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMD  1203
             YYWVD+KKINEIYRYKTEEYS DA NKFNIYP+QIPPW+++WIPE GGYL+GNLQPAHMD
Sbjct  358   YYWVDIKKINEIYRYKTEEYSTDATNKFNIYPEQIPPWLMDWIPEQGGYLLGNLQPAHMD  417

Query  1202  FRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGS  1023
             FRFF+LGN W+I+SSLGT +QN++ILN +E KWDD+I  MPLKICYPALE +DWRIITGS
Sbjct  418   FRFFSLGNFWSIVSSLGTPKQNEAILNLMEAKWDDIIGNMPLKICYPALEYDDWRIITGS  477

Query  1022  DPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHG  843
             DPKNTPWSYHN GSWPTLLWQFTLAC+KMG+PELA KA+A+AE+RL  D+WPEYYDTR G
Sbjct  478   DPKNTPWSYHNSGSWPTLLWQFTLACMKMGRPELAEKALALAEKRLMADRWPEYYDTRSG  537

Query  842   RFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSR  663
             +FIGKQ+RL QTWTVAG+LTSK+LL NP+MASLL W EDYELL+ C CGL+ + R+KCSR
Sbjct  538   KFIGKQSRLYQTWTVAGFLTSKLLLANPEMASLLFWEEDYELLDICACGLRKSDRKKCSR  597

Query  662   FGVRSQVGV  636
                ++Q+ V
Sbjct  598   VAAKTQILV  606



>ref|XP_010480269.1| PREDICTED: alkaline/neutral invertase CINV2-like [Camelina sativa]
Length=612

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/579 (71%), Positives = 478/579 (83%), Gaps = 24/579 (4%)
 Frame = -3

Query  2372  FVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDG  2193
             F   K++ + R  STS E    DK+F++ ++Q G+ V+ +  +  E  E V     +  G
Sbjct  57    FPQSKISPNRREFSTSVETNPTDKTFERIHVQSGVIVERIHKKEEEEEETVSRVNVETTG  116

Query  2192  GRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAAND  2013
              R  +                      RE SE EKEAW++L+ A+V YCG PVGTVAAND
Sbjct  117   ERKAL----------------------REESEAEKEAWRILENAIVRYCGSPVGTVAAND  154

Query  2012  PADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLM  1833
             P DK PLNYDQVFIRDF+PSALAFLL GEG+IV+NFLLHTLQLQSWEKTVDCYSPGQGLM
Sbjct  155   PGDKTPLNYDQVFIRDFVPSALAFLLKGEGDIVRNFLLHTLQLQSWEKTVDCYSPGQGLM  214

Query  1832  PASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQ  1653
             PASFKVRT+ LD      E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGD++LQ
Sbjct  215   PASFKVRTVALD--ENTTEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDFSLQ  272

Query  1652  ERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCT  1473
             ER+DVQTGI+LI+NLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSALRC+
Sbjct  273   ERIDVQTGIKLIMNLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCS  332

Query  1472  REMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNI  1293
             REML VNDS+K+LV AINNRLSALSFHIREYYWVD+KKINEIYRYKTEEYS DA NKFNI
Sbjct  333   REMLSVNDSSKNLVRAINNRLSALSFHIREYYWVDIKKINEIYRYKTEEYSTDATNKFNI  392

Query  1292  YPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIE  1113
             YP+QIPPW+++WIPE GGYL+GNLQPAHMDFRFF+LGN W+I+SSLGT +QN++ILN +E
Sbjct  393   YPEQIPPWLMDWIPEQGGYLLGNLQPAHMDFRFFSLGNFWSIVSSLGTPKQNEAILNLME  452

Query  1112  GKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG  933
              KWDD+I  MPLKICYPALE +DWRIITGSDPKNTPWSYHN GSWPTLLWQFTLAC+KMG
Sbjct  453   AKWDDIIGNMPLKICYPALEYDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMG  512

Query  932   KPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDM  753
             +PELA KA+A+AE+RL  D+WPEYYDTR G+FIGKQ+RL QTWTVAG+LTSK+LL NP+M
Sbjct  513   RPELAEKALALAEKRLMADRWPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKLLLANPEM  572

Query  752   ASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             ASLL W EDYELL+ C CGL+ + R+KCSR   ++Q+ V
Sbjct  573   ASLLFWEEDYELLDICACGLRKSDRKKCSRVAAKTQILV  611



>ref|NP_176049.1| alkaline/neutral invertase A [Arabidopsis thaliana]
 sp|Q9FXA8.1|INVA_ARATH RecName: Full=Alkaline/neutral invertase A, mitochondrial; Short=A/N-INVA; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAG09107.1|AC009323_18 Putative invertase [Arabidopsis thaliana]
 gb|AAM53335.1| putative alkaline/neutral invertase [Arabidopsis thaliana]
 gb|AAP37746.1| At1g56560 [Arabidopsis thaliana]
 gb|AEE33409.1| alkaline/neutral invertase A [Arabidopsis thaliana]
Length=616

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/570 (72%), Positives = 470/570 (82%), Gaps = 31/570 (5%)
 Frame = -3

Query  2345  MRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDS  2166
             +R  STS E  ++DKSF++ ++Q                                I +  
Sbjct  77    VRQFSTSVETNLSDKSFERIHVQSDA-----------------------------ILERI  107

Query  2165  TVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNY  1986
               N+ ++   SI      RE SE EKEAW++L+ AVV YCG PVGTVAANDP DK+PLNY
Sbjct  108   HKNEEEVETVSIGSEKVVREESEAEKEAWRILENAVVRYCGSPVGTVAANDPGDKMPLNY  167

Query  1985  DQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTM  1806
             DQVFIRDF+PSALAFLL GEG+IV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+
Sbjct  168   DQVFIRDFVPSALAFLLKGEGDIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTV  227

Query  1805  PLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGI  1626
              LD    E  +VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGD++LQER+DVQTGI
Sbjct  228   ALDENTTE--EVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDFSLQERIDVQTGI  285

Query  1625  RLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDS  1446
             +LI+NLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSALRC+REML VNDS
Sbjct  286   KLIMNLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLSVNDS  345

Query  1445  TKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWI  1266
             +K LV AINNRLSALSFHIREYYWVD+KKINEIYRYKTEEYS DA NKFNIYP+QIPPW+
Sbjct  346   SKDLVRAINNRLSALSFHIREYYWVDIKKINEIYRYKTEEYSTDATNKFNIYPEQIPPWL  405

Query  1265  VNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQ  1086
             ++WIPE GGYL+GNLQPAHMDFRFFTLGN W+I+SSL T +QN++ILN IE KWDD+I  
Sbjct  406   MDWIPEQGGYLLGNLQPAHMDFRFFTLGNFWSIVSSLATPKQNEAILNLIEAKWDDIIGN  465

Query  1085  MPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAV  906
             MPLKICYPALE +DWRIITGSDPKNTPWSYHN GSWPTLLWQFTLAC+KMG+PELA KA+
Sbjct  466   MPLKICYPALEYDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMGRPELAEKAL  525

Query  905   AVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNED  726
             AVAE+RL  D+WPEYYDTR G+FIGKQ+RL QTWTVAG+LTSK+LL NP+MASLL W ED
Sbjct  526   AVAEKRLLADRWPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKLLLANPEMASLLFWEED  585

Query  725   YELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             YELL+ C CGL+ + R+KCSR   ++Q+ V
Sbjct  586   YELLDICACGLRKSDRKKCSRVAAKTQILV  615



>ref|XP_006297136.1| hypothetical protein CARUB_v10013138mg [Capsella rubella]
 gb|EOA30034.1| hypothetical protein CARUB_v10013138mg [Capsella rubella]
Length=669

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/688 (65%), Positives = 519/688 (75%), Gaps = 35/688 (5%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M SRSCI +S MKPC R L S+  S   + F   +   + N SK      D         
Sbjct  1     MNSRSCICVSAMKPCCRFLISFRSSSL-FGFSPPSSGRLINSSKLHCTKID--------S  51

Query  2510  rhrHSVVTLTR-VINSNRCAFCGSGSNGDQHR-------DSFCNWLGRSKNRLVFVVPKV  2355
             R   S V   R V++ N  +   S S G   R        S  +       R V ++P+V
Sbjct  52    RSIRSGVHCRRFVLDRNDFSDSDSISWGGGSRVLRARGSSSSSSSSRGRGGRGVLLIPRV  111

Query  2354  ASDMRSHSTST-EAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEI  2178
             ASD R+HS+S+ ++ VNDK+F+  +      VKPLV +  E  +   +      GG+   
Sbjct  112   ASDFRNHSSSSLDSHVNDKTFESMF------VKPLVFKEVEKTQGRPKKESGNGGGKYAN  165

Query  2177  TDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKL  1998
               +  V +    GSS          ++ EKEAWKLL+GAVVNYCG+PVGTVAANDP DK 
Sbjct  166   FGNVDVRRETERGSS---------QNDDEKEAWKLLRGAVVNYCGFPVGTVAANDPGDKQ  216

Query  1997  PLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFK  1818
              LNYDQVFIRDF+PSA AFLL+GEGEIV+NFLLHTLQLQSWEKTVDC+SPG GLMPASFK
Sbjct  217   TLNYDQVFIRDFVPSAYAFLLDGEGEIVRNFLLHTLQLQSWEKTVDCHSPGPGLMPASFK  276

Query  1817  VRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDV  1638
             V++ PL+G +G FE+ LDPDFG SAIGRV+PVDSGLWWIILLRAY K+TGDYTLQER+DV
Sbjct  277   VKSEPLEGNDGSFEEFLDPDFGGSAIGRVSPVDSGLWWIILLRAYGKLTGDYTLQERIDV  336

Query  1637  QTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLI  1458
             QTGI+LIL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC REMLI
Sbjct  337   QTGIKLILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMLI  396

Query  1457  VNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQI  1278
             VND TK+LVAA+NNRLSALSFHIREYYWVD+KKINEIYRY TEEYS DA NKFNIYPDQI
Sbjct  397   VNDGTKNLVAAVNNRLSALSFHIREYYWVDIKKINEIYRYNTEEYSADATNKFNIYPDQI  456

Query  1277  PPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDD  1098
             P W+V+WIP+ GGY +GNLQPAHMDFRFFTLGNLWA+ISSLG  EQN+ ++  IE KWDD
Sbjct  457   PTWLVDWIPDKGGYFIGNLQPAHMDFRFFTLGNLWAVISSLGDQEQNEGVMTLIEEKWDD  516

Query  1097  LIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELA  918
             L+A MPLKIC+PALE ++WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGK ELA
Sbjct  517   LVANMPLKICFPALEKDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKLELA  576

Query  917   MKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLV  738
              KAVAVAE+RL  D+WPEYYDT+ GRF+GKQ+RL QTWT+AG+L SK L++ P+ ASLL 
Sbjct  577   KKAVAVAEKRLKEDEWPEYYDTKSGRFVGKQSRLYQTWTIAGFLASKKLIEQPEKASLLF  636

Query  737   WNEDYELLENCVCGLKYN--GRRKCSRF  660
             W EDY+LLE CVCGL  +  G+ KC RF
Sbjct  637   WEEDYQLLETCVCGLSRSSGGKNKCLRF  664



>ref|XP_010415004.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X1 [Camelina 
sativa]
Length=612

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/579 (71%), Positives = 477/579 (82%), Gaps = 24/579 (4%)
 Frame = -3

Query  2372  FVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDG  2193
             F   K+  + R  STS E    DKSF++ ++Q G+ V+ +  +  E  E V     +  G
Sbjct  57    FPQSKIPPNRREFSTSVETNPTDKSFERIHVQSGVIVEMIHKKEEEEEETVSRVNVESTG  116

Query  2192  GRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAAND  2013
              R  +                      RE SE EKEAW++L+ A+V YCG PVGTVAAND
Sbjct  117   ERKAL----------------------REESEAEKEAWRILENAIVRYCGSPVGTVAAND  154

Query  2012  PADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLM  1833
             P DK PLNYDQVFIRDF+PSALAFLL GEG+IV+NFLLHTLQLQSWEKTVDCYSPGQGLM
Sbjct  155   PGDKTPLNYDQVFIRDFVPSALAFLLKGEGDIVRNFLLHTLQLQSWEKTVDCYSPGQGLM  214

Query  1832  PASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQ  1653
             PASFKVRT+ LD    E  +VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGD++LQ
Sbjct  215   PASFKVRTVALDENTTE--EVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDFSLQ  272

Query  1652  ERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCT  1473
             ER+DVQTGI+LI+NLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSALRC+
Sbjct  273   ERIDVQTGIKLIMNLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCS  332

Query  1472  REMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNI  1293
             REML VNDS+K+LV AINNRLSALSFHIREYYWVD+KKINEIYRYKTEEYS DA NKFNI
Sbjct  333   REMLSVNDSSKNLVRAINNRLSALSFHIREYYWVDIKKINEIYRYKTEEYSTDATNKFNI  392

Query  1292  YPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIE  1113
             YP+QIPPW+++WIPE GGYL+GNLQPAHMDFRFF+LGN W+I+SSLGT +QN++ILN +E
Sbjct  393   YPEQIPPWLMDWIPEQGGYLLGNLQPAHMDFRFFSLGNFWSIVSSLGTPKQNEAILNLME  452

Query  1112  GKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG  933
              KWDD+I  MPLKICYPALE +DWRIITGSDPKNTPWSYHN GSWPTLLWQFTLAC+KMG
Sbjct  453   AKWDDIIGNMPLKICYPALEYDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMG  512

Query  932   KPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDM  753
             +P+LA KA+A+AE+RL  D+WPEYYDTR G+FIGKQ+RL QTWTVAG+LTSK+LL NP+M
Sbjct  513   RPKLAEKALALAEKRLMADRWPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKLLLANPEM  572

Query  752   ASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             ASLL W EDYELL+ C CGL+ + R+KCSR   ++Q+ V
Sbjct  573   ASLLFWEEDYELLDICACGLRKSDRKKCSRVAAKTQILV  611



>ref|XP_008793361.1| PREDICTED: alkaline/neutral invertase CINV2 [Phoenix dactylifera]
Length=670

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/590 (71%), Positives = 482/590 (82%), Gaps = 9/590 (2%)
 Frame = -3

Query  2384  NRLVFVVPKVASDMRSHSTSTEA--QVNDKSFKKFYIQGGMNVKPLviertetredvvet  2211
             +R +  +P   SD+R  STS E      DK+F + YIQG M VKPLV+E  E        
Sbjct  83    HRGILGIPAAVSDLRHFSTSAEPFPGGGDKAFDRVYIQG-MAVKPLVLENVEAEALKEAV  141

Query  2210  yEQKDGGRVEITD-----DSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYC  2046
              E+ +     + +     D  V   + +G ++ ++  EREVSEVEKEAW+LL  AVV+YC
Sbjct  142   KEEVEREPAAMVEKKGSLDGGVGNLEESGGNL-EVGKEREVSEVEKEAWRLLNKAVVSYC  200

Query  2045  GYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKT  1866
             G PVGTVAANDP     LNYDQVFIRDF+P+A+AFLL GE ++V+NFLLHTLQLQSWEKT
Sbjct  201   GSPVGTVAANDPTALNQLNYDQVFIRDFVPAAIAFLLKGESDVVRNFLLHTLQLQSWEKT  260

Query  1865  VDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRA  1686
             VDCYSPGQGLMPASFKVRT+PLDG N  FE+VLDPDFGESAIGRVAPVDSGLWWIILLRA
Sbjct  261   VDCYSPGQGLMPASFKVRTVPLDGSNEAFEEVLDPDFGESAIGRVAPVDSGLWWIILLRA  320

Query  1685  YVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEI  1506
             Y KITGDYTLQERVDVQTGI+LILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEI
Sbjct  321   YGKITGDYTLQERVDVQTGIKLILNLCLSDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEI  380

Query  1505  QALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEE  1326
             QALFYSALRC+REM+ +ND++K+LV AINNRLSALSFHIREYYW+DMKKINEIYRYKTEE
Sbjct  381   QALFYSALRCSREMITINDTSKNLVRAINNRLSALSFHIREYYWIDMKKINEIYRYKTEE  440

Query  1325  YSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTH  1146
             YS +A+NKFNIYP+QIP W+ +WIPE GGYL+GNLQPAHMDFRFF+LGN WAI+SSL T 
Sbjct  441   YSHNAVNKFNIYPEQIPSWLADWIPEKGGYLIGNLQPAHMDFRFFSLGNFWAIVSSLATP  500

Query  1145  EQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLL  966
              Q + ILN IE KWDDL+A MP KICYPALE E+WRIITG DPKNTPWSYHNGGSWPTLL
Sbjct  501   RQAEGILNLIEDKWDDLVANMPFKICYPALEYEEWRIITGGDPKNTPWSYHNGGSWPTLL  560

Query  965   WQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYL  786
             WQFTLACIKMG+P+LA +AV VAE+RL  D+WPEYYDTR GRFIGKQ+ L QTWT+AG+L
Sbjct  561   WQFTLACIKMGRPDLAQRAVTVAEKRLSNDKWPEYYDTRTGRFIGKQSHLYQTWTIAGFL  620

Query  785   TSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
              SKM L+NP++A +L   ED ELLE C+C L+ + R KCSR   RSQ+ V
Sbjct  621   ISKMFLENPEIAMILTCEEDLELLEGCICSLRKSSRAKCSRLAARSQIIV  670



>ref|XP_010415005.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X2 [Camelina 
sativa]
Length=612

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/579 (71%), Positives = 476/579 (82%), Gaps = 24/579 (4%)
 Frame = -3

Query  2372  FVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDG  2193
             F   K+  + R  STS E    DKSF++ ++Q G+ V+ +  +  E  E V     +  G
Sbjct  57    FPQSKIPPNRREFSTSVETNPTDKSFERIHVQSGVIVEMIHKKEEEEEETVSRVNVESTG  116

Query  2192  GRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAAND  2013
              R  +                      RE SE EKEAW++L+ A+V YCG PVGTVAAND
Sbjct  117   ERKAL----------------------REESEAEKEAWRILENAIVRYCGSPVGTVAAND  154

Query  2012  PADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLM  1833
             P DK PLNYDQVFIRDF+PSALAFLL GEG+IV+NFLLHTLQLQSWEKTVDCYSPGQGLM
Sbjct  155   PGDKTPLNYDQVFIRDFVPSALAFLLKGEGDIVRNFLLHTLQLQSWEKTVDCYSPGQGLM  214

Query  1832  PASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQ  1653
             PASFKVRT+ LD    E  +VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGD++LQ
Sbjct  215   PASFKVRTVALDENTTE--EVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDFSLQ  272

Query  1652  ERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCT  1473
             ER+DVQTGI+LI+NLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSALRC+
Sbjct  273   ERIDVQTGIKLIMNLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCS  332

Query  1472  REMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNI  1293
             REML VNDS+K+LV AINNRLSALSFHIREYYWVD+KKINEIYRYKTEEYS DA NKFNI
Sbjct  333   REMLSVNDSSKNLVRAINNRLSALSFHIREYYWVDIKKINEIYRYKTEEYSTDATNKFNI  392

Query  1292  YPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIE  1113
             YP+QIPPW+++WIPE GGYL+GNLQPAHMDFRFF+LGN W+I+SSLGT +QN++ILN +E
Sbjct  393   YPEQIPPWLMDWIPEQGGYLLGNLQPAHMDFRFFSLGNFWSIVSSLGTPKQNEAILNLME  452

Query  1112  GKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG  933
              KWDD+I  MPLKICYPALE +DWRIITGSDPKNTPWSYHN GSWPTLLWQFTLAC+KMG
Sbjct  453   AKWDDIIGNMPLKICYPALEYDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMG  512

Query  932   KPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDM  753
             +P+LA KA+A+AE+RL  D+WPEYYDTR G+FIGKQ+RL QTWTVAG+LTSK+LL NP+M
Sbjct  513   RPKLAEKALALAEKRLMADRWPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKLLLANPEM  572

Query  752   ASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             ASLL W EDYEL + C CGL+ + R+KCSR   ++Q+ V
Sbjct  573   ASLLFWEEDYELQDICACGLRKSDRKKCSRVAAKTQILV  611



>ref|XP_006302021.1| hypothetical protein CARUB_v10020003mg [Capsella rubella]
 gb|EOA34919.1| hypothetical protein CARUB_v10020003mg [Capsella rubella]
Length=610

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/571 (72%), Positives = 479/571 (84%), Gaps = 27/571 (5%)
 Frame = -3

Query  2342  RSHSTSTEAQVNDKSFKKFYI--QGGMNVKPLviertetredvvetyEQKDGGRVEITDD  2169
             R  STS E    DKSF + ++  Q G+ V+ +                     ++E +++
Sbjct  64    RGFSTSVETNPTDKSFGRIHVDVQSGVIVERIH--------------------KIE-SEE  102

Query  2168  STVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLN  1989
              TV+  ++  S   K+   RE SE EKEAW++L+ AVV YCG PVGTVAANDP DK+PLN
Sbjct  103   ETVSGVNVETSGDGKVV--REESEAEKEAWRILEDAVVRYCGSPVGTVAANDPGDKMPLN  160

Query  1988  YDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT  1809
             YDQVFIRDF+PSALAFLL GEG+IV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT
Sbjct  161   YDQVFIRDFVPSALAFLLKGEGDIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT  220

Query  1808  MPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTG  1629
             + LD      E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGD++LQER+DVQTG
Sbjct  221   VALD--ENTTEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDFSLQERIDVQTG  278

Query  1628  IRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVND  1449
             I+LI+NLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSALRC+REML VND
Sbjct  279   IKLIMNLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLSVND  338

Query  1448  STKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPW  1269
             S+K+LV AINNRLSALSFHIREYYWVD+KKINEIYRYKTEEYS DA NKFNIYP+QIPPW
Sbjct  339   SSKNLVRAINNRLSALSFHIREYYWVDIKKINEIYRYKTEEYSTDATNKFNIYPEQIPPW  398

Query  1268  IVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIA  1089
             +++WIPE GGYL+GNLQPAHMDFRFF+LGN W+I+SSLGT +QN++ILN IE KW+D+I 
Sbjct  399   LMDWIPEQGGYLLGNLQPAHMDFRFFSLGNFWSIVSSLGTPKQNEAILNLIEAKWEDIIG  458

Query  1088  QMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKA  909
              MPLKICYPALE +DWRIITGSDPKNTPWSYHN GSWPTLLWQFTLAC+KMG+PELA KA
Sbjct  459   NMPLKICYPALEYDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMGRPELAEKA  518

Query  908   VAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNE  729
             +A+AE+RL  D+WPEYYDTR G+FIGKQ+RL QTWTVAG+LTSK+LL NP+MASLL W E
Sbjct  519   IALAEKRLMADRWPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKLLLANPEMASLLFWEE  578

Query  728   DYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             DYELL+ C CGL+ + R+KCSR   ++Q+ V
Sbjct  579   DYELLDICACGLRKSDRKKCSRVAAKTQILV  609



>ref|XP_010941514.1| PREDICTED: alkaline/neutral invertase CINV2-like [Elaeis guineensis]
Length=634

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/585 (73%), Positives = 477/585 (82%), Gaps = 23/585 (4%)
 Frame = -3

Query  2369  VVPKVASDMRSHSTSTEA---QVNDKSFKKFYIQGGM-NVKPLviertetredvvetyEQ  2202
             V P  A D+R  STS E+      DK+F++ Y+QGG+  VKPLVIER E      +  + 
Sbjct  66    VAPASAPDVRRLSTSVESVPGAAGDKAFERIYVQGGLAAVKPLVIERVEEERKEEKEIKD  125

Query  2201  KDGGRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVA  2022
                   E+ ++                A  RE SE EKEAW+LL+ AVVNYCG PVGTVA
Sbjct  126   AAPPPAEVAEER---------------AQGREESEAEKEAWRLLKRAVVNYCGTPVGTVA  170

Query  2021  ANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQ  1842
             A DP  + PLNYDQVFIRDF+PSALAFLL GE +IVKNFLLHTLQLQSWEKTVDCYSPGQ
Sbjct  171   AEDPGAQ-PLNYDQVFIRDFVPSALAFLLKGETDIVKNFLLHTLQLQSWEKTVDCYSPGQ  229

Query  1841  GLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDY  1662
             GLMPASFKVRT+PLDG N  +E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY
Sbjct  230   GLMPASFKVRTLPLDGSNEAYEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDY  289

Query  1661  TLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL  1482
              LQERVDVQTGIRLILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL
Sbjct  290   ALQERVDVQTGIRLILNLCLSDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL  349

Query  1481  RCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINK  1302
             RC+REM+ VND +K+L+ AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DAINK
Sbjct  350   RCSREMITVNDGSKNLLRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSQDAINK  409

Query  1301  FNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILN  1122
             FNIYP+QIP W+VNWIPE GGYL+GN+QPAHMDFRFF+LGNLWAI+SSL T  Q + ILN
Sbjct  410   FNIYPEQIPSWLVNWIPEKGGYLIGNVQPAHMDFRFFSLGNLWAIVSSLSTPRQAEDILN  469

Query  1121  FIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACI  942
              IE KWDDL+  MPLKICYPALE ++W IITGSDPKNTPWSYHNGGSWPTLLWQFTLACI
Sbjct  470   LIEDKWDDLMGNMPLKICYPALEFDEWHIITGSDPKNTPWSYHNGGSWPTLLWQFTLACI  529

Query  941   KMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKN  762
             K+G+PELA KA+A+AE+RL +D+WPEYYDTR GRFIGKQARL QTWT++GYLTSK+ L+N
Sbjct  530   KIGRPELARKAIALAEKRLSIDKWPEYYDTRTGRFIGKQARLYQTWTISGYLTSKLFLEN  589

Query  761   PDMASLLVWNEDYELLENCVCGLKYNG---RRKCSRFGVRSQVGV  636
             P MAS+L   ED ELLE C C L  +    R KCSR   +SQ+ V
Sbjct  590   PGMASILTCEEDLELLEGCACSLSKSAKGTRTKCSRTAAKSQLLV  634



>gb|KHG16119.1| hypothetical protein F383_01238 [Gossypium arboreum]
Length=667

 Score =   865 bits (2235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/574 (72%), Positives = 483/574 (84%), Gaps = 11/574 (2%)
 Frame = -3

Query  2357  VASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEI  2178
             +AS +R  STS E   +DK+F++ ++Q G+NVK LV      +  V        G    +
Sbjct  105   IASRVRDLSTSVETGRHDKNFERIHVQNGINVKTLVERIDTDKNLV--------GRENPL  156

Query  2177  TDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKL  1998
             T+D    KN   G    K     + S +EKEAW LL+ +VV+YCG+PVGTVAANDP DK 
Sbjct  157   TEDGNNVKNIGEGLGKGKNGVSID-SAIEKEAWDLLRDSVVSYCGFPVGTVAANDPGDKQ  215

Query  1997  PLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFK  1818
             PLNYDQVFIRDF+PSALAFLL GEG I+KNFLLHTLQLQSWEKTVDCYSPGQGLMPASFK
Sbjct  216   PLNYDQVFIRDFVPSALAFLLKGEGGILKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFK  275

Query  1817  VRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDV  1638
             VRT+P+D  + +FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY +ITGDY+LQERVDV
Sbjct  276   VRTVPID--DNKFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGRITGDYSLQERVDV  333

Query  1637  QTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLI  1458
             QTG++LILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFY+ALR +RE+L 
Sbjct  334   QTGMKLILNLCLADGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYAALRSSREILS  393

Query  1457  VNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQI  1278
             VN+ +K+LV AINNRL+ALSFHIREYYWVDMKKINEIYRYKTEEYSMDA NKFNIYP+QI
Sbjct  394   VNEGSKNLVRAINNRLNALSFHIREYYWVDMKKINEIYRYKTEEYSMDATNKFNIYPEQI  453

Query  1277  PPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDD  1098
             P W+++W+PE GGYL+GNLQPAHMDFRFFTLGNLW+I+SSLGT +QN++ILN IE KWDD
Sbjct  454   PSWLMDWVPEEGGYLIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILNLIENKWDD  513

Query  1097  LIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELA  918
             ++  MPLKICYPA+E E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLAC+KMG+ ELA
Sbjct  514   IVGHMPLKICYPAVENEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACVKMGRLELA  573

Query  917   MKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLV  738
              KA+A+AE+RL  D WPEYYDTR G+FIGKQ+RL QTWT+AG+LTSKM+++N +MASLL 
Sbjct  574   QKAIALAEKRLSRDHWPEYYDTRSGKFIGKQSRLYQTWTIAGFLTSKMMVENREMASLLF  633

Query  737   WNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             W EDYELLE CVC L  +GR KCSR   +SQ+ V
Sbjct  634   WEEDYELLEICVCALSKSGRVKCSRGAAKSQILV  667



>ref|XP_010938195.1| PREDICTED: alkaline/neutral invertase CINV1-like [Elaeis guineensis]
Length=649

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/592 (71%), Positives = 483/592 (82%), Gaps = 13/592 (2%)
 Frame = -3

Query  2384  NRLVFVVPKVASDMRSHSTSTEA--QVNDKSFKKFYIQGGMNVKPLviertetredvvet  2211
             +R +  +P   SD+R  STS+E      DK+F + YIQG M VKPL +E  E        
Sbjct  62    HRGILGIPAAVSDLRRFSTSSEPFPGGGDKAFDRIYIQG-MAVKPLELESVEAEALREAG  120

Query  2210  yEQKDGGR-------VEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVN  2052
               +++G R        E + D  V   + +G ++ ++  +REVSEVEKEAW+ L  AV +
Sbjct  121   --KEEGEREQAATVETEGSVDGGVGNLEESGRNL-EVGKDREVSEVEKEAWRFLNKAVAS  177

Query  2051  YCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWE  1872
             YCG PVGTVAANDP     LNYDQVFIRDF+PSA+AFL+ GE ++V+NFLLH +QLQSWE
Sbjct  178   YCGSPVGTVAANDPTTLSQLNYDQVFIRDFVPSAIAFLIKGESDVVRNFLLHIVQLQSWE  237

Query  1871  KTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILL  1692
             KTVDCYSPGQGLMPASFKVRT+PLDG N  FE+VLDPDFGESAIGRVAPVDSGLWWIILL
Sbjct  238   KTVDCYSPGQGLMPASFKVRTVPLDGSNEAFEEVLDPDFGESAIGRVAPVDSGLWWIILL  297

Query  1691  RAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPL  1512
             RAY KITGDYTLQERVDVQTGI+LILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPL
Sbjct  298   RAYGKITGDYTLQERVDVQTGIKLILNLCLSDGFDMFPSLLVTDGSCMIDRRMGIHGHPL  357

Query  1511  EIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKT  1332
             EIQALFYSALRC+REM+ +ND++K+LV AINNRLSALSFHIREYYWVDMKKINEIYRYKT
Sbjct  358   EIQALFYSALRCSREMITINDTSKNLVRAINNRLSALSFHIREYYWVDMKKINEIYRYKT  417

Query  1331  EEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLG  1152
             EEYS +A+NKFNIYP+QIP W+ +WIPE GGYL+GNLQPAHMDFRFF+LGN WAI+SSL 
Sbjct  418   EEYSQNAVNKFNIYPEQIPYWLADWIPEKGGYLIGNLQPAHMDFRFFSLGNFWAIVSSLT  477

Query  1151  THEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPT  972
             T  Q + ILN IE KWDDL+A MP KICYPALE E+WRIITG DPKNTPWSYHNGGSWPT
Sbjct  478   TPRQAEGILNLIEDKWDDLVANMPFKICYPALEYEEWRIITGGDPKNTPWSYHNGGSWPT  537

Query  971   LLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAG  792
             LLWQFTLACIKMG+P+LA +AVAVAE+RL  D+WPEYYDTR GRFIGKQ+RL QTWT+AG
Sbjct  538   LLWQFTLACIKMGRPDLAQRAVAVAEKRLSNDKWPEYYDTRAGRFIGKQSRLYQTWTIAG  597

Query  791   YLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             +L SK+LL  P++A++L   ED ELLE C+CGL  + R KCSR   RSQ+ V
Sbjct  598   FLVSKLLLAYPEIATILTCEEDLELLEGCICGLNKSSRTKCSRLAARSQILV  649



>gb|AFS17279.1| neutral/alkaline invertase [Amaranthus cruentus/Amaranthus hypocondriacus 
mixed library]
Length=556

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/532 (77%), Positives = 460/532 (86%), Gaps = 12/532 (2%)
 Frame = -3

Query  2204  QKDGGRVEITDDSTVNKNDLNGSSISKLAPEREV------------SEVEKEAWKLLQGA  2061
             +KD   V+      VN+ D++    + L  E EV            SE+E+EAW+LL+ +
Sbjct  22    EKDRIGVDTNHLEEVNEVDVSPRKSNLLEIEEEVNEVDVSPRKAKLSEIEEEAWELLRSS  81

Query  2060  VVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQ  1881
             VVNYCG PVGTVAANDP DK PLNYDQVFIRDF+PSALAFLLNGEG+IVKNFLLHTLQLQ
Sbjct  82    VVNYCGNPVGTVAANDPNDKQPLNYDQVFIRDFVPSALAFLLNGEGDIVKNFLLHTLQLQ  141

Query  1880  SWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWI  1701
             SWEKTVDCYSP QGLMPASFKV T+ L+G+ G FE+VLDPDFGESAIGR APVDSGLWWI
Sbjct  142   SWEKTVDCYSPRQGLMPASFKVSTVSLNGKEGAFEEVLDPDFGESAIGRAAPVDSGLWWI  201

Query  1700  ILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHG  1521
             ILLRAY KITGDY+LQE+VDVQTGIRLILNLCL +GFDMFPTLLVTDGSCMIDRRMGIHG
Sbjct  202   ILLRAYGKITGDYSLQEKVDVQTGIRLILNLCLTNGFDMFPTLLVTDGSCMIDRRMGIHG  261

Query  1520  HPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYR  1341
             HPLEIQALFYSALRC+REMLIVN+ TKSLVAAINNRLSALSFH+REYYWVD+KK+NEIYR
Sbjct  262   HPLEIQALFYSALRCSREMLIVNNGTKSLVAAINNRLSALSFHMREYYWVDLKKLNEIYR  321

Query  1340  YKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIIS  1161
             YKTEEYS DAINKFNIYP+QIP W+V+WIPE GGY +GNLQPAHMDFRFFTLGNLW+I+S
Sbjct  322   YKTEEYSTDAINKFNIYPEQIPSWLVDWIPEQGGYFIGNLQPAHMDFRFFTLGNLWSIVS  381

Query  1160  SLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGS  981
             SLGT +QN+SILN I+ KW+DLIA MPLKICYPALE E+WRIITG DPKNTPWSYHNGGS
Sbjct  382   SLGTPQQNESILNLIDAKWEDLIADMPLKICYPALESEEWRIITGCDPKNTPWSYHNGGS  441

Query  980   WPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWT  801
             WPTLLWQFTLACIKM + +LA KA+ VAE+RL VD+WPEYYDT+ GRFIGKQARL QTWT
Sbjct  442   WPTLLWQFTLACIKMNRLDLAEKAITVAEKRLSVDKWPEYYDTKKGRFIGKQARLFQTWT  501

Query  800   VAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQ  645
             +AGYLTSK LL+NPD+AS L+++EDYELLE CVC     GR+KCSR   R Q
Sbjct  502   IAGYLTSKKLLENPDIASSLMFDEDYELLEICVCAFSKAGRKKCSRGVTRHQ  553



>ref|XP_008794511.1| PREDICTED: alkaline/neutral invertase CINV2-like [Phoenix dactylifera]
Length=631

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/574 (74%), Positives = 470/574 (82%), Gaps = 24/574 (4%)
 Frame = -3

Query  2345  MRSHSTSTEAQVNDKSFKKFYIQGGMN-VKPLviertetredvvetyEQKDGGRVEITDD  2169
             +R  STS      DK+F + Y+QGG+  VKPLVIE             + +G   E   +
Sbjct  78    LRRLSTSVNPVPGDKAFDRIYVQGGLAAVKPLVIET------------KPEGDVKEPAPE  125

Query  2168  STVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLN  1989
             + V        +  + AP RE SE EKEAW+LL+ AVVNYCG PVGTVAA+DP    PLN
Sbjct  126   APVE-------APPEAAPVREESEFEKEAWRLLKRAVVNYCGNPVGTVAADDPGAG-PLN  177

Query  1988  YDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT  1809
             YDQVFIRDF+PSALAFLL GE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT
Sbjct  178   YDQVFIRDFVPSALAFLLKGESEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT  237

Query  1808  MPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTG  1629
             +P+DG N  +E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTG
Sbjct  238   LPMDGSNEAYEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYGLQERVDVQTG  297

Query  1628  IRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVND  1449
             I+LILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REM+ VND
Sbjct  298   IKLILNLCLSDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMITVND  357

Query  1448  STKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPW  1269
              TK+L+ AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DA NKFNIYP+QIP W
Sbjct  358   GTKNLLRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSQDATNKFNIYPEQIPSW  417

Query  1268  IVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIA  1089
             +V+WIPE GGY +GNLQPAHMDFRFF+LGNLWAI+SSL T    + ILN IE KWDDL+ 
Sbjct  418   LVHWIPEKGGYFIGNLQPAHMDFRFFSLGNLWAIVSSLSTPRHAEGILNLIEDKWDDLVG  477

Query  1088  QMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKA  909
              MPLKICYPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+PELA KA
Sbjct  478   NMPLKICYPALEFEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARKA  537

Query  908   VAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNE  729
             +AVAE+RL  D+WPEYYDT+ GRFIGKQARL QTWTV+GYL SKM L+NP+MAS+L   E
Sbjct  538   IAVAEKRLSNDKWPEYYDTQTGRFIGKQARLYQTWTVSGYLASKMFLENPEMASILTCEE  597

Query  728   DYELLENCVCGL---KYNGRRKCSRFGVRSQVGV  636
             D ELLE C C L     + R+KCSR   +SQV V
Sbjct  598   DLELLEGCACSLTKSAKSARKKCSRSAAKSQVLV  631



>ref|XP_009124460.1| PREDICTED: alkaline/neutral invertase CINV2 [Brassica rapa]
Length=632

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/518 (78%), Positives = 456/518 (88%), Gaps = 4/518 (1%)
 Frame = -3

Query  2183  EITDDSTVNKNDLNGSSISKLAPE--REVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDP  2010
             E T   +V+  ++ G+ I K      RE SE EKEAW++L+ AVV YCG PVGTVAANDP
Sbjct  116   EETIGESVSGGEIIGNEIKKSEETLVREESEAEKEAWRILEDAVVRYCGSPVGTVAANDP  175

Query  2009  ADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMP  1830
              DKLPLNYDQVFIRDF+PSALAFLL GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQGLMP
Sbjct  176   GDKLPLNYDQVFIRDFVPSALAFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMP  235

Query  1829  ASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQE  1650
             ASFKVRT+ LD      E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY K+TGD++LQE
Sbjct  236   ASFKVRTVALD--ENTTEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDFSLQE  293

Query  1649  RVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTR  1470
             R+DVQTGI+LI+NLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSALRC+R
Sbjct  294   RIDVQTGIKLIMNLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSR  353

Query  1469  EMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIY  1290
             EML VNDS+ +LV AI+NRLSALSFHIREYYWVD+KKINEIYRYKTEEYS DA NKFNIY
Sbjct  354   EMLSVNDSSSNLVRAISNRLSALSFHIREYYWVDIKKINEIYRYKTEEYSTDATNKFNIY  413

Query  1289  PDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEG  1110
             P+QIPPW+++WIPE GGYL+GNLQPAHMDFRFFTLGN W+++SSL T +QN++ILN IE 
Sbjct  414   PEQIPPWLMDWIPEQGGYLLGNLQPAHMDFRFFTLGNFWSVVSSLSTPKQNEAILNLIEA  473

Query  1109  KWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGK  930
             KWDD+I  MPLKICYPALE +DWRIITGSDPKNTPWSYHN GSWPTLLWQFTLAC+KMG+
Sbjct  474   KWDDIIGNMPLKICYPALEYDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMGR  533

Query  929   PELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMA  750
             PELA KA+A+AE+RL  D+WPEYYDTR G+FIGKQ+RL QTWTVAG+LTSK+LL NP+MA
Sbjct  534   PELAEKALALAEKRLMADRWPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKLLLANPEMA  593

Query  749   SLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             S L W EDYELL+ CVCGL  +GRRKCSR   ++Q+ V
Sbjct  594   SKLFWEEDYELLDICVCGLSKSGRRKCSRVAAKTQILV  631



>emb|CDY04446.1| BnaA03g59380D [Brassica napus]
Length=622

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/492 (81%), Positives = 445/492 (90%), Gaps = 2/492 (0%)
 Frame = -3

Query  2111  REVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLN  1932
             RE SE EKEAW++L+ AVV YCG PVGTVAANDP DKLPLNYDQVFIRDF+PSALAFLL 
Sbjct  132   REESEAEKEAWRILEDAVVRYCGSPVGTVAANDPGDKLPLNYDQVFIRDFVPSALAFLLK  191

Query  1931  GEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFG  1752
             GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+ LD      E+VLDPDFG
Sbjct  192   GEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVALD--ENTTEEVLDPDFG  249

Query  1751  ESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTL  1572
             ESAIGRVAPVDSGLWWIILLRAY K+TGD++LQER+DVQTGI+LI+NLCL DGFDMFPTL
Sbjct  250   ESAIGRVAPVDSGLWWIILLRAYGKLTGDFSLQERIDVQTGIKLIMNLCLADGFDMFPTL  309

Query  1571  LVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFH  1392
             LVTDGSCMIDRRMGIHGHPLEIQ+LFYSALRC+REML VNDS+ +LV AI+NRLSALSFH
Sbjct  310   LVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLSVNDSSSNLVRAISNRLSALSFH  369

Query  1391  IREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPA  1212
             IREYYWVD+KKINEIYRYKTEEYS DA NKFNIYP+QIPPW+++WIPE GGYL+GNLQPA
Sbjct  370   IREYYWVDIKKINEIYRYKTEEYSTDATNKFNIYPEQIPPWLMDWIPEQGGYLLGNLQPA  429

Query  1211  HMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRII  1032
             HMDFRFFTLGN W+++SSL T +QN++ILN IE KWDD+I  MPLKICYPALE +DWRII
Sbjct  430   HMDFRFFTLGNFWSVVSSLSTPKQNEAILNLIEAKWDDIIGNMPLKICYPALEYDDWRII  489

Query  1031  TGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDT  852
             TGSDPKNTPWSYHN GSWPTLLWQFTLAC+KMG+PELA KA+A+AE+RL  D+WPEYYDT
Sbjct  490   TGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMGRPELAEKALALAEKRLMADRWPEYYDT  549

Query  851   RHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRK  672
             R G+FIGKQ+RL QTWTVAG+LTSK+LL NP+MAS L W EDYELL+ CVCGL  +GRRK
Sbjct  550   RSGKFIGKQSRLYQTWTVAGFLTSKLLLANPEMASKLFWEEDYELLDICVCGLSKSGRRK  609

Query  671   CSRFGVRSQVGV  636
             CSR   ++Q+ V
Sbjct  610   CSRVAAKTQILV  621



>emb|CDY04374.1| BnaC04g18190D [Brassica napus]
Length=626

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/591 (71%), Positives = 482/591 (82%), Gaps = 36/591 (6%)
 Frame = -3

Query  2405  NWLGRSKNRLVFVVPKVASDMRSHSTST-EAQVNDKSFKKFYIQGGMNVKPLviertetr  2229
             NW+   K         ++  +R  S S  E   +DK+F++     G+N  PLVIER    
Sbjct  70    NWVSEKKK-------SISVSLREFSISVVETNTSDKTFERVV---GLNPNPLVIERIHNG  119

Query  2228  edvvetyEQKDGGRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNY  2049
             E       +  G  +E ++++ V                RE SE EKEAW++L+ AVV Y
Sbjct  120   E-------ETIGESIEKSEETLV----------------REESEAEKEAWRILEDAVVRY  156

Query  2048  CGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEK  1869
             CG PVGTVAANDP DKLPLNYDQVFIRDF+PSALAFLL GEGEIV+NFLLHTLQLQSWEK
Sbjct  157   CGSPVGTVAANDPGDKLPLNYDQVFIRDFVPSALAFLLKGEGEIVRNFLLHTLQLQSWEK  216

Query  1868  TVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLR  1689
             TVDCYSPGQGLMPASFKVRT+ LD      E+VLDPDFGESAIGRVAPVDSGLWWIILLR
Sbjct  217   TVDCYSPGQGLMPASFKVRTVALD--ENTTEEVLDPDFGESAIGRVAPVDSGLWWIILLR  274

Query  1688  AYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLE  1509
             AY K+TGD++LQER+DVQTGI+LI+NLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLE
Sbjct  275   AYGKLTGDFSLQERIDVQTGIKLIMNLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLE  334

Query  1508  IQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTE  1329
             IQ+LFYSALRC+REML VNDS+ +LV AINNRLSALSFHIREYYWVD++KINEIYRYKTE
Sbjct  335   IQSLFYSALRCSREMLSVNDSSNNLVRAINNRLSALSFHIREYYWVDIRKINEIYRYKTE  394

Query  1328  EYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGT  1149
             EYS DA NKFNIYP+QIPPW+++WIPE GGYL+GNLQPAHMDFRFFTLGN W+++SSL T
Sbjct  395   EYSTDATNKFNIYPEQIPPWLMDWIPEQGGYLLGNLQPAHMDFRFFTLGNFWSVVSSLST  454

Query  1148  HEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTL  969
              +QN++ILN IE KWDD+I  MPLKICYPALE +DWRIITGSDPKNTPWSYHN GSWPTL
Sbjct  455   PKQNEAILNLIEAKWDDIIGNMPLKICYPALEYDDWRIITGSDPKNTPWSYHNSGSWPTL  514

Query  968   LWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGY  789
             LWQFTLAC+KMG+PELA KA+A+AE+RL  D+WPEYYDTR G+FIGKQ+RL QTWTVAG+
Sbjct  515   LWQFTLACMKMGRPELAEKALALAEKRLMADRWPEYYDTRSGKFIGKQSRLYQTWTVAGF  574

Query  788   LTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             LTSK+LL NP+MAS L W EDYELL+ CVCGL  +GR+KCSR   ++Q+ V
Sbjct  575   LTSKLLLANPEMASKLFWEEDYELLDICVCGLSKSGRKKCSRVAAKTQILV  625



>gb|KFK22543.1| hypothetical protein AALP_AAs68488U000500 [Arabis alpina]
Length=617

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/572 (72%), Positives = 474/572 (83%), Gaps = 18/572 (3%)
 Frame = -3

Query  2357  VASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEI  2178
             V+    S   S     N    +K ++Q G+N  PLVI              ++   + + 
Sbjct  63    VSQKTTSIGVSVRHFSNSVETEKIHVQTGLNSNPLVI--------------ERIHNKDQE  108

Query  2177  TDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKL  1998
             T   +V++ ++N  ++      RE SE EKEAW++L+ AVV YCG PVGTVAANDP DKL
Sbjct  109   TLGESVSRVEINVETLG--GKVREESEAEKEAWRILEDAVVRYCGSPVGTVAANDPGDKL  166

Query  1997  PLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFK  1818
             PLNYDQVFIRDF+PSALAFLL G+G+IV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFK
Sbjct  167   PLNYDQVFIRDFVPSALAFLLKGQGDIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFK  226

Query  1817  VRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDV  1638
             VRT+ LD  +   E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY K+TGD++LQER+DV
Sbjct  227   VRTVALD--DNTTEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDFSLQERIDV  284

Query  1637  QTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLI  1458
             QTGI+LI+NLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSAL C+REML 
Sbjct  285   QTGIKLIMNLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALICSREMLS  344

Query  1457  VNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQI  1278
             VNDS+K+LV AINNRLSALSFHIREYYWVD+KKINEIYRYKTEEYS DA NKFNIYP+QI
Sbjct  345   VNDSSKNLVRAINNRLSALSFHIREYYWVDIKKINEIYRYKTEEYSTDATNKFNIYPEQI  404

Query  1277  PPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDD  1098
             PPW+++WIPE GGYL+GNLQPAHMDFRFF+LGN W+++SSL T +QN++ILN IE KWDD
Sbjct  405   PPWLMDWIPEQGGYLLGNLQPAHMDFRFFSLGNFWSVVSSLSTPKQNEAILNLIEAKWDD  464

Query  1097  LIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELA  918
             +I  MPLKICYPALE +DWRIITGSDPKNTPWSYHN GSWPTLLWQFTLAC+KMG+PELA
Sbjct  465   IIGNMPLKICYPALEYDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMGRPELA  524

Query  917   MKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLV  738
              KAVA+AE+RL  D+WPEYYDTR G+FIGKQ+RL QTWTVAGYLTSK+LL NP+MASLL 
Sbjct  525   EKAVALAEKRLMADRWPEYYDTRSGKFIGKQSRLYQTWTVAGYLTSKLLLANPEMASLLF  584

Query  737   WNEDYELLENCVCGLKYNGRRKCSRFGVRSQV  642
             W EDYELL+ CVCGL   GR+KCSR   +  +
Sbjct  585   WEEDYELLDICVCGLSKTGRKKCSRVAAKIHI  616



>ref|XP_003591226.1| Neutral invertase [Medicago truncatula]
 gb|AES61477.1| neutral/alkaline invertase [Medicago truncatula]
Length=594

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/571 (73%), Positives = 468/571 (82%), Gaps = 40/571 (7%)
 Frame = -3

Query  2348  DMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDD  2169
             +++  STS E +VN+ +F++ YIQGG+NVKPL                            
Sbjct  64    NVQCFSTSVETRVNENNFERIYIQGGVNVKPL----------------------------  95

Query  2168  STVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLN  1989
                          S +  E E S VEK+AWKLL+ AVV YCG PVGTVAANDP DKLPLN
Sbjct  96    ----------VVESVVVKEEEESHVEKQAWKLLKDAVVTYCGNPVGTVAANDPGDKLPLN  145

Query  1988  YDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT  1809
             YDQVFIRDF+PSALAFLL G+ EIVK FLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT
Sbjct  146   YDQVFIRDFVPSALAFLLKGDTEIVKYFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT  205

Query  1808  MPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTG  1629
             + LDG   E  +VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY+LQERVDVQTG
Sbjct  206   VALDGDTRE--EVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYSLQERVDVQTG  263

Query  1628  IRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVND  1449
             +++IL LCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML+V D
Sbjct  264   LKMILKLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVVTD  323

Query  1448  STKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPW  1269
              T  LV AINNRLSALSFHIR+YYWVDMKKINEIYRY TEEYSMDAINKFNIYP+QIP W
Sbjct  324   GTNDLVRAINNRLSALSFHIRQYYWVDMKKINEIYRYNTEEYSMDAINKFNIYPEQIPFW  383

Query  1268  IVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIA  1089
             +++WIPE GGYL+GNLQPAHMDFRFFTLGNLW+IISSL T  QN++ILN IE KWD+L+ 
Sbjct  384   VMDWIPEKGGYLIGNLQPAHMDFRFFTLGNLWSIISSLSTPRQNEAILNLIEAKWDELVG  443

Query  1088  QMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKA  909
              MPLKICYPAL+ E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ ELA KA
Sbjct  444   HMPLKICYPALDNEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRIELAQKA  503

Query  908   VAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNE  729
             V +AE+RLPVD WPEYYDTR G+FIGKQ+RL QTWT+AG+LTSK+LLKNP MAS+L   E
Sbjct  504   VDLAEKRLPVDSWPEYYDTRSGKFIGKQSRLYQTWTIAGFLTSKLLLKNPKMASMLFSEE  563

Query  728   DYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             DY+LL+ CVCGL   GR+KCSR   +SQ+ V
Sbjct  564   DYDLLDICVCGLSKRGRKKCSRGAAKSQILV  594



>emb|CDY05271.1| BnaC05g45320D [Brassica napus]
Length=664

 Score =   854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/693 (65%), Positives = 526/693 (76%), Gaps = 52/693 (8%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M +RSCI +S +KPC R L S+  S     FG      + N SK + +  D   +  G  
Sbjct  3     MNNRSCICVSAVKPCCRFLISFKRSSL---FGL---SPLINSSKLRSRKIDARSIRSGVN  56

Query  2510  rhrHSVVTLTRVINSNRCAFC--------GSGSNGDQHRDSFCNWLGRSKNRLVFVVPKV  2355
                       R I  +R AFC        G+GS     R S     GR + R V V+P+V
Sbjct  57    ---------CRRIALDRNAFCDSESTSWGGAGSRVIIGRASIGR--GRGRGRGVLVIPRV  105

Query  2354  ASDMRSHSTST-EAQVN-DKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVE  2181
             ASD R+ STS+  + VN DKSF+      G+ VKPLV +  E  E++ +   ++ GG   
Sbjct  106   ASDFRNQSTSSLGSHVNKDKSFE------GIFVKPLVFKELEQTEEIPK---KESGG---  153

Query  2180  ITDDSTVNKNDLNGSSISKLAPEREVS--EVEKEAWKLLQGAVVNYCGYPVGTVAANDPA  2007
               +D+      + G +      ER VS  E E+EAWKLL+GAVVNYCG+PVGTVAANDP 
Sbjct  154   -DEDAKFGNVGVKGET------ERVVSQSEAEREAWKLLRGAVVNYCGFPVGTVAANDPG  206

Query  2006  DKLP-LNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMP  1830
             DK   LNYDQVFIRDF+PSA AFLL+G+GEIV+NFLL TLQLQSWEKTVDC+SPG GLMP
Sbjct  207   DKQKTLNYDQVFIRDFVPSAYAFLLDGDGEIVRNFLLQTLQLQSWEKTVDCHSPGPGLMP  266

Query  1829  ASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQE  1650
             ASFKV+++PL+G +G FE+ LD DFGESAIGRV+PVDSGLWWIILLRAY K+TGDYTLQE
Sbjct  267   ASFKVKSVPLEGNDGSFEECLDADFGESAIGRVSPVDSGLWWIILLRAYGKLTGDYTLQE  326

Query  1649  RVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTR  1470
             R+DVQTGI+LIL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYS+LRC R
Sbjct  327   RIDVQTGIKLILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSSLRCAR  386

Query  1469  EMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIY  1290
             EML VND TK+LVAA+N+RLSALSFHIREYYWVD+KKINEIYRY TEEYS DA NKFNIY
Sbjct  387   EMLNVNDETKNLVAAVNSRLSALSFHIREYYWVDIKKINEIYRYNTEEYSADATNKFNIY  446

Query  1289  PDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEG  1110
             P+QIP W+V+WIP  GGY +GNLQPAHMDFRFFTLGNLWA++SSLG+ EQN+ ++  IE 
Sbjct  447   PEQIPSWLVDWIPNRGGYFIGNLQPAHMDFRFFTLGNLWAVVSSLGSQEQNEGVMALIEE  506

Query  1109  KWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGK  930
             KWDDL+A MPLKIC+PALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGK
Sbjct  507   KWDDLVANMPLKICFPALEQEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGK  566

Query  929   PELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMA  750
              +LA KAVAVAE+RL  DQWPEYYDTR GRF+GKQ+RL QTWT+AG+L SK L++ P+ A
Sbjct  567   LDLAKKAVAVAEKRLKEDQWPEYYDTRSGRFVGKQSRLYQTWTIAGFLASKKLIEQPEKA  626

Query  749   SLLVWNEDYELLENCVCGL---KYNGRRKCSRF  660
             SLL W EDY+LLE CVCGL       + KCSRF
Sbjct  627   SLLFWEEDYQLLETCVCGLNKSSGKKKNKCSRF  659



>ref|XP_006841615.1| hypothetical protein AMTR_s00003p00222410 [Amborella trichopoda]
 gb|ERN03290.1| hypothetical protein AMTR_s00003p00222410 [Amborella trichopoda]
Length=648

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/601 (69%), Positives = 480/601 (80%), Gaps = 33/601 (5%)
 Frame = -3

Query  2351  SDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITD  2172
             S++R +ST+ E    ++ F+  Y+QG + VKPLVIE+ E +   V     K    V+ +D
Sbjct  52    SEIRCNSTTAEQHTGNQGFESIYVQG-IGVKPLVIEKIEEQNPGVSG---KSDSCVQESD  107

Query  2171  D-----------------------STVNKNDLNGSSIS------KLAPEREVSEVEKEAW  2079
             D                         V   ++    +S      +++ ERE S +EKEAW
Sbjct  108   DLRDSEEIRSFNSSESSEETGASGDHVRFEEIRAPEVSGGVEENRVSIEREESAIEKEAW  167

Query  2078  KLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLL  1899
             +LL  AVVNYCG P+G+VAAN+PAD  PLNYDQVFIRDF+PSALA+LL G+ EIV+NFLL
Sbjct  168   RLLNAAVVNYCGSPIGSVAANNPADNSPLNYDQVFIRDFVPSALAYLLKGDREIVRNFLL  227

Query  1898  HTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVD  1719
             HTLQLQSWEKTVDCYSPGQGLMPASFKVRT+PLDG +  FE++LDPDFGESAIGRVAPVD
Sbjct  228   HTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGSHEAFEEILDPDFGESAIGRVAPVD  287

Query  1718  SGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDR  1539
             SGLWWIILLRAY K+TGDY LQERVDVQTGI+LILNLCL DGFDMFPTLLVTDGSCMIDR
Sbjct  288   SGLWWIILLRAYGKLTGDYALQERVDVQTGIKLILNLCLADGFDMFPTLLVTDGSCMIDR  347

Query  1538  RMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKK  1359
             RMGIHGHPLEIQALFYSALRC REM+ +ND TK+L+ A+NNRLSALSFHIREYYWVDMKK
Sbjct  348   RMGIHGHPLEIQALFYSALRCAREMITINDGTKNLMRAVNNRLSALSFHIREYYWVDMKK  407

Query  1358  INEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGN  1179
             INEIYRYKTEEYS DA+NKFNIYP+QIP W+V WIP+ GGYL+GNLQPAHMDFRFF+LGN
Sbjct  408   INEIYRYKTEEYSHDAVNKFNIYPEQIPSWLVEWIPDKGGYLIGNLQPAHMDFRFFSLGN  467

Query  1178  LWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWS  999
             LWAI+SSL T EQ +SILN IE KWDDL+ +MPLKIC+PALE E+WRIITGSDPKNTPWS
Sbjct  468   LWAIVSSLTTPEQAESILNLIESKWDDLVGKMPLKICFPALEYEEWRIITGSDPKNTPWS  527

Query  998   YHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQAR  819
             YHN GSWPTLLWQFT ACIKMG+P++A +A+AVAE+RL  D WPEYYDTR  RFIGKQAR
Sbjct  528   YHNAGSWPTLLWQFTAACIKMGRPDMAKRALAVAEKRLSKDLWPEYYDTRSARFIGKQAR  587

Query  818   LNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVG  639
             L QTWT+AG+LT+KMLL NP++A +L   ED ELLE C C L  + R KCSR   RSQV 
Sbjct  588   LYQTWTIAGFLTAKMLLDNPELACMLTCEEDLELLEGCSCPLSASPRTKCSRNAARSQVL  647

Query  638   V  636
             V
Sbjct  648   V  648



>ref|XP_009414162.1| PREDICTED: alkaline/neutral invertase CINV2-like [Musa acuminata 
subsp. malaccensis]
Length=650

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/578 (72%), Positives = 471/578 (81%), Gaps = 16/578 (3%)
 Frame = -3

Query  2345  MRSHSTSTEA-QVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDD  2169
             +R  STS +     DK+ ++ +IQ  M+VKP+V++  +      E  E+ D     +  D
Sbjct  75    VRRFSTSVDPISGGDKNLERIFIQN-MSVKPIVVDGVDAVPIEDERKEEVD----TVVAD  129

Query  2168  STVNKNDLNGSSISKL---------APEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAAN  2016
                 K +L G  +  L           E+E SEVEKEAW+LL  AVV+YCG P+GTVAAN
Sbjct  130   VEEGKEELCGGKVGDLDQLEGGLEVRQEKEQSEVEKEAWRLLDRAVVSYCGRPIGTVAAN  189

Query  2015  D-PADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQG  1839
             D  A    +NYDQVFIRDF+PSALAFLL GE EIV+NFLLHTLQLQSWEKTVDCYSPGQG
Sbjct  190   DVTAANQAVNYDQVFIRDFVPSALAFLLKGESEIVRNFLLHTLQLQSWEKTVDCYSPGQG  249

Query  1838  LMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYT  1659
             LMPASFKVRT+PLDG N  FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY 
Sbjct  250   LMPASFKVRTVPLDGSNEAFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYA  309

Query  1658  LQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALR  1479
             LQERVDVQTGIRLILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALR
Sbjct  310   LQERVDVQTGIRLILNLCLSDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALR  369

Query  1478  CTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKF  1299
             C+REM+  ND +K+LV AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DAINKF
Sbjct  370   CSREMITFNDGSKNLVRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSHDAINKF  429

Query  1298  NIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNF  1119
             NIYP+QIP W+V W+P+ GGY +GNLQPAHMDFRFF+LGN WAI+SSL T  Q + ILN 
Sbjct  430   NIYPEQIPSWLVEWMPDKGGYFIGNLQPAHMDFRFFSLGNFWAIVSSLATPRQAEGILNL  489

Query  1118  IEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIK  939
             IE KWDD++ +MPLKICYP+LE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIK
Sbjct  490   IEDKWDDIVGRMPLKICYPSLEYEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIK  549

Query  938   MGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNP  759
             MG+ ELA +AVAVAE+RLP+D+WPEYYDTR GRFIGKQ+RL QTWT+AG+LT+KMLL+NP
Sbjct  550   MGRSELAQRAVAVAEKRLPIDKWPEYYDTRSGRFIGKQSRLYQTWTIAGFLTAKMLLENP  609

Query  758   DMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQ  645
               A++L  +ED ELL+ C C L  N R KCSR   +SQ
Sbjct  610   AAAAVLTCDEDLELLQGCACSLSKNARIKCSRLAAKSQ  647



>gb|AAF26084.1|AC012393_10 putative alkaline/neutral invertase [Arabidopsis thaliana]
Length=622

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/605 (68%), Positives = 486/605 (80%), Gaps = 30/605 (5%)
 Frame = -3

Query  2429  DQHRDSFCNWLGRSKNRLVF-------VVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGG  2271
             +Q+R++  + + R  N + F       V  +V S+ RSHS ST    ND +  + Y + G
Sbjct  37    NQYRNADSDRIIRPTNAVPFCTDRQSSVTAQVVSEARSHSASTTC-ANDTTLDQIYTKNG  95

Query  2270  MNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNGSSISKLAPEREVSEVE  2091
             +NVKPLV+ER +          +KD   V   D+  V ++   G          + ++VE
Sbjct  96    LNVKPLVVERLKRD--------EKDEEAVN-EDEEGVKRDGFEGV---------KCNDVE  137

Query  2090  KEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVK  1911
             +EAW+LL+ ++V YC  PVGTVAA DP D  P NYDQVFIRDF+PSALAFLL GE EIV+
Sbjct  138   EEAWRLLRDSIVTYCDSPVGTVAAKDPTDTTPSNYDQVFIRDFVPSALAFLLKGESEIVR  197

Query  1910  NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRV  1731
             NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+PL+    +FE+VLDPDFGE+AIGRV
Sbjct  198   NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTLPLE--EDKFEEVLDPDFGEAAIGRV  255

Query  1730  APVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSC  1551
             APVDSGLWWIILLRAY KITGDY+LQER+DVQTGI++I NLCL DGFDMFPTLLVTDGSC
Sbjct  256   APVDSGLWWIILLRAYGKITGDYSLQERIDVQTGIKMIANLCLADGFDMFPTLLVTDGSC  315

Query  1550  MIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWV  1371
             MIDRRMGIHGHPLEIQALFYSALR +REM+ VNDS+K+++  I+NRLSALSFHIRE YWV
Sbjct  316   MIDRRMGIHGHPLEIQALFYSALRSSREMITVNDSSKNIIKTISNRLSALSFHIRENYWV  375

Query  1370  DMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPET--GGYLVGNLQPAHMDFR  1197
             D  KINEIYRYKTEEYSMDA NKFNIYP+Q+ PW+++W+PE+   G+L+GNLQPAHMDFR
Sbjct  376   DKNKINEIYRYKTEEYSMDATNKFNIYPEQVSPWLMDWVPESPDSGFLIGNLQPAHMDFR  435

Query  1196  FFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDP  1017
             FFTLGNLW+IISSLGT +QN++ILN +E KWDDL+  MPLKICYPALE  +W IITGSDP
Sbjct  436   FFTLGNLWSIISSLGTPKQNQAILNLVEEKWDDLVGHMPLKICYPALESSEWHIITGSDP  495

Query  1016  KNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRF  837
             KNTPWSYHNGGSWPTLLWQFTLACIKMG+PELA KAV +AE+RL  D+WPEYYDTR G+F
Sbjct  496   KNTPWSYHNGGSWPTLLWQFTLACIKMGRPELAEKAVTLAEKRLQADRWPEYYDTRDGKF  555

Query  836   IGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFG  657
             IGKQ+RL QTWT+AG+LTSK LL+NP++AS L W ED ELLE+CVC L  +GR+KCSR  
Sbjct  556   IGKQSRLYQTWTIAGFLTSKQLLQNPEIASSLFWEEDLELLESCVCVLTKSGRKKCSRAA  615

Query  656   VRSQV  642
              +SQ+
Sbjct  616   AKSQI  620



>sp|Q84JL5.1|INVH_ARATH RecName: Full=Probable alkaline/neutral invertase A, chloroplastic; 
Short=A/N-INVA; Flags: Precursor [Arabidopsis thaliana]
 gb|AAO42161.1| putative alkaline/neutral invertase [Arabidopsis thaliana]
 gb|AAO64115.1| putative alkaline/neutral invertase [Arabidopsis thaliana]
Length=633

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/605 (68%), Positives = 486/605 (80%), Gaps = 30/605 (5%)
 Frame = -3

Query  2429  DQHRDSFCNWLGRSKNRLVF-------VVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGG  2271
             +Q+R++  + + R  N + F       V  +V S+ RSHS ST    ND +  + Y + G
Sbjct  48    NQYRNADSDRIIRPTNAVPFCTDRQSSVTAQVVSEARSHSASTTC-ANDTTLDQIYTKNG  106

Query  2270  MNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNGSSISKLAPEREVSEVE  2091
             +NVKPLV+ER +          +KD   V   D+  V ++   G          + ++VE
Sbjct  107   LNVKPLVVERLKRD--------EKDEEAVN-EDEEGVKRDGFEGV---------KCNDVE  148

Query  2090  KEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVK  1911
             +EAW+LL+ ++V YC  PVGTVAA DP D  P NYDQVFIRDF+PSALAFLL GE EIV+
Sbjct  149   EEAWRLLRDSIVTYCDSPVGTVAAKDPTDTTPSNYDQVFIRDFVPSALAFLLKGESEIVR  208

Query  1910  NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRV  1731
             NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+PL+    +FE+VLDPDFGE+AIGRV
Sbjct  209   NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTLPLE--EDKFEEVLDPDFGEAAIGRV  266

Query  1730  APVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSC  1551
             APVDSGLWWIILLRAY KITGDY+LQER+DVQTGI++I NLCL DGFDMFPTLLVTDGSC
Sbjct  267   APVDSGLWWIILLRAYGKITGDYSLQERIDVQTGIKMIANLCLADGFDMFPTLLVTDGSC  326

Query  1550  MIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWV  1371
             MIDRRMGIHGHPLEIQALFYSALR +REM+ VNDS+K+++  I+NRLSALSFHIRE YWV
Sbjct  327   MIDRRMGIHGHPLEIQALFYSALRSSREMITVNDSSKNIIKTISNRLSALSFHIRENYWV  386

Query  1370  DMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPET--GGYLVGNLQPAHMDFR  1197
             D  KINEIYRYKTEEYSMDA NKFNIYP+Q+ PW+++W+PE+   G+L+GNLQPAHMDFR
Sbjct  387   DKNKINEIYRYKTEEYSMDATNKFNIYPEQVSPWLMDWVPESPDSGFLIGNLQPAHMDFR  446

Query  1196  FFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDP  1017
             FFTLGNLW+IISSLGT +QN++ILN +E KWDDL+  MPLKICYPALE  +W IITGSDP
Sbjct  447   FFTLGNLWSIISSLGTPKQNQAILNLVEEKWDDLVGHMPLKICYPALESSEWHIITGSDP  506

Query  1016  KNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRF  837
             KNTPWSYHNGGSWPTLLWQFTLACIKMG+PELA KAV +AE+RL  D+WPEYYDTR G+F
Sbjct  507   KNTPWSYHNGGSWPTLLWQFTLACIKMGRPELAEKAVTLAEKRLQADRWPEYYDTRDGKF  566

Query  836   IGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFG  657
             IGKQ+RL QTWT+AG+LTSK LL+NP++AS L W ED ELLE+CVC L  +GR+KCSR  
Sbjct  567   IGKQSRLYQTWTIAGFLTSKQLLQNPEIASSLFWEEDLELLESCVCVLTKSGRKKCSRAA  626

Query  656   VRSQV  642
              +SQ+
Sbjct  627   AKSQI  631



>ref|XP_010276558.1| PREDICTED: alkaline/neutral invertase CINV1-like [Nelumbo nucifera]
Length=664

 Score =   847 bits (2189),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/676 (66%), Positives = 507/676 (75%), Gaps = 18/676 (3%)
 Frame = -3

Query  2657  MKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggryrhrHSVVTLTR  2478
             M PC RIL ++    F     +C++ V++NLS  Q K+          + H   +    R
Sbjct  1     MMPCFRILSAF----FGLLPPKCHQSVVNNLSNFQYKL----IQDRHLHHHLCPIFGFKR  52

Query  2477  VINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSHSTSTEAQVNDKS  2298
              I  N+  F    S+  Q R    N+    K+R   ++  VASD++   TS E   NDK 
Sbjct  53    AIVPNQRPFHVPDSSWGQSR-VLSNYCDVGKDRGTSIISNVASDIQ-QPTSVECHANDKK  110

Query  2297  FKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNGSSISKLA  2118
                 YIQG +N KP      E  E V     QK+  +  I  DS +N N  +   + + A
Sbjct  111   LDNIYIQGEINKKP---PIVERIESVDVGKGQKEV-QPPIRGDSCLNVNIGSSEDLKQAA  166

Query  2117  PER----EVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSA  1950
                    E SE+EKEAWKL+Q AVV YCG PVGTVAANDP D+ P+NYDQVFIRDF+PSA
Sbjct  167   KVSTCITETSEIEKEAWKLMQNAVVYYCGRPVGTVAANDPTDEQPINYDQVFIRDFVPSA  226

Query  1949  LAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDV  1770
             LAFLL GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV T+ LD    EFE+V
Sbjct  227   LAFLLQGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVTTVNLDSNTREFEEV  286

Query  1769  LDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGF  1590
             LDPDFGESAIGRVAPVDSGLWWIILLRAY +ITGDY+LQER D QTGI+LILNLCL DGF
Sbjct  287   LDPDFGESAIGRVAPVDSGLWWIILLRAYGRITGDYSLQERADAQTGIKLILNLCLTDGF  346

Query  1589  DMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRL  1410
             DMFP+LLVTD SCM+DRR+GIHGHPLEIQALFYSALR +REMLIVND +K+LV AINNRL
Sbjct  347   DMFPSLLVTDASCMVDRRLGIHGHPLEIQALFYSALRFSREMLIVNDESKNLVTAINNRL  406

Query  1409  SALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLV  1230
              ALSFHIREYYWVD KKINEIYRYKTEEYS +AINKFNIYPDQ+P W+V+WIPE GGYL+
Sbjct  407   RALSFHIREYYWVDRKKINEIYRYKTEEYSTNAINKFNIYPDQVPSWLVDWIPENGGYLI  466

Query  1229  GNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEG  1050
             GNLQPAHMDFR FTLGNLW+IISSL T +QN+ IL  IE KW DL+  MPLKICYPALE 
Sbjct  467   GNLQPAHMDFRLFTLGNLWSIISSLATPKQNEGILTLIEDKWVDLMGHMPLKICYPALEY  526

Query  1049  EDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQW  870
             ++WR+ITGSDPKNTPWSYHNGGSWPTLLWQ TLACIKMGKPELA KA+ +AE +L VDQW
Sbjct  527   DEWRLITGSDPKNTPWSYHNGGSWPTLLWQLTLACIKMGKPELARKAITLAERKLSVDQW  586

Query  869   PEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLK  690
             PEYYDT  GRFIGKQ+RL QTWT+AGYLTSKMLL NP+ AS+L+ +EDYELLE C C   
Sbjct  587   PEYYDTYSGRFIGKQSRLFQTWTIAGYLTSKMLLNNPEKASMLLLDEDYELLETCACASI  646

Query  689   YNGRRKCSRFGVRSQV  642
               GR+KCS    RS V
Sbjct  647   QGGRKKCSLGAARSLV  662



>ref|NP_187233.5| alkaline/neutral invertase H [Arabidopsis thaliana]
 gb|AEE74300.1| alkaline/neutral invertase H [Arabidopsis thaliana]
Length=659

 Score =   847 bits (2189),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/605 (68%), Positives = 486/605 (80%), Gaps = 30/605 (5%)
 Frame = -3

Query  2429  DQHRDSFCNWLGRSKNRLVF-------VVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGG  2271
             +Q+R++  + + R  N + F       V  +V S+ RSHS ST    ND +  + Y + G
Sbjct  74    NQYRNADSDRIIRPTNAVPFCTDRQSSVTAQVVSEARSHSASTTC-ANDTTLDQIYTKNG  132

Query  2270  MNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNGSSISKLAPEREVSEVE  2091
             +NVKPLV+ER +          +KD   V   D+  V ++   G          + ++VE
Sbjct  133   LNVKPLVVERLKRD--------EKDEEAVN-EDEEGVKRDGFEGV---------KCNDVE  174

Query  2090  KEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVK  1911
             +EAW+LL+ ++V YC  PVGTVAA DP D  P NYDQVFIRDF+PSALAFLL GE EIV+
Sbjct  175   EEAWRLLRDSIVTYCDSPVGTVAAKDPTDTTPSNYDQVFIRDFVPSALAFLLKGESEIVR  234

Query  1910  NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRV  1731
             NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+PL+    +FE+VLDPDFGE+AIGRV
Sbjct  235   NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTLPLE--EDKFEEVLDPDFGEAAIGRV  292

Query  1730  APVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSC  1551
             APVDSGLWWIILLRAY KITGDY+LQER+DVQTGI++I NLCL DGFDMFPTLLVTDGSC
Sbjct  293   APVDSGLWWIILLRAYGKITGDYSLQERIDVQTGIKMIANLCLADGFDMFPTLLVTDGSC  352

Query  1550  MIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWV  1371
             MIDRRMGIHGHPLEIQALFYSALR +REM+ VNDS+K+++  I+NRLSALSFHIRE YWV
Sbjct  353   MIDRRMGIHGHPLEIQALFYSALRSSREMITVNDSSKNIIKTISNRLSALSFHIRENYWV  412

Query  1370  DMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPET--GGYLVGNLQPAHMDFR  1197
             D  KINEIYRYKTEEYSMDA NKFNIYP+Q+ PW+++W+PE+   G+L+GNLQPAHMDFR
Sbjct  413   DKNKINEIYRYKTEEYSMDATNKFNIYPEQVSPWLMDWVPESPDSGFLIGNLQPAHMDFR  472

Query  1196  FFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDP  1017
             FFTLGNLW+IISSLGT +QN++ILN +E KWDDL+  MPLKICYPALE  +W IITGSDP
Sbjct  473   FFTLGNLWSIISSLGTPKQNQAILNLVEEKWDDLVGHMPLKICYPALESSEWHIITGSDP  532

Query  1016  KNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRF  837
             KNTPWSYHNGGSWPTLLWQFTLACIKMG+PELA KAV +AE+RL  D+WPEYYDTR G+F
Sbjct  533   KNTPWSYHNGGSWPTLLWQFTLACIKMGRPELAEKAVTLAEKRLQADRWPEYYDTRDGKF  592

Query  836   IGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFG  657
             IGKQ+RL QTWT+AG+LTSK LL+NP++AS L W ED ELLE+CVC L  +GR+KCSR  
Sbjct  593   IGKQSRLYQTWTIAGFLTSKQLLQNPEIASSLFWEEDLELLESCVCVLTKSGRKKCSRAA  652

Query  656   VRSQV  642
              +SQ+
Sbjct  653   AKSQI  657



>ref|XP_010551013.1| PREDICTED: alkaline/neutral invertase CINV2 [Tarenaya hassleriana]
Length=625

 Score =   844 bits (2181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/603 (67%), Positives = 479/603 (79%), Gaps = 33/603 (5%)
 Frame = -3

Query  2438  SNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVK  2259
             S+ +  + SF   L  +  R   V  +VAS  R+ STSTE + ND + ++   + G+   
Sbjct  54    SSANISKSSFV--LSSNDPRGSLVAARVASRARNLSTSTEIRENDATLERICGKHGLKAG  111

Query  2258  PLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAW  2079
             P +                    RV+I D+   N+++L          ++     E+EAW
Sbjct  112   PAIE-------------------RVKI-DEKAANRDELEDV-------KKRSETKEEEAW  144

Query  2078  KLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLL  1899
             +LL+ AVV YC  PVGTVAA DP+D  PLNYDQVFIRDF+PSALAFLL GE EIV+NFLL
Sbjct  145   RLLKEAVVTYCDCPVGTVAAKDPSDATPLNYDQVFIRDFVPSALAFLLKGEPEIVRNFLL  204

Query  1898  HTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVD  1719
             HTLQLQSWEKTVDCYSPGQGLMPASFKVR++ L+  N + E+VLDPDFGESAIGRVAPVD
Sbjct  205   HTLQLQSWEKTVDCYSPGQGLMPASFKVRSVLLE--NDKCEEVLDPDFGESAIGRVAPVD  262

Query  1718  SGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDR  1539
             SGLWWIILLRAY KITGDYTLQER+DVQTGI++I+NLCL DGFDMFPTLLVTDGSCMIDR
Sbjct  263   SGLWWIILLRAYGKITGDYTLQERIDVQTGIKMIMNLCLADGFDMFPTLLVTDGSCMIDR  322

Query  1538  RMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKK  1359
             RMGIHGHPLEIQALFYSALRC+REM+  N+S+K+L+  INNRLSALSFHIRE YW+D+KK
Sbjct  323   RMGIHGHPLEIQALFYSALRCSREMITANESSKNLIRTINNRLSALSFHIRENYWLDIKK  382

Query  1358  INEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPET--GGYLVGNLQPAHMDFRFFTL  1185
             INEIYRYKTEEYSMDA NKFNIYP+Q+ PW+++WIPE    G+L+GNLQPAHMDFRFFTL
Sbjct  383   INEIYRYKTEEYSMDATNKFNIYPEQVSPWLMDWIPEKPGSGFLIGNLQPAHMDFRFFTL  442

Query  1184  GNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTP  1005
             GNLW+IISSLGT +QN++ILN IE KW+D+I  MPLKICYPALE  +W +ITGSDPKNTP
Sbjct  443   GNLWSIISSLGTPKQNEAILNLIEEKWNDIIGHMPLKICYPALEFAEWSVITGSDPKNTP  502

Query  1004  WSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQ  825
             WSYHN GSWPTLLWQFTLACIKMG+PELA +AV +AE+RL  D+WPEYYDTR G+FIGKQ
Sbjct  503   WSYHNSGSWPTLLWQFTLACIKMGRPELAERAVTLAEKRLQADRWPEYYDTRSGKFIGKQ  562

Query  824   ARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQ  645
             +RL QTWT+AGYLTSKMLL+NP+ ASLL W ED ELLE CVC L  +GR+KCSR   +SQ
Sbjct  563   SRLYQTWTIAGYLTSKMLLENPETASLLFWEEDLELLETCVCALTKSGRKKCSRVAAKSQ  622

Query  644   VGV  636
             + V
Sbjct  623   ILV  625



>ref|XP_009147157.1| PREDICTED: alkaline/neutral invertase CINV2 [Brassica rapa]
Length=652

 Score =   845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/690 (64%), Positives = 509/690 (74%), Gaps = 58/690 (8%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M SRSCI +S MKPC R L S+  S   +     +   + N SK  Q  K          
Sbjct  3     MTSRSCICVSAMKPCCRFLISFKSSSL-FGVSPTSSSRLINSSKLLQCRK----------  51

Query  2510  rhrHSVVTLTRVINSNRCAFCGSGS---NGDQHRDSFCNWLGRSKNRLVFVVPKVASDMR  2340
                 S    + V    R  FC S S    G +   S    +GR + R + V+P+VASD R
Sbjct  52    --IESRSIRSGVHCRRRNVFCNSDSISWGGSRCSSS----IGRGRGRGILVIPRVASDFR  105

Query  2339  SHSTST--EAQVN-DKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDD  2169
             + S+S+  ++ VN DKSF+  +      VKPLV +                    EI   
Sbjct  106   NQSSSSSLDSHVNKDKSFESLF------VKPLVFK--------------------EIPKK  139

Query  2168  STVNKNDLNGSSISKLAPEREVS---EVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKL  1998
              +  K D    ++       EVS   E E+EAW+LL+GAVVNYCG+PVGTVAANDP DK 
Sbjct  140   ESGGKEDAKFGNVRVKGEREEVSSQSEAEREAWRLLRGAVVNYCGFPVGTVAANDPGDKQ  199

Query  1997  P-LNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASF  1821
               LNYDQVFIRDF+PSA AFLL+G+GEIV+NFLL TLQLQSWEKTVDC+SPG GLMPASF
Sbjct  200   KTLNYDQVFIRDFVPSAYAFLLDGDGEIVRNFLLQTLQLQSWEKTVDCHSPGPGLMPASF  259

Query  1820  KVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVD  1641
             KV++  L+G +G FE+ LD DFGESAIGRV+PVDSGLWWIILLRAY K+TGDYTLQER+D
Sbjct  260   KVKS--LEGNDGSFEECLDADFGESAIGRVSPVDSGLWWIILLRAYGKLTGDYTLQERID  317

Query  1640  VQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREML  1461
             VQTGI+LIL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYS+LRC REML
Sbjct  318   VQTGIKLILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSSLRCAREML  377

Query  1460  IVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQ  1281
              VND TK+LVAA+N+RLSALSFHIREYYWVD+KKINEIYRY TEEYS DA NKFNIYP+Q
Sbjct  378   NVNDETKNLVAAVNSRLSALSFHIREYYWVDIKKINEIYRYNTEEYSADATNKFNIYPEQ  437

Query  1280  IPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWD  1101
             IP W+V+WIP  GGY +GNLQPAHMDFRFFTLGNLWA++SSLG+ EQN+ ++  IE KWD
Sbjct  438   IPSWLVDWIPNRGGYFIGNLQPAHMDFRFFTLGNLWAVVSSLGSQEQNEGVMALIEEKWD  497

Query  1100  DLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPEL  921
             DL+A MPLKIC+PALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKM K +L
Sbjct  498   DLVANMPLKICFPALEQEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMEKLDL  557

Query  920   AMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLL  741
             A KAVAVAE+RL  DQWPEYYDT+ GRF+GKQ+RL QTWT AG+L SK L++ P+ ASLL
Sbjct  558   AKKAVAVAEKRLKEDQWPEYYDTKSGRFVGKQSRLYQTWTNAGFLASKKLIEQPEKASLL  617

Query  740   VWNEDYELLENCVCGL---KYNGRRKCSRF  660
              W EDY+LLE CVCGL       + KCSRF
Sbjct  618   FWEEDYQLLETCVCGLNKSSGKKKNKCSRF  647



>gb|AAG51337.1|AC020580_17 neutral invertase, putative; 73674-70896 [Arabidopsis thaliana]
Length=536

 Score =   840 bits (2170),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/483 (81%), Positives = 436/483 (90%), Gaps = 2/483 (0%)
 Frame = -3

Query  2102  SEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEG  1923
             +EVEKEAWKLL+GAVVNYCG+PVGTVAANDP D   LNYDQVFIRDF+PSA AF+L+GEG
Sbjct  49    TEVEKEAWKLLRGAVVNYCGFPVGTVAANDPGDTQTLNYDQVFIRDFVPSAYAFMLDGEG  108

Query  1922  EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESA  1743
             EIV+NFLLHTLQLQSWEKTVDC+SPG GLMPASFKV++ PL+G +G FE+ LDPDFG SA
Sbjct  109   EIVRNFLLHTLQLQSWEKTVDCHSPGPGLMPASFKVKSAPLEGNDGSFEEFLDPDFGGSA  168

Query  1742  IGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVT  1563
             IGRV+PVDSGLWWIILLRAY K+TGDYTLQER+DVQTGI+LIL LCL DGFDMFPTLLVT
Sbjct  169   IGRVSPVDSGLWWIILLRAYGKLTGDYTLQERIDVQTGIKLILKLCLADGFDMFPTLLVT  228

Query  1562  DGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIRE  1383
             DGSCM+DRRMGIHGHPLEIQALFYSALRC REMLIVND TKSLV A+NNRLSALSFHIRE
Sbjct  229   DGSCMVDRRMGIHGHPLEIQALFYSALRCAREMLIVNDGTKSLVTAVNNRLSALSFHIRE  288

Query  1382  YYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMD  1203
             YYWVD+KKINEIYRY TEEYS DA NKFNIYP+QIP W+V+WIP+ GGY +GNLQPAHMD
Sbjct  289   YYWVDIKKINEIYRYNTEEYSADATNKFNIYPEQIPTWLVDWIPDKGGYFIGNLQPAHMD  348

Query  1202  FRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGS  1023
             FRFFTLGNLWA+ISSLG  EQN+ ++  IE KWDDL+A MPLKIC+PALE ++WRIITGS
Sbjct  349   FRFFTLGNLWAVISSLGNQEQNEGVMTLIEEKWDDLVANMPLKICFPALEKDEWRIITGS  408

Query  1022  DPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHG  843
             DPKNTPWSYHNGGSWPTLLWQFTLACIKMGK ELA KAVAVAE+RL  D+WPEYYDT+ G
Sbjct  409   DPKNTPWSYHNGGSWPTLLWQFTLACIKMGKLELAKKAVAVAEKRLKEDEWPEYYDTKSG  468

Query  842   RFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGL-KYNGRR-KC  669
             RF+GKQ+RL QTWT+AG+L +K L++ P+ ASLL W EDY+LLE CVCGL K +GR+ KC
Sbjct  469   RFVGKQSRLYQTWTIAGFLAAKKLIEQPEKASLLFWEEDYQLLETCVCGLSKSSGRKNKC  528

Query  668   SRF  660
             SRF
Sbjct  529   SRF  531



>ref|XP_008655058.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 ref|XP_008655060.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 ref|XP_008655063.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 ref|XP_008655066.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 ref|XP_008655067.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 ref|XP_008655070.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 ref|XP_008655073.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 ref|XP_008655075.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 ref|XP_008655078.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 ref|XP_008655082.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 ref|XP_008655086.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 tpg|DAA45081.1| TPA: hypothetical protein ZEAMMB73_402946 [Zea mays]
Length=625

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/492 (80%), Positives = 432/492 (88%), Gaps = 0/492 (0%)
 Frame = -3

Query  2111  REVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLN  1932
             RE S  EKEAW LL  AVVNYCG  VGTVAANDP+    LNYDQVFIRDF+PSA+AFLL 
Sbjct  134   REESPEEKEAWWLLSRAVVNYCGSAVGTVAANDPSTSQMLNYDQVFIRDFVPSAIAFLLK  193

Query  1931  GEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFG  1752
             GE +IVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR++PLDG +  FE+VLDPDFG
Sbjct  194   GESDIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSVPLDGNSEAFEEVLDPDFG  253

Query  1751  ESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTL  1572
             ESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGIRLILNLCL DGFDMFPTL
Sbjct  254   ESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLSDGFDMFPTL  313

Query  1571  LVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFH  1392
             LVTDGSCMIDRRMGIHGHPLEIQALFYSALRC REM+ V D +K+L+ AINNRLSALSFH
Sbjct  314   LVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMIGVTDGSKNLIRAINNRLSALSFH  373

Query  1391  IREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPA  1212
             IREYYWVDMKKINEIYRYKTEEYS DAINKFNIYP+QIP W+ +WIP  GGYL+GNLQPA
Sbjct  374   IREYYWVDMKKINEIYRYKTEEYSHDAINKFNIYPEQIPSWLADWIPVKGGYLIGNLQPA  433

Query  1211  HMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRII  1032
             HMDFRFF+LGNLWAI+SSL T  Q + ILN IE KWDD++A MPLKICYPALE E+WRII
Sbjct  434   HMDFRFFSLGNLWAIVSSLATQRQAEGILNLIEAKWDDIVANMPLKICYPALEYEEWRII  493

Query  1031  TGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDT  852
             TGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ +LA +AV VAE+RL  D+WPEYYDT
Sbjct  494   TGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRRDLARRAVEVAEKRLSDDKWPEYYDT  553

Query  851   RHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRK  672
             R GRFIGKQ+RL QTW++AGYL+SKMLL  P+MAS+LV +ED+ELLE C C L  N R K
Sbjct  554   RTGRFIGKQSRLYQTWSIAGYLSSKMLLDCPEMASILVCDEDFELLEGCACSLNKNARTK  613

Query  671   CSRFGVRSQVGV  636
             CSR   +SQV V
Sbjct  614   CSRRAAKSQVLV  625



>emb|CDY24687.1| BnaA05g30860D [Brassica napus]
Length=652

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/707 (62%), Positives = 510/707 (72%), Gaps = 92/707 (13%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M SRSCI +S MKPC R L S+  S     FG                            
Sbjct  3     MTSRSCICVSAMKPCCRFLISFKSSSL---FG----------------------------  31

Query  2510  rhrHSVVTLTRVINSNRCAFCGSGSNGD-------QHRDSFCN-----WLGRSKNRL---  2376
                 S  + +R+INS++   C    +         + R+ FCN     W G   + +   
Sbjct  32    ---VSPTSSSRLINSSKLLQCRKIESRSIRSGVHCRRRNVFCNSDSISWGGSRCSSIGRG  88

Query  2375  ------VFVVPKVASDMRSHSTST-EAQVN-DKSFKKFYIQGGMNVKPLviertetredv  2220
                   + V+P+VASD R+ S+S+ ++ VN DKSF+  +      VKPLV +        
Sbjct  89    RGRGRGILVIPRVASDFRNQSSSSLDSHVNKDKSFESLF------VKPLVFK--------  134

Query  2219  vetyEQKDGGRVEITDDSTVNKNDLNGSSISKLAPEREVS---EVEKEAWKLLQGAVVNY  2049
                         EI    +  K D    ++       EVS   E E+EAW+LL+G+VVNY
Sbjct  135   ------------EIPKKESGGKEDAKFGNVRVKGEREEVSSQSEAEREAWRLLRGSVVNY  182

Query  2048  CGYPVGTVAANDPADKLP-LNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWE  1872
             CG+PVGTVAANDP DK   LNYDQVFIRDF+PSA AFLL+G+GEIV+NFLL TLQLQSWE
Sbjct  183   CGFPVGTVAANDPGDKQKTLNYDQVFIRDFVPSAYAFLLDGDGEIVRNFLLQTLQLQSWE  242

Query  1871  KTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILL  1692
             KTVDC+SPG GLMPASFKV++  L+G +G FE+ LD DFGESAIGRV+PVDSGLWWIILL
Sbjct  243   KTVDCHSPGPGLMPASFKVKS--LEGNDGSFEECLDADFGESAIGRVSPVDSGLWWIILL  300

Query  1691  RAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPL  1512
             RAY K+TGDYTLQER+DVQTGI+LIL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPL
Sbjct  301   RAYGKLTGDYTLQERIDVQTGIKLILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPL  360

Query  1511  EIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKT  1332
             EIQALFYS+LRC REML VND TK+LVAA+N+RLSALSFHIREYYWVD+KKINEIYRY T
Sbjct  361   EIQALFYSSLRCAREMLNVNDETKNLVAAVNSRLSALSFHIREYYWVDIKKINEIYRYNT  420

Query  1331  EEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLG  1152
             EEYS DA NKFNIYP+QIP W+V+WIP  GGY +GNLQPAHMDFRFFTLGNLWA++SSLG
Sbjct  421   EEYSADATNKFNIYPEQIPSWLVDWIPNRGGYFIGNLQPAHMDFRFFTLGNLWAVVSSLG  480

Query  1151  THEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPT  972
             + EQN+ ++  IE KWDDL+A MPLKIC+PALE E+WRIITGSDPKNTPWSYHNGGSWPT
Sbjct  481   SQEQNEGVMALIEEKWDDLVANMPLKICFPALEQEEWRIITGSDPKNTPWSYHNGGSWPT  540

Query  971   LLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAG  792
             LLWQFTLACIKM K +LA KAVAVAE+RL  DQWPEYYDT+ GRF+GKQ+RL QTWT+AG
Sbjct  541   LLWQFTLACIKMEKLDLAKKAVAVAEKRLKEDQWPEYYDTKSGRFVGKQSRLYQTWTIAG  600

Query  791   YLTSKMLLKNPDMASLLVWNEDYELLENCVCGL---KYNGRRKCSRF  660
             +L SK L++ P+ ASLL W EDY+LLE CVCGL       + KCSRF
Sbjct  601   FLASKKLIEQPEKASLLFWEEDYQLLETCVCGLNKSSGKKKNKCSRF  647



>gb|EPS61872.1| neutral/alkaline invertase 2, partial [Genlisea aurea]
Length=484

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/486 (80%), Positives = 440/486 (91%), Gaps = 2/486 (0%)
 Frame = -3

Query  2093  EKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIV  1914
             E+EAW+LL+ AVV+YC  PVGTVAANDP DK+PLNYDQVFIRDFIPSA AFLL G+GEIV
Sbjct  1     EEEAWRLLRNAVVSYCRSPVGTVAANDPNDKIPLNYDQVFIRDFIPSAFAFLLKGDGEIV  60

Query  1913  KNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGR  1734
             +NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR + L+  N  FE+VLDPDFGESAIGR
Sbjct  61    RNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRAVALEDNN--FEEVLDPDFGESAIGR  118

Query  1733  VAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGS  1554
             VAPVDSGLWWIILLRAY K+TGD+TLQER+DVQTGI+LILNLCL DGFDMFP+LLVTDGS
Sbjct  119   VAPVDSGLWWIILLRAYGKLTGDFTLQERIDVQTGIKLILNLCLSDGFDMFPSLLVTDGS  178

Query  1553  CMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYW  1374
             CMIDRRMGIHGHPLEIQ+LFYSALRC+RE+L  ++ +K+LV AINNRLSALSFHIREYYW
Sbjct  179   CMIDRRMGIHGHPLEIQSLFYSALRCSREILSTDEGSKNLVRAINNRLSALSFHIREYYW  238

Query  1373  VDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRF  1194
             VD+KKINEIYRYKTEEYS +A NKFNIYP+QIP W+++WIPE GGYL+GNLQPAHMDFRF
Sbjct  239   VDLKKINEIYRYKTEEYSTEATNKFNIYPEQIPHWLMHWIPEKGGYLIGNLQPAHMDFRF  298

Query  1193  FTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPK  1014
             FTLGNLW+I+SSLGT +QN+++LN IE KWDDL+ QMPLKICYPALE E+WRIITGSDPK
Sbjct  299   FTLGNLWSIVSSLGTPKQNEAVLNLIEAKWDDLVGQMPLKICYPALEAEEWRIITGSDPK  358

Query  1013  NTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFI  834
             NTPWSYHNGGSWP LLWQFTLAC+KMG+ +LA KA+ +AE RL  D WPEYYDTR+G+FI
Sbjct  359   NTPWSYHNGGSWPVLLWQFTLACMKMGRTDLAKKAIDLAEMRLSKDHWPEYYDTRNGKFI  418

Query  833   GKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGV  654
             GKQARL QTWT+AG+LTSKMLL+NP+MASLL W+EDYELLE CVC L  + R+KCSR   
Sbjct  419   GKQARLYQTWTIAGFLTSKMLLRNPEMASLLYWDEDYELLEICVCALSNSNRKKCSRHLA  478

Query  653   RSQVGV  636
             RSQ+ V
Sbjct  479   RSQILV  484



>ref|XP_002465359.1| hypothetical protein SORBIDRAFT_01g037120 [Sorghum bicolor]
 gb|EER92357.1| hypothetical protein SORBIDRAFT_01g037120 [Sorghum bicolor]
Length=626

 Score =   842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/492 (81%), Positives = 432/492 (88%), Gaps = 0/492 (0%)
 Frame = -3

Query  2111  REVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLN  1932
             RE S  EKEAW LL  AVVNYCG  VGTVAANDP+    LNYDQVFIRDF+PSA+AFLL 
Sbjct  135   REESPEEKEAWWLLSRAVVNYCGSAVGTVAANDPSTSQMLNYDQVFIRDFVPSAIAFLLK  194

Query  1931  GEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFG  1752
             GE +IVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR++PLDG +  FE+VLDPDFG
Sbjct  195   GESDIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSVPLDGNSEAFEEVLDPDFG  254

Query  1751  ESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTL  1572
             ESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGIRLILNLCL DGFDMFPTL
Sbjct  255   ESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLSDGFDMFPTL  314

Query  1571  LVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFH  1392
             LVTDGSCMIDRRMGIHGHPLEIQALFYSALRC REM+ V D +K+L+ AINNRLSALSFH
Sbjct  315   LVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMIGVTDGSKNLIRAINNRLSALSFH  374

Query  1391  IREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPA  1212
             IREYYWVDMKKINEIYRYKTEEYS DAINKFNIYP+QIP W+ +WIP  GGYL+GNLQPA
Sbjct  375   IREYYWVDMKKINEIYRYKTEEYSHDAINKFNIYPEQIPSWLADWIPVKGGYLIGNLQPA  434

Query  1211  HMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRII  1032
             HMDFRFF+LGNLWAI+SSL T  Q + ILN IE KWDD++A MPLKICYPALE E+WRII
Sbjct  435   HMDFRFFSLGNLWAIVSSLATQRQAEGILNLIEAKWDDIVANMPLKICYPALEYEEWRII  494

Query  1031  TGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDT  852
             TGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ +LA +AV VAE+RL  D+WPEYYDT
Sbjct  495   TGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRRDLARRAVEVAEKRLSDDKWPEYYDT  554

Query  851   RHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRK  672
             R GRFIGKQ+RL QTWT+AGYL+SKMLL  P+MAS+LV +ED+ELLE C C L  N R K
Sbjct  555   RTGRFIGKQSRLYQTWTIAGYLSSKMLLDCPEMASILVCDEDFELLEGCACSLNKNARTK  614

Query  671   CSRFGVRSQVGV  636
             CSR   +SQV V
Sbjct  615   CSRRAAKSQVLV  626



>ref|XP_002884536.1| hypothetical protein ARALYDRAFT_896678 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60795.1| hypothetical protein ARALYDRAFT_896678 [Arabidopsis lyrata subsp. 
lyrata]
Length=633

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/609 (67%), Positives = 488/609 (80%), Gaps = 30/609 (5%)
 Frame = -3

Query  2441  GSNGDQHRDSFCNWLGRSKNRLVF-------VVPKVASDMRSHSTSTEAQVNDKSFKKFY  2283
              S  +Q+R++  + + + +N + F       V  +V S+ RS S ST    ND +  + Y
Sbjct  44    SSCNNQYRNADSDRIIKLRNVVPFCTDRQSSVTAQVVSEARSLSASTTC-ANDTTLDQIY  102

Query  2282  IQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNGSSISKLAPEREV  2103
              + G+NVKPLV+ER +          +KD   V   DD +VN++   G          + 
Sbjct  103   TKNGLNVKPLVVERLKGH--------EKDEEVVN-GDDKSVNRDGFEGV---------KS  144

Query  2102  SEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEG  1923
             +++E+EAW+LL+ +VV YC  PVGTVAA DP D +P NYDQVFIRDF+PSALAFLL GE 
Sbjct  145   NDLEEEAWRLLRDSVVTYCDSPVGTVAAKDPTDTMPSNYDQVFIRDFVPSALAFLLKGES  204

Query  1922  EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESA  1743
             EIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT+PL+    +FE+VLDPDFGE+A
Sbjct  205   EIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTLPLE--EDKFEEVLDPDFGEAA  262

Query  1742  IGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVT  1563
             IGRVAPVDSGLWWIILLRAY KITGDY+LQER+DVQTGI++I NLCL DGFDMFPTLLVT
Sbjct  263   IGRVAPVDSGLWWIILLRAYGKITGDYSLQERIDVQTGIKMIANLCLADGFDMFPTLLVT  322

Query  1562  DGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIRE  1383
             DGSCMIDRRMGIHGHPLEIQALFYSALR +REM+ VNDS+K+++  I+NRLSALSFHIRE
Sbjct  323   DGSCMIDRRMGIHGHPLEIQALFYSALRSSREMITVNDSSKNIIKTISNRLSALSFHIRE  382

Query  1382  YYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPET--GGYLVGNLQPAH  1209
              YWVD  KINEIYRYKTEEYSMDA NKFNIYP+Q+ PW+++W+PE+   G+L+GNLQPAH
Sbjct  383   NYWVDKNKINEIYRYKTEEYSMDATNKFNIYPEQVSPWLMDWVPESPDSGFLIGNLQPAH  442

Query  1208  MDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIIT  1029
             MDFRFFTLGNLW+IISSLGT + N++ILN IE KWDDL+  MPLKICYPALE  +W IIT
Sbjct  443   MDFRFFTLGNLWSIISSLGTPKHNQAILNLIEEKWDDLVGHMPLKICYPALESSEWHIIT  502

Query  1028  GSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTR  849
             GSDPKNTPWSYHNGGSWPTLLWQFTLACIKM +PELA KAV +AE+RL  D+WPEYYDTR
Sbjct  503   GSDPKNTPWSYHNGGSWPTLLWQFTLACIKMDRPELAEKAVTMAEKRLQADRWPEYYDTR  562

Query  848   HGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKC  669
              G+FIGKQ+RL QTWT+AG+LTSK LL+NP++AS L W ED ELLE+CVC L  +GR+KC
Sbjct  563   DGKFIGKQSRLYQTWTIAGFLTSKQLLQNPEIASSLFWEEDLELLESCVCVLTKSGRKKC  622

Query  668   SRFGVRSQV  642
             SR   +SQ+
Sbjct  623   SRAAAKSQI  631



>ref|XP_006299298.1| hypothetical protein CARUB_v10015452mg [Capsella rubella]
 gb|EOA32196.1| hypothetical protein CARUB_v10015452mg [Capsella rubella]
Length=662

 Score =   841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/595 (68%), Positives = 475/595 (80%), Gaps = 33/595 (6%)
 Frame = -3

Query  2414  SFCNWLGRSKNRLVFVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLvierte  2235
             SFC       +R   V  +V S+ RS S ST     D +  + Y + G+NVKPL      
Sbjct  95    SFCT------DRQSSVTAQVVSEARSLSASTTCP-RDPTLDQIYTKNGLNVKPL------  141

Query  2234  tredvvetyEQKDGGRVEITDDSTVNKND--LNGSSISKLAPEREVSEVEKEAWKLLQGA  2061
                       + +  + +  DD  +N +D  +NG     +    + +E E+EAW+LL+ +
Sbjct  142   ----------ELERLKGDEKDDKAINGDDKRVNGDGFEGI----KSNETEEEAWRLLRDS  187

Query  2060  VVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQ  1881
             VV YC  PVGT+AA DP D  P NYDQVFIRDF+PSALAFLLNGE +IV+NFLLHTLQLQ
Sbjct  188   VVTYCDSPVGTMAAKDPTDTTPSNYDQVFIRDFVPSALAFLLNGESDIVRNFLLHTLQLQ  247

Query  1880  SWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWI  1701
             SWEKTVDCYSPGQGLMPASFKVRT+PL+    +FE+VLDPDFGE+AIGRVAPVDSGLWWI
Sbjct  248   SWEKTVDCYSPGQGLMPASFKVRTLPLE--EDKFEEVLDPDFGEAAIGRVAPVDSGLWWI  305

Query  1700  ILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHG  1521
             ILLRAY KITGDY+LQER+DVQTGI++I NLCL DGFDMFPTLLVTDGSCMIDRRMGIHG
Sbjct  306   ILLRAYGKITGDYSLQERIDVQTGIKMIANLCLADGFDMFPTLLVTDGSCMIDRRMGIHG  365

Query  1520  HPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYR  1341
             HPLEIQALFYSALR +REML VNDS+K+++  I+NRLSALSFHIRE YWVD  KINEIYR
Sbjct  366   HPLEIQALFYSALRSSREMLTVNDSSKNIIKTISNRLSALSFHIRENYWVDKTKINEIYR  425

Query  1340  YKTEEYSMDAINKFNIYPDQIPPWIVNWIPET--GGYLVGNLQPAHMDFRFFTLGNLWAI  1167
             YKTEEYSMDA NKFNIYP+Q+ PW+++W+PE    G+L+GNLQPAHMDFRFFTLGNLW+I
Sbjct  426   YKTEEYSMDATNKFNIYPEQVSPWLMDWVPECPDSGFLIGNLQPAHMDFRFFTLGNLWSI  485

Query  1166  ISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNG  987
             ISSLGT +QN++ILN IE KWDDL+  MPLKICYPALE  +W IITGSDPKNTPWSYHNG
Sbjct  486   ISSLGTPKQNQAILNLIEEKWDDLVGHMPLKICYPALESSEWHIITGSDPKNTPWSYHNG  545

Query  986   GSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQT  807
             GSWPTLLWQFTLACIKMG+PELA KAV +AE+RL  D+WPEYYDTR+G+FIGKQ+RL QT
Sbjct  546   GSWPTLLWQFTLACIKMGRPELAEKAVTLAEKRLQADRWPEYYDTRNGKFIGKQSRLYQT  605

Query  806   WTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQV  642
             WT+AG+LTSK LL+NP++AS L W ED ELLE CVC L  +GR+KCSR   +SQ+
Sbjct  606   WTIAGFLTSKQLLQNPEIASSLFWEEDLELLETCVCVLTKSGRKKCSRAAAKSQI  660



>ref|XP_006408025.1| hypothetical protein EUTSA_v10020291mg [Eutrema salsugineum]
 gb|ESQ49478.1| hypothetical protein EUTSA_v10020291mg [Eutrema salsugineum]
Length=630

 Score =   839 bits (2168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/578 (69%), Positives = 468/578 (81%), Gaps = 25/578 (4%)
 Frame = -3

Query  2369  VVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGG  2190
             V  +V S+ RS S S+     D +  +   + G+NVK +                 ++  
Sbjct  74    VTAQVVSEARSLSASSTC-TKDTTLDQRIAKNGVNVKIIERLEG-----------DENAE  121

Query  2189  RVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDP  2010
             +V   DD +++++ L          + + +E+E+EAW+LL+ +VV YC  PVGT+AANDP
Sbjct  122   KVINGDDKSIDRDGLE---------DNKRNEIEEEAWRLLRQSVVTYCDSPVGTMAANDP  172

Query  2009  ADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMP  1830
              D  PLNYDQVFIRDF+PSALAFL+ GEGEIV+NFLLHTLQLQSWEKTVDCYSPGQGLMP
Sbjct  173   TDTTPLNYDQVFIRDFVPSALAFLMKGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMP  232

Query  1829  ASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQE  1650
             ASFKVRT+PL+    +FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY+LQE
Sbjct  233   ASFKVRTLPLE--EDKFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYSLQE  290

Query  1649  RVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTR  1470
             RVDVQTGI++I NLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALR +R
Sbjct  291   RVDVQTGIKMIANLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRSSR  350

Query  1469  EMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIY  1290
             EML VN+S+K+L+  INNRLSA+SFHIRE YWVD  KINEIYRYKTEEYS DA NKFNIY
Sbjct  351   EMLTVNESSKNLIRTINNRLSAISFHIRENYWVDKSKINEIYRYKTEEYSTDATNKFNIY  410

Query  1289  PDQIPPWIVNWIPET--GGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFI  1116
             PDQ+ PW+++WIPE+   G+LVGNLQPAHMDFRFFTLGNLW+I+SSLGT  QN++ILN I
Sbjct  411   PDQVSPWLMDWIPESPRSGFLVGNLQPAHMDFRFFTLGNLWSIVSSLGTPRQNQAILNLI  470

Query  1115  EGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKM  936
             E KW+DLI  MPLKICYPALE  +W IITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKM
Sbjct  471   EEKWNDLIGHMPLKICYPALESSEWHIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKM  530

Query  935   GKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPD  756
             G+PELA KAV +AE+RL  D+WPEYYDTR G+FIGK++RL QTWT+AG+LTSK LL+NP+
Sbjct  531   GRPELAEKAVTLAEKRLQADRWPEYYDTRDGKFIGKKSRLYQTWTIAGFLTSKQLLQNPE  590

Query  755   MASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQV  642
             MAS L W ED ELLE CVC L  +GR+KCSR   +SQ+
Sbjct  591   MASSLFWEEDLELLETCVCALTKSGRKKCSRAAAKSQI  628



>ref|XP_004984582.1| PREDICTED: alkaline/neutral invertase CINV2-like [Setaria italica]
Length=621

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/492 (80%), Positives = 433/492 (88%), Gaps = 0/492 (0%)
 Frame = -3

Query  2111  REVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLN  1932
             RE S  EKEAW LL  AVVNYCG  VGTVAANDP+    LNYDQVFIRDF+PSA+AFLL 
Sbjct  130   REESPEEKEAWWLLGRAVVNYCGSAVGTVAANDPSTSQMLNYDQVFIRDFVPSAIAFLLK  189

Query  1931  GEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFG  1752
             GE +IVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR++PLDG +  FE++LDPDFG
Sbjct  190   GESDIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSVPLDGNSEAFEEILDPDFG  249

Query  1751  ESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTL  1572
             ESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGIRLILNLCL DGFDMFPTL
Sbjct  250   ESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLSDGFDMFPTL  309

Query  1571  LVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFH  1392
             LVTDGSCMIDRRMGIHGHPLEIQALFYSALRC REM+ VND +K+L+ AINNRLSALSFH
Sbjct  310   LVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMISVNDGSKNLIRAINNRLSALSFH  369

Query  1391  IREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPA  1212
             IREYYWVDMKKINEIYRYKTEEYS DAINKFNIYP+QIP W+ +WIP  GGYL+GNLQPA
Sbjct  370   IREYYWVDMKKINEIYRYKTEEYSHDAINKFNIYPEQIPSWLADWIPVKGGYLIGNLQPA  429

Query  1211  HMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRII  1032
             HMDFRFF+LGNLW+I+SSL T  Q + ILN IE KWDD++A MPLKICYPALE E+WRII
Sbjct  430   HMDFRFFSLGNLWSIVSSLATQRQAEGILNLIEAKWDDIVANMPLKICYPALEYEEWRII  489

Query  1031  TGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDT  852
             TGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ +LA +AV VAE+RL  D+WPEYYDT
Sbjct  490   TGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRRDLARRAVEVAEKRLSDDKWPEYYDT  549

Query  851   RHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRK  672
             R GRFIGKQ+RL QTWT+AGYL+SKMLL  P+MAS+L+ +ED+ELLE C C L  + R K
Sbjct  550   RTGRFIGKQSRLYQTWTIAGYLSSKMLLDCPEMASILICDEDFELLEGCACSLNKSARIK  609

Query  671   CSRFGVRSQVGV  636
             CSR   +SQV V
Sbjct  610   CSRRAAKSQVLV  621



>ref|XP_006649984.1| PREDICTED: alkaline/neutral invertase CINV2-like [Oryza brachyantha]
Length=622

 Score =   836 bits (2160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/514 (77%), Positives = 439/514 (85%), Gaps = 2/514 (0%)
 Frame = -3

Query  2171  DSTVNKNDLNG-SSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLP  1995
             DS   +++L G  +  +    R  S  EKEAW LL  +VVNYCG  VGTVAANDP+    
Sbjct  109   DSVACQHELEGLKAWVETVRSRVESTQEKEAWSLLGRSVVNYCGTAVGTVAANDPSTASQ  168

Query  1994  -LNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFK  1818
              LNYDQVFIRDFIPSA+AFLL GEG+IVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFK
Sbjct  169   MLNYDQVFIRDFIPSAIAFLLKGEGDIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFK  228

Query  1817  VRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDV  1638
             VR++PLDG +  FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDV
Sbjct  229   VRSIPLDGNSEAFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYSKITGDYALQERVDV  288

Query  1637  QTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLI  1458
             QTGIRLILNLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSALRC REM+ 
Sbjct  289   QTGIRLILNLCLSDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCAREMVS  348

Query  1457  VNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQI  1278
             +ND + SL+ AINNRLSALSFHIREYYWVDMKKINEIYRY+TEEYS DAINKFNIYP+QI
Sbjct  349   INDGSSSLIRAINNRLSALSFHIREYYWVDMKKINEIYRYRTEEYSHDAINKFNIYPEQI  408

Query  1277  PPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDD  1098
             P W+ +WIPE GGYL+GNLQPAHMDFRFF+LGNLWAIISSL T  Q + ILN IE KWDD
Sbjct  409   PTWLADWIPEKGGYLIGNLQPAHMDFRFFSLGNLWAIISSLATQRQAEGILNLIEAKWDD  468

Query  1097  LIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELA  918
             ++A MPLKICYPALE E+WRIITGSDPKN PWSYHNGGSWPTLLWQFTLACIKMG+ +LA
Sbjct  469   IVANMPLKICYPALEYEEWRIITGSDPKNMPWSYHNGGSWPTLLWQFTLACIKMGRRDLA  528

Query  917   MKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLV  738
              +AV VAE+RL  D+WPEYYDTR GRFIGKQ+RL QTWT+AGYL+SKMLL  P++AS+L+
Sbjct  529   QRAVEVAEKRLSDDKWPEYYDTRTGRFIGKQSRLYQTWTIAGYLSSKMLLACPELASILI  588

Query  737   WNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
               ED ELLE C C +  + R KCSR   RSQV V
Sbjct  589   CEEDLELLEGCACSVNKSARTKCSRRAARSQVLV  622



>ref|XP_003520789.1| PREDICTED: alkaline/neutral invertase CINV2-like [Glycine max]
Length=652

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/674 (62%), Positives = 499/674 (74%), Gaps = 22/674 (3%)
 Frame = -3

Query  2657  MKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggryrhrHSVVTLTR  2478
             MKP  +IL  Y +S F     RC+  +  ++S           +     +    +    R
Sbjct  1     MKPSPKILIGYKNSSF---LARCHHTLAMSMSNYSNSCD--INIYRNTMQCPFHMREFGR  55

Query  2477  VINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDMRSHSTSTEAQVNDKS  2298
             +++ N   F    S+  Q R    +   R  + +  V   +    R  S S   +V+D +
Sbjct  56    IMHGNHQVFGLPSSSFGQSRSLSLSSTKRDASSIAGV--DLNFKARDFSGSVGTRVDDNN  113

Query  2297  FKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNGSSISKLA  2118
              +  Y++GGMNVKP+V+E              ++  R+E+ ++    +N     +  +  
Sbjct  114   GEMAYVKGGMNVKPIVVESV------------EEESRLEVGEEDENKENSGGVKNADEAE  161

Query  2117  PEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFL  1938
               +E +E EKEAW+LLQ A+V YC  PVGTVAAND   + PLNYDQVFIRDFIPSALAFL
Sbjct  162   NVQEETEAEKEAWRLLQEALVTYCDSPVGTVAANDSDSEQPLNYDQVFIRDFIPSALAFL  221

Query  1937  LNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPD  1758
             L GE +IVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV+T+ LD    E   VLDPD
Sbjct  222   LKGEKDIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVKTLKLDHEKTE---VLDPD  278

Query  1757  FGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFP  1578
             FGESAIGRVAPVDSGLWWI+LLRAY KITGDY LQER+DVQTG+R+ILNLCL DGFDMFP
Sbjct  279   FGESAIGRVAPVDSGLWWIMLLRAYGKITGDYGLQERLDVQTGLRMILNLCLTDGFDMFP  338

Query  1577  TLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALS  1398
             +LLVTDGSCMIDRRMGIHGHPLEIQALFYSALR  REM+  ++++K+LV  INNRLSALS
Sbjct  339   SLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRSAREMVTEDENSKNLVGEINNRLSALS  398

Query  1397  FHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQ  1218
             FHIREYYW+DM+KINEIYRYKTEEYS+DA NKFNIYPDQIP W+++WIPE GGYL+GNLQ
Sbjct  399   FHIREYYWLDMRKINEIYRYKTEEYSLDATNKFNIYPDQIPTWLMDWIPEEGGYLLGNLQ  458

Query  1217  PAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWR  1038
             PAHMDFRFF LGNLW+I+SSLGT  QN +ILN I+ KW DL+ +MPLKICYPALE  +WR
Sbjct  459   PAHMDFRFFMLGNLWSIVSSLGTPRQNNAILNLIDAKWGDLVGEMPLKICYPALEHHEWR  518

Query  1037  IITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYY  858
             IITG DPKNTPWSYHNGGSWPTLLWQFTLAC+KM + ELA KA+A+AE+RLP D WPEYY
Sbjct  519   IITGCDPKNTPWSYHNGGSWPTLLWQFTLACMKMERTELAEKAIALAEKRLPRDSWPEYY  578

Query  857   DTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGR  678
             DTR  RF+GKQARL QTWT+AG+L SKMLLKNP +ASLL W+ED E+LE CVC L  +GR
Sbjct  579   DTRSARFVGKQARLYQTWTLAGFLASKMLLKNPKLASLLCWDEDLEILETCVCLLHKSGR  638

Query  677   RKCSRFGVRSQVGV  636
              KCSR   +SQ+ V
Sbjct  639   IKCSRDVAKSQILV  652



>ref|XP_009381188.1| PREDICTED: alkaline/neutral invertase CINV2-like [Musa acuminata 
subsp. malaccensis]
Length=641

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/571 (71%), Positives = 467/571 (82%), Gaps = 15/571 (3%)
 Frame = -3

Query  2351  SDMRSHSTSTEAQVN-DKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEIT  2175
             SD R  ST+       D++F++ ++QG   V+PLVIER   +E +             + 
Sbjct  83    SDARRLSTAAGPVPGVDRAFERIFVQGLAAVEPLVIERVAEKERM-------------LV  129

Query  2174  DDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLP  1995
              +      ++    ++++A  REVSE EKEAW+LL+ AVV YCG PVGTVAA DPA +  
Sbjct  130   VEEKRKVEEVEEERVTEVAKAREVSESEKEAWRLLKNAVVEYCGSPVGTVAATDPAAE-A  188

Query  1994  LNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV  1815
             LNYDQVFIRDF+PSALAFLL GE EIV+NFLL+TLQLQSWEKTVDCYSPGQGLMPASFKV
Sbjct  189   LNYDQVFIRDFVPSALAFLLKGETEIVRNFLLYTLQLQSWEKTVDCYSPGQGLMPASFKV  248

Query  1814  RTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQ  1635
             R++PLD    E E++LDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDYTLQERVDVQ
Sbjct  249   RSVPLDVSKDEVEEMLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERVDVQ  308

Query  1634  TGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIV  1455
             TGI+LILNLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFY ALRC+REM+ V
Sbjct  309   TGIKLILNLCLSDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYCALRCSREMIAV  368

Query  1454  NDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIP  1275
             ND +KSL+ AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DAINKFNIYP+QIP
Sbjct  369   NDGSKSLLRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSQDAINKFNIYPEQIP  428

Query  1274  PWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDL  1095
              W+V+W+PE GGY +GNLQPAHMDFRFF+LGNLWAI+SSL T  Q + IL+ IE KWDDL
Sbjct  429   GWLVDWVPEKGGYFIGNLQPAHMDFRFFSLGNLWAIVSSLATPRQAEGILDLIEEKWDDL  488

Query  1094  IAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAM  915
             +  MPLKICYPALE E+WRIITGSDPKNTPWSYHNGGSWPTLLWQFT ACIKMG+PELA 
Sbjct  489   VGNMPLKICYPALEYEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTSACIKMGRPELAR  548

Query  914   KAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVW  735
             KA+ +AE RL  D+WPEYYDT  GRFIGKQ+RL QTWT+AG+L SK+LL+NP+MAS+L +
Sbjct  549   KAITIAENRLSNDKWPEYYDTPTGRFIGKQSRLYQTWTIAGFLASKLLLENPEMASILTF  608

Query  734   NEDYELLENCVCGLKYNGRRKCSRFGVRSQV  642
              ED ELLE C C L  + R +CSR   +S V
Sbjct  609   EEDLELLEGCACNLIKSPRTQCSRHAAKSHV  639



>ref|XP_010432487.1| PREDICTED: alkaline/neutral invertase CINV1-like [Camelina sativa]
Length=635

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/575 (70%), Positives = 465/575 (81%), Gaps = 23/575 (4%)
 Frame = -3

Query  2360  KVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVE  2181
             +V S+ RS S ST    ND +  + Y + G+NVKPL +++ +  E   E     DG RV 
Sbjct  80    QVVSEARSLSASTTC-ANDSTVDRIYTKNGLNVKPLDLKKLKGDEKDEEVI-NGDGKRVV  137

Query  2180  ITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADK  2001
                   +  N                 E E+EAW+LL+ +VV YC  PVGT+AA DP D 
Sbjct  138   GDGYEGIKSN-----------------ETEEEAWRLLRDSVVTYCDSPVGTMAAKDPTDT  180

Query  2000  LPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASF  1821
             +P NYDQVFIRDF+PSALAFLL GE EIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASF
Sbjct  181   MPSNYDQVFIRDFVPSALAFLLKGESEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASF  240

Query  1820  KVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVD  1641
             KVRT+PL+    +FE+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY KITGDY+LQER+D
Sbjct  241   KVRTLPLEEE--KFEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKITGDYSLQERID  298

Query  1640  VQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREML  1461
             VQTGI++I NLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALR +REM+
Sbjct  299   VQTGIKMIANLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRSSREMI  358

Query  1460  IVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQ  1281
              VNDS+K+++  I+NRLSALSFHIRE YWVD KKINEIYRYKTEEYS DA NKFNIYP+Q
Sbjct  359   TVNDSSKNIIKTISNRLSALSFHIRENYWVDKKKINEIYRYKTEEYSTDATNKFNIYPEQ  418

Query  1280  IPPWIVNWIPETG--GYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGK  1107
             + PW+++W+PE+   G+L+GNLQPAHMDFRFFTLGNLW+IISSLGT +QN++ILN IE K
Sbjct  419   VSPWLMDWVPESSDCGFLIGNLQPAHMDFRFFTLGNLWSIISSLGTPKQNQAILNLIEEK  478

Query  1106  WDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKP  927
             WDDL+  MPLKICYPALE  +W IITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+P
Sbjct  479   WDDLVGHMPLKICYPALESSEWHIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRP  538

Query  926   ELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMAS  747
             ELA KAV +AE+RL  D+WPEYYDTR+G+FIGKQ+RL QTWT+AG+LTSK LL+NP +AS
Sbjct  539   ELAEKAVTLAEKRLQADRWPEYYDTRNGKFIGKQSRLYQTWTIAGFLTSKQLLQNPKIAS  598

Query  746   LLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQV  642
              L W ED ELLE CVC L   GR+KCSR   +SQ+
Sbjct  599   SLFWEEDLELLETCVCVLTKAGRKKCSRAAAKSQI  633



>ref|XP_010464135.1| PREDICTED: alkaline/neutral invertase CINV1-like [Camelina sativa]
Length=635

 Score =   834 bits (2155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/577 (70%), Positives = 470/577 (81%), Gaps = 27/577 (5%)
 Frame = -3

Query  2360  KVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVE  2181
             +V S+ RS S ST    ND +  K + + G+NVKPL +ER                 + +
Sbjct  80    QVVSEARSLSASTTC-ANDPTVGKIHTKNGLNVKPLDLERL----------------KGD  122

Query  2180  ITDDSTVNKND--LNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPA  2007
               D+  +N +D  +NG     +    + +E E+EAW+LL+ +VV YC  PVGT+AA DP 
Sbjct  123   EKDEEVINGDDKRVNGDCYEGI----KSNESEEEAWRLLRDSVVTYCDSPVGTMAAKDPT  178

Query  2006  DKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPA  1827
             D LP NYDQVFIRDF+PSALAFLL GE EIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPA
Sbjct  179   DTLPSNYDQVFIRDFVPSALAFLLKGESEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPA  238

Query  1826  SFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQER  1647
             SFKVRT+PL+    +FE+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY KITGDY+LQER
Sbjct  239   SFKVRTLPLE--EDKFEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKITGDYSLQER  296

Query  1646  VDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTRE  1467
             +DVQTGI++I NLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALR +RE
Sbjct  297   IDVQTGIKMIANLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRSSRE  356

Query  1466  MLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYP  1287
             ML VNDS+K+++  I+NRLSALSFHIRE YWVD  KINEIYRYKTEEYSMDA NKFNIYP
Sbjct  357   MLTVNDSSKNIIKTISNRLSALSFHIRENYWVDKNKINEIYRYKTEEYSMDATNKFNIYP  416

Query  1286  DQIPPWIVNWIPETG--GYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIE  1113
             +Q+ PW+++W+PE+   G+L+GNLQPAHMDFRFFTLGNL +IISSLGT +QN++ILN IE
Sbjct  417   EQVSPWLMDWVPESSDCGFLIGNLQPAHMDFRFFTLGNLLSIISSLGTPKQNQAILNLIE  476

Query  1112  GKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG  933
              KWDDL+  MPLKICYPALE  +W IITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG
Sbjct  477   EKWDDLVGHMPLKICYPALESSEWHIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG  536

Query  932   KPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDM  753
             +PELA KAV +AE+RL  D+WPEYYDTR+G+FIGKQ+RL QTWT+AG+LTSK LL+NP++
Sbjct  537   RPELAEKAVTLAEKRLQADRWPEYYDTRNGKFIGKQSRLYQTWTIAGFLTSKQLLQNPEI  596

Query  752   ASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQV  642
             AS L W ED ELLE CVC L   GR+KCSR   +SQ+
Sbjct  597   ASSLFWEEDLELLETCVCVLTKAGRKKCSRAAAKSQI  633



>ref|NP_001049936.1| Os03g0314800 [Oryza sativa Japonica Group]
 sp|Q10MC0.1|NIN1_ORYSJ RecName: Full=Neutral/alkaline invertase 1, mitochondrial; Short=OsNIN1; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABF95611.1| beta-fructofuranosidase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11850.1| Os03g0314800 [Oryza sativa Japonica Group]
Length=628

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/494 (80%), Positives = 434/494 (88%), Gaps = 3/494 (1%)
 Frame = -3

Query  2111  REVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDP--ADKLPLNYDQVFIRDFIPSALAFL  1938
             R+ S  EKEAW LL  +VV+YCG  VGTVAANDP  A+++ LNYDQVFIRDF+PSA+AFL
Sbjct  136   RKESTEEKEAWSLLGRSVVSYCGTAVGTVAANDPSTANQM-LNYDQVFIRDFVPSAIAFL  194

Query  1937  LNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPD  1758
             L GEG+IVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR++PLDG +  FE+VLDPD
Sbjct  195   LKGEGDIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSIPLDGNSEAFEEVLDPD  254

Query  1757  FGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFP  1578
             FGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGIRLILNLCL DGFDMFP
Sbjct  255   FGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLSDGFDMFP  314

Query  1577  TLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALS  1398
             TLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSALRC REM+ VND + SL+ AIN RLSALS
Sbjct  315   TLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCAREMVSVNDGSNSLIRAINYRLSALS  374

Query  1397  FHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQ  1218
             FHIREYYWVDMKKINEIYRYKTEEYS DAINKFNIYP+QIP W+ +WIPE GGYL+GNLQ
Sbjct  375   FHIREYYWVDMKKINEIYRYKTEEYSHDAINKFNIYPEQIPSWLADWIPEKGGYLIGNLQ  434

Query  1217  PAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWR  1038
             PAHMDFRFF+LGNLWAIISSL T  Q + ILN IE KW+D+IA MPLKICYPALE E+WR
Sbjct  435   PAHMDFRFFSLGNLWAIISSLATQRQAEGILNLIEAKWEDIIANMPLKICYPALEYEEWR  494

Query  1037  IITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYY  858
             IITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ +LA +A+ VAE+RL  D+WPEYY
Sbjct  495   IITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRRDLAQRAIEVAEKRLSEDKWPEYY  554

Query  857   DTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGR  678
             DTR GRFIGKQ+RL QTWT+AGYL+SKMLL  P++AS+L+  ED ELLE C C +  + R
Sbjct  555   DTRTGRFIGKQSRLYQTWTIAGYLSSKMLLDCPELASILICEEDLELLEGCACSVNKSAR  614

Query  677   RKCSRFGVRSQVGV  636
              KCSR   RSQV V
Sbjct  615   TKCSRRAARSQVLV  628



>ref|XP_007035890.1| Neutral invertase isoform 2 [Theobroma cacao]
 gb|EOY06816.1| Neutral invertase isoform 2 [Theobroma cacao]
Length=621

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/584 (73%), Positives = 481/584 (82%), Gaps = 12/584 (2%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSY-NHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggr  2514
             M S +CIGIS+MKPC RIL SY + SIF     + NR  + NLSKS  K  D  R     
Sbjct  1     MKSSTCIGISSMKPCCRILISYKSSSIFGLSPPKMNRSGIHNLSKSLSKAVD-RRRFHCY  59

Query  2513  yrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRD---SFCNWLGRSKNRLVFVVPKVASDM  2343
                +  +V     ++SNR AF  S S+  Q R    SFC   GRS  R V V+PKVASD 
Sbjct  60    KHSKSQIVGYNCAVDSNRRAFSVSDSSWGQSRGFTGSFCVNKGRS--RGVLVIPKVASDF  117

Query  2342  RSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDST  2163
             R+HSTS E  VN+K+F++ YIQGG+NVKPLVIER ET   +V    ++D   +++ ++S 
Sbjct  118   RNHSTSVEPHVNEKNFERIYIQGGLNVKPLVIERIETGNGLV----KEDNTGIDV-NESG  172

Query  2162  VNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
             VN +++ G ++++   EREVSE+EKEAWK+L+GAVVNYCG+PVGTVAANDPADK PLNYD
Sbjct  173   VNIDNVKGLNLTETEIEREVSEIEKEAWKILRGAVVNYCGHPVGTVAANDPADKQPLNYD  232

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             Q+FIRDF+PSALAFLLNGE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT P
Sbjct  233   QIFIRDFVPSALAFLLNGEPEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTAP  292

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LDG +  FE+VLD DFGESAIGRVAPVDSGLWWIILLRAY KITGDYTLQERVDVQTGI 
Sbjct  293   LDGSSEAFEEVLDADFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERVDVQTGIS  352

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             LILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML VND+T
Sbjct  353   LILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVNDAT  412

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
             K+LVAAIN+RLSALSFHIREYYWVDMKKINEIYRYKTEEYS DAINKFNIYPDQIP W+V
Sbjct  413   KNLVAAINSRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPSWLV  472

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
             +WIP+ GGY +GNLQPAHMDFRFFTLGNLWAI+SSLGT +QN+ +LN IE KWDD +A M
Sbjct  473   DWIPDEGGYFIGNLQPAHMDFRFFTLGNLWAIVSSLGTSKQNEDVLNLIEAKWDDFVANM  532

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTL  951
             PLKI YPALE ++WRIITGSDPKNTPWSYHNGGSWPTLLWQ  L
Sbjct  533   PLKIIYPALESDEWRIITGSDPKNTPWSYHNGGSWPTLLWQVKL  576



>gb|KHN03923.1| hypothetical protein glysoja_022609 [Glycine soja]
Length=596

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/569 (70%), Positives = 463/569 (81%), Gaps = 15/569 (3%)
 Frame = -3

Query  2342  RSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDST  2163
             R  S S   +V+D + +  Y++GGMNVKP+V+E              ++  R+E+ ++  
Sbjct  43    RDFSGSVGTRVDDNNGEMAYVKGGMNVKPIVVESV------------EEESRLEVGEEDE  90

Query  2162  VNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
               +N     +  +    +E +E EKEAW+LLQ A+V YC  PVGTVAAND   + PLNYD
Sbjct  91    NMENSGGVKNADEAENVQEETEAEKEAWRLLQEALVTYCDSPVGTVAANDSDSEQPLNYD  150

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             QVFIRDFIPSALAFLL GE +IVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV+T+ 
Sbjct  151   QVFIRDFIPSALAFLLKGEKDIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVKTLK  210

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LD    E   VLDPDFGESAIGRVAPVDSGLWWI+LLRAY KITGDY LQER+DVQTG+R
Sbjct  211   LDHEKTE---VLDPDFGESAIGRVAPVDSGLWWIMLLRAYGKITGDYGLQERLDVQTGLR  267

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             +ILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALR  REM+  ++++
Sbjct  268   MILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRSAREMVTEDENS  327

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
             K+LV  INNRLSALSFHIREYYW+DM+KINEIYRYKTEEYS+DA NKFNIYPDQIP W++
Sbjct  328   KNLVGEINNRLSALSFHIREYYWLDMRKINEIYRYKTEEYSLDATNKFNIYPDQIPTWLM  387

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
             +WIPE GGYL+GNLQPAHMDFRFF LGNLW+I+SSLGT  QN +ILN I+ KW DL+ +M
Sbjct  388   DWIPEEGGYLLGNLQPAHMDFRFFMLGNLWSIVSSLGTPRQNNAILNLIDAKWGDLVGEM  447

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVA  903
             PLKICYPALE  +WRIITG DPKNTPWSYHNGGSWPTLLWQFTLAC+KM + ELA KA+A
Sbjct  448   PLKICYPALEHHEWRIITGCDPKNTPWSYHNGGSWPTLLWQFTLACMKMERTELAEKAIA  507

Query  902   VAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDY  723
             +AE+RLP D WPEYYDTR  RF+GKQARL QTWT+AG+L SKMLLKNP +ASLL W+ED 
Sbjct  508   LAEKRLPRDSWPEYYDTRSARFVGKQARLYQTWTLAGFLASKMLLKNPKLASLLCWDEDL  567

Query  722   ELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             E+LE CVC L  +GR KCSR   +SQ+ V
Sbjct  568   EILETCVCLLHKSGRIKCSRDVAKSQILV  596



>ref|XP_010486057.1| PREDICTED: alkaline/neutral invertase CINV1-like [Camelina sativa]
Length=627

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/583 (68%), Positives = 468/583 (80%), Gaps = 30/583 (5%)
 Frame = -3

Query  2384  NRLVFVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyE  2205
             +R   V  +V S+ RS S ST    ND +  + Y + G+NVKPL + +            
Sbjct  71    DRQSSVTAQVVSEARSLSASTTC-ANDPTVDRIYTKNGLNVKPLDLNKL-----------  118

Query  2204  QKDGGRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTV  2025
                  + +  D+  +N +   G          + +E E+EAW+LL+ +VV YC  PVGT+
Sbjct  119   -----KGDEKDEEVINGDGYEGI---------KSNETEEEAWRLLRDSVVTYCDSPVGTM  164

Query  2024  AANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPG  1845
             AA DP D +P NYDQVFIRDF+PSALAFLL GE EIV+NFLLHTLQLQSWEKTVDCYSPG
Sbjct  165   AAKDPTDTMPSNYDQVFIRDFVPSALAFLLKGESEIVRNFLLHTLQLQSWEKTVDCYSPG  224

Query  1844  QGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGD  1665
             QGLMPASFKVRT+PL+    +FE+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY KITGD
Sbjct  225   QGLMPASFKVRTLPLE--EDKFEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKITGD  282

Query  1664  YTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSA  1485
             Y+LQER+DVQTGI++I NLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSA
Sbjct  283   YSLQERIDVQTGIKMIANLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSA  342

Query  1484  LRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAIN  1305
             LR +REM+ VNDS+K+++  I+NRLSALSFHIRE YWVD  KINEIYRYKTEEYSMDA N
Sbjct  343   LRSSREMITVNDSSKNIIKTISNRLSALSFHIRENYWVDKNKINEIYRYKTEEYSMDATN  402

Query  1304  KFNIYPDQIPPWIVNWIPETG--GYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKS  1131
             KFNIYP+Q+ PW+++W+PE+   G+L+GNLQPAHMDFRFFTLGNL +IISSLGT +QN++
Sbjct  403   KFNIYPEQVSPWLMDWVPESSDCGFLIGNLQPAHMDFRFFTLGNLLSIISSLGTPKQNQA  462

Query  1130  ILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTL  951
             ILN IE KWDDL+  MPLKICYPALE  +W IITGSDPKNTPWSYHNGGSWPTLLWQFTL
Sbjct  463   ILNLIEEKWDDLVGHMPLKICYPALESSEWHIITGSDPKNTPWSYHNGGSWPTLLWQFTL  522

Query  950   ACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKML  771
             ACIKMG+PELA KAV +AE+RL  D+WPEYYDTR+G+FIGKQ+RL QTWT+AG+LTSK L
Sbjct  523   ACIKMGRPELAEKAVTLAEKRLQADRWPEYYDTRNGKFIGKQSRLYQTWTIAGFLTSKQL  582

Query  770   LKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQV  642
             L+NP++AS L W ED ELLE CVC L   GR+KCSR   +SQ+
Sbjct  583   LQNPEIASSLFWEEDLELLETCVCVLTKAGRKKCSRAAAKSQI  625



>ref|XP_003558048.1| PREDICTED: alkaline/neutral invertase CINV1-like [Brachypodium 
distachyon]
Length=621

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/493 (80%), Positives = 433/493 (88%), Gaps = 1/493 (0%)
 Frame = -3

Query  2111  REVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPAD-KLPLNYDQVFIRDFIPSALAFLL  1935
             RE S  EKEAW LL  AVVNYCG  VGTVAANDP+     LNYDQVFIRDF+PSA+AFLL
Sbjct  129   REQSPQEKEAWWLLSRAVVNYCGSAVGTVAANDPSTANHMLNYDQVFIRDFVPSAIAFLL  188

Query  1934  NGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDF  1755
              GE +IVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR++PLDG +  FE+VLDPDF
Sbjct  189   KGESDIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSVPLDGNSEAFEEVLDPDF  248

Query  1754  GESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPT  1575
             GESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGI+LILNLCL DGFDMFPT
Sbjct  249   GESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIKLILNLCLSDGFDMFPT  308

Query  1574  LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSF  1395
             LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC REM+ +ND +K+L+ AINNRLSALSF
Sbjct  309   LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMVSINDGSKNLIRAINNRLSALSF  368

Query  1394  HIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQP  1215
             HIREYYWVDMKKINEIYRYKTEEYS DAINKFNIYP+QIP W+ +WIPE GGYL+GNLQP
Sbjct  369   HIREYYWVDMKKINEIYRYKTEEYSHDAINKFNIYPEQIPSWLADWIPEKGGYLIGNLQP  428

Query  1214  AHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRI  1035
             AHMDFRFF+LGNLWAI+SSL T +Q + ILN IE KWDD++A MPLKICYPALE E+WRI
Sbjct  429   AHMDFRFFSLGNLWAIVSSLATQKQAEGILNLIETKWDDIVANMPLKICYPALEYEEWRI  488

Query  1034  ITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYD  855
             ITG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ +LA +AV   E+RL  D+WPEYYD
Sbjct  489   ITGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRHDLAQRAVEAVEKRLSDDKWPEYYD  548

Query  854   TRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRR  675
             TR GRFIGKQ+RL QTWT+AG+L+SKMLL +P++AS+L+ +ED ELLE C CGL  + R 
Sbjct  549   TRTGRFIGKQSRLYQTWTIAGFLSSKMLLASPEIASILICDEDLELLEGCACGLNKSARI  608

Query  674   KCSRFGVRSQVGV  636
             KCSR   RSQV V
Sbjct  609   KCSRRAARSQVLV  621



>dbj|BAJ94475.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00808.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=619

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/493 (80%), Positives = 431/493 (87%), Gaps = 1/493 (0%)
 Frame = -3

Query  2111  REVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPAD-KLPLNYDQVFIRDFIPSALAFLL  1935
             RE S  EKEAW LL  AVVNYCG  VGTVAANDP+     LNYDQVFIRDF+PSA+AFLL
Sbjct  127   REESPEEKEAWWLLNRAVVNYCGSAVGTVAANDPSTANHMLNYDQVFIRDFVPSAIAFLL  186

Query  1934  NGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDF  1755
              GE +IVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR++PLDG N  FE+VLDPDF
Sbjct  187   RGESDIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSVPLDGNNEAFEEVLDPDF  246

Query  1754  GESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPT  1575
             GESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGIRLILNLCL DGFDMFPT
Sbjct  247   GESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLSDGFDMFPT  306

Query  1574  LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSF  1395
             LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC REM+  +D +K+L+  +NNRLSALSF
Sbjct  307   LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMVSTDDGSKNLIRVVNNRLSALSF  366

Query  1394  HIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQP  1215
             HIREYYWVDMKKINEIYRYKTEEYS DAINKFNIYP+QIP W+ +WIP+ GGYL+GNLQP
Sbjct  367   HIREYYWVDMKKINEIYRYKTEEYSHDAINKFNIYPEQIPSWLADWIPDKGGYLIGNLQP  426

Query  1214  AHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRI  1035
             AHMDFRFF+LGNLWAI+SSL T +Q + ILN IE KWDD++A MPLKICYPALE E+WRI
Sbjct  427   AHMDFRFFSLGNLWAIVSSLATQKQAEGILNLIETKWDDIVANMPLKICYPALEYEEWRI  486

Query  1034  ITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYD  855
             ITG DPKNTPWSYHNGGSWPTLLWQFTLACIKMG+P+LA +AV   E+RL  D+WPEYYD
Sbjct  487   ITGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPDLARRAVEAVEKRLSDDKWPEYYD  546

Query  854   TRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRR  675
             TR GRFIGKQ+RL QTWT+AG+L+SKMLL  P+MAS+L+ +ED ELLE C CGL  + R 
Sbjct  547   TRTGRFIGKQSRLYQTWTIAGFLSSKMLLDCPEMASILICDEDLELLEGCACGLSNSARI  606

Query  674   KCSRFGVRSQVGV  636
             KCSR   RSQV V
Sbjct  607   KCSRRAARSQVLV  619



>gb|EEC75120.1| hypothetical protein OsI_11302 [Oryza sativa Indica Group]
 gb|EEE58943.1| hypothetical protein OsJ_10618 [Oryza sativa Japonica Group]
Length=683

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/491 (80%), Positives = 432/491 (88%), Gaps = 3/491 (1%)
 Frame = -3

Query  2111  REVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDP--ADKLPLNYDQVFIRDFIPSALAFL  1938
             R+ S  EKEAW LL  +VV+YCG  VGTVAANDP  A+++ LNYDQVFIRDF+PSA+AFL
Sbjct  136   RKESTEEKEAWSLLGRSVVSYCGTAVGTVAANDPSTANQM-LNYDQVFIRDFVPSAIAFL  194

Query  1937  LNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPD  1758
             L GEG+IVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR++PLDG +  FE+VLDPD
Sbjct  195   LKGEGDIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSIPLDGNSEAFEEVLDPD  254

Query  1757  FGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFP  1578
             FGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQTGIRLILNLCL DGFDMFP
Sbjct  255   FGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLSDGFDMFP  314

Query  1577  TLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALS  1398
             TLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSALRC REM+ VND + SL+ AIN RLSALS
Sbjct  315   TLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCAREMVSVNDGSNSLIRAINYRLSALS  374

Query  1397  FHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQ  1218
             FHIREYYWVDMKKINEIYRYKTEEYS DAINKFNIYP+QIP W+ +WIPE GGYL+GNLQ
Sbjct  375   FHIREYYWVDMKKINEIYRYKTEEYSHDAINKFNIYPEQIPSWLADWIPEKGGYLIGNLQ  434

Query  1217  PAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWR  1038
             PAHMDFRFF+LGNLWAIISSL T  Q + ILN IE KW+D+IA MPLKICYPALE E+WR
Sbjct  435   PAHMDFRFFSLGNLWAIISSLATQRQAEGILNLIEAKWEDIIANMPLKICYPALEYEEWR  494

Query  1037  IITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYY  858
             IITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+ +LA +A+ VAE+RL  D+WPEYY
Sbjct  495   IITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRRDLAQRAIEVAEKRLSEDKWPEYY  554

Query  857   DTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGR  678
             DTR GRFIGKQ+RL QTWT+AGYL+SKMLL  P++AS+L+  ED ELLE C C +  + R
Sbjct  555   DTRTGRFIGKQSRLYQTWTIAGYLSSKMLLDCPELASILICEEDLELLEGCACSVNKSAR  614

Query  677   RKCSRFGVRSQ  645
              KCSR   RSQ
Sbjct  615   TKCSRRAARSQ  625



>emb|CDY18825.1| BnaAnng02900D [Brassica napus]
Length=629

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/583 (70%), Positives = 468/583 (80%), Gaps = 23/583 (4%)
 Frame = -3

Query  2384  NRLVFVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyE  2205
             NR   V  +VAS+ R+ S S      D +  K   + G+NVKPL +ER E  E   E   
Sbjct  66    NRPSSVTTQVASEARNLSASRTC-TKDPTLDKIIAKNGLNVKPLTVERLEEDEKDEE---  121

Query  2204  QKDGGRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTV  2025
                   V   D   ++K+ L               E+E+EAW+LL+ +VV YC  PVGT+
Sbjct  122   ------VVNGDVRNIDKDGLENV---------RRKEIEEEAWRLLRQSVVTYCDSPVGTM  166

Query  2024  AANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPG  1845
             AANDP D  PLNYDQVF+RDF+PSALAFL+ GEGEIV+NFLL+TLQLQSWEKTVDCYSPG
Sbjct  167   AANDPTDTAPLNYDQVFVRDFVPSALAFLMKGEGEIVRNFLLYTLQLQSWEKTVDCYSPG  226

Query  1844  QGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGD  1665
             QGLMPASFKVRT PL+    +FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGD
Sbjct  227   QGLMPASFKVRTSPLE--EDKFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGD  284

Query  1664  YTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSA  1485
             Y+LQERVDVQTGI++I NLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSA
Sbjct  285   YSLQERVDVQTGIKMIANLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSA  344

Query  1484  LRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAIN  1305
             LR +REM+ +NDS+K+LV  INNRLSA+SFHIRE YWVD  KINEIYRYKTEEYS DA N
Sbjct  345   LRSSREMITINDSSKNLVRTINNRLSAISFHIRENYWVDKGKINEIYRYKTEEYSTDATN  404

Query  1304  KFNIYPDQIPPWIVNWIPETG--GYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKS  1131
             KFNIYPDQ+ PW+++WIPE+   G+LVGNLQPAHMDFRFFTLGNLW+IISSLGT  QN++
Sbjct  405   KFNIYPDQVSPWLMDWIPESHRCGFLVGNLQPAHMDFRFFTLGNLWSIISSLGTPRQNQA  464

Query  1130  ILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTL  951
             ILN IE KWDDLI  MPLKIC+PALE  +W IITGSDPKNTPWSYHNGGSWPTLLWQFTL
Sbjct  465   ILNLIEEKWDDLIGHMPLKICFPALESSEWHIITGSDPKNTPWSYHNGGSWPTLLWQFTL  524

Query  950   ACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKML  771
             AC+KMG+PELA KAV +AE+RL  D+WPEYYDTR+G+FIGK++RL QTWT+AG+LT+K L
Sbjct  525   ACMKMGRPELAEKAVTLAEKRLQADRWPEYYDTRYGKFIGKKSRLYQTWTIAGFLTAKQL  584

Query  770   LKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQV  642
             L+NP+MAS L W ED ELLE CVC L  +GR+ CSR   +SQ+
Sbjct  585   LQNPEMASSLFWEEDLELLETCVCVLTKSGRKSCSRAAAKSQI  627



>ref|XP_009124963.1| PREDICTED: alkaline/neutral invertase CINV1 [Brassica rapa]
Length=629

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/583 (70%), Positives = 468/583 (80%), Gaps = 23/583 (4%)
 Frame = -3

Query  2384  NRLVFVVPKVASDMRSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyE  2205
             NR   V  +VAS+ R+ S S      D +  K   + G+NVKPL +ER E  E   E   
Sbjct  66    NRPSSVTTQVASEARNLSAS-RICTKDPTLDKIIAKNGLNVKPLTVERLEEDEKDEE---  121

Query  2204  QKDGGRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTV  2025
                   V   D   ++K+ L               E+E+EAW+LL+ +VV YC  PVGT+
Sbjct  122   ------VVNGDVRNIDKDGLENV---------RRKEIEEEAWRLLRQSVVTYCDSPVGTM  166

Query  2024  AANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPG  1845
             AANDP D  PLNYDQVF+RDF+PSALAFL+ GEGEIV+NFLL+TLQLQSWEKTVDCYSPG
Sbjct  167   AANDPTDTAPLNYDQVFVRDFVPSALAFLMKGEGEIVRNFLLYTLQLQSWEKTVDCYSPG  226

Query  1844  QGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGD  1665
             QGLMPASFKVRT PL+    +FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGD
Sbjct  227   QGLMPASFKVRTSPLE--EDKFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGD  284

Query  1664  YTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSA  1485
             Y+LQERVDVQTGI++I NLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSA
Sbjct  285   YSLQERVDVQTGIKMIANLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSA  344

Query  1484  LRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAIN  1305
             LR +REM+ +NDS+K+LV  INNRLSA+SFHIRE YWVD  KINEIYRYKTEEYS DA N
Sbjct  345   LRSSREMITINDSSKNLVRTINNRLSAISFHIRENYWVDKGKINEIYRYKTEEYSTDATN  404

Query  1304  KFNIYPDQIPPWIVNWIPETG--GYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKS  1131
             KFNIYPDQ+ PW+++WIPE+   G+LVGNLQPAHMDFRFFTLGNLW+IISSLGT  QN++
Sbjct  405   KFNIYPDQVSPWLMDWIPESHRCGFLVGNLQPAHMDFRFFTLGNLWSIISSLGTPRQNQA  464

Query  1130  ILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTL  951
             ILN IE KWDDLI  MPLKIC+PALE  +W IITGSDPKNTPWSYHNGGSWPTLLWQFTL
Sbjct  465   ILNLIEEKWDDLIGHMPLKICFPALESSEWHIITGSDPKNTPWSYHNGGSWPTLLWQFTL  524

Query  950   ACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKML  771
             AC+KMG+PELA KAV +AE+RL  D+WPEYYDTR+G+FIGK++RL QTWT+AG+LT+K L
Sbjct  525   ACMKMGRPELAEKAVTLAEKRLQADRWPEYYDTRYGKFIGKKSRLYQTWTIAGFLTAKQL  584

Query  770   LKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQV  642
             L+NP+MAS L W ED ELLE CVC L  +GR+ CSR   +SQ+
Sbjct  585   LQNPEMASSLFWEEDLELLETCVCVLTKSGRKSCSRAAAKSQI  627



>ref|XP_003567650.1| PREDICTED: alkaline/neutral invertase CINV1-like [Brachypodium 
distachyon]
Length=619

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/486 (80%), Positives = 431/486 (89%), Gaps = 2/486 (0%)
 Frame = -3

Query  2120  APEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAF  1941
             +P RE SE E+EAW+LL+ AVV+YCG PVGTVAA DP      NYDQVFIRDF+PSALAF
Sbjct  127   SPVREESETEREAWRLLRRAVVSYCGEPVGTVAAEDPECTEVANYDQVFIRDFVPSALAF  186

Query  1940  LLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDP  1761
             L+ GE EIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFK+RT+PLD  N  FE+VLDP
Sbjct  187   LMRGETEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKIRTVPLDENNEAFEEVLDP  246

Query  1760  DFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMF  1581
             DFGESAIGRVAPVDSGLWWIILLRAY KITGDY+LQERVDVQTGI+LIL+LCL DGFDMF
Sbjct  247   DFGESAIGRVAPVDSGLWWIILLRAYCKITGDYSLQERVDVQTGIKLILSLCLTDGFDMF  306

Query  1580  PTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSAL  1401
             PTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REM+ VND +K L+ AINNRLSAL
Sbjct  307   PTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMITVNDGSKHLLRAINNRLSAL  366

Query  1400  SFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNL  1221
             SFHIREYYWVDMKKINEIYRYKTEEYS DA NKFNIYP+QIP W+V+WIPE GGYL+GNL
Sbjct  367   SFHIREYYWVDMKKINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEEGGYLIGNL  426

Query  1220  QPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDW  1041
             QPAHMDFRFF+LGNLWAI SSL T  Q + IL+ IE KWDDL+A MPLKICYPA+E  +W
Sbjct  427   QPAHMDFRFFSLGNLWAISSSLTTPTQAEGILSLIEEKWDDLVANMPLKICYPAMEDNEW  486

Query  1040  RIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEY  861
             RI+TGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+PELA +AVAVAEE+L  D+WPEY
Sbjct  487   RIVTGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARRAVAVAEEQLSADKWPEY  546

Query  860   YDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNG  681
             YDTR GRF+GKQ+R  QTWT+AG+LTSKMLL+NP++AS+L  +ED ELLE C C L  + 
Sbjct  547   YDTRSGRFVGKQSRSYQTWTIAGFLTSKMLLENPELASILTCDEDLELLEGCACCL--SK  604

Query  680   RRKCSR  663
             R +CSR
Sbjct  605   RTRCSR  610



>gb|KEH24469.1| alkaline/neutral invertase [Medicago truncatula]
Length=609

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/522 (75%), Positives = 447/522 (86%), Gaps = 6/522 (1%)
 Frame = -3

Query  2201  KDGGRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVA  2022
             K GG  E  D    N + L    ++K   E E ++VEK+AWKLLQ A+V YC  PVGTVA
Sbjct  94    KGGGDEE--DLKEKNCDSLKNVIVAKNGDEEE-TDVEKDAWKLLQKALVTYCDTPVGTVA  150

Query  2021  ANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQ  1842
             AND +   PLNYDQVFIRDF+PSALAFLL GE EIVKNFLLHTLQLQSWEKTVDCYSPGQ
Sbjct  151   ANDDSGS-PLNYDQVFIRDFVPSALAFLLKGEHEIVKNFLLHTLQLQSWEKTVDCYSPGQ  209

Query  1841  GLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDY  1662
             GLMPASFKV+TM  D +  + E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY K+TGDY
Sbjct  210   GLMPASFKVKTMEFDDK--KTEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDY  267

Query  1661  TLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL  1482
             +LQE+++VQTG+R+ILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL
Sbjct  268   SLQEKLEVQTGLRMILNLCLSDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL  327

Query  1481  RCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINK  1302
             R  REM++ ND +KSLV  INNRLSALSFHIREYYW+DM+K+NEIYRYKTEEYS+DA NK
Sbjct  328   RSAREMVVKNDESKSLVGEINNRLSALSFHIREYYWLDMRKVNEIYRYKTEEYSLDATNK  387

Query  1301  FNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILN  1122
             FNIYP+QIP W+++WIPE GGYL+GNLQPAHMDFRFF LGNLW+I+SSLGT  QNKS+LN
Sbjct  388   FNIYPEQIPMWLMDWIPEEGGYLIGNLQPAHMDFRFFMLGNLWSIVSSLGTPRQNKSVLN  447

Query  1121  FIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACI  942
              IE KWDDL+ QMPLKICYPALE ++WR++TGSDPKNTPWSYHNGGSWPTLLWQFTLACI
Sbjct  448   LIESKWDDLVGQMPLKICYPALEHDEWRLVTGSDPKNTPWSYHNGGSWPTLLWQFTLACI  507

Query  941   KMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKN  762
             KMG+ +LA KAV +AE+RLP D WPEYYDT+ GRFIGKQARL QTWT+AG+L SKMLLK 
Sbjct  508   KMGRTDLAEKAVGLAEKRLPFDSWPEYYDTKTGRFIGKQARLFQTWTLAGFLASKMLLKK  567

Query  761   PDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             P++A+LL W+ED E+LE CVC L  +GR KCSR   +S + V
Sbjct  568   PEIATLLCWDEDLEILETCVCVLNKSGRTKCSRRVAKSHILV  609



>ref|NP_001169586.1| hypothetical protein [Zea mays]
 gb|ACN34188.1| unknown [Zea mays]
 gb|AFW80675.1| hypothetical protein ZEAMMB73_618506 [Zea mays]
Length=626

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/512 (76%), Positives = 440/512 (86%), Gaps = 4/512 (1%)
 Frame = -3

Query  2174  DDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLP  1995
             +D+   + D    +++  AP R+ +E E+EAW+LL+ AVV+YCG PVGTVAA DP     
Sbjct  119   EDAAAAQTD---EAVAPAAPLRQETETEREAWRLLRRAVVSYCGEPVGTVAAEDPECTET  175

Query  1994  LNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV  1815
             LNYDQVFIRDF+PSALAFL+ GE EIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFK+
Sbjct  176   LNYDQVFIRDFVPSALAFLMRGETEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKI  235

Query  1814  RTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQ  1635
             RT+PLD  N  FE+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY KITGD  L ERVDVQ
Sbjct  236   RTLPLDENNEGFEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYSKITGDSALLERVDVQ  295

Query  1634  TGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIV  1455
             TGI+LIL+LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML+V
Sbjct  296   TGIQLILSLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVV  355

Query  1454  NDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIP  1275
             ND +K+L+ AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DA NKFNIYP+QIP
Sbjct  356   NDGSKNLIRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSHDATNKFNIYPEQIP  415

Query  1274  PWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDL  1095
              W+V+WIPE GGYL+GNLQPAHMDFRFF+LGNLWAI SSL T +Q + IL+ IE KWDDL
Sbjct  416   SWLVDWIPEKGGYLIGNLQPAHMDFRFFSLGNLWAIASSLTTPKQAEGILSLIEEKWDDL  475

Query  1094  IAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAM  915
             IA MPLKICYPA+E ++WRIITGSDPKNTPWSYHNGGSWPTLLWQF LACIKMG+PELA 
Sbjct  476   IANMPLKICYPAMEDDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFILACIKMGRPELAR  535

Query  914   KAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVW  735
             +A+ VAEERL  D+WPEYYDTR GRFIGKQ+R  QTWT+AG+LTSKMLL+NP++AS+L  
Sbjct  536   RAITVAEERLSDDKWPEYYDTRSGRFIGKQSRSYQTWTIAGFLTSKMLLENPELASILTC  595

Query  734   NEDYELLENCVCGLKYNGRRKCSRFGVRSQVG  639
             +ED ELLE C C L    R +CSR   +S   
Sbjct  596   DEDLELLEGCACCLS-KKRTRCSRRAAKSHAA  626



>ref|XP_006645848.1| PREDICTED: alkaline/neutral invertase CINV2-like, partial [Oryza 
brachyantha]
Length=542

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/480 (80%), Positives = 426/480 (89%), Gaps = 1/480 (0%)
 Frame = -3

Query  2081  WKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFL  1902
             W+LL+ AVV+YCG PVGTVAA DP     LNYDQVFIRDF+PSALAFL+ GE EIV+NFL
Sbjct  62    WRLLRRAVVSYCGAPVGTVAAEDPECTETLNYDQVFIRDFVPSALAFLMRGETEIVRNFL  121

Query  1901  LHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPV  1722
             LHTLQLQSWEKTVDCYSPGQGLMPASFK+R +PLD  N  FE+VLDPDFGESAIGRVAPV
Sbjct  122   LHTLQLQSWEKTVDCYSPGQGLMPASFKIRAVPLDDNNEAFEEVLDPDFGESAIGRVAPV  181

Query  1721  DSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMID  1542
             DSGLWWIILLRAY KITGDY LQERVDVQTGI+LIL+LCL DGFDMFPTLLVTDGSCMID
Sbjct  182   DSGLWWIILLRAYCKITGDYALQERVDVQTGIKLILSLCLSDGFDMFPTLLVTDGSCMID  241

Query  1541  RRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMK  1362
             RRMGIHGHPLEIQALFYSALRC+REML++ND +K+L+ AINNRLSALSFHIREYYWVDMK
Sbjct  242   RRMGIHGHPLEIQALFYSALRCSREMLVLNDGSKNLLRAINNRLSALSFHIREYYWVDMK  301

Query  1361  KINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLG  1182
             KINEIYRYKTEEYS DA NKFNIYP+QIP W+V+WIPE GGYL+GNLQPAHMDFRFF+LG
Sbjct  302   KINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEKGGYLIGNLQPAHMDFRFFSLG  361

Query  1181  NLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPW  1002
             NLWAI SSL T +Q + IL+ IE KWDDL+A MPLKICYPA+E ++WRIITGSDPKNTPW
Sbjct  362   NLWAIASSLTTPKQAEGILSLIEEKWDDLVANMPLKICYPAMEDDEWRIITGSDPKNTPW  421

Query  1001  SYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQA  822
             SYHNGGSWPTLLWQFTLACIKMG+PELA +A+AVAEERL  D+WPEYYDTR GRFIGKQ+
Sbjct  422   SYHNGGSWPTLLWQFTLACIKMGRPELARRAIAVAEERLTADKWPEYYDTRSGRFIGKQS  481

Query  821   RLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQV  642
             R  QTWT+AG+LTSKMLL+NP++AS+L  +ED ELLE C C L    R +CSR   +S V
Sbjct  482   RSYQTWTIAGFLTSKMLLENPELASILTCDEDLELLEGCACCLS-KKRTRCSRRAAKSHV  540



>gb|EMT27716.1| hypothetical protein F775_26108 [Aegilops tauschii]
Length=506

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/481 (79%), Positives = 427/481 (89%), Gaps = 2/481 (0%)
 Frame = -3

Query  2084  AWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNF  1905
             AW+LL+ AVV+YCG PVGTVAA DP     LNYDQVFIRDF+PSALAFL+ GE EIV+NF
Sbjct  26    AWRLLRRAVVSYCGEPVGTVAAEDPECTEMLNYDQVFIRDFVPSALAFLMRGETEIVRNF  85

Query  1904  LLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAP  1725
             LLHTLQLQSWEKTVDCYSPGQGLMPASFK+RT+PLD  N  FE++LDPDFGESAIGRVAP
Sbjct  86    LLHTLQLQSWEKTVDCYSPGQGLMPASFKIRTVPLDENNEAFEEILDPDFGESAIGRVAP  145

Query  1724  VDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMI  1545
             VDSGLWWIILLRAY KITGDY+LQERVDVQTGI+LIL+LCL DGFDMFPTLLVTDGSCMI
Sbjct  146   VDSGLWWIILLRAYCKITGDYSLQERVDVQTGIKLILSLCLSDGFDMFPTLLVTDGSCMI  205

Query  1544  DRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDM  1365
             DRRMGIHGHPLEIQALFYSALRC+REM+++N+ +K L+ AINNRLSALSFHIREYYWVDM
Sbjct  206   DRRMGIHGHPLEIQALFYSALRCSREMIVMNEGSKHLLRAINNRLSALSFHIREYYWVDM  265

Query  1364  KKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTL  1185
              KINEIYRYKTEEYS DA NKFNIYP+QIP W+V+WIPE GGYL+GNLQPAHMDFRFF+L
Sbjct  266   NKINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEKGGYLIGNLQPAHMDFRFFSL  325

Query  1184  GNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTP  1005
             GNLWAI SSL T  Q + IL+ IE KWDDL+A MP+KICYPA+E ++WRIITGSDPKNTP
Sbjct  326   GNLWAISSSLTTPTQAEGILSLIEEKWDDLVANMPVKICYPAMEYDEWRIITGSDPKNTP  385

Query  1004  WSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQ  825
             WSYHNGGSWPTLLWQFTLACIKMG+PELA +A+AVAEE+L  D+WPEYYDTR GRFIGKQ
Sbjct  386   WSYHNGGSWPTLLWQFTLACIKMGRPELARRAIAVAEEKLSADKWPEYYDTRSGRFIGKQ  445

Query  824   ARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQ  645
             +R  QTWT+AG+LTSKMLL+NP++AS+L  +ED ELLE C C L  + R +CSR   +S 
Sbjct  446   SRSYQTWTIAGFLTSKMLLENPELASILTCDEDLELLEGCACCL--SKRTRCSRRAAKSD  503

Query  644   V  642
             +
Sbjct  504   I  504



>gb|EMS59378.1| hypothetical protein TRIUR3_23445 [Triticum urartu]
Length=517

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/481 (79%), Positives = 427/481 (89%), Gaps = 2/481 (0%)
 Frame = -3

Query  2084  AWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNF  1905
             AW+LL+ AVV+YCG PVGTVAA DP     LNYDQVFIRDF+PSALAFL+ GE EIV+NF
Sbjct  37    AWRLLRRAVVSYCGEPVGTVAAEDPECTEMLNYDQVFIRDFVPSALAFLMRGETEIVRNF  96

Query  1904  LLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAP  1725
             LLHTLQLQSWEKTVDCYSPGQGLMPASFK+RT+PLD  N  FE++LDPDFGESAIGRVAP
Sbjct  97    LLHTLQLQSWEKTVDCYSPGQGLMPASFKIRTVPLDENNEAFEEILDPDFGESAIGRVAP  156

Query  1724  VDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMI  1545
             VDSGLWWIILLRAY KITGDY+LQERVDVQTGI+LIL+LCL DGFDMFPTLLVTDGSCMI
Sbjct  157   VDSGLWWIILLRAYCKITGDYSLQERVDVQTGIKLILSLCLSDGFDMFPTLLVTDGSCMI  216

Query  1544  DRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDM  1365
             DRRMGIHGHPLEIQALFYSALRC+REM+++N+ +K L+ AINNRLSALSFHIREYYWVDM
Sbjct  217   DRRMGIHGHPLEIQALFYSALRCSREMIVMNEGSKHLLRAINNRLSALSFHIREYYWVDM  276

Query  1364  KKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTL  1185
              KINEIYRYKTEEYS DA NKFNIYP+QIP W+V+WIPE GGYL+GNLQPAHMDFRFF+L
Sbjct  277   NKINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEKGGYLIGNLQPAHMDFRFFSL  336

Query  1184  GNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTP  1005
             GNLWAI SSL T  Q + IL+ IE KWDDL+A MP+KICYPA+E ++WRIITGSDPKNTP
Sbjct  337   GNLWAISSSLTTPTQAEGILSLIEEKWDDLVANMPVKICYPAMEYDEWRIITGSDPKNTP  396

Query  1004  WSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQ  825
             WSYHNGGSWPTLLWQFTLACIKMG+PELA +A+AVAEE+L  D+WPEYYDTR GRFIGKQ
Sbjct  397   WSYHNGGSWPTLLWQFTLACIKMGRPELARRAIAVAEEKLSADKWPEYYDTRSGRFIGKQ  456

Query  824   ARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQ  645
             +R  QTWT+AG+LTSKMLL+NP++AS+L  +ED ELLE C C L  + R +CSR   +S 
Sbjct  457   SRSYQTWTIAGFLTSKMLLENPELASILTCDEDLELLEGCACCL--SKRTRCSRRAAKSD  514

Query  644   V  642
             +
Sbjct  515   I  515



>gb|AGG41113.1| putative neutral/alkaline invertase [Saccharum hybrid cultivar 
FN-41]
Length=629

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/512 (76%), Positives = 442/512 (86%), Gaps = 4/512 (1%)
 Frame = -3

Query  2174  DDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLP  1995
             +D+   + D    ++   AP RE +E E+EAW+LL+ AVV+YCG PVGTVAA DP     
Sbjct  122   EDAAAVQTD---EAVEPAAPLREETETEREAWRLLRRAVVSYCGEPVGTVAAEDPECTET  178

Query  1994  LNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV  1815
             LNYDQVFIRDF+PSALAFL+ GE EIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFK+
Sbjct  179   LNYDQVFIRDFVPSALAFLMRGETEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKI  238

Query  1814  RTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQ  1635
             RT+PLD  N  FE+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY KITGD  L ERVDVQ
Sbjct  239   RTVPLDENNEGFEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYCKITGDNALLERVDVQ  298

Query  1634  TGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIV  1455
             TGI+LIL+LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML+V
Sbjct  299   TGIQLILSLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVV  358

Query  1454  NDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIP  1275
             N+ +K+L+ AIN RLSALSFHIREYYWVDMKKINEIYRYKTEEYS DA NKFNIYP+QIP
Sbjct  359   NNGSKNLIRAINTRLSALSFHIREYYWVDMKKINEIYRYKTEEYSHDATNKFNIYPEQIP  418

Query  1274  PWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDL  1095
              W+V+WIPE GGYL+GNLQPAHMDFRFF+LGNLWAI SSL T +Q + IL+ IE KWDDL
Sbjct  419   SWLVDWIPEKGGYLIGNLQPAHMDFRFFSLGNLWAIASSLTTPKQAEGILSLIEEKWDDL  478

Query  1094  IAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAM  915
             +A MPLKICYPA+E ++WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+PELA 
Sbjct  479   VANMPLKICYPAMEDDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELAR  538

Query  914   KAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVW  735
             +A+AVAEERL  D+WPEYYDTR GRFIGKQ+R  QTWT+AG+LTSKMLL+NP++AS+L  
Sbjct  539   RAIAVAEERLSDDKWPEYYDTRSGRFIGKQSRSYQTWTIAGFLTSKMLLENPELASILTC  598

Query  734   NEDYELLENCVCGLKYNGRRKCSRFGVRSQVG  639
             +ED ELLE C C L    R +CSR   +S +G
Sbjct  599   DEDLELLEGCACCLS-TKRTRCSRRAAKSHIG  629



>gb|EMS48780.1| hypothetical protein TRIUR3_08899 [Triticum urartu]
Length=576

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/529 (74%), Positives = 431/529 (81%), Gaps = 37/529 (7%)
 Frame = -3

Query  2111  REVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPAD-KLPLNYDQVFIRDFIPSALAFLL  1935
             RE S  EKEAW LL  AVVNYCG  VGTVAANDP+     LNYDQVFIRDF+PSA+AFLL
Sbjct  48    REESPEEKEAWWLLNRAVVNYCGSAVGTVAANDPSTANHMLNYDQVFIRDFVPSAIAFLL  107

Query  1934  NGEGEIVKNFLLHTLQLQ------------------------------------SWEKTV  1863
              GE +IVKNFLLHTLQLQ                                    SWEKTV
Sbjct  108   RGESDIVKNFLLHTLQLQRWALANLDSYVTADFWTRRKCHGRHTAVEPRADSSTSWEKTV  167

Query  1862  DCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAY  1683
             DCYSPGQGLMPASFKVR++PLDG N  FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY
Sbjct  168   DCYSPGQGLMPASFKVRSVPLDGNNEAFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAY  227

Query  1682  VKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ  1503
              KITGDY LQERVDVQTGIRLILNLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ
Sbjct  228   GKITGDYALQERVDVQTGIRLILNLCLTDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ  287

Query  1502  ALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEY  1323
             ALFYSALRC REM+  +D +K+L+  INNRLSALSFHIREYYWVDMKKINEIYRYKTEEY
Sbjct  288   ALFYSALRCAREMVSTDDGSKNLIRVINNRLSALSFHIREYYWVDMKKINEIYRYKTEEY  347

Query  1322  SMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHE  1143
             S DAINKFNIYP+QIP W+ +WIP+ GGYL+GNLQPAHMDFRFF+LGNLWAI+SSL T +
Sbjct  348   SHDAINKFNIYPEQIPSWLADWIPDKGGYLIGNLQPAHMDFRFFSLGNLWAIVSSLATQK  407

Query  1142  QNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLW  963
             Q + ILN IE KWDD++A MPLKICYPALE E+WRIITG DPKNTPWSYHNGGSWPTLLW
Sbjct  408   QAEGILNLIETKWDDIVANMPLKICYPALEYEEWRIITGCDPKNTPWSYHNGGSWPTLLW  467

Query  962   QFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLT  783
             QFTLACIKMG+P+LA +AV   E+RL  D+WPEYYDTR GRFIGKQ+RL QTWT+AG+L+
Sbjct  468   QFTLACIKMGRPDLARRAVEAVEKRLSDDKWPEYYDTRTGRFIGKQSRLYQTWTIAGFLS  527

Query  782   SKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             SKMLL  P+MAS+L+ +ED ELLE C CGL  + R KCSR   RSQV V
Sbjct  528   SKMLLDCPEMASILICDEDLELLEGCACGLSNSARIKCSRRAARSQVLV  576



>gb|EAY73839.1| hypothetical protein OsI_01715 [Oryza sativa Indica Group]
Length=621

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/480 (80%), Positives = 425/480 (89%), Gaps = 1/480 (0%)
 Frame = -3

Query  2081  WKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFL  1902
             W+LL+ AVV+YCG PVGTVAA DP     LNYDQVFIRDF+PSALAFL+ GE EIV+NFL
Sbjct  141   WRLLRRAVVSYCGEPVGTVAAEDPECTETLNYDQVFIRDFVPSALAFLMRGETEIVRNFL  200

Query  1901  LHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPV  1722
             LHTLQLQSWEKTVDCYSPGQGLMPASFK+R +PLD  N  FE+VLDPDFGESAIGRVAPV
Sbjct  201   LHTLQLQSWEKTVDCYSPGQGLMPASFKIRAVPLDDNNEAFEEVLDPDFGESAIGRVAPV  260

Query  1721  DSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMID  1542
             DSGLWWIILLRAY KITGD  LQERVDVQTGI+LIL+LCL DGFDMFPTLLVTDGSCMID
Sbjct  261   DSGLWWIILLRAYCKITGDNALQERVDVQTGIKLILSLCLSDGFDMFPTLLVTDGSCMID  320

Query  1541  RRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMK  1362
             RRMGIHGHPLEIQALFYSALRC+REML++ND +K+L+ AINNRLSALSFHIREYYWVDMK
Sbjct  321   RRMGIHGHPLEIQALFYSALRCSREMLVMNDGSKNLLRAINNRLSALSFHIREYYWVDMK  380

Query  1361  KINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLG  1182
             KINEIYRYKTEEYS DA NKFNIYP+QIP W+V+WIPE GGYL+GNLQPAHMDFRFF+LG
Sbjct  381   KINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEKGGYLIGNLQPAHMDFRFFSLG  440

Query  1181  NLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPW  1002
             NLWAI SSL T +Q + IL+ I+ KWDDLIA MPLKICYPA+E ++WRIITGSDPKNTPW
Sbjct  441   NLWAITSSLTTPKQAEGILSLIDEKWDDLIANMPLKICYPAMEDDEWRIITGSDPKNTPW  500

Query  1001  SYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQA  822
             SYHNGGSWPTLLWQFTLACIKMG+PELA +A+AVAEE+L  D+WPEYYDTR GRFIGKQ+
Sbjct  501   SYHNGGSWPTLLWQFTLACIKMGRPELARRAIAVAEEKLAADKWPEYYDTRSGRFIGKQS  560

Query  821   RLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQV  642
             R  QTWT+AG+LTSKMLL+NP++AS+L  NED ELLE C C L    R +CSR   +S V
Sbjct  561   RSYQTWTIAGFLTSKMLLENPELASILTCNEDLELLEGCACCLS-KKRTRCSRRAAKSHV  619



>ref|XP_007163312.1| hypothetical protein PHAVU_001G224200g [Phaseolus vulgaris]
 gb|ESW35306.1| hypothetical protein PHAVU_001G224200g [Phaseolus vulgaris]
Length=669

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/701 (60%), Positives = 509/701 (73%), Gaps = 48/701 (7%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggry  2511
             M++ + +   TMKP  +IL  Y +S  W  F RC+  +   +S S +       +     
Sbjct  1     MITTNLVCNCTMKPSPKILIGYKNS--W--FARCHHTL--TMSTSNKSTTCGLNLHLITM  54

Query  2510  rhrHSVVTLTRVINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRL----VFVVPKVASDM  2343
             +         R+++ ++  F    S+  Q      +++G S  R+    V  +  +    
Sbjct  55    QSPFHAREFGRIMHGSQQVFGLPSSSFGQ-----SSFIGLSTTRISKRGVSSIAGIDLKF  109

Query  2342  RSHSTSTEAQVNDKSFKKFY-IQGGMNVKPLviertetredvvetyEQKDGGRVEITDDS  2166
             +S   S   +  +    K   ++GGMNVKP                    G RV+  D+ 
Sbjct  110   KSRDFSNSVETYENGNGKMVCLKGGMNVKP------------------NVGERVD-NDED  150

Query  2165  TVNKNDLNGSSISKLAPERE-----------VSEVEKEAWKLLQGAVVNYCGYPVGTVAA  2019
             +V   +++G  + +   + E            +EVEKEAW+LLQ A+V YC +PVGTVAA
Sbjct  151   SVEGEEVSGLEVGEKNEKSEDVEEGEKAEEEETEVEKEAWQLLQEALVTYCDHPVGTVAA  210

Query  2018  NDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQG  1839
             ND  D+ PLNYDQVFIRDFIPSALAFLL GE EIVKNFLL+TLQLQSWEKTVDCYSPGQG
Sbjct  211   NDSDDQQPLNYDQVFIRDFIPSALAFLLKGEKEIVKNFLLNTLQLQSWEKTVDCYSPGQG  270

Query  1838  LMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYT  1659
             LMPASFKV+T  LD   G+ E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITG+Y 
Sbjct  271   LMPASFKVKTKKLD--EGKTEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGEYG  328

Query  1658  LQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALR  1479
             LQER+DVQTG+R+IL+LCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALR
Sbjct  329   LQERLDVQTGLRMILHLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALR  388

Query  1478  CTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKF  1299
               REML  ++++K+++  INNRLSAL FHIREYYW+DM+K+NEIYRYKTEEYS+DA NKF
Sbjct  389   SAREMLAADENSKNMIGEINNRLSALQFHIREYYWLDMQKMNEIYRYKTEEYSLDATNKF  448

Query  1298  NIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNF  1119
             NIYPDQIP W+++W+PE GGYL+GNLQPAHMDFRFF LGNLW+I+S+LGT +QN +ILN 
Sbjct  449   NIYPDQIPLWLIDWVPEEGGYLLGNLQPAHMDFRFFMLGNLWSIVSALGTPKQNNAILNL  508

Query  1118  IEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIK  939
             IE  W DL+ +MPLKICYPALE  +WRIITG DPKNTPWSYHNGGSWPTLLWQFTLAC+K
Sbjct  509   IEANWGDLVGEMPLKICYPALEHHEWRIITGCDPKNTPWSYHNGGSWPTLLWQFTLACMK  568

Query  938   MGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNP  759
             M + ELA KAVA+AE+RLP D WPEYYDTR  RFIGKQARL QTWT+AG+L SKMLLKNP
Sbjct  569   MNRTELAEKAVALAEKRLPRDSWPEYYDTRSARFIGKQARLYQTWTLAGFLASKMLLKNP  628

Query  758   DMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
              +ASLL W+ED+E+LE CVC L  +GR KCSR   +SQ+ V
Sbjct  629   KLASLLSWDEDFEILETCVCLLNKSGRAKCSRDAAKSQILV  669



>ref|XP_009412138.1| PREDICTED: alkaline/neutral invertase CINV1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412139.1| PREDICTED: alkaline/neutral invertase CINV1-like [Musa acuminata 
subsp. malaccensis]
Length=644

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/577 (69%), Positives = 461/577 (80%), Gaps = 16/577 (3%)
 Frame = -3

Query  2357  VASDMRSHSTST---EAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGR  2187
               SD R  STS         D+ F + ++QG   VKPLVI+  E    V        GG 
Sbjct  81    AVSDPRRLSTSVGPVPRPGGDEDFGRIFVQGLAAVKPLVIDSVEQPPAV--------GGE  132

Query  2186  VEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPA  2007
                 +     + + + S ++K    R  SE EKEAW+LL+ AVV YCG PVGT+AA DPA
Sbjct  133   KTKKEAVEEEEEEEDRSEVAK---GRLQSESEKEAWRLLKNAVVTYCGSPVGTLAAIDPA  189

Query  2006  DKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPA  1827
              + PLNYDQVFIRDF+PSAL+FLL GE EIV+NFLLHTL LQSWEKTVDCYSPGQGLMPA
Sbjct  190   VE-PLNYDQVFIRDFVPSALSFLLKGEMEIVRNFLLHTLHLQSWEKTVDCYSPGQGLMPA  248

Query  1826  SFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQER  1647
             SFKVR++P  G NGE E+ LDPDFGESAIGRVAPVDSGLWWIILLRAY KI+GDY LQER
Sbjct  249   SFKVRSVP-QGSNGEVEEFLDPDFGESAIGRVAPVDSGLWWIILLRAYGKISGDYALQER  307

Query  1646  VDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTRE  1467
             +DVQTGI+LILNLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFY ALRC+RE
Sbjct  308   IDVQTGIKLILNLCLSDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYCALRCSRE  367

Query  1466  MLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYP  1287
             M++ +D +K+++ AINNRLSALSFHIREYYW DMKK+NEIYRYKTEEYS DAINKFNIYP
Sbjct  368   MIVASDGSKNVLRAINNRLSALSFHIREYYWADMKKVNEIYRYKTEEYSQDAINKFNIYP  427

Query  1286  DQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGK  1107
             +QIP W+V+WIPE GGY +GNLQPAHMDFRFF+LGNLWAIISSL T +Q + IL+ IE K
Sbjct  428   EQIPGWLVDWIPEKGGYFIGNLQPAHMDFRFFSLGNLWAIISSLATPKQAEGILDLIEDK  487

Query  1106  WDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKP  927
             WD+L+  MPLKICYPALE E+WRI TGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+P
Sbjct  488   WDELVGNMPLKICYPALENEEWRITTGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRP  547

Query  926   ELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMAS  747
             E A KA+A+AE  L  D+WPEYYDT  GRFIGKQ+RL QTWT+AG+L SK+LL+NP++AS
Sbjct  548   ESARKAIAIAENHLSNDRWPEYYDTPTGRFIGKQSRLYQTWTIAGFLASKLLLENPELAS  607

Query  746   LLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             +L + ED ELLE C C L  + R KCSR   +S + V
Sbjct  608   ILTFEEDLELLEGCACSLAKSPRIKCSRHAAKSHIFV  644



>ref|XP_002455584.1| hypothetical protein SORBIDRAFT_03g013420 [Sorghum bicolor]
 gb|EES00704.1| hypothetical protein SORBIDRAFT_03g013420 [Sorghum bicolor]
Length=627

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/512 (76%), Positives = 443/512 (87%), Gaps = 4/512 (1%)
 Frame = -3

Query  2174  DDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLP  1995
             DD+   + D    ++   AP RE +E E+EAW+LL+ AVV+YCG PVGTVAA DP     
Sbjct  120   DDAAAVQAD---EAVEPPAPLREETETEREAWRLLRRAVVSYCGEPVGTVAAEDPECTET  176

Query  1994  LNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV  1815
             LNYDQVFIRDF+PSALAFL+ GE EIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFK+
Sbjct  177   LNYDQVFIRDFVPSALAFLMRGETEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKI  236

Query  1814  RTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQ  1635
             RT+PLD  N  FE+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY KITGD  L ERVDVQ
Sbjct  237   RTVPLDENNEGFEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYCKITGDNALLERVDVQ  296

Query  1634  TGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIV  1455
             TGI+LIL+LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML++
Sbjct  297   TGIQLILSLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVM  356

Query  1454  NDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIP  1275
             N+ +K+L+ AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS DA NKFNIYP+QIP
Sbjct  357   NNGSKNLIRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSHDATNKFNIYPEQIP  416

Query  1274  PWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDL  1095
              W+V+WIPE GGYL+GNLQPAHMDFRFF+LGNLWAI SSL T +Q + IL+ I+ KWDDL
Sbjct  417   SWLVDWIPEKGGYLIGNLQPAHMDFRFFSLGNLWAIASSLTTPKQAEGILSLIDEKWDDL  476

Query  1094  IAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAM  915
             +A MPLKICYPA+E ++WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+PELA 
Sbjct  477   VANMPLKICYPAMEDDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELAR  536

Query  914   KAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVW  735
             +A+AVAEERL  D+WPEYYDTR GRFIGKQ+R  QTWT+AG+LTSKMLL+NP++AS+L  
Sbjct  537   RAIAVAEERLSDDKWPEYYDTRSGRFIGKQSRSYQTWTIAGFLTSKMLLENPELASILTC  596

Query  734   NEDYELLENCVCGLKYNGRRKCSRFGVRSQVG  639
             +ED ELLE C C L    R +CSR   +S +G
Sbjct  597   DEDLELLEGCACCLS-TKRTRCSRRAAKSHIG  627



>ref|NP_001042931.1| Os01g0332100 [Oryza sativa Japonica Group]
 dbj|BAD54740.1| putative neutral invertase [Oryza sativa Japonica Group]
 dbj|BAD53496.1| putative neutral invertase [Oryza sativa Japonica Group]
 dbj|BAF04845.1| Os01g0332100 [Oryza sativa Japonica Group]
 dbj|BAH00142.1| unnamed protein product [Oryza sativa Japonica Group]
Length=628

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/480 (79%), Positives = 425/480 (89%), Gaps = 1/480 (0%)
 Frame = -3

Query  2081  WKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFL  1902
             W+LL+ AVV+YCG PVGTVAA DP     LNYDQVFIRDF+PSALAFL+ GE EIV+NFL
Sbjct  148   WRLLRRAVVSYCGEPVGTVAAEDPECTETLNYDQVFIRDFVPSALAFLMRGETEIVRNFL  207

Query  1901  LHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPV  1722
             LHTLQLQSWEKTVDCYSPGQGLMPASFK+R +PLD  N  FE+VLDPDFGESAIGRVAPV
Sbjct  208   LHTLQLQSWEKTVDCYSPGQGLMPASFKIRAVPLDDNNEAFEEVLDPDFGESAIGRVAPV  267

Query  1721  DSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMID  1542
             DSGLWWIILLRAY KITGD  LQERVDVQTGI+LIL+LCL DGFDMFPTLLVTDGSCMID
Sbjct  268   DSGLWWIILLRAYCKITGDNALQERVDVQTGIKLILSLCLSDGFDMFPTLLVTDGSCMID  327

Query  1541  RRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMK  1362
             RRMGIHGHPLEIQALFYSALRC+REML++ND +K+L+ AINNRLSALSFHIREYYWVDMK
Sbjct  328   RRMGIHGHPLEIQALFYSALRCSREMLVMNDGSKNLLRAINNRLSALSFHIREYYWVDMK  387

Query  1361  KINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLG  1182
             KINEIYRYKTEEYS DA NKFNIYP+QIP W+V+WIPE GGYL+GNLQPAHMDFRFF+LG
Sbjct  388   KINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEKGGYLIGNLQPAHMDFRFFSLG  447

Query  1181  NLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPW  1002
             NLWAI SSL T +Q + IL+ I+ KWDDLIA MPLKICYPA+E ++WRIITGSDPKNTPW
Sbjct  448   NLWAITSSLTTPKQAEGILSLIDEKWDDLIANMPLKICYPAMEDDEWRIITGSDPKNTPW  507

Query  1001  SYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQA  822
             SYHNGGSWPTLLWQFTLACIKMG+PELA +A+AVAEE+L  D+WPEYYDTR GRFIGKQ+
Sbjct  508   SYHNGGSWPTLLWQFTLACIKMGRPELARRAIAVAEEKLAADKWPEYYDTRSGRFIGKQS  567

Query  821   RLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQV  642
             R  QTWT+AG+LTSKMLL+NP++AS+L  +ED ELLE C C L    R +CSR   +S V
Sbjct  568   RSYQTWTIAGFLTSKMLLENPELASILTCDEDLELLEGCACCLS-KKRTRCSRRAAKSHV  626



>gb|AGG41122.1| putative neutral/alkaline invertase [Saccharum hybrid cultivar 
FN-41]
Length=629

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/512 (76%), Positives = 441/512 (86%), Gaps = 4/512 (1%)
 Frame = -3

Query  2174  DDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLP  1995
             +D+   + D    ++   AP RE +E E+EAW+LL+ AVV+YCG PVGTVAA DP     
Sbjct  122   EDAAAVQTD---EAVEPAAPLREETETEREAWRLLRRAVVSYCGEPVGTVAAEDPECTET  178

Query  1994  LNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV  1815
             LNYDQVFIRDF+PSALAFL+ GE EIV+NFLLHTLQLQSWEKTVDCYSPGQGLMPASFK+
Sbjct  179   LNYDQVFIRDFVPSALAFLMRGETEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKI  238

Query  1814  RTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQ  1635
             RT+PLD  N  FE+VLDPDFG +AIGRVAPVDSGLWWIILLRAY KITGD  L ERVDVQ
Sbjct  239   RTVPLDENNEGFEEVLDPDFGGAAIGRVAPVDSGLWWIILLRAYCKITGDNALLERVDVQ  298

Query  1634  TGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIV  1455
             TGI+LIL+LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML+V
Sbjct  299   TGIQLILSLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVV  358

Query  1454  NDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIP  1275
             N+ +K+L+ AIN RLSALSFHIREYYWVDMKKINEIYRYKTEEYS DA NKFNIYP+QIP
Sbjct  359   NNGSKNLIRAINTRLSALSFHIREYYWVDMKKINEIYRYKTEEYSHDATNKFNIYPEQIP  418

Query  1274  PWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDL  1095
              W+V+WIPE GGYL+GNLQPAHMDFRFF+LGNLWAI SSL T +Q + IL+ IE KWDDL
Sbjct  419   SWLVDWIPEKGGYLIGNLQPAHMDFRFFSLGNLWAIASSLTTPKQAEGILSLIEEKWDDL  478

Query  1094  IAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAM  915
             +A MPLKICYPA+E ++WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG+PELA 
Sbjct  479   VANMPLKICYPAMEDDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELAR  538

Query  914   KAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVW  735
             +A+AVAEERL  D+WPEYYDTR GRFIGKQ+R  QTWT+AG+LTSKMLL+NP++AS+L  
Sbjct  539   RAIAVAEERLSDDKWPEYYDTRSGRFIGKQSRSYQTWTIAGFLTSKMLLENPELASILTC  598

Query  734   NEDYELLENCVCGLKYNGRRKCSRFGVRSQVG  639
             +ED ELLE C C L    R +CSR   +S +G
Sbjct  599   DEDLELLEGCACCLS-TKRTRCSRRAAKSHIG  629



>ref|XP_004968681.1| PREDICTED: alkaline/neutral invertase CINV2-like [Setaria italica]
Length=625

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/482 (79%), Positives = 426/482 (88%), Gaps = 1/482 (0%)
 Frame = -3

Query  2084  AWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNF  1905
             AW+LL+ AVV+YCG PVGTVAA DP     LNYDQVFIRDF+PSALAFL+ GE EIV+NF
Sbjct  145   AWRLLRRAVVSYCGEPVGTVAAEDPECTETLNYDQVFIRDFVPSALAFLMRGETEIVRNF  204

Query  1904  LLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAP  1725
             LLHTLQLQSWEKTVDCYSPGQGLMPASFK+RT+PLD  N  FE+VLDPDFGE+AIGRVAP
Sbjct  205   LLHTLQLQSWEKTVDCYSPGQGLMPASFKIRTVPLDENNEGFEEVLDPDFGEAAIGRVAP  264

Query  1724  VDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMI  1545
             VDSGLWWIILLRAY KITGD  L ERVDVQTGI+LIL+LCL DGFDMFPTLLVTDGSCMI
Sbjct  265   VDSGLWWIILLRAYCKITGDNDLLERVDVQTGIQLILSLCLSDGFDMFPTLLVTDGSCMI  324

Query  1544  DRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDM  1365
             DRRMGIHGHPLEIQALFYSALRC+REML+VND +K+L+ A+NNRLSALSFHIREYYWVDM
Sbjct  325   DRRMGIHGHPLEIQALFYSALRCSREMLVVNDGSKNLIRAVNNRLSALSFHIREYYWVDM  384

Query  1364  KKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTL  1185
             KKINEIYRYKTEEYS DA NKFNIYP+QIP W+V+WIPE GGYL+GNLQPAHMDFRFF+L
Sbjct  385   KKINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEKGGYLIGNLQPAHMDFRFFSL  444

Query  1184  GNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTP  1005
             GNLWAI SSL T +Q + IL+ IE KWDDL+A MPLKICYPA+E ++WRIITGSDPKNTP
Sbjct  445   GNLWAIASSLTTPKQAEGILSLIEEKWDDLVANMPLKICYPAMEDDEWRIITGSDPKNTP  504

Query  1004  WSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQ  825
             WSYHNGGSWPTLLWQFTLACIKMG+PELA KA+AVAE+RL  D+WPEYYDTR GRFIGKQ
Sbjct  505   WSYHNGGSWPTLLWQFTLACIKMGRPELARKAIAVAEDRLSDDKWPEYYDTRSGRFIGKQ  564

Query  824   ARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQ  645
             +R  QTWT+AG+LTSKMLL+NP++AS+L  +ED ELLE C C L    R +CSR   +S 
Sbjct  565   SRSYQTWTIAGFLTSKMLLENPELASILTCDEDLELLEGCACCLS-KKRARCSRRVAKSH  623

Query  644   VG  639
              G
Sbjct  624   AG  625



>ref|XP_008674013.1| PREDICTED: alkaline/neutral invertase CINV1-like [Zea mays]
 tpg|DAA54480.1| TPA: hypothetical protein ZEAMMB73_144921 [Zea mays]
Length=627

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/483 (78%), Positives = 426/483 (88%), Gaps = 1/483 (0%)
 Frame = -3

Query  2084  AWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNF  1905
             AW+LL+ AVV+YCG PVGTVAA DP     LNYDQVFIRDF+PSALAFL+ GE EIV+NF
Sbjct  144   AWRLLRRAVVSYCGEPVGTVAAEDPECTEMLNYDQVFIRDFVPSALAFLMRGETEIVRNF  203

Query  1904  LLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAP  1725
             LLHTLQLQSWEKTVDCYSPGQGLMPASFK+RT+PLD  N  FE+VLDPDFGE+AIGRVAP
Sbjct  204   LLHTLQLQSWEKTVDCYSPGQGLMPASFKIRTVPLDENNEGFEEVLDPDFGEAAIGRVAP  263

Query  1724  VDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMI  1545
             VDSGLWWIILLRAY KITGD  L ERVDVQTGI+LIL+LCL DGFDMFPTLLVTDGSCMI
Sbjct  264   VDSGLWWIILLRAYCKITGDNALLERVDVQTGIQLILSLCLADGFDMFPTLLVTDGSCMI  323

Query  1544  DRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDM  1365
             DRRMGIHGHPLEIQALFYSALRC+REML+VN+ +K+L+ AINNRLSALSFHIREYYWVDM
Sbjct  324   DRRMGIHGHPLEIQALFYSALRCSREMLVVNNGSKNLIRAINNRLSALSFHIREYYWVDM  383

Query  1364  KKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTL  1185
             KKINEIYRYKTEEYS DA NKFNIYP+QIP W+V+WIPE GGYL+GNLQPAHMDFRFF+L
Sbjct  384   KKINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEKGGYLIGNLQPAHMDFRFFSL  443

Query  1184  GNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTP  1005
             GNLWAI SSL T +Q + IL+ IE KWDDL+A MPLKIC+PA+E ++WRIITGSDPKNTP
Sbjct  444   GNLWAIASSLTTPKQAEGILSLIEEKWDDLVANMPLKICFPAMEDDEWRIITGSDPKNTP  503

Query  1004  WSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQ  825
             WSYHNGGSWPTLLWQFTLACIKMG+PELA +A+AVAEERL  D+WPEYYDTR GRF+GKQ
Sbjct  504   WSYHNGGSWPTLLWQFTLACIKMGRPELARRAIAVAEERLSDDKWPEYYDTRSGRFVGKQ  563

Query  824   ARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQ  645
             +R  QTWT+AG+LTSKMLL+NP++AS+L  +ED ELL+ C C L    R +CSR   +  
Sbjct  564   SRSYQTWTIAGFLTSKMLLENPELASILTCDEDLELLQGCACCLS-KKRTRCSRRVAKPH  622

Query  644   VGV  636
              GV
Sbjct  623   AGV  625



>ref|XP_006605260.1| PREDICTED: alkaline/neutral invertase CINV2-like [Glycine max]
Length=660

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/678 (62%), Positives = 499/678 (74%), Gaps = 22/678 (3%)
 Frame = -3

Query  2657  MKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggryrhrHSVVTLTR  2478
             MKP  +IL  Y +S       RC+  +  ++S           +     +         R
Sbjct  1     MKPSPKILIGYKNSTL---LARCHHSLAMSMSNYSNPCS--INLDHNTMQCPFHTREFGR  55

Query  2477  VINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDM--RSHSTSTEAQVND  2304
             +++ N+  F    S+  Q R S      R+  R    + +V  +   R  S S   + + 
Sbjct  56    IMHGNQQVFGLPSSSFGQSR-SLSLSATRTAKRGASAIARVDFNFKARDFSGSVGTRASG  114

Query  2303  KSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNG--SSI  2130
              + +  Y++GGMNVKP+V+E  +           ++  R+E+ ++   N  +L G  ++ 
Sbjct  115   NNGEMAYVKGGMNVKPIVVESVDNV---------EEESRLEVGEEDE-NTENLGGVKNAD  164

Query  2129  SKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSA  1950
              +     E +EVEKEAW+LLQ A+V Y   PVGTVAAND   +  LNYDQVFIRDFIPSA
Sbjct  165   DEAENVEEETEVEKEAWRLLQEALVTYFDSPVGTVAANDSDSEQSLNYDQVFIRDFIPSA  224

Query  1949  LAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDV  1770
             LAFLL GE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV+T+ LD   G+ E+V
Sbjct  225   LAFLLKGEKEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVKTVELD--QGKTEEV  282

Query  1769  LDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGF  1590
             LDPDFGESAIGRVAPVDSGLWWI LLRAY KITGDY+LQER+DVQTG+R+I+NLCL DGF
Sbjct  283   LDPDFGESAIGRVAPVDSGLWWITLLRAYGKITGDYSLQERLDVQTGLRMIINLCLTDGF  342

Query  1589  DMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRL  1410
             DMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALR  REM+  ++ + +LV  INNRL
Sbjct  343   DMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRSAREMVTEDEKSNNLVGEINNRL  402

Query  1409  SALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLV  1230
             SAL FHIREYYW+DM+K+NEIYRYKTEEYS+DA NKFNIYPDQIP W+++WIPE GGYL+
Sbjct  403   SALLFHIREYYWLDMRKLNEIYRYKTEEYSLDATNKFNIYPDQIPKWLMDWIPEEGGYLL  462

Query  1229  GNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEG  1050
             GNLQPAHMDFRFF LGNLW+++SSLGT  QN +ILN IE KW DL+ +MPLKICYPALE 
Sbjct  463   GNLQPAHMDFRFFMLGNLWSVVSSLGTPRQNNAILNLIETKWGDLVGEMPLKICYPALEH  522

Query  1049  EDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQW  870
              +WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLAC+KM + ELA KAVA+AE+RLP D W
Sbjct  523   HEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACMKMERTELAEKAVALAEKRLPCDSW  582

Query  869   PEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLK  690
             PEYYDTR  RF+GKQARL QTWT+AGYL SKM LKNP + SLL W+ED E+LE CVC L 
Sbjct  583   PEYYDTRSARFVGKQARLYQTWTLAGYLASKMFLKNPKLVSLLSWDEDLEILETCVCLLH  642

Query  689   YNGRRKCSRFGVRSQVGV  636
              +GR KCSR   +SQ+ V
Sbjct  643   KSGRIKCSRHAAKSQILV  660



>gb|KHN43356.1| hypothetical protein glysoja_001939 [Glycine soja]
Length=660

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/678 (61%), Positives = 498/678 (73%), Gaps = 22/678 (3%)
 Frame = -3

Query  2657  MKPCSRILGSYNHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggryrhrHSVVTLTR  2478
             MKP  +IL  Y +S       RC+  +  ++S           +     +         R
Sbjct  1     MKPSPKILIGYKNSSL---LARCHHSLAMSMSNYSNPCS--INLDHNTMQCPFHTREFGR  55

Query  2477  VINSNRCAFCGSGSNGDQHRDSFCNWLGRSKNRLVFVVPKVASDM--RSHSTSTEAQVND  2304
             +++ N+  F    S+  Q R S      R+  R    + +V  +   R  S S   + + 
Sbjct  56    IMHGNQQVFGLPSSSFGQSR-SLSLSATRTAKRGASAIARVDFNFKARDFSGSVGTRASG  114

Query  2303  KSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNG--SSI  2130
              + +  Y++GGMNVKP+V+E  +           ++  R+E+ ++   N  +L G  ++ 
Sbjct  115   NNGEMAYVKGGMNVKPIVVESVDNV---------EEESRLEVGEEDE-NTENLGGVKNAD  164

Query  2129  SKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSA  1950
              +     E +EVEKEAW+LLQ A+V Y   PVGTVAAND   +  LNYDQVFIRDFIPSA
Sbjct  165   DEAENVEEETEVEKEAWRLLQEALVTYFDSPVGTVAANDSDSEQSLNYDQVFIRDFIPSA  224

Query  1949  LAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDV  1770
             LAFLL GE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV+T+  D   G+ E+V
Sbjct  225   LAFLLKGEKEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVKTVEFD--QGKTEEV  282

Query  1769  LDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGF  1590
             LDPDFGESAIGRVAPVDSGLWWI LLRAY KITGDY+LQER+DVQTG+R+I+NLCL DGF
Sbjct  283   LDPDFGESAIGRVAPVDSGLWWITLLRAYGKITGDYSLQERLDVQTGLRMIINLCLTDGF  342

Query  1589  DMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRL  1410
             DMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALR  REM+  ++ + +LV  INNRL
Sbjct  343   DMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRSAREMVTEDEKSNNLVGEINNRL  402

Query  1409  SALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLV  1230
             SAL FHIREYYW+DM+K+NEIYRYKTEEYS+DA NKFNIYPDQIP W+++WIPE GGYL+
Sbjct  403   SALLFHIREYYWLDMRKLNEIYRYKTEEYSLDATNKFNIYPDQIPKWLMDWIPEEGGYLL  462

Query  1229  GNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEG  1050
             GNLQPAHMDFRFF LGNLW+++SSLGT  QN +ILN IE KW DL+ +MPLKICYPALE 
Sbjct  463   GNLQPAHMDFRFFMLGNLWSVVSSLGTPRQNNAILNLIETKWGDLVGEMPLKICYPALEH  522

Query  1049  EDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQW  870
              +WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLAC+KM + ELA KAVA+AE+RLP D W
Sbjct  523   HEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACMKMERTELAEKAVALAEKRLPCDSW  582

Query  869   PEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLK  690
             PEYYDTR  RF+GKQARL QTWT+AGYL SKM LKNP + SLL W+ED E+LE CVC L 
Sbjct  583   PEYYDTRSARFVGKQARLYQTWTLAGYLASKMFLKNPKLVSLLSWDEDLEILETCVCLLH  642

Query  689   YNGRRKCSRFGVRSQVGV  636
              +GR KCSR   +SQ+ V
Sbjct  643   KSGRIKCSRHAAKSQILV  660



>ref|XP_004494531.1| PREDICTED: uncharacterized protein LOC101506288 [Cicer arietinum]
Length=657

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/484 (78%), Positives = 426/484 (88%), Gaps = 2/484 (0%)
 Frame = -3

Query  2084  AWKLLQGAVVNYCGYPVGTVAANDPADK-LPLNYDQVFIRDFIPSALAFLLNGEGEIVKN  1908
             AWKLLQ A+V YC  PVGTVAAND +DK  PLNYDQVFIRDFIPSALAFLL GE EIVKN
Sbjct  175   AWKLLQKALVTYCDTPVGTVAANDDSDKDSPLNYDQVFIRDFIPSALAFLLKGEKEIVKN  234

Query  1907  FLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVA  1728
             FLLHTLQLQSWEKTVDCYSPGQGLMPASFKV+T  +D  N   E VLDPDFGESAIGRVA
Sbjct  235   FLLHTLQLQSWEKTVDCYSPGQGLMPASFKVKTTEVDDNNKSGE-VLDPDFGESAIGRVA  293

Query  1727  PVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCM  1548
             PVDSGLWWIILLRAY K+TGDY+LQE+++VQTG+++ILNLCL DGFDMFP+LLVTDGSCM
Sbjct  294   PVDSGLWWIILLRAYGKLTGDYSLQEKLEVQTGLQMILNLCLSDGFDMFPSLLVTDGSCM  353

Query  1547  IDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVD  1368
             IDRRMGIHGHPLEIQALFYSALR  REM+++N+ + +L+  INNRLSALSFHIREYYW+D
Sbjct  354   IDRRMGIHGHPLEIQALFYSALRSAREMVVINEESNNLIGEINNRLSALSFHIREYYWLD  413

Query  1367  MKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFT  1188
             M+K+NEIYRYKTEEYS DA NKFNIYP+QIP W+++WIPE GGYL+GNLQPAHMDFRFF 
Sbjct  414   MRKVNEIYRYKTEEYSFDATNKFNIYPEQIPMWLMDWIPEEGGYLIGNLQPAHMDFRFFM  473

Query  1187  LGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNT  1008
             LGNLW+I+SSLGT +QNKSILN I+ KW DL+  MPLKICYPALE E+WR+ITGSDPKNT
Sbjct  474   LGNLWSIVSSLGTPKQNKSILNLIDSKWGDLVGCMPLKICYPALEHEEWRLITGSDPKNT  533

Query  1007  PWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGK  828
             PWSYHNGGSWPTLLWQFTLACIKM + +LA KAVA+AE+RLP D WPEYYDT+ GRFIGK
Sbjct  534   PWSYHNGGSWPTLLWQFTLACIKMERNDLAEKAVALAEKRLPFDSWPEYYDTKTGRFIGK  593

Query  827   QARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRS  648
             QARL QTWT+AG+L SKMLLKNP+ ASLL W+ED E+LE CVC L  +GR KCSR   +S
Sbjct  594   QARLFQTWTLAGFLASKMLLKNPETASLLCWDEDLEILETCVCALNKSGRTKCSRNVAKS  653

Query  647   QVGV  636
              + V
Sbjct  654   HILV  657



>gb|AAO25633.1| invertase [Oryza sativa Indica Group]
Length=627

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/480 (79%), Positives = 422/480 (88%), Gaps = 1/480 (0%)
 Frame = -3

Query  2081  WKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFL  1902
             W+LL+ AVV+YC  PVGTVAA DP     LNYDQVFIRDF+PSALAFL+ GE E V+NFL
Sbjct  147   WRLLRRAVVSYCVEPVGTVAAEDPECTETLNYDQVFIRDFVPSALAFLMRGETETVRNFL  206

Query  1901  LHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPV  1722
             LHTLQLQSWEKTVDCYSPGQ LMPASFK+R +PLD  N  FE+VLDPDFGESAIGRVAPV
Sbjct  207   LHTLQLQSWEKTVDCYSPGQDLMPASFKIRAVPLDDNNEAFEEVLDPDFGESAIGRVAPV  266

Query  1721  DSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMID  1542
             DSGLWWIILLRAY KITGD  LQERVDVQTGI+LIL+LCL DGFDMFPTLLVTDGSCMID
Sbjct  267   DSGLWWIILLRAYCKITGDNALQERVDVQTGIKLILSLCLSDGFDMFPTLLVTDGSCMID  326

Query  1541  RRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMK  1362
             RRMGIHGHPLEIQALFYSALRC+REML++ND +K+L+ AINNRLSALSFHIRE+YWVDMK
Sbjct  327   RRMGIHGHPLEIQALFYSALRCSREMLVMNDGSKNLLRAINNRLSALSFHIREHYWVDMK  386

Query  1361  KINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLG  1182
             KINEIYRYKTEEYS DA NKFNIYP+QIP W+V+WIPE GGYL+GNLQPAHMDFRFF+LG
Sbjct  387   KINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEKGGYLIGNLQPAHMDFRFFSLG  446

Query  1181  NLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPW  1002
             NLWAI SSL T +Q + IL+ I+ KWDDLIA MPLKICYPA+E ++WRIITGSDPKNTPW
Sbjct  447   NLWAITSSLTTPKQAEGILSLIDEKWDDLIANMPLKICYPAMEDDEWRIITGSDPKNTPW  506

Query  1001  SYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQA  822
             SYHNGGSWPTLLWQFTLACIKMG+PELA +A+AVAEE+L  D+WPEYYDTR GRFIGKQ+
Sbjct  507   SYHNGGSWPTLLWQFTLACIKMGRPELARRAIAVAEEKLAADKWPEYYDTRSGRFIGKQS  566

Query  821   RLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQV  642
             R  QTWT+AG+LTSKMLL+NP++AS+L  NED ELLE C C L    R +CSR   +S V
Sbjct  567   RSYQTWTIAGFLTSKMLLENPELASILTCNEDLELLEGCACCLS-KKRTRCSRRAAKSHV  625



>ref|XP_007035891.1| Neutral invertase isoform 3 [Theobroma cacao]
 gb|EOY06817.1| Neutral invertase isoform 3 [Theobroma cacao]
Length=557

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/565 (72%), Positives = 464/565 (82%), Gaps = 12/565 (2%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSY-NHSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggr  2514
             M S +CIGIS+MKPC RIL SY + SIF     + NR  + NLSKS  K  D  R     
Sbjct  1     MKSSTCIGISSMKPCCRILISYKSSSIFGLSPPKMNRSGIHNLSKSLSKAVD-RRRFHCY  59

Query  2513  yrhrHSVVTLTRVINSNRCAFCGSGSNGDQHRD---SFCNWLGRSKNRLVFVVPKVASDM  2343
                +  +V     ++SNR AF  S S+  Q R    SFC   GRS  R V V+PKVASD 
Sbjct  60    KHSKSQIVGYNCAVDSNRRAFSVSDSSWGQSRGFTGSFCVNKGRS--RGVLVIPKVASDF  117

Query  2342  RSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDST  2163
             R+HSTS E  VN+K+F++ YIQGG+NVKPLVIER ET   +V    ++D   +++ ++S 
Sbjct  118   RNHSTSVEPHVNEKNFERIYIQGGLNVKPLVIERIETGNGLV----KEDNTGIDV-NESG  172

Query  2162  VNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
             VN +++ G ++++   EREVSE+EKEAWK+L+GAVVNYCG+PVGTVAANDPADK PLNYD
Sbjct  173   VNIDNVKGLNLTETEIEREVSEIEKEAWKILRGAVVNYCGHPVGTVAANDPADKQPLNYD  232

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             Q+FIRDF+PSALAFLLNGE EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRT P
Sbjct  233   QIFIRDFVPSALAFLLNGEPEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTAP  292

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LDG +  FE+VLD DFGESAIGRVAPVDSGLWWIILLRAY KITGDYTLQERVDVQTGI 
Sbjct  293   LDGSSEAFEEVLDADFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERVDVQTGIS  352

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             LILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC+REML VND+T
Sbjct  353   LILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVNDAT  412

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
             K+LVAAIN+RLSALSFHIREYYWVDMKKINEIYRYKTEEYS DAINKFNIYPDQIP W+V
Sbjct  413   KNLVAAINSRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPSWLV  472

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
             +WIP+ GGY +GNLQPAHMDFRFFTLGNLWAI+SSLGT +QN+ +LN IE KWDD +A M
Sbjct  473   DWIPDEGGYFIGNLQPAHMDFRFFTLGNLWAIVSSLGTSKQNEDVLNLIEAKWDDFVANM  532

Query  1082  PLKICYPALEGEDWRIITGSDPKNT  1008
             PLKI YPALE ++WRIITGSDPKNT
Sbjct  533   PLKIIYPALESDEWRIITGSDPKNT  557



>gb|KFK37997.1| hypothetical protein AALP_AA3G056600 [Arabis alpina]
Length=578

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/466 (79%), Positives = 410/466 (88%), Gaps = 4/466 (1%)
 Frame = -3

Query  2033  GTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCY  1854
             GT+AANDP D  PLNYDQVFIRDFIPS LAFLL GE EIV+NFLLHTLQLQSWEKTVDCY
Sbjct  113   GTMAANDPTDTAPLNYDQVFIRDFIPSGLAFLLKGETEIVRNFLLHTLQLQSWEKTVDCY  172

Query  1853  SPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKI  1674
             SPGQGLMPASFKVRT+PL+    +FE+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KI
Sbjct  173   SPGQGLMPASFKVRTLPLE--EDKFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKI  230

Query  1673  TGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALF  1494
             TGDY+LQER+DVQTGI++I NLCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALF
Sbjct  231   TGDYSLQERIDVQTGIKMIANLCLSDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALF  290

Query  1493  YSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMD  1314
             YSALR +REML VNDS+K+++  INNRLSALSFHIRE YWVD  KINEIYRYKTEEYSMD
Sbjct  291   YSALRSSREMLAVNDSSKNIIKTINNRLSALSFHIRENYWVDKSKINEIYRYKTEEYSMD  350

Query  1313  AINKFNIYPDQIPPWIVNWIPE--TGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQ  1140
             A NKFNIYP+Q+ PW+++WIPE    G+LVGNL P HMDFRFFTLGNLW+IISSLGT  Q
Sbjct  351   ATNKFNIYPEQVSPWLMDWIPEGPQSGFLVGNLTPGHMDFRFFTLGNLWSIISSLGTPRQ  410

Query  1139  NKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQ  960
             N++ILN IE +WDDLI  MPLKICYPALE  +W IITGSDPKNTPWSYHNGGSWPTLLWQ
Sbjct  411   NQAILNLIEERWDDLIGHMPLKICYPALESAEWHIITGSDPKNTPWSYHNGGSWPTLLWQ  470

Query  959   FTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTS  780
             FTLACIKMGKPELA KAV +AEERL  D+WPEYYDTR G+FIGK++RL QTWT+AG+LTS
Sbjct  471   FTLACIKMGKPELAEKAVTLAEERLQADRWPEYYDTRDGKFIGKKSRLYQTWTIAGFLTS  530

Query  779   KMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQV  642
             K LL+N ++AS L W ED+ELLE CVC L  +GR KCSR   +SQ+
Sbjct  531   KQLLQNHELASSLFWEEDFELLETCVCALTKSGRTKCSRAAAKSQI  576



>emb|CBI17063.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/502 (70%), Positives = 420/502 (84%), Gaps = 0/502 (0%)
 Frame = -3

Query  2141  GSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDF  1962
             G +I+    +  +  +E EAW LL+ ++V YCGYP+GT+AANDP++   LNYDQVFIRDF
Sbjct  40    GGTINDTLGKASIDSIEDEAWNLLRESIVFYCGYPIGTIAANDPSNSSSLNYDQVFIRDF  99

Query  1961  IPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGE  1782
             IPS +AFLL GE +IV++F+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLDG +  
Sbjct  100   IPSGIAFLLKGEYDIVRSFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSA  159

Query  1781  FEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCL  1602
              EDVLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD ++QER DVQTGI++IL LCL
Sbjct  160   TEDVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERFDVQTGIKMILKLCL  219

Query  1601  RDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAI  1422
              DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C REML   D + +L+ A+
Sbjct  220   ADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSSALIRAL  279

Query  1421  NNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETG  1242
             NNR+ ALSFHIREYYW+DM+K+NEIYRYKTEEYS DA+NKFNIYPDQIPPW+V W+P  G
Sbjct  280   NNRVVALSFHIREYYWIDMRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWMPSKG  339

Query  1241  GYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYP  1062
             GYL+GNLQPAHMDFRFF+LGNLW+I+SSL T +Q+ ++L+ IE KW +L+A MP KICYP
Sbjct  340   GYLIGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAMLDLIEAKWSELVADMPFKICYP  399

Query  1061  ALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLP  882
             A EG++WRI TGSDPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PE+A KAV +AE+R+ 
Sbjct  400   AFEGQEWRITTGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPEIAEKAVKIAEKRIS  459

Query  881   VDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCV  702
              D+WPEYYDT+ GRFIGKQARL QTW++AGYL SK+LL NPD A++LV  ED +L+    
Sbjct  460   RDKWPEYYDTKQGRFIGKQARLFQTWSIAGYLVSKLLLANPDAANILVNREDSDLVSAFS  519

Query  701   CGLKYNGRRKCSRFGVRSQVGV  636
               L  N RRK    G++ +  V
Sbjct  520   SMLSANPRRKRDWKGLKQKFIV  541



>ref|XP_009606001.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009606003.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009606004.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009606005.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X3 [Nicotiana 
tomentosiformis]
Length=642

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/498 (72%), Positives = 413/498 (83%), Gaps = 0/498 (0%)
 Frame = -3

Query  2144  NGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRD  1965
               ++++   P      +E EAW  L+ A+V YCG PVGT+AANDP++   LNYDQVFIRD
Sbjct  140   TAATVNSAFPRTNTDSIEDEAWHFLRAAMVYYCGTPVGTIAANDPSEATMLNYDQVFIRD  199

Query  1964  FIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNG  1785
             FIPS +AFLL GE +IV+NF+LHTLQLQSWEKT+DCYSPGQGLMPASFKVRT+PLD    
Sbjct  200   FIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLDNDES  259

Query  1784  EFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLC  1605
               EDVLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD +LQERVDVQTG+++IL LC
Sbjct  260   ATEDVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERVDVQTGMKMILKLC  319

Query  1604  LRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAA  1425
             L DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQAL+YSAL C REML   + +  LV A
Sbjct  320   LADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALYYSALLCAREMLAPEEVSTDLVRA  379

Query  1424  INNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPET  1245
             +NNRL ALSFHIREYYW+D+KK+NEIYRYKTEEYS DAINKFNIYPDQIPPW+V W+P  
Sbjct  380   LNNRLLALSFHIREYYWIDVKKLNEIYRYKTEEYSYDAINKFNIYPDQIPPWLVEWMPSK  439

Query  1244  GGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICY  1065
             GGYL+GNLQPAHMDFRFF LGNLW+I+SSL T +Q+ +IL+ IE KW+DL+A MPLKICY
Sbjct  440   GGYLIGNLQPAHMDFRFFALGNLWSIVSSLATIDQSHAILDLIEAKWEDLVADMPLKICY  499

Query  1064  PALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERL  885
             PALEG++WRIITG DPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PE++ KA+ +AE RL
Sbjct  500   PALEGQEWRIITGGDPKNTPWSYHNGGSWPTLLWQLTVACIKMKRPEISEKAIMIAERRL  559

Query  884   PVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENC  705
               D+WPEYYDTR G FIGKQARL QTWT+AGYL +K L+ NP+ A +L+  ED ELL   
Sbjct  560   ARDRWPEYYDTRRGGFIGKQARLFQTWTIAGYLVAKQLIANPEAAKILINVEDTELLSAF  619

Query  704   VCGLKYNGRRKCSRFGVR  651
                L  N RRK SR GV+
Sbjct  620   SSILSSNPRRKRSRKGVK  637



>ref|XP_009606000.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=668

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/498 (72%), Positives = 413/498 (83%), Gaps = 0/498 (0%)
 Frame = -3

Query  2144  NGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRD  1965
               ++++   P      +E EAW  L+ A+V YCG PVGT+AANDP++   LNYDQVFIRD
Sbjct  166   TAATVNSAFPRTNTDSIEDEAWHFLRAAMVYYCGTPVGTIAANDPSEATMLNYDQVFIRD  225

Query  1964  FIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNG  1785
             FIPS +AFLL GE +IV+NF+LHTLQLQSWEKT+DCYSPGQGLMPASFKVRT+PLD    
Sbjct  226   FIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLDNDES  285

Query  1784  EFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLC  1605
               EDVLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD +LQERVDVQTG+++IL LC
Sbjct  286   ATEDVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERVDVQTGMKMILKLC  345

Query  1604  LRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAA  1425
             L DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQAL+YSAL C REML   + +  LV A
Sbjct  346   LADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALYYSALLCAREMLAPEEVSTDLVRA  405

Query  1424  INNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPET  1245
             +NNRL ALSFHIREYYW+D+KK+NEIYRYKTEEYS DAINKFNIYPDQIPPW+V W+P  
Sbjct  406   LNNRLLALSFHIREYYWIDVKKLNEIYRYKTEEYSYDAINKFNIYPDQIPPWLVEWMPSK  465

Query  1244  GGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICY  1065
             GGYL+GNLQPAHMDFRFF LGNLW+I+SSL T +Q+ +IL+ IE KW+DL+A MPLKICY
Sbjct  466   GGYLIGNLQPAHMDFRFFALGNLWSIVSSLATIDQSHAILDLIEAKWEDLVADMPLKICY  525

Query  1064  PALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERL  885
             PALEG++WRIITG DPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PE++ KA+ +AE RL
Sbjct  526   PALEGQEWRIITGGDPKNTPWSYHNGGSWPTLLWQLTVACIKMKRPEISEKAIMIAERRL  585

Query  884   PVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENC  705
               D+WPEYYDTR G FIGKQARL QTWT+AGYL +K L+ NP+ A +L+  ED ELL   
Sbjct  586   ARDRWPEYYDTRRGGFIGKQARLFQTWTIAGYLVAKQLIANPEAAKILINVEDTELLSAF  645

Query  704   VCGLKYNGRRKCSRFGVR  651
                L  N RRK SR GV+
Sbjct  646   SSILSSNPRRKRSRKGVK  663



>ref|XP_009605998.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009605999.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=683

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/498 (72%), Positives = 413/498 (83%), Gaps = 0/498 (0%)
 Frame = -3

Query  2144  NGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRD  1965
               ++++   P      +E EAW  L+ A+V YCG PVGT+AANDP++   LNYDQVFIRD
Sbjct  181   TAATVNSAFPRTNTDSIEDEAWHFLRAAMVYYCGTPVGTIAANDPSEATMLNYDQVFIRD  240

Query  1964  FIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNG  1785
             FIPS +AFLL GE +IV+NF+LHTLQLQSWEKT+DCYSPGQGLMPASFKVRT+PLD    
Sbjct  241   FIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLDNDES  300

Query  1784  EFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLC  1605
               EDVLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD +LQERVDVQTG+++IL LC
Sbjct  301   ATEDVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERVDVQTGMKMILKLC  360

Query  1604  LRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAA  1425
             L DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQAL+YSAL C REML   + +  LV A
Sbjct  361   LADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALYYSALLCAREMLAPEEVSTDLVRA  420

Query  1424  INNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPET  1245
             +NNRL ALSFHIREYYW+D+KK+NEIYRYKTEEYS DAINKFNIYPDQIPPW+V W+P  
Sbjct  421   LNNRLLALSFHIREYYWIDVKKLNEIYRYKTEEYSYDAINKFNIYPDQIPPWLVEWMPSK  480

Query  1244  GGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICY  1065
             GGYL+GNLQPAHMDFRFF LGNLW+I+SSL T +Q+ +IL+ IE KW+DL+A MPLKICY
Sbjct  481   GGYLIGNLQPAHMDFRFFALGNLWSIVSSLATIDQSHAILDLIEAKWEDLVADMPLKICY  540

Query  1064  PALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERL  885
             PALEG++WRIITG DPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PE++ KA+ +AE RL
Sbjct  541   PALEGQEWRIITGGDPKNTPWSYHNGGSWPTLLWQLTVACIKMKRPEISEKAIMIAERRL  600

Query  884   PVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENC  705
               D+WPEYYDTR G FIGKQARL QTWT+AGYL +K L+ NP+ A +L+  ED ELL   
Sbjct  601   ARDRWPEYYDTRRGGFIGKQARLFQTWTIAGYLVAKQLIANPEAAKILINVEDTELLSAF  660

Query  704   VCGLKYNGRRKCSRFGVR  651
                L  N RRK SR GV+
Sbjct  661   SSILSSNPRRKRSRKGVK  678



>ref|XP_003632264.1| PREDICTED: alkaline/neutral invertase CINV1-like [Vitis vinifera]
 ref|XP_010651714.1| PREDICTED: alkaline/neutral invertase CINV1-like [Vitis vinifera]
Length=639

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/490 (71%), Positives = 415/490 (85%), Gaps = 0/490 (0%)
 Frame = -3

Query  2141  GSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDF  1962
             G +I+    +  +  +E EAW LL+ ++V YCGYP+GT+AANDP++   LNYDQVFIRDF
Sbjct  138   GGTINDTLGKASIDSIEDEAWNLLRESIVFYCGYPIGTIAANDPSNSSSLNYDQVFIRDF  197

Query  1961  IPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGE  1782
             IPS +AFLL GE +IV++F+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLDG +  
Sbjct  198   IPSGIAFLLKGEYDIVRSFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSA  257

Query  1781  FEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCL  1602
              EDVLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD ++QER DVQTGI++IL LCL
Sbjct  258   TEDVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERFDVQTGIKMILKLCL  317

Query  1601  RDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAI  1422
              DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C REML   D + +L+ A+
Sbjct  318   ADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSSALIRAL  377

Query  1421  NNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETG  1242
             NNR+ ALSFHIREYYW+DM+K+NEIYRYKTEEYS DA+NKFNIYPDQIPPW+V W+P  G
Sbjct  378   NNRVVALSFHIREYYWIDMRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWMPSKG  437

Query  1241  GYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYP  1062
             GYL+GNLQPAHMDFRFF+LGNLW+I+SSL T +Q+ ++L+ IE KW +L+A MP KICYP
Sbjct  438   GYLIGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAMLDLIEAKWSELVADMPFKICYP  497

Query  1061  ALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLP  882
             A EG++WRI TGSDPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PE+A KAV +AE+R+ 
Sbjct  498   AFEGQEWRITTGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPEIAEKAVKIAEKRIS  557

Query  881   VDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCV  702
              D+WPEYYDT+ GRFIGKQARL QTW++AGYL SK+LL NPD A++LV  ED +L+    
Sbjct  558   RDKWPEYYDTKQGRFIGKQARLFQTWSIAGYLVSKLLLANPDAANILVNREDSDLVSAFS  617

Query  701   CGLKYNGRRK  672
               L  N RRK
Sbjct  618   SMLSANPRRK  627



>ref|XP_006349102.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X6 [Solanum 
tuberosum]
Length=534

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/489 (72%), Positives = 410/489 (84%), Gaps = 0/489 (0%)
 Frame = -3

Query  2117  PEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFL  1938
             P      +E EAW  L+ A+V YCG PVGT+AANDP++   LNYDQVFIRDFIPS +AFL
Sbjct  41    PRTNTESIEDEAWHFLRAAMVYYCGSPVGTIAANDPSEATMLNYDQVFIRDFIPSGIAFL  100

Query  1937  LNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPD  1758
             L GE +IV+NF+LHTLQLQSWEKT+DCYSPGQGLMPASFKVRT+PLD      EDVLDPD
Sbjct  101   LKGEYDIVRNFILHTLQLQSWEKTMDCYSPGQGLMPASFKVRTIPLDNDESATEDVLDPD  160

Query  1757  FGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFP  1578
             FGE+AIGRVAPVDSGLWWIILLRAY K +GD +LQERVDVQTG+++IL LCL DGFDMFP
Sbjct  161   FGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERVDVQTGMKMILRLCLADGFDMFP  220

Query  1577  TLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALS  1398
             TLLVTDGSCMIDRRMGIHGHPLEIQAL+YSAL   REML   +++  LV A+NNRL ALS
Sbjct  221   TLLVTDGSCMIDRRMGIHGHPLEIQALYYSALLGAREMLAPEEASTDLVRALNNRLLALS  280

Query  1397  FHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQ  1218
             FHIREYYW+D+KK+NEIYRYKTEEYS DAINKFNIYPDQIPPW+V W+P  GGYL+GNLQ
Sbjct  281   FHIREYYWIDVKKLNEIYRYKTEEYSYDAINKFNIYPDQIPPWLVEWMPSEGGYLIGNLQ  340

Query  1217  PAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWR  1038
             PAHMDFRFF+LGN+W+I+SSL   +Q+ +IL+ IE KW+DL+A MPLKICYPALEG++WR
Sbjct  341   PAHMDFRFFSLGNVWSIVSSLANIDQSHAILDLIEAKWEDLVADMPLKICYPALEGQEWR  400

Query  1037  IITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYY  858
             IITG DPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PE+A KA+ +AE RL  D+WPEYY
Sbjct  401   IITGGDPKNTPWSYHNGGSWPTLLWQLTVACIKMKRPEIAEKAIKIAERRLSRDRWPEYY  460

Query  857   DTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGR  678
             DTR G FIGKQARL QTWT+AGYL +K+L+ NP+ A +++  ED ELL      L  N R
Sbjct  461   DTRRGGFIGKQARLFQTWTIAGYLVAKLLIANPEAAKMVINVEDTELLSAFSSILSSNPR  520

Query  677   RKCSRFGVR  651
             RK SR GV+
Sbjct  521   RKRSRKGVK  529



>emb|CAL64380.1| putative neutral invertase [Prunus persica]
Length=418

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/418 (84%), Positives = 383/418 (92%), Gaps = 0/418 (0%)
 Frame = -3

Query  1889  QLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGL  1710
             QLQSWEKTVDC+SPGQGLMPASFKV+T+PLDG NGEFE+VLDPDFGESAIGRVAPVDSGL
Sbjct  1     QLQSWEKTVDCHSPGQGLMPASFKVKTVPLDGMNGEFEEVLDPDFGESAIGRVAPVDSGL  60

Query  1709  WWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMG  1530
             WWIILLRAY KITGDY LQERVD QTGIRL+LNLCL++GFDMFPTLLVTDGSCMIDRRMG
Sbjct  61    WWIILLRAYGKITGDYALQERVDFQTGIRLVLNLCLKNGFDMFPTLLVTDGSCMIDRRMG  120

Query  1529  IHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINE  1350
             IHGHPLEIQALFYSALRC+REMLIVND TK LVAAINNRLSALSFH+REYYWVDMKKINE
Sbjct  121   IHGHPLEIQALFYSALRCSREMLIVNDGTKDLVAAINNRLSALSFHMREYYWVDMKKINE  180

Query  1349  IYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWA  1170
             IYRYKTEEYS DA+NKFNIYPDQIP W+V+WIPE GG+L+GNLQPAHMDFRFFTLGNLW+
Sbjct  181   IYRYKTEEYSTDAVNKFNIYPDQIPSWLVDWIPEEGGFLIGNLQPAHMDFRFFTLGNLWS  240

Query  1169  IISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHN  990
             I+SSLGTH+QN+ ILN IE KWDD +AQMPLKICYPALE E+WRIITG DPKNTPWSYHN
Sbjct  241   IVSSLGTHKQNEDILNLIEAKWDDFVAQMPLKICYPALEYEEWRIITGGDPKNTPWSYHN  300

Query  989   GGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQ  810
             GGSWPTLLWQFTLACIKMG+ ELA KAV +AE+RL  DQWPEYYDT+ GRFIGKQ+RL Q
Sbjct  301   GGSWPTLLWQFTLACIKMGRTELAQKAVDLAEKRLSADQWPEYYDTKSGRFIGKQSRLFQ  360

Query  809   TWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQVGV  636
             TWT+AGYLTSKMLL+NP+ ASLL+W EDYELLE CVC L   G +KCSR   + Q+ V
Sbjct  361   TWTIAGYLTSKMLLENPEKASLLLWEEDYELLETCVCALTKTGXKKCSRLAAKXQIVV  418



>ref|NP_001047012.1| Os02g0529400 [Oryza sativa Japonica Group]
 sp|Q6H6N5.1|NIN3_ORYSJ RecName: Full=Neutral/alkaline invertase 3, chloroplastic; Short=OsNIN3; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD25431.1| putative alkaline/neutral invertase [Oryza sativa Japonica Group]
 dbj|BAD25614.1| putative alkaline/neutral invertase [Oryza sativa Japonica Group]
 dbj|BAF08926.1| Os02g0529400 [Oryza sativa Japonica Group]
 gb|EAZ23290.1| hypothetical protein OsJ_06987 [Oryza sativa Japonica Group]
 dbj|BAH00419.1| unnamed protein product [Oryza sativa Japonica Group]
Length=606

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/506 (70%), Positives = 416/506 (82%), Gaps = 1/506 (0%)
 Frame = -3

Query  2192  GRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAAND  2013
             G V +   +      +NGS+       R+ S VE EAW+LL+ +VV YCG PVGT+AAND
Sbjct  94    GDVRVPGQAVGGNGSVNGSAAKPPPQRRKASSVEDEAWELLRESVVYYCGSPVGTIAAND  153

Query  2012  PADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLM  1833
             P D  P+NYDQVFIRDFIPS +AFLL GE EIV+NF+LHTLQLQSWEKT+DC+SPGQGLM
Sbjct  154   PNDANPMNYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLM  213

Query  1832  PASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQ  1653
             PASFKVRT+PLDG     E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD T+Q
Sbjct  214   PASFKVRTIPLDGDEDATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLTVQ  273

Query  1652  ERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCT  1473
             ER+DVQTGI++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C 
Sbjct  274   ERIDVQTGIKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCA  333

Query  1472  REMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNI  1293
             REML   D +  L+ A+NNRL ALSFHIREYYWVDM+K+NEIYRYKTEEYS DA+NKFNI
Sbjct  334   REMLTPEDGSADLIRALNNRLIALSFHIREYYWVDMQKLNEIYRYKTEEYSYDAVNKFNI  393

Query  1292  YPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIE  1113
             YPDQ+ PW+V WIP  GGY +GNLQPAHMDFRFF+LGNLW+I+SSL T  Q+ +IL+ IE
Sbjct  394   YPDQVSPWLVEWIPPKGGYFIGNLQPAHMDFRFFSLGNLWSIVSSLATTHQSHAILDLIE  453

Query  1112  GKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG  933
              KW DL+A+MPLKICYPALE ++W+IITGSDPKNTPWSYHNGGSWPTLLWQ T+A IKM 
Sbjct  454   SKWSDLVAEMPLKICYPALENQEWKIITGSDPKNTPWSYHNGGSWPTLLWQLTVASIKMN  513

Query  932   KPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDM  753
             +PE+A KAV VAE R+ +D+WPEYYDT+  RFIGKQ+RL QTW++AGYL +K LL  PD 
Sbjct  514   RPEIAAKAVEVAERRIAIDKWPEYYDTKRARFIGKQSRLYQTWSIAGYLVAKQLLDKPDA  573

Query  752   ASLLVWNEDYELLENCVCGLKYNGRR  675
             A +L  +ED E+L N +   +  G++
Sbjct  574   ARILSNDEDSEIL-NALSTNRKRGKK  598



>ref|XP_008661659.1| PREDICTED: uncharacterized protein LOC100274465 isoform X1 [Zea 
mays]
 gb|ACF84899.1| unknown [Zea mays]
 gb|ACG27641.1| alkaline/neutral invertase [Zea mays]
 gb|AFW55780.1| alkaline/neutral invertase isoform 1 [Zea mays]
 gb|AFW55781.1| alkaline/neutral invertase isoform 2 [Zea mays]
Length=601

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/493 (71%), Positives = 412/493 (84%), Gaps = 0/493 (0%)
 Frame = -3

Query  2192  GRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAAND  2013
             G + +   +      LNGS+       R+ S VE EAW+LLQ ++V YCG PVGT+AAND
Sbjct  89    GDISVLGQAVSGNGGLNGSAAKTPPQRRKSSSVEDEAWELLQESMVYYCGSPVGTIAAND  148

Query  2012  PADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLM  1833
             P D  P+NYDQVFIRDFIPS +AFLL GE EIV+NF+LHTLQLQSWEKT+DC+SPGQGLM
Sbjct  149   PNDSDPVNYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLM  208

Query  1832  PASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQ  1653
             PASFKVRT+PLDG     E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD ++Q
Sbjct  209   PASFKVRTIPLDGDEDATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQ  268

Query  1652  ERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCT  1473
             ER+DVQTG+++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C 
Sbjct  269   ERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCA  328

Query  1472  REMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNI  1293
             REML   D +  L+ A+NNRL ALSFHIREYYW+DM+K+NEIYRYKTEEYS DA+NKFNI
Sbjct  329   REMLTQEDGSADLIRALNNRLIALSFHIREYYWLDMQKLNEIYRYKTEEYSYDAVNKFNI  388

Query  1292  YPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIE  1113
             YPDQI PW+V WIP  GGY +GNLQPAHMDFRFF+LGNLW+I+SSL T  Q+ +IL+ IE
Sbjct  389   YPDQISPWLVEWIPPKGGYFIGNLQPAHMDFRFFSLGNLWSIVSSLATTHQSHAILDLIE  448

Query  1112  GKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG  933
              KW DL+A+MPLKICYPALE ++W+IITGSDPKNTPWSYHNGGSWPTLLWQ T+ACIKM 
Sbjct  449   SKWSDLVAEMPLKICYPALENQEWKIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMN  508

Query  932   KPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDM  753
             +PELA KA+ VAE R+  D+WPEYYDT+  RFIGKQ+RL QTW++AG+L +K+L++ PD 
Sbjct  509   RPELAAKAIEVAERRIATDKWPEYYDTKRARFIGKQSRLYQTWSIAGFLVAKLLIEKPDA  568

Query  752   ASLLVWNEDYELL  714
             A +L  +ED E+L
Sbjct  569   ARILWNDEDAEIL  581



>gb|AAS79609.1| putative neutral invertase [Ipomoea trifida]
Length=634

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/518 (69%), Positives = 424/518 (82%), Gaps = 6/518 (1%)
 Frame = -3

Query  2183  EITDDSTVNKNDLNGS-----SISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAA  2019
             + +D +   KND NG+     +++   P+   + +E+EAW LL+ ++V YCG P+GT+AA
Sbjct  114   QTSDAAQQFKND-NGTVPSSKTVNNALPKSSTNSIEEEAWNLLRASMVYYCGNPIGTIAA  172

Query  2018  NDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQG  1839
             NDP+D   LNYDQVFIRDFIPS +AFLL GE +IV+NFLLHTLQLQSWEKT+DCYSPGQG
Sbjct  173   NDPSDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQG  232

Query  1838  LMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYT  1659
             LMPASFKVRT+PLD      EDVLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD +
Sbjct  233   LMPASFKVRTVPLDNDENATEDVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLS  292

Query  1658  LQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALR  1479
             L ER+DVQTG+++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL 
Sbjct  293   LLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALL  352

Query  1478  CTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKF  1299
             C REML   +++  L+ A+NNRL ALSFHIREYYW+D+KK+NEIYRYKTEEYS +AINKF
Sbjct  353   CAREMLAPEEASIDLITALNNRLLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKF  412

Query  1298  NIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNF  1119
             NIYPDQIPPW+V W+P  GGYL+GNLQPAHMDFRFF+LGNLW+I+SSL T +Q+ +IL+ 
Sbjct  413   NIYPDQIPPWLVEWMPSKGGYLIGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDL  472

Query  1118  IEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIK  939
             IE KW+DL+A MPLKICYPALEG++WRIITG DPKNTPWSYHN GSWPTLLWQ  +AC+K
Sbjct  473   IETKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVACVK  532

Query  938   MGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNP  759
             M +PE+A  A+ VAE R+  D+WPEYYDT+ G FIGKQARL QTW++AGYL +K+L+ NP
Sbjct  533   MKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANP  592

Query  758   DMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVRSQ  645
             + A +L+  ED ELL      L  N RRK SR G   Q
Sbjct  593   EAAKMLITIEDTELLSAFSSILSSNPRRKRSRKGAVKQ  630



>ref|XP_002452195.1| hypothetical protein SORBIDRAFT_04g021550 [Sorghum bicolor]
 gb|EES05171.1| hypothetical protein SORBIDRAFT_04g021550 [Sorghum bicolor]
Length=603

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/506 (70%), Positives = 417/506 (82%), Gaps = 1/506 (0%)
 Frame = -3

Query  2192  GRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAAND  2013
             G + +   +      LNGS        R+ S VE EAW+LLQ ++V YCG PVGT+AAND
Sbjct  91    GDISVPGQAVGGNGSLNGSVAKPPPQRRKSSSVEDEAWELLQESMVYYCGSPVGTIAAND  150

Query  2012  PADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLM  1833
             P D  P+NYDQVFIRDFIPS +AFLL GE EIV+NF+LHTLQLQSWEKT+DC+SPGQGLM
Sbjct  151   PNDSDPVNYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLM  210

Query  1832  PASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQ  1653
             PASFKVRT+PLDG     E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD ++Q
Sbjct  211   PASFKVRTIPLDGDEDATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQ  270

Query  1652  ERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCT  1473
             ER+DVQTG+++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C 
Sbjct  271   ERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCA  330

Query  1472  REMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNI  1293
             REML   D +  L+ A+NNRL ALSFHIREYYW+DM+K+NEIYRYKTEEYS DA+NKFNI
Sbjct  331   REMLAQEDGSADLIRALNNRLIALSFHIREYYWLDMQKLNEIYRYKTEEYSYDAVNKFNI  390

Query  1292  YPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIE  1113
             YPDQI PW+V WIP  GGY +GNLQPAHMDFRFF+LGNLW+I+SSL T  Q+ +IL+ IE
Sbjct  391   YPDQISPWLVEWIPPKGGYFIGNLQPAHMDFRFFSLGNLWSIVSSLATTHQSHAILDLIE  450

Query  1112  GKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG  933
              KW DL+A+MPLKICYPALE ++W+IITGSDPKNTPWSYHNGGSWPTLLWQ T+ACIKM 
Sbjct  451   SKWSDLVAEMPLKICYPALENQEWKIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMN  510

Query  932   KPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDM  753
             +PELA KA+ VAE R+  D+WPEYYDT+  RFIGKQARL QTW++AG+L +K+L++ PD 
Sbjct  511   RPELAAKAIEVAERRIATDKWPEYYDTKRARFIGKQARLYQTWSIAGFLVAKLLIEKPDA  570

Query  752   ASLLVWNEDYELLENCVCGLKYNGRR  675
             A +L  +ED E+L N +   +  G++
Sbjct  571   ARILWNDEDAEIL-NALSTNRKRGKK  595



>ref|XP_006349099.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006349100.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X4 [Solanum 
tuberosum]
 ref|XP_006349101.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X5 [Solanum 
tuberosum]
Length=641

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/489 (72%), Positives = 410/489 (84%), Gaps = 0/489 (0%)
 Frame = -3

Query  2117  PEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFL  1938
             P      +E EAW  L+ A+V YCG PVGT+AANDP++   LNYDQVFIRDFIPS +AFL
Sbjct  148   PRTNTESIEDEAWHFLRAAMVYYCGSPVGTIAANDPSEATMLNYDQVFIRDFIPSGIAFL  207

Query  1937  LNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPD  1758
             L GE +IV+NF+LHTLQLQSWEKT+DCYSPGQGLMPASFKVRT+PLD      EDVLDPD
Sbjct  208   LKGEYDIVRNFILHTLQLQSWEKTMDCYSPGQGLMPASFKVRTIPLDNDESATEDVLDPD  267

Query  1757  FGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFP  1578
             FGE+AIGRVAPVDSGLWWIILLRAY K +GD +LQERVDVQTG+++IL LCL DGFDMFP
Sbjct  268   FGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERVDVQTGMKMILRLCLADGFDMFP  327

Query  1577  TLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALS  1398
             TLLVTDGSCMIDRRMGIHGHPLEIQAL+YSAL   REML   +++  LV A+NNRL ALS
Sbjct  328   TLLVTDGSCMIDRRMGIHGHPLEIQALYYSALLGAREMLAPEEASTDLVRALNNRLLALS  387

Query  1397  FHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQ  1218
             FHIREYYW+D+KK+NEIYRYKTEEYS DAINKFNIYPDQIPPW+V W+P  GGYL+GNLQ
Sbjct  388   FHIREYYWIDVKKLNEIYRYKTEEYSYDAINKFNIYPDQIPPWLVEWMPSEGGYLIGNLQ  447

Query  1217  PAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWR  1038
             PAHMDFRFF+LGN+W+I+SSL   +Q+ +IL+ IE KW+DL+A MPLKICYPALEG++WR
Sbjct  448   PAHMDFRFFSLGNVWSIVSSLANIDQSHAILDLIEAKWEDLVADMPLKICYPALEGQEWR  507

Query  1037  IITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYY  858
             IITG DPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PE+A KA+ +AE RL  D+WPEYY
Sbjct  508   IITGGDPKNTPWSYHNGGSWPTLLWQLTVACIKMKRPEIAEKAIKIAERRLSRDRWPEYY  567

Query  857   DTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGR  678
             DTR G FIGKQARL QTWT+AGYL +K+L+ NP+ A +++  ED ELL      L  N R
Sbjct  568   DTRRGGFIGKQARLFQTWTIAGYLVAKLLIANPEAAKMVINVEDTELLSAFSSILSSNPR  627

Query  677   RKCSRFGVR  651
             RK SR GV+
Sbjct  628   RKRSRKGVK  636



>gb|AHA82517.1| neutral/alkaline invertase [Manihot esculenta]
Length=624

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/507 (70%), Positives = 418/507 (82%), Gaps = 0/507 (0%)
 Frame = -3

Query  2171  DSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPL  1992
             D  VN N  +  ++   + +     V +EAW LL+ +VV YCG P+GT+AANDP+D   L
Sbjct  113   DVKVNGNVDSAKTVRDTSHKTNECSVVEEAWDLLRESVVYYCGNPIGTIAANDPSDTSIL  172

Query  1991  NYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR  1812
             NYDQVFIRDFIPS +AFLL GE +IV+NF+L+TLQLQSWEKT+DC+SPGQGLMPASFKVR
Sbjct  173   NYDQVFIRDFIPSGIAFLLKGEFDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVR  232

Query  1811  TMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQT  1632
             T+PLDG +   ED+LD DFGE+AIGRVAPVDSGLWWIILLRAY K TGD ++QERVDVQT
Sbjct  233   TVPLDGDDSATEDILDADFGEAAIGRVAPVDSGLWWIILLRAYGKCTGDLSVQERVDVQT  292

Query  1631  GIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVN  1452
             GI++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C REML   
Sbjct  293   GIKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE  352

Query  1451  DSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPP  1272
             D +  L+ A+NNRL ALSFHIREYYW+DM+KINEIYRYKTEEYS DA+NKFNIYPDQIP 
Sbjct  353   DGSADLIRALNNRLVALSFHIREYYWIDMRKINEIYRYKTEEYSYDAVNKFNIYPDQIPS  412

Query  1271  WIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLI  1092
             W+V+++P  GGYL+GNLQPAHMDFRFF+LGNLW+I+SSL T +Q+ +IL+ IE KW DL+
Sbjct  413   WLVDFMPNRGGYLIGNLQPAHMDFRFFSLGNLWSIVSSLATVDQSHAILDLIEAKWADLV  472

Query  1091  AQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMK  912
             A+MP KICYPALEG++WRIITGSDPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PE+A K
Sbjct  473   AEMPFKICYPALEGQEWRIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPEIAEK  532

Query  911   AVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWN  732
             AV +AE R+  D+WPEYYDT+  RFIGKQARL QTW++AGYL +K+LL NP  A +LV  
Sbjct  533   AVKLAERRISKDKWPEYYDTKKARFIGKQARLFQTWSIAGYLVAKLLLDNPSAAKILVNE  592

Query  731   EDYELLENCVCGLKYNGRRKCSRFGVR  651
             ED EL     C +  N RRK  R G +
Sbjct  593   EDTELQNTFSCIINANPRRKRGRSGYK  619



>ref|XP_006349098.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X2 [Solanum 
tuberosum]
Length=645

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/489 (72%), Positives = 410/489 (84%), Gaps = 0/489 (0%)
 Frame = -3

Query  2117  PEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFL  1938
             P      +E EAW  L+ A+V YCG PVGT+AANDP++   LNYDQVFIRDFIPS +AFL
Sbjct  152   PRTNTESIEDEAWHFLRAAMVYYCGSPVGTIAANDPSEATMLNYDQVFIRDFIPSGIAFL  211

Query  1937  LNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPD  1758
             L GE +IV+NF+LHTLQLQSWEKT+DCYSPGQGLMPASFKVRT+PLD      EDVLDPD
Sbjct  212   LKGEYDIVRNFILHTLQLQSWEKTMDCYSPGQGLMPASFKVRTIPLDNDESATEDVLDPD  271

Query  1757  FGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFP  1578
             FGE+AIGRVAPVDSGLWWIILLRAY K +GD +LQERVDVQTG+++IL LCL DGFDMFP
Sbjct  272   FGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERVDVQTGMKMILRLCLADGFDMFP  331

Query  1577  TLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALS  1398
             TLLVTDGSCMIDRRMGIHGHPLEIQAL+YSAL   REML   +++  LV A+NNRL ALS
Sbjct  332   TLLVTDGSCMIDRRMGIHGHPLEIQALYYSALLGAREMLAPEEASTDLVRALNNRLLALS  391

Query  1397  FHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQ  1218
             FHIREYYW+D+KK+NEIYRYKTEEYS DAINKFNIYPDQIPPW+V W+P  GGYL+GNLQ
Sbjct  392   FHIREYYWIDVKKLNEIYRYKTEEYSYDAINKFNIYPDQIPPWLVEWMPSEGGYLIGNLQ  451

Query  1217  PAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWR  1038
             PAHMDFRFF+LGN+W+I+SSL   +Q+ +IL+ IE KW+DL+A MPLKICYPALEG++WR
Sbjct  452   PAHMDFRFFSLGNVWSIVSSLANIDQSHAILDLIEAKWEDLVADMPLKICYPALEGQEWR  511

Query  1037  IITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYY  858
             IITG DPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PE+A KA+ +AE RL  D+WPEYY
Sbjct  512   IITGGDPKNTPWSYHNGGSWPTLLWQLTVACIKMKRPEIAEKAIKIAERRLSRDRWPEYY  571

Query  857   DTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGR  678
             DTR G FIGKQARL QTWT+AGYL +K+L+ NP+ A +++  ED ELL      L  N R
Sbjct  572   DTRRGGFIGKQARLFQTWTIAGYLVAKLLIANPEAAKMVINVEDTELLSAFSSILSSNPR  631

Query  677   RKCSRFGVR  651
             RK SR GV+
Sbjct  632   RKRSRKGVK  640



>ref|XP_011090015.1| PREDICTED: alkaline/neutral invertase CINV1 [Sesamum indicum]
Length=634

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/523 (68%), Positives = 421/523 (80%), Gaps = 7/523 (1%)
 Frame = -3

Query  2198  DGGRVEITDDSTVNKNDL-------NGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGY  2040
             D   +E T      K DL       + +++ K       + +E EAW LL+ ++V YCG 
Sbjct  107   DNQSLEATQHFKYEKEDLLSNDKLASDTAVGKTFSGAGANSLEDEAWNLLRASMVYYCGN  166

Query  2039  PVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVD  1860
             PVGT+AANDP+D   LNYDQVFIRDFIPS +AFLL GE EIV+NF+LHTLQLQSWEKT+D
Sbjct  167   PVGTIAANDPSDSNTLNYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMD  226

Query  1859  CYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYV  1680
             C+SPGQGLMPASFKVR +PLDG +   E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY 
Sbjct  227   CHSPGQGLMPASFKVRVVPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYG  286

Query  1679  KITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQA  1500
             K +GD ++QER+DVQTGI++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQA
Sbjct  287   KCSGDLSVQERIDVQTGIKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQA  346

Query  1499  LFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYS  1320
             LFYSAL C REML   D++  LV A+NNRL ALS HIREYYW+DMKK+NEIYRYKTEEYS
Sbjct  347   LFYSALLCAREMLAPEDASADLVRALNNRLVALSIHIREYYWIDMKKLNEIYRYKTEEYS  406

Query  1319  MDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQ  1140
              DA+NKFNIYPDQIPPW+V W+P  GGYL+GNLQPAHMDFRFF+LGNLWAI+ SL T +Q
Sbjct  407   FDAVNKFNIYPDQIPPWLVEWMPNKGGYLIGNLQPAHMDFRFFSLGNLWAIVCSLATADQ  466

Query  1139  NKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQ  960
             + +IL+ IE KW DL+A MPLKICYPALEG++WRIITGSDPKNTPWSYHNGGSWPTL+WQ
Sbjct  467   SHAILDLIEAKWSDLVADMPLKICYPALEGQEWRIITGSDPKNTPWSYHNGGSWPTLIWQ  526

Query  959   FTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTS  780
              T+ACIKM +PE+A KA+  AE+RL  D+WPEYYD++  RFIGKQA L QTW++AGYL +
Sbjct  527   LTVACIKMNRPEIAEKAIRAAEKRLARDKWPEYYDSKGARFIGKQAHLFQTWSIAGYLVA  586

Query  779   KMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFGVR  651
             K+L+ NP  A++L+  ED ELL      L  N R K SR G +
Sbjct  587   KLLIANPSAANILINMEDAELLSVFSWALNANPRGKRSRKGPK  629



>ref|XP_004251032.1| PREDICTED: alkaline/neutral invertase CINV1 [Solanum lycopersicum]
Length=672

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/489 (72%), Positives = 410/489 (84%), Gaps = 0/489 (0%)
 Frame = -3

Query  2117  PEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFL  1938
             P      +E EAW  L+ A+V YCG PVGT+AANDP++   LNYDQVFIRDFIPS +AFL
Sbjct  179   PRTNTESIEDEAWHFLRAAMVYYCGSPVGTIAANDPSEATMLNYDQVFIRDFIPSGIAFL  238

Query  1937  LNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPD  1758
             L GE +IV+NF+LHTLQLQSWEKT+DCYSPGQGLMPASFKVRT+PLD      EDVLDPD
Sbjct  239   LKGEYDIVRNFILHTLQLQSWEKTMDCYSPGQGLMPASFKVRTIPLDNDESATEDVLDPD  298

Query  1757  FGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFP  1578
             FGE+AIGRVAPVDSGLWWIILLRAY K +GD +LQERVDVQTG+++IL LCL DGFDMFP
Sbjct  299   FGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERVDVQTGMKMILRLCLADGFDMFP  358

Query  1577  TLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALS  1398
             TLLVTDGSCMIDRRMGIHGHPLEIQAL+YSAL   REML   +++  LV A+NNRL ALS
Sbjct  359   TLLVTDGSCMIDRRMGIHGHPLEIQALYYSALLGAREMLAPEEASTDLVRALNNRLLALS  418

Query  1397  FHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQ  1218
             FHIREYYW+D+KK+NEIYRYKTEEYS DAINKFNIYPDQIPPW+V W+P  GGYL+GNLQ
Sbjct  419   FHIREYYWIDVKKLNEIYRYKTEEYSYDAINKFNIYPDQIPPWLVEWMPSEGGYLIGNLQ  478

Query  1217  PAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWR  1038
             PAHMDFRFF+LGN+W+I+SSL   +Q+ +IL+ IE KW+DL+A MPLKICYPALEG++WR
Sbjct  479   PAHMDFRFFSLGNVWSIVSSLANIDQSHAILDLIEAKWEDLVADMPLKICYPALEGQEWR  538

Query  1037  IITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYY  858
             IITG DPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PE+A KA+ +AE RL  D+WPEYY
Sbjct  539   IITGGDPKNTPWSYHNGGSWPTLLWQLTVACIKMKRPEIAEKAIKIAERRLSRDRWPEYY  598

Query  857   DTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGR  678
             DTR G FIGKQARL QTWT+AGYL +K+L+ NP+ A +++  ED ELL      L  N R
Sbjct  599   DTRRGGFIGKQARLFQTWTIAGYLVAKLLIANPEAAKMVINVEDTELLSAFSSILSSNPR  658

Query  677   RKCSRFGVR  651
             RK SR GV+
Sbjct  659   RKRSRKGVK  667



>ref|NP_001142296.1| alkaline/neutral invertase isoform 1 [Zea mays]
 gb|ACF88123.1| unknown [Zea mays]
Length=601

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/493 (71%), Positives = 411/493 (83%), Gaps = 0/493 (0%)
 Frame = -3

Query  2192  GRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAAND  2013
             G + +   +      LNGS+       R+ S VE EAW+LLQ ++V YCG PVGT+AAND
Sbjct  89    GDISVLGQAVSGNGGLNGSAAKTPPQRRKSSSVEDEAWELLQESMVYYCGSPVGTIAAND  148

Query  2012  PADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLM  1833
             P D  P+NYDQVFIRDFIPS +AFLL GE EIV+NF+LHTLQLQSWEKT+DC+SPGQGLM
Sbjct  149   PNDSDPVNYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLM  208

Query  1832  PASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQ  1653
             PASFKVRT+PLDG     E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD ++Q
Sbjct  209   PASFKVRTIPLDGDEDATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQ  268

Query  1652  ERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCT  1473
             ER+DVQTG+++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C 
Sbjct  269   ERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCA  328

Query  1472  REMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNI  1293
             REML   D +  L+ A+NNRL ALSFHIREYYW+DM+K+NEIYRYKTEEYS DA+NKFNI
Sbjct  329   REMLTQEDGSADLIRALNNRLIALSFHIREYYWLDMQKLNEIYRYKTEEYSYDAVNKFNI  388

Query  1292  YPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIE  1113
             YPDQI PW+V WIP  GGY +GNLQPAHMDFRFF+LGNLW+I+SSL T  Q+ +IL+ IE
Sbjct  389   YPDQISPWLVEWIPPKGGYFIGNLQPAHMDFRFFSLGNLWSIVSSLATTHQSHAILDLIE  448

Query  1112  GKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG  933
              KW DL+A+MPLKICYPALE ++W+IITGSDPKNTPWSYHNGGSWPTLLWQ T+ACIKM 
Sbjct  449   SKWSDLVAEMPLKICYPALENQEWKIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMN  508

Query  932   KPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDM  753
             +PELA KA+ VAE R+  D+WP YYDT+  RFIGKQ+RL QTW++AG+L +K+L++ PD 
Sbjct  509   RPELAAKAIEVAERRIATDKWPVYYDTKRARFIGKQSRLYQTWSIAGFLVAKLLIEKPDA  568

Query  752   ASLLVWNEDYELL  714
             A +L  +ED E+L
Sbjct  569   ARILWNDEDAEIL  581



>ref|XP_006349097.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X1 [Solanum 
tuberosum]
Length=672

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/489 (72%), Positives = 410/489 (84%), Gaps = 0/489 (0%)
 Frame = -3

Query  2117  PEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFL  1938
             P      +E EAW  L+ A+V YCG PVGT+AANDP++   LNYDQVFIRDFIPS +AFL
Sbjct  179   PRTNTESIEDEAWHFLRAAMVYYCGSPVGTIAANDPSEATMLNYDQVFIRDFIPSGIAFL  238

Query  1937  LNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPD  1758
             L GE +IV+NF+LHTLQLQSWEKT+DCYSPGQGLMPASFKVRT+PLD      EDVLDPD
Sbjct  239   LKGEYDIVRNFILHTLQLQSWEKTMDCYSPGQGLMPASFKVRTIPLDNDESATEDVLDPD  298

Query  1757  FGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFP  1578
             FGE+AIGRVAPVDSGLWWIILLRAY K +GD +LQERVDVQTG+++IL LCL DGFDMFP
Sbjct  299   FGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERVDVQTGMKMILRLCLADGFDMFP  358

Query  1577  TLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALS  1398
             TLLVTDGSCMIDRRMGIHGHPLEIQAL+YSAL   REML   +++  LV A+NNRL ALS
Sbjct  359   TLLVTDGSCMIDRRMGIHGHPLEIQALYYSALLGAREMLAPEEASTDLVRALNNRLLALS  418

Query  1397  FHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQ  1218
             FHIREYYW+D+KK+NEIYRYKTEEYS DAINKFNIYPDQIPPW+V W+P  GGYL+GNLQ
Sbjct  419   FHIREYYWIDVKKLNEIYRYKTEEYSYDAINKFNIYPDQIPPWLVEWMPSEGGYLIGNLQ  478

Query  1217  PAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWR  1038
             PAHMDFRFF+LGN+W+I+SSL   +Q+ +IL+ IE KW+DL+A MPLKICYPALEG++WR
Sbjct  479   PAHMDFRFFSLGNVWSIVSSLANIDQSHAILDLIEAKWEDLVADMPLKICYPALEGQEWR  538

Query  1037  IITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYY  858
             IITG DPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PE+A KA+ +AE RL  D+WPEYY
Sbjct  539   IITGGDPKNTPWSYHNGGSWPTLLWQLTVACIKMKRPEIAEKAIKIAERRLSRDRWPEYY  598

Query  857   DTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGR  678
             DTR G FIGKQARL QTWT+AGYL +K+L+ NP+ A +++  ED ELL      L  N R
Sbjct  599   DTRRGGFIGKQARLFQTWTIAGYLVAKLLIANPEAAKMVINVEDTELLSAFSSILSSNPR  658

Query  677   RKCSRFGVR  651
             RK SR GV+
Sbjct  659   RKRSRKGVK  667



>ref|XP_003575059.1| PREDICTED: alkaline/neutral invertase CINV1 [Brachypodium distachyon]
 ref|XP_010235489.1| PREDICTED: alkaline/neutral invertase CINV1 [Brachypodium distachyon]
Length=603

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/492 (72%), Positives = 413/492 (84%), Gaps = 1/492 (0%)
 Frame = -3

Query  2150  DLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFI  1971
             +LNG++   L   ++VS VE EAW LL+ ++VNYCG PVGT+AANDP D  P NYDQVFI
Sbjct  105   NLNGNATKPLPQRQKVSSVEDEAWDLLRDSIVNYCGIPVGTIAANDPNDSNPANYDQVFI  164

Query  1970  RDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGR  1791
             RDFIPS +AFLL GE EIV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLDG 
Sbjct  165   RDFIPSGVAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTIPLDGD  224

Query  1790  NGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILN  1611
             +   E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD ++QER+DVQTGI++IL 
Sbjct  225   DDATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILK  284

Query  1610  LCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLV  1431
             LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL   REML   D +  L+
Sbjct  285   LCLTDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLSAREMLTPEDGSADLI  344

Query  1430  AAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIP  1251
              A+NNRL ALSFHIREYYWVDM+K+NEIYRYKTEEYS DA+NKFNIYPDQ+ PW+V WIP
Sbjct  345   RALNNRLIALSFHIREYYWVDMQKLNEIYRYKTEEYSYDAVNKFNIYPDQVSPWLVEWIP  404

Query  1250  ETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKI  1071
               GGY +GNLQPAHMDFRFF LGNLW+I+SSL T  Q+ +IL+ IE KW DL+A+MPLKI
Sbjct  405   PKGGYFIGNLQPAHMDFRFFALGNLWSIVSSLATTHQSHAILDLIESKWSDLVAEMPLKI  464

Query  1070  CYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEE  891
             CYPALE ++W+IITGSDPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PE+A KAV +AE 
Sbjct  465   CYPALENQEWKIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPEIAAKAVEIAER  524

Query  890   RLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLE  711
             R+  D+WPEYYDT+  RFIGKQ+RL QTW++AGYL +K LL  PD A +L  +ED E+L 
Sbjct  525   RIATDKWPEYYDTKRARFIGKQSRLYQTWSIAGYLVAKQLLDKPDAARILWNDEDAEIL-  583

Query  710   NCVCGLKYNGRR  675
             N +   +  G++
Sbjct  584   NALSTNRKRGKK  595



>ref|XP_004952630.1| PREDICTED: alkaline/neutral invertase CINV2-like [Setaria italica]
Length=603

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/478 (73%), Positives = 410/478 (86%), Gaps = 1/478 (0%)
 Frame = -3

Query  2108  EVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNG  1929
             + S VE EAW+LLQ ++V YCG PVGT+AANDP D  P+NYDQVFIRDFIPS +AFLL G
Sbjct  119   KTSSVEDEAWELLQESMVYYCGSPVGTIAANDPNDSDPVNYDQVFIRDFIPSGIAFLLKG  178

Query  1928  EGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGE  1749
             E EIV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLDG     E+VLDPDFGE
Sbjct  179   EYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTIPLDGDEDVTEEVLDPDFGE  238

Query  1748  SAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLL  1569
             +AIGRVAPVDSGLWWIILLRAY K +GD ++QER+DVQTG+++IL LCL DGFDMFPTLL
Sbjct  239   AAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGMKMILKLCLADGFDMFPTLL  298

Query  1568  VTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHI  1389
             VTDGSCMIDRRMGIHGHPLEIQALFYSAL C REML   D +  L+ A+NNRL ALSFHI
Sbjct  299   VTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDGSADLIRALNNRLIALSFHI  358

Query  1388  REYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAH  1209
             REYYWVDM+K+NEIYRYKTEEYS DA+NKFNIYPDQIPPW+V WIP  GGY +GNLQPAH
Sbjct  359   REYYWVDMQKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWIPPKGGYFIGNLQPAH  418

Query  1208  MDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIIT  1029
             MDFRFF+LGNLW+I+SSL T +Q+ +IL+ IE KW DL+A+MPLKICYPALE ++W+IIT
Sbjct  419   MDFRFFSLGNLWSIVSSLATTQQSHAILDLIESKWSDLVAEMPLKICYPALENQEWKIIT  478

Query  1028  GSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTR  849
             GSDPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PELA KA+ VAE R+  D+WPEYYDT+
Sbjct  479   GSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPELAAKAIEVAERRIATDKWPEYYDTK  538

Query  848   HGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRR  675
               RFIGKQ+RL QTW++AG+L +K+L++ PD A +L  +ED E+L N +   +  G++
Sbjct  539   RARFIGKQSRLYQTWSIAGFLVAKLLIEKPDAARILWNDEDAEIL-NALSTNRKRGKK  595



>ref|XP_006647331.1| PREDICTED: alkaline/neutral invertase CINV2-like [Oryza brachyantha]
Length=608

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/508 (70%), Positives = 421/508 (83%), Gaps = 4/508 (1%)
 Frame = -3

Query  2192  GRVEITDDSTVNKN-DLNGSSISKLAPER-EVSEVEKEAWKLLQGAVVNYCGYPVGTVAA  2019
             G V +     +  N  LNGS++ K  P+R +VS VE E W+LL+ ++V YCG PVGT+AA
Sbjct  95    GDVSVPPGQAIGGNGSLNGSAV-KSPPQRCKVSSVEDEGWELLRESMVYYCGSPVGTIAA  153

Query  2018  NDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQG  1839
             NDP D  P+NYDQVFIRDFIPS +AFLL GE EIV+NF+LHTLQLQSWEKT+DC+SPGQG
Sbjct  154   NDPNDANPMNYDQVFIRDFIPSGVAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQG  213

Query  1838  LMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYT  1659
             LMPASFKVRT+PLDG     E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD +
Sbjct  214   LMPASFKVRTIPLDGDEDATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLS  273

Query  1658  LQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALR  1479
             +QER+DVQTGI++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL 
Sbjct  274   VQERIDVQTGIKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALL  333

Query  1478  CTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKF  1299
             C REML   D +  L+ A+NNRL ALSFHIREYYWVDM+K+NEIYRYKTEEYS DA+NKF
Sbjct  334   CAREMLTPEDGSADLIRALNNRLIALSFHIREYYWVDMQKLNEIYRYKTEEYSYDAVNKF  393

Query  1298  NIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNF  1119
             NIYPDQI PW+V WIP  GGY +GNLQPAHMDFRFF+LGNLW+I+SSL T  Q+ +IL+ 
Sbjct  394   NIYPDQISPWLVEWIPPKGGYFIGNLQPAHMDFRFFSLGNLWSIVSSLATTHQSHAILDL  453

Query  1118  IEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIK  939
             IE KW DL+A+MPLKICYPALE ++W+IITGSDPKNTPWSYHNGGSWPTLLWQ T+A IK
Sbjct  454   IESKWSDLVAEMPLKICYPALENQEWKIITGSDPKNTPWSYHNGGSWPTLLWQLTVASIK  513

Query  938   MGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNP  759
             M +PE+A KAV VAE R+ +D+WPEYYDT+  RFIGKQ+RL QTW++AGYL +K LL  P
Sbjct  514   MNRPEIAAKAVEVAERRIAIDKWPEYYDTKRARFIGKQSRLYQTWSIAGYLVAKQLLDKP  573

Query  758   DMASLLVWNEDYELLENCVCGLKYNGRR  675
             D A +L  +ED E+L N +   +  G++
Sbjct  574   DAARILWNDEDAEIL-NALSTNRKRGKK  600



>ref|XP_009790874.1| PREDICTED: alkaline/neutral invertase CINV2-like [Nicotiana sylvestris]
Length=642

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/498 (71%), Positives = 411/498 (83%), Gaps = 0/498 (0%)
 Frame = -3

Query  2144  NGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRD  1965
               + ++   P      +E EAW  L+ A+V Y G PVGT+AANDP++   LNYDQVFIRD
Sbjct  140   TAAMVNSALPRTNTGSIEDEAWHFLRAAMVYYYGDPVGTIAANDPSEATMLNYDQVFIRD  199

Query  1964  FIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNG  1785
             FIPS +AFLL GE +IV+NF+LHTLQLQSWEKT+DCYSPGQGLMPASFKVRT+PLD    
Sbjct  200   FIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLDNDES  259

Query  1784  EFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLC  1605
               EDVLDPDFGE+AIGRVAPVDSGLWWI+LLRAY K +GD +LQ RVDVQTG+++IL LC
Sbjct  260   ATEDVLDPDFGEAAIGRVAPVDSGLWWIVLLRAYGKCSGDLSLQGRVDVQTGMKMILRLC  319

Query  1604  LRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAA  1425
             L DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQAL+YSAL C REML   +++  LV A
Sbjct  320   LADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALYYSALLCAREMLAPEEASTDLVRA  379

Query  1424  INNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPET  1245
             +NNRL ALSFHIREYYW+D+KK+NEIYRYKTEEYS DAINKFNIYPDQIPPW+V W+P  
Sbjct  380   LNNRLLALSFHIREYYWIDVKKLNEIYRYKTEEYSYDAINKFNIYPDQIPPWLVEWMPSK  439

Query  1244  GGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICY  1065
             GGYL+GNLQPAHMDFRFF LGNLW+I+SSL T +Q+ +IL+ IE KW+DL+A MPLKICY
Sbjct  440   GGYLIGNLQPAHMDFRFFALGNLWSIVSSLATIDQSHAILDLIEAKWEDLVADMPLKICY  499

Query  1064  PALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERL  885
             PALEG++WRIITG DPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PE+A KA+ +AE RL
Sbjct  500   PALEGQEWRIITGGDPKNTPWSYHNGGSWPTLLWQLTVACIKMKRPEIAEKAIKIAEIRL  559

Query  884   PVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENC  705
               D+WPEYYDTR G FIGKQARL QTWT+AGYL +K L+ NP+ A +L+  ED ELL   
Sbjct  560   ARDKWPEYYDTRRGGFIGKQARLFQTWTIAGYLVAKQLIANPEAAKILINVEDTELLSAF  619

Query  704   VCGLKYNGRRKCSRFGVR  651
                L  N RRK SR GV+
Sbjct  620   SSILSSNPRRKRSRKGVK  637



>ref|XP_010244028.1| PREDICTED: alkaline/neutral invertase CINV1-like [Nelumbo nucifera]
 ref|XP_010244036.1| PREDICTED: alkaline/neutral invertase CINV1-like [Nelumbo nucifera]
Length=659

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/485 (72%), Positives = 406/485 (84%), Gaps = 0/485 (0%)
 Frame = -3

Query  2105  VSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGE  1926
             V  +E EAW LL  ++V YCG P+GT+AA DP D   LNYDQVFIRDFIPS +AFLL GE
Sbjct  170   VDSLEDEAWNLLHDSMVYYCGSPIGTIAAKDPTDSNALNYDQVFIRDFIPSGMAFLLKGE  229

Query  1925  GEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGES  1746
              +IV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PL+G +   EDVLDPDFGE+
Sbjct  230   YDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLEGDDSATEDVLDPDFGEA  289

Query  1745  AIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLV  1566
             AIGRVAPVDSGLWWIILLRAY K +GD ++QER+DVQTGI++IL LCL DGFDMFPTLLV
Sbjct  290   AIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILKLCLADGFDMFPTLLV  349

Query  1565  TDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIR  1386
             TDGSCMIDRRMGIHGHPLEIQALFYSAL C REML   D++  L+ A+NNRL ALSFHIR
Sbjct  350   TDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDASADLMRALNNRLLALSFHIR  409

Query  1385  EYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHM  1206
              YYWVDM+K+NEIYRYKTEEYS DA+NKFNIYPDQIPPW+V WIP  GGYL+GNLQPAHM
Sbjct  410   NYYWVDMRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWIPNKGGYLIGNLQPAHM  469

Query  1205  DFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITG  1026
             DFRFF LGNLW+I+SSL T +Q+ +IL+ IE KW DL+  MP KICYPALEG++WRIITG
Sbjct  470   DFRFFALGNLWSIVSSLATMDQSHAILDLIEAKWTDLVGHMPFKICYPALEGQEWRIITG  529

Query  1025  SDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRH  846
             SDPKNTPWSYHN GSWPTLLWQ T+ACIKM + ++A KAV VAE+R+  D+WPEYYDT+ 
Sbjct  530   SDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRSDIAAKAVEVAEKRISKDRWPEYYDTKS  589

Query  845   GRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCS  666
              RFIGKQARL QTW++AGYL +K+LL NP  A +L+  ED EL+    C +  N +RK  
Sbjct  590   ARFIGKQARLFQTWSIAGYLVAKLLLANPSAAKILINEEDQELVNALSCIIGANPKRKRG  649

Query  665   RFGVR  651
             R G++
Sbjct  650   RKGMK  654



>ref|XP_002975181.1| hypothetical protein SELMODRAFT_267827 [Selaginella moellendorffii]
 ref|XP_002977587.1| hypothetical protein SELMODRAFT_151967 [Selaginella moellendorffii]
 gb|EFJ21591.1| hypothetical protein SELMODRAFT_151967 [Selaginella moellendorffii]
 gb|EFJ23966.1| hypothetical protein SELMODRAFT_267827 [Selaginella moellendorffii]
Length=476

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/468 (76%), Positives = 398/468 (85%), Gaps = 3/468 (1%)
 Frame = -3

Query  2060  VVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQ  1881
             +V YCG PVGT+AANDP D  PLNYDQVFIRDFIPSA+AFLL GE +IV+NFLLHTLQLQ
Sbjct  1     MVYYCGTPVGTIAANDPTDGHPLNYDQVFIRDFIPSAIAFLLKGETDIVRNFLLHTLQLQ  60

Query  1880  SWEKTVDCYSPGQGLMPASFKVRTMPLDG--RNGEFEDVLDPDFGESAIGRVAPVDSGLW  1707
             SWEKTVDCY+PGQGLMPASFKVRT+PL+G   NG  E+VLDPDFGE+AIGRVAPVDSGLW
Sbjct  61    SWEKTVDCYNPGQGLMPASFKVRTVPLEGDPANGT-EEVLDPDFGEAAIGRVAPVDSGLW  119

Query  1706  WIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGI  1527
             WIILLRAY K TGDYTLQERVDVQTG+++IL LCL DGFDMFPTLLVTDGSCMIDRRMGI
Sbjct  120   WIILLRAYGKSTGDYTLQERVDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGI  179

Query  1526  HGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEI  1347
             HGHPLEIQALFYSALRC REMLI  DS   L+  + +RLSALSFHIREYYWVDM K+NEI
Sbjct  180   HGHPLEIQALFYSALRCAREMLISEDSALDLIRTLTSRLSALSFHIREYYWVDMGKLNEI  239

Query  1346  YRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAI  1167
             YRYKTEEYS +A+NKFNIYPD + PW+V+WIP  GGYLVGNLQPAHMDFRFF+LGNLWAI
Sbjct  240   YRYKTEEYSHEAVNKFNIYPDHLSPWLVDWIPNKGGYLVGNLQPAHMDFRFFSLGNLWAI  299

Query  1166  ISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNG  987
             +SSL T EQ + IL+ IE +W D +  MP+KICYPAL+GE+WRIITGSDPKNTPWSYHNG
Sbjct  300   VSSLATPEQAEGILDLIEARWVDFVGNMPMKICYPALQGEEWRIITGSDPKNTPWSYHNG  359

Query  986   GSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQT  807
             GSWPTLLWQ T+ACIKMG+PE+A +A+ VAE+R+  D+WPEYYDTR  RF+GKQARL QT
Sbjct  360   GSWPTLLWQLTVACIKMGRPEMAERAIEVAEKRISRDRWPEYYDTRAARFVGKQARLYQT  419

Query  806   WTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSR  663
             W++AGYL +KMLL  PD   +L   ED  LLE   C L  N R K  R
Sbjct  420   WSIAGYLVAKMLLDKPDAVKILTCEEDLALLEAMSCSLDANPRIKRKR  467



>gb|AFV94466.1| alkaline/neutral invertase protein [Saccharum hybrid cultivar 
GT28]
Length=603

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/488 (72%), Positives = 415/488 (85%), Gaps = 2/488 (0%)
 Frame = -3

Query  2135  SISKLAPER-EVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFI  1959
             S +K  P+R + S VE EAW+LLQ ++V YCG PVGT+AANDP D  P+NYDQVFIRDFI
Sbjct  109   SAAKPPPQRRKSSSVEDEAWELLQESMVYYCGSPVGTIAANDPNDSDPVNYDQVFIRDFI  168

Query  1958  PSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEF  1779
             PS +AFLL GE EIV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLDG     
Sbjct  169   PSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTIPLDGDEDAT  228

Query  1778  EDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLR  1599
             E+VLDPDFGE+A+GRVAPVDSGLWWIILLRAY K +GD ++QER+DVQTG+++IL LCL 
Sbjct  229   EEVLDPDFGEAAMGRVAPVDSGLWWIILLRAYGKCSGDMSVQERIDVQTGMKMILKLCLA  288

Query  1598  DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAIN  1419
             DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C REML   D +  L+ A+N
Sbjct  289   DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDGSADLIRALN  348

Query  1418  NRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGG  1239
             NRL ALSFHIREYYW+DM+K+NEIYRYKTEEYS DA+NKFNIYPDQI PW+V WIP  GG
Sbjct  349   NRLIALSFHIREYYWLDMQKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWIPPKGG  408

Query  1238  YLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPA  1059
             Y +GNLQPAHMDFRFF+LGNLW+I+SSL T +Q+ +IL+ IE KW DL+A+MPLKICYPA
Sbjct  409   YFIGNLQPAHMDFRFFSLGNLWSIVSSLATTQQSHAILDLIESKWSDLVAEMPLKICYPA  468

Query  1058  LEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPV  879
             LE ++W+IITGSDPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PELA KA+ VAE R+  
Sbjct  469   LENQEWKIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPELAAKAIEVAERRIAT  528

Query  878   DQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVC  699
             D+WPEYYDT+  RFIGKQARL QTW++AG+L +K+L++ PD A +L  +ED E+L N + 
Sbjct  529   DKWPEYYDTKKARFIGKQARLYQTWSIAGFLVAKLLIEKPDAARILWNDEDAEIL-NALS  587

Query  698   GLKYNGRR  675
               +  G++
Sbjct  588   TNRKRGKK  595



>ref|XP_002311958.2| hypothetical protein POPTR_0008s02460g [Populus trichocarpa]
 gb|EEE89325.2| hypothetical protein POPTR_0008s02460g [Populus trichocarpa]
Length=663

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/509 (69%), Positives = 421/509 (83%), Gaps = 6/509 (1%)
 Frame = -3

Query  2180  ITDDSTVNKND----LNGSSISKLAPEREVS--EVEKEAWKLLQGAVVNYCGYPVGTVAA  2019
             +T + + NK +     NG+  +     R+VS    E+EAW+LL+ +VV+YCG P+GT+AA
Sbjct  143   LTSNGSANKEEESLATNGAVGTGRDASRKVSVDPTEEEAWELLRDSVVHYCGSPIGTIAA  202

Query  2018  NDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQG  1839
             NDP     LNYDQVFIRDFIPS +AFLL GE +IV+NFLLHTLQLQSWEKT+DC+SPGQG
Sbjct  203   NDPTSSSVLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCHSPGQG  262

Query  1838  LMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYT  1659
             LMPASFKVRT PLDG +   E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD +
Sbjct  263   LMPASFKVRTFPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLS  322

Query  1658  LQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALR  1479
             +QER+DVQTGI++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL 
Sbjct  323   VQERIDVQTGIKMILRLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALL  382

Query  1478  CTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKF  1299
             C +EML   D +  L+ A+NNRL ALSFHIREYYW+D++K+NEIYRYKTEEYS DA+NKF
Sbjct  383   CAKEMLAPEDGSADLLRALNNRLVALSFHIREYYWIDLRKLNEIYRYKTEEYSYDAVNKF  442

Query  1298  NIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNF  1119
             NIYPDQ+ PW+V W+P  GGYL+GNLQPAHMDFRFF+LGN+W+++S L T +Q+ +IL+ 
Sbjct  443   NIYPDQVSPWLVEWMPNQGGYLIGNLQPAHMDFRFFSLGNIWSVVSGLATRDQSNAILDL  502

Query  1118  IEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIK  939
             IE KW DL+A MPLKICYPALEG++W+IITGSDPKNTPWSYHN GSWPTLLWQ T+ACIK
Sbjct  503   IEAKWSDLVADMPLKICYPALEGQEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTVACIK  562

Query  938   MGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNP  759
             M +PE+A +AV +AE+R+  D+WPEYYDT+  RFIGKQARL QTW++AGYL +K+LL +P
Sbjct  563   MNRPEIAARAVDIAEKRISRDKWPEYYDTKKARFIGKQARLFQTWSIAGYLVAKLLLADP  622

Query  758   DMASLLVWNEDYELLENCVCGLKYNGRRK  672
               A +LV +ED EL+    C +  N RRK
Sbjct  623   SAARMLVTDEDPELVNAFSCMISSNPRRK  651



>ref|XP_010088753.1| hypothetical protein L484_018310 [Morus notabilis]
 gb|EXB36936.1| hypothetical protein L484_018310 [Morus notabilis]
Length=585

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/500 (70%), Positives = 408/500 (82%), Gaps = 0/500 (0%)
 Frame = -3

Query  2162  VNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYD  1983
             +  N  NG+ +     +  V  +E EAW LL+ +VV YCG P+GT+AA DP     LNYD
Sbjct  77    LTSNGANGTVVRDEFRKISVDSIEDEAWNLLRDSVVYYCGSPIGTIAATDPTSSNVLNYD  136

Query  1982  QVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMP  1803
             QVFIRDFIP+ +AFLL GE +IV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+P
Sbjct  137   QVFIRDFIPAGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVP  196

Query  1802  LDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             LDG     E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD ++QERVDVQTGI+
Sbjct  197   LDGDGSATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIK  256

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             +IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C REML   D +
Sbjct  257   MILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGS  316

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
               L+ A+NNRL ALSFHIREYYW+DMKK+NEIYRYKTEEYS DA+NKFNIYPDQI PW+V
Sbjct  317   ADLIRALNNRLLALSFHIREYYWIDMKKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLV  376

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
              W+P  GGYL+GNLQPAHMDFRFF+LGNLW+I+SSL T  Q+ +IL+ IE KWDDL+A M
Sbjct  377   EWMPSKGGYLIGNLQPAHMDFRFFSLGNLWSIVSSLATMNQSHAILDLIEAKWDDLVADM  436

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVA  903
             P KICYPALEG +W+IITGSDPKNTPWSYHN GSWPTLLWQ T+ACIKM +PE+A KAV 
Sbjct  437   PFKICYPALEGMEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRPEIAAKAVD  496

Query  902   VAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDY  723
             VAE+ +  D+WPEYYDT+  RFIGKQA L QTW++AGYL +K+LL +P  A +L+  ED 
Sbjct  497   VAEKHISRDKWPEYYDTKRARFIGKQAHLYQTWSIAGYLVAKLLLADPSKARMLITEEDS  556

Query  722   ELLENCVCGLKYNGRRKCSR  663
             EL+    C +  N RRK  R
Sbjct  557   ELVNAFSCMVSANPRRKRGR  576



>gb|KDP34707.1| hypothetical protein JCGZ_10912 [Jatropha curcas]
Length=646

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/482 (72%), Positives = 410/482 (85%), Gaps = 0/482 (0%)
 Frame = -3

Query  2096  VEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEI  1917
             +E+EAW  L+ ++V YC  P+GT+AANDP+D   LNYDQVFIRDFIPS +AFLL GE +I
Sbjct  160   IEEEAWNQLRASIVYYCSNPIGTIAANDPSDASILNYDQVFIRDFIPSGIAFLLKGEYDI  219

Query  1916  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIG  1737
             V+NF+L+TLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLDG +   ED+LDPDFGESAIG
Sbjct  220   VRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSATEDILDPDFGESAIG  279

Query  1736  RVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDG  1557
             RVAPVDSGLWWIILLRAY K +GD ++QER+DVQTGI++IL LCL DGFDMFPTLLVTDG
Sbjct  280   RVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILKLCLADGFDMFPTLLVTDG  339

Query  1556  SCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYY  1377
             SCMIDRRMGIHGHPLEIQALFYSAL C REML   D +  L+ A+NNRL ALSFHIREYY
Sbjct  340   SCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNRLVALSFHIREYY  399

Query  1376  WVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFR  1197
             W+D +K+NEIYRYKTEEYS DA+NKFNIYPDQIPPW+V ++P  GGYL+GNLQPAHMDFR
Sbjct  400   WIDRRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEFMPNRGGYLIGNLQPAHMDFR  459

Query  1196  FFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDP  1017
             FF+LGNLW+IISSL T +Q+ +IL+ IE KW +L+A+MPLKICYPALEG++WRIITGSDP
Sbjct  460   FFSLGNLWSIISSLATVDQSHAILDLIEAKWPELVAEMPLKICYPALEGQEWRIITGSDP  519

Query  1016  KNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRF  837
             KNTPWSYHNGGSWPTLLWQ T+AC+KM +PE+A KAV +AE R+  D WPEYYDT+  RF
Sbjct  520   KNTPWSYHNGGSWPTLLWQLTVACVKMNRPEIAEKAVKIAERRISRDNWPEYYDTKKARF  579

Query  836   IGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFG  657
             IGKQARL QTW++AGYL +K++L+NP  A ++V  ED ELL      +  N RRK SR G
Sbjct  580   IGKQARLFQTWSIAGYLVAKLILENPSAAKIVVNEEDSELLTTFSYMMNANPRRKRSRPG  639

Query  656   VR  651
              +
Sbjct  640   FK  641



>ref|XP_006851551.1| hypothetical protein AMTR_s00040p00181990 [Amborella trichopoda]
 gb|ERN13132.1| hypothetical protein AMTR_s00040p00181990 [Amborella trichopoda]
Length=646

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/484 (73%), Positives = 414/484 (86%), Gaps = 1/484 (0%)
 Frame = -3

Query  2114  EREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLL  1935
             ERE S VE+EAW LLQ A+VNYCG P+GT+AANDP D   LNYDQ+FIRDFIPS +AFLL
Sbjct  155   ERE-SAVEREAWDLLQAAMVNYCGSPIGTIAANDPTDPSILNYDQIFIRDFIPSGIAFLL  213

Query  1934  NGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDF  1755
              GE EIV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PL+G +   EDVLDPDF
Sbjct  214   KGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLEGDDTATEDVLDPDF  273

Query  1754  GESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPT  1575
             GE+AIGRVAPVDSGLWWIILLRAY K +GD ++QERVDVQTG+++IL LCL DGFDMFPT
Sbjct  274   GEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGMQMILKLCLADGFDMFPT  333

Query  1574  LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSF  1395
             LLVTDGSCMIDRRMGIHGHPLEIQALFYSALR  REML   DS+  L+ A+NNRL ALSF
Sbjct  334   LLVTDGSCMIDRRMGIHGHPLEIQALFYSALRSAREMLTPEDSSADLMRALNNRLIALSF  393

Query  1394  HIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQP  1215
             HIREYYWVDMKK+NEIYRYKTEEYS DA+NKFNIYPDQIPPW+V W+P+TGGY +GNLQP
Sbjct  394   HIREYYWVDMKKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWMPDTGGYFIGNLQP  453

Query  1214  AHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRI  1035
             AHMDFRFF+LGNLW+I+ +L T EQ+++IL+ +E KW D +A MP KICYPALEG++WRI
Sbjct  454   AHMDFRFFSLGNLWSIVCNLATREQSEAILDLVESKWGDFVADMPFKICYPALEGQEWRI  513

Query  1034  ITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYD  855
             ITGSDPKNTPWSYHNGGSWPTLLWQ T+ACIKM +P LA KA+ +AE R+  ++WPEYYD
Sbjct  514   ITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPHLAAKAIKIAEARISRERWPEYYD  573

Query  854   TRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRR  675
             T+  RFIGKQARL QTW++AG+L SK+LL+NP+   +L   ED EL+    C L  N +R
Sbjct  574   TKKARFIGKQARLYQTWSIAGFLVSKLLLRNPETIKILTCEEDAELVNAFYCMLDANPKR  633

Query  674   KCSR  663
             K +R
Sbjct  634   KRNR  637



>ref|XP_008788363.1| PREDICTED: alkaline/neutral invertase CINV1 [Phoenix dactylifera]
 ref|XP_008788372.1| PREDICTED: alkaline/neutral invertase CINV1 [Phoenix dactylifera]
Length=633

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/514 (70%), Positives = 421/514 (82%), Gaps = 7/514 (1%)
 Frame = -3

Query  2201  KDGGRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVA  2022
             ++G  V I D S      L GS+   +  +R  S VE EAW LLQ +VV YCG PVGT+A
Sbjct  117   ENGPAVAIDDKSV-----LAGSAKHAMHKKRGNS-VEDEAWSLLQESVVYYCGSPVGTIA  170

Query  2021  ANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQ  1842
             A DP+D   LNYDQVFIRDFIPS +AFLL GE EIV+NF+LHTLQLQSWEKT+DC+SPGQ
Sbjct  171   AKDPSDSNVLNYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQ  230

Query  1841  GLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDY  1662
             GLMPASFKVRT+PLDG +   E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD 
Sbjct  231   GLMPASFKVRTVPLDGDDLATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDL  290

Query  1661  TLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL  1482
             ++QER+DVQTGI++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL
Sbjct  291   SVQERIDVQTGIKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL  350

Query  1481  RCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINK  1302
              C REML   D +  L+ A+NNRL ALSFHIREYYWVDM+K+NEIYRYKTEEYS DA+NK
Sbjct  351   LCAREMLAPEDGSADLIRALNNRLIALSFHIREYYWVDMRKLNEIYRYKTEEYSYDAVNK  410

Query  1301  FNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILN  1122
             FNIYPDQI PW+V W+P+ GGY +GNLQPAHMDFRFF+LGNLW+I+SSL T  Q+ +IL+
Sbjct  411   FNIYPDQISPWLVEWVPDKGGYFIGNLQPAHMDFRFFSLGNLWSIVSSLATVHQSHAILD  470

Query  1121  FIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACI  942
              IE KW DL+A MP KICYPALEG++WRIITGSDPKNTPWSYHNGG+WPTLLWQ  +ACI
Sbjct  471   LIEAKWSDLVADMPFKICYPALEGQEWRIITGSDPKNTPWSYHNGGAWPTLLWQLAVACI  530

Query  941   KMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKN  762
             KM +PE+A +AV VAE+R+  D+WPEYYDT+  RF+GKQ+RL+QTW++AG+L +K+LL N
Sbjct  531   KMNRPEIAARAVEVAEKRIAADKWPEYYDTKQARFLGKQSRLHQTWSIAGFLVAKLLLDN  590

Query  761   PDMASLLVWNEDYELLENC-VCGLKYNGRRKCSR  663
             P+ A  L  +ED E+L    + G   N RRK  R
Sbjct  591   PNAAKTLWNDEDAEILNALNIMGDPSNPRRKRGR  624



>gb|KDO46923.1| hypothetical protein CISIN_1g006329mg [Citrus sinensis]
 gb|KDO46924.1| hypothetical protein CISIN_1g006329mg [Citrus sinensis]
 gb|KDO46925.1| hypothetical protein CISIN_1g006329mg [Citrus sinensis]
 gb|KDO46926.1| hypothetical protein CISIN_1g006329mg [Citrus sinensis]
 gb|KDO46927.1| hypothetical protein CISIN_1g006329mg [Citrus sinensis]
Length=650

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/504 (69%), Positives = 416/504 (83%), Gaps = 1/504 (0%)
 Frame = -3

Query  2174  DDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLP  1995
             +  +   N   G++I  ++ +  V  +E EAW LL+ ++V YCG P+GT+AANDP     
Sbjct  139   EKKSFTSNGAAGTTIDSVS-KATVDCLEDEAWNLLRDSMVYYCGSPIGTIAANDPTSSNV  197

Query  1994  LNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV  1815
             LNYDQVFIRDFIPS +AFLL GE +IV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKV
Sbjct  198   LNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKV  257

Query  1814  RTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQ  1635
             RT+PLDG +   E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD  +QER+DVQ
Sbjct  258   RTVPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLLVQERIDVQ  317

Query  1634  TGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIV  1455
             TGI++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C REML  
Sbjct  318   TGIKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAP  377

Query  1454  NDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIP  1275
              D +  L+ A+NNRL ALSFHIREYYW+D++K+NEIYRYKTEEYS DA+NKFNIYPDQIP
Sbjct  378   EDGSADLIRALNNRLVALSFHIREYYWIDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQIP  437

Query  1274  PWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDL  1095
             PW+V W+P  GGYL+GNLQPAHMDFRFF+LGN+W+I++ L T +Q+ +IL+ +E KW DL
Sbjct  438   PWLVEWMPNKGGYLIGNLQPAHMDFRFFSLGNIWSIVNGLATRDQSHAILDLMEAKWADL  497

Query  1094  IAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAM  915
             +A MPLKICYPALEG++W+IITGSDPKNTPWSYHN GSWPTLLWQFT+ACIKM +PE+A 
Sbjct  498   VADMPLKICYPALEGQEWQIITGSDPKNTPWSYHNAGSWPTLLWQFTVACIKMNRPEIAA  557

Query  914   KAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVW  735
             +AV VAE+RL  D+WPEYYDT+  RFIGKQA+L QTW++AGYL SK+LL +P  A +L  
Sbjct  558   RAVQVAEKRLSRDKWPEYYDTKRARFIGKQAQLFQTWSIAGYLVSKILLADPSAAKILTT  617

Query  734   NEDYELLENCVCGLKYNGRRKCSR  663
              ED EL+    C +  N RRK  R
Sbjct  618   EEDSELVNAFSCMISANPRRKRGR  641



>gb|KDO72047.1| hypothetical protein CISIN_1g0061311mg, partial [Citrus sinensis]
Length=535

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/552 (70%), Positives = 437/552 (79%), Gaps = 24/552 (4%)
 Frame = -3

Query  2690  MVSRSCIGISTMKPCSRILGSYN-HSIFWYPFGRCNRQVMDNLSKSQQKIKDVhrmgggr  2514
             M + SCIGISTMKPC RIL  Y   SIF     R N ++++N SK   K K         
Sbjct  1     MNTSSCIGISTMKPCCRILIGYRISSIFGVSHIRSNHKIVNNSSKLHSKSK-----LSCY  55

Query  2513  yrhrHSVVTLTR-VINSNRCAFCGSGSNGDQHRDSFCNWLGRSKN--RLVFVVPKVASDM  2343
                +  V+   + VI+ NR AF  SGSN  + +    N LG +K+  R + V+P VASD 
Sbjct  56    NDAKCKVIGHKKGVIDLNRRAFFASGSNWGESKILGKNKLGVNKDSSRGILVIPHVASDF  115

Query  2342  RSHSTSTEAQVNDKSFKKFYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDST  2163
             R+HSTS ++ VN+K F+  YIQGG+NVKPLVIE             ++DG RV++ + S 
Sbjct  116   RNHSTSIDSHVNEKGFESIYIQGGLNVKPLVIENGNEVV-------KEDGSRVQV-NGSG  167

Query  2162  VNKN---DLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPL  1992
             VN +   DLN      +  E E S +EKEAWKLL+ AVVNYCG PVGTVAAN+PADK PL
Sbjct  168   VNLDILKDLN----ENVETESEASNIEKEAWKLLRDAVVNYCGNPVGTVAANNPADKQPL  223

Query  1991  NYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR  1812
             NYDQVFIRDF+PSALAFLLNGEG+IVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR
Sbjct  224   NYDQVFIRDFVPSALAFLLNGEGDIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR  283

Query  1811  TMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQT  1632
             T+PLDG +G  E+VLDPDFGESAIGRVAPVDSGLWWIILLRAY KITGDY LQERVDVQT
Sbjct  284   TVPLDGGDGTLEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQT  343

Query  1631  GIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVN  1452
             GIRLILNLCL DGFDMFP+LLVTDGSCMIDRRMGIHGHPLEIQ+LFYSALRC+REMLIVN
Sbjct  344   GIRLILNLCLTDGFDMFPSLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLIVN  403

Query  1451  DSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPP  1272
             D TK+LVAAINNRLSALSFH+REYYWVDMKKINEIYRYKTEEYS DAINKFNIYPDQIP 
Sbjct  404   DGTKNLVAAINNRLSALSFHVREYYWVDMKKINEIYRYKTEEYSADAINKFNIYPDQIPS  463

Query  1271  WIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLI  1092
             W+V+WIP  GGYL+GNL+P HMDFRFFTLGNLWAI+SSLGT  QN+ ILN IE KWDDL+
Sbjct  464   WLVDWIPNEGGYLIGNLEPGHMDFRFFTLGNLWAIVSSLGTARQNEGILNLIEAKWDDLV  523

Query  1091  AQMPLKICYPAL  1056
             A MPLKICYPAL
Sbjct  524   AHMPLKICYPAL  535



>gb|KHG04215.1| hypothetical protein F383_30053 [Gossypium arboreum]
Length=620

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/482 (72%), Positives = 406/482 (84%), Gaps = 0/482 (0%)
 Frame = -3

Query  2096  VEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEI  1917
             +E+EAW LL+ +VV YCG P+GT+AA+D +    LNYDQVFIRDFIPS +AFLL GE +I
Sbjct  134   IEEEAWDLLKESVVYYCGNPIGTIAASDTSSSSILNYDQVFIRDFIPSGIAFLLKGEYDI  193

Query  1916  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIG  1737
             V+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLDG N   EDVLDPDFGE+AIG
Sbjct  194   VRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDNSVTEDVLDPDFGEAAIG  253

Query  1736  RVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDG  1557
             RVAPVDSGLWWIILLRAY K TGD ++QERVDVQTGI++IL LCL DGFDMFPTLLVTDG
Sbjct  254   RVAPVDSGLWWIILLRAYGKCTGDLSVQERVDVQTGIKMILKLCLADGFDMFPTLLVTDG  313

Query  1556  SCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYY  1377
             SCMIDRRMGIHGHPLEIQALFYSAL C REML   D +  L+ A+NNRL ALSFHIREYY
Sbjct  314   SCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNRLVALSFHIREYY  373

Query  1376  WVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFR  1197
             W+DMKK+NEIYRYKTEEYS DA+NKFNIYPDQIP W+V ++P  GGYL+GNLQPAHMDFR
Sbjct  374   WIDMKKLNEIYRYKTEEYSYDAVNKFNIYPDQIPSWLVEFMPSRGGYLIGNLQPAHMDFR  433

Query  1196  FFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDP  1017
             FF+LGNLW+I+  L T +Q+ +IL+ +E KW +L+A MPLKICYPALEG++WRIITGSDP
Sbjct  434   FFSLGNLWSIVGGLATVDQSHAILDLVEEKWSELVADMPLKICYPALEGQEWRIITGSDP  493

Query  1016  KNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRF  837
             KNT WSYHNGGSWPTLLWQ T+AC+KM +PE+A KAV +AE RL  D+WPEYYDTR  RF
Sbjct  494   KNTAWSYHNGGSWPTLLWQLTVACMKMNRPEIAEKAVMLAERRLSRDKWPEYYDTRRARF  553

Query  836   IGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFG  657
             IGKQ+RL QTW++AGYL +K+LL NP  A +L+  ED EL+    C L  N RRK  R G
Sbjct  554   IGKQSRLFQTWSIAGYLVAKLLLANPSAAKVLITEEDSELVNAFSCMLSANPRRKRGRKG  613

Query  656   VR  651
              +
Sbjct  614   FK  615



>ref|XP_006492196.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X1 [Citrus 
sinensis]
Length=650

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/504 (69%), Positives = 416/504 (83%), Gaps = 1/504 (0%)
 Frame = -3

Query  2174  DDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLP  1995
             +  +   N   G++I  ++ +  V  +E EAW LL+ ++V YCG P+GT+AANDP     
Sbjct  139   EKKSFTSNGAAGTTIDSVS-KATVDCLEDEAWNLLRDSMVYYCGSPIGTIAANDPTASNV  197

Query  1994  LNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKV  1815
             LNYDQVFIRDFIPS +AFLL GE +IV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKV
Sbjct  198   LNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKV  257

Query  1814  RTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQ  1635
             RT+PLDG +   E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD  +QER+DVQ
Sbjct  258   RTVPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLLVQERIDVQ  317

Query  1634  TGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIV  1455
             TGI++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C REML  
Sbjct  318   TGIKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAP  377

Query  1454  NDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIP  1275
              D +  L+ A+NNRL ALSFHIREYYW+D++K+NEIYRYKTEEYS DA+NKFNIYPDQIP
Sbjct  378   EDGSADLIRALNNRLVALSFHIREYYWIDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQIP  437

Query  1274  PWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDL  1095
             PW+V W+P  GGYL+GNLQPAHMDFRFF+LGN+W+I++ L T +Q+ +IL+ +E KW DL
Sbjct  438   PWLVEWMPNKGGYLIGNLQPAHMDFRFFSLGNIWSIVNGLATRDQSHAILDLMEAKWADL  497

Query  1094  IAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAM  915
             +A MPLKICYPALEG++W+IITGSDPKNTPWSYHN GSWPTLLWQFT+ACIKM +PE+A 
Sbjct  498   VADMPLKICYPALEGQEWQIITGSDPKNTPWSYHNAGSWPTLLWQFTVACIKMNRPEIAA  557

Query  914   KAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVW  735
             +AV VAE+RL  D+WPEYYDT+  RFIGKQA+L QTW++AGYL SK+LL +P  A +L  
Sbjct  558   RAVQVAEKRLSRDKWPEYYDTKRARFIGKQAQLFQTWSIAGYLVSKILLADPSAAKILTT  617

Query  734   NEDYELLENCVCGLKYNGRRKCSR  663
              ED EL+    C +  N RRK  R
Sbjct  618   EEDSELVNAFSCMISANPRRKRGR  641



>ref|XP_009364876.1| PREDICTED: alkaline/neutral invertase CINV2-like [Pyrus x bretschneideri]
Length=624

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/475 (73%), Positives = 406/475 (85%), Gaps = 0/475 (0%)
 Frame = -3

Query  2096  VEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEI  1917
             +E+EAW LL+ ++V YC  PVGT+AANDP+    LNYDQVFIRDFIPS +AFLL GE +I
Sbjct  141   IEEEAWTLLKNSMVYYCNNPVGTIAANDPSSPSTLNYDQVFIRDFIPSGIAFLLKGEYDI  200

Query  1916  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIG  1737
             V+NF+LHTLQLQSWEKT+DCYSPGQGLMPASFKVRT+PLDG     EDVLDPDFGE+AIG
Sbjct  201   VRNFILHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLDGDEFATEDVLDPDFGEAAIG  260

Query  1736  RVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDG  1557
             RVAPVDSGLWWIILLRAY K + D ++QERVDVQTGI++IL LCL DGFDMFPTLLVTDG
Sbjct  261   RVAPVDSGLWWIILLRAYGKCSRDLSVQERVDVQTGIKMILKLCLADGFDMFPTLLVTDG  320

Query  1556  SCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYY  1377
             SCMIDRRMGIHGHPLEIQALFYSAL C REML   +++  LV A+NNRL ALSFHIREYY
Sbjct  321   SCMIDRRMGIHGHPLEIQALFYSALLCVREMLAPEEASADLVRALNNRLVALSFHIREYY  380

Query  1376  WVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFR  1197
             W+DM+K+NEIYRYKTEEYS DA+NKFNIYPDQIP W+V ++P TGGYL+GNLQPAHMDFR
Sbjct  381   WIDMRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPSWLVGFMPSTGGYLIGNLQPAHMDFR  440

Query  1196  FFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDP  1017
             FF+LGNLW+I+SSL T  Q+ +IL+ IE KWD+L+A MP KICYPALEG++W+IITGSDP
Sbjct  441   FFSLGNLWSIVSSLATDLQSHAILDLIEAKWDELVADMPFKICYPALEGQEWQIITGSDP  500

Query  1016  KNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRF  837
             KNTPWSYHNGGSWPTLLWQ T+ACIK+ +PE+A KAV +AE+R+ +D+WPEYYDT+  RF
Sbjct  501   KNTPWSYHNGGSWPTLLWQLTVACIKLNRPEIAAKAVEIAEKRISIDKWPEYYDTKRARF  560

Query  836   IGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRK  672
             IGKQA+L QTW+VAGYL +K+LL NP  A  LV  ED EL+    C +  + RRK
Sbjct  561   IGKQAQLYQTWSVAGYLVAKLLLANPSAAKNLVNEEDSELINAFSCMISASPRRK  615



>gb|EAY86114.1| hypothetical protein OsI_07486 [Oryza sativa Indica Group]
Length=624

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/524 (68%), Positives = 416/524 (79%), Gaps = 19/524 (4%)
 Frame = -3

Query  2192  GRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAAND  2013
             G V +   +      +NGS+       R+ S VE EAW+LL+ +VV YCG PVGT+AAND
Sbjct  94    GDVRVPGQAVGGNGSVNGSAAKPPPQRRKASSVEDEAWELLRESVVYYCGSPVGTIAAND  153

Query  2012  PADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQ----------------  1881
             P D  P+NYDQVFIRDFIPS +AFLL GE EIV+NF+LHTLQLQ                
Sbjct  154   PNDANPMNYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQVFFFRHIIALSLEEVR  213

Query  1880  --SWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLW  1707
               SWEKT+DC+SPGQGLMPASFKVRT+PLDG     E+VLDPDFGE+AIGRVAPVDSGLW
Sbjct  214   TMSWEKTMDCHSPGQGLMPASFKVRTIPLDGDEDATEEVLDPDFGEAAIGRVAPVDSGLW  273

Query  1706  WIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGI  1527
             WIILLRAY K +GD T+QER+DVQTGI++IL LCL DGFDMFPTLLVTDGSCMIDRRMGI
Sbjct  274   WIILLRAYGKCSGDLTVQERIDVQTGIKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGI  333

Query  1526  HGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEI  1347
             HGHPLEIQALFYSAL C REML   D +  L+ A+NNRL ALSFHIREYYWVDM+K+NEI
Sbjct  334   HGHPLEIQALFYSALLCAREMLTPEDGSADLIRALNNRLIALSFHIREYYWVDMQKLNEI  393

Query  1346  YRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAI  1167
             YRYKTEEYS DA+NKFNIYPDQ+ PW+V WIP  GGY +GNLQPAHMDFRFF+LGNLW+I
Sbjct  394   YRYKTEEYSYDAVNKFNIYPDQVSPWLVEWIPPKGGYFIGNLQPAHMDFRFFSLGNLWSI  453

Query  1166  ISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNG  987
             +SSL T  Q+ +IL+ IE KW DL+A+MPLKICYPALE ++W+IITGSDPKNTPWSYHNG
Sbjct  454   VSSLATTHQSHAILDLIESKWSDLVAEMPLKICYPALENQEWKIITGSDPKNTPWSYHNG  513

Query  986   GSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQT  807
             GSWPTLLWQ T+A IKM +PE+A KAV VAE R+ +D+WPEYYDT+  RFIGKQ+RL QT
Sbjct  514   GSWPTLLWQLTVASIKMNRPEIAAKAVEVAERRIAIDKWPEYYDTKRARFIGKQSRLYQT  573

Query  806   WTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRR  675
             W++AGYL +K LL  PD A +L  +ED E+L N +   +  G++
Sbjct  574   WSIAGYLVAKQLLDKPDAARILSNDEDAEIL-NALSTNRKRGKK  616



>ref|XP_010535668.1| PREDICTED: alkaline/neutral invertase CINV1 [Tarenaya hassleriana]
Length=637

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/484 (72%), Positives = 408/484 (84%), Gaps = 0/484 (0%)
 Frame = -3

Query  2096  VEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEI  1917
             +E+EAW LL+ +VV YCG P+GT+AANDP     LNYDQVFIRDFIPS +AFLL GE +I
Sbjct  150   IEEEAWDLLRESVVYYCGNPIGTIAANDPNSSSVLNYDQVFIRDFIPSGIAFLLKGEYDI  209

Query  1916  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIG  1737
             V+NF+L+TLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLDG +   E+VLDPDFGE+AIG
Sbjct  210   VRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSMTEEVLDPDFGEAAIG  269

Query  1736  RVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDG  1557
             RVAPVDSGLWWIILLRAY K TGD+++QERVDVQTGI++IL LCL DGFDMFPTLLVTDG
Sbjct  270   RVAPVDSGLWWIILLRAYGKCTGDHSVQERVDVQTGIKMILKLCLADGFDMFPTLLVTDG  329

Query  1556  SCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYY  1377
             SCMIDRRMGIHGHPLEIQALFYSAL C REML   D +  L+ A+NNRL ALSFHIREYY
Sbjct  330   SCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDGSADLIRALNNRLVALSFHIREYY  389

Query  1376  WVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFR  1197
             W+D+KKINEIYRY+TEEYS DA+NKFNIYPDQIP W+V+++P  GGYL+GNLQPAHMDFR
Sbjct  390   WLDLKKINEIYRYQTEEYSYDAVNKFNIYPDQIPSWLVDFMPNRGGYLIGNLQPAHMDFR  449

Query  1196  FFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDP  1017
             FF+LGNLW+I+SSL T++Q+ +IL+ IE KW +L+A MP KICYPALEGE+WRIITGSDP
Sbjct  450   FFSLGNLWSIVSSLATNDQSHAILDLIEAKWAELVADMPFKICYPALEGEEWRIITGSDP  509

Query  1016  KNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRF  837
             KNTPWSYHNGG+WPTLLWQ T+ACIKM +PE+A KAV +AE R+  D+WPEYYDT+  RF
Sbjct  510   KNTPWSYHNGGAWPTLLWQLTVACIKMERPEIAEKAVELAERRIARDKWPEYYDTKRARF  569

Query  836   IGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFG  657
             IGKQARL QTW++AGYL +K+LL+NP  A  L   ED +L       +  N RRK  R G
Sbjct  570   IGKQARLYQTWSIAGYLVAKLLLENPSAAKFLSNEEDSDLKSAFSSIISANPRRKRGRKG  629

Query  656   VRSQ  645
                Q
Sbjct  630   ANKQ  633



>ref|XP_002529075.1| beta-fructofuranosidase, putative [Ricinus communis]
 gb|EEF33319.1| beta-fructofuranosidase, putative [Ricinus communis]
Length=634

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/482 (72%), Positives = 410/482 (85%), Gaps = 0/482 (0%)
 Frame = -3

Query  2096  VEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEI  1917
             +++EAW LL+ ++V YC  P+GT+AANDP+D   LNYDQVFIRDFIPS +AFLL GE +I
Sbjct  148   IDEEAWDLLRASIVYYCSNPIGTIAANDPSDTSILNYDQVFIRDFIPSGIAFLLKGEFDI  207

Query  1916  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIG  1737
             V+NF+L+TLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLDG +   EDVLDPDFGE+AIG
Sbjct  208   VRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVRTIPLDGDDSASEDVLDPDFGEAAIG  267

Query  1736  RVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDG  1557
             RVAPVDSGLWWIILLRAY K +GD ++QERVDVQTGI++IL LCL DGFDMFPTLLVTDG
Sbjct  268   RVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADGFDMFPTLLVTDG  327

Query  1556  SCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYY  1377
             SCMIDRRMGIHGHPLEIQALFYSAL C REML   D++  L+ A+NNRL ALSFHIREYY
Sbjct  328   SCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDASVDLIRALNNRLVALSFHIREYY  387

Query  1376  WVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFR  1197
             W+DMKK+NEIYRYKTEEYS DA+NKFNIYPDQIP W+V ++P  GGYL+GNLQPAHMDFR
Sbjct  388   WIDMKKLNEIYRYKTEEYSYDAVNKFNIYPDQIPSWLVEFMPNRGGYLIGNLQPAHMDFR  447

Query  1196  FFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDP  1017
             FF+LGNLW+I+SSL T +Q+ +IL+ IE KW +L+A+MP KICYPALEG++WRIITGSDP
Sbjct  448   FFSLGNLWSIVSSLATVDQSHAILDLIEAKWKELVAEMPFKICYPALEGQEWRIITGSDP  507

Query  1016  KNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRF  837
             KNTPWSYHNGGSWPTLLWQ T+ACI+M +PE+A KAV +AE R+  D+WPEYYDT+  RF
Sbjct  508   KNTPWSYHNGGSWPTLLWQLTVACIRMKRPEIAEKAVKLAERRISRDKWPEYYDTKKARF  567

Query  836   IGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFG  657
             IGKQARL QTW++AGYL +K+LL NP  A +LV  ED ELL      +  + RRK  R G
Sbjct  568   IGKQARLFQTWSIAGYLVAKLLLDNPSAAKILVNEEDPELLNTFSYMINASPRRKRGRVG  627

Query  656   VR  651
              +
Sbjct  628   SK  629



>emb|CDP06959.1| unnamed protein product [Coffea canephora]
Length=640

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/509 (68%), Positives = 421/509 (83%), Gaps = 3/509 (1%)
 Frame = -3

Query  2180  ITDDSTVNKNDLNGSSISKLAPERE---VSEVEKEAWKLLQGAVVNYCGYPVGTVAANDP  2010
             + ++ TV  +D   ++ S+++   +   ++ +E EAW LL+ ++V YCG P+GT+AANDP
Sbjct  124   LNNEKTVISSDDEIAAASEMSDTLQGFGINSIEDEAWNLLRASIVYYCGNPIGTIAANDP  183

Query  2009  ADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMP  1830
             +    LNYDQ+FIRDFIPS +AFLL GE +IV+NF+LHTLQLQSWEKT+DC+SPGQGLMP
Sbjct  184   SAANILNYDQIFIRDFIPSGMAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMP  243

Query  1829  ASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQE  1650
             ASFKVRT+PLDG +   EDVLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD ++QE
Sbjct  244   ASFKVRTVPLDGDDSATEDVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKFSGDLSVQE  303

Query  1649  RVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTR  1470
             RVDVQTGI++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C R
Sbjct  304   RVDVQTGIKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAR  363

Query  1469  EMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIY  1290
             EML+  +++  L+ A+NNRL ALSFHIREYYW+DM+K+NEIYRY TEEYS DA+NKFNIY
Sbjct  364   EMLVPEEASADLIRALNNRLVALSFHIREYYWIDMRKLNEIYRYTTEEYSYDAVNKFNIY  423

Query  1289  PDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEG  1110
             PDQIPPW+V W+P TGGY +GNLQPAHMDFRFF+LGNLW+IISSL T +Q+ +IL+ IE 
Sbjct  424   PDQIPPWLVEWMPTTGGYFIGNLQPAHMDFRFFSLGNLWSIISSLATTDQSHAILDLIEA  483

Query  1109  KWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGK  930
             KW+D++A MPLKICYPALEGE+W+IITG DPKNTPWSYHN G+WPTLLWQ T+ACIKM +
Sbjct  484   KWEDIVANMPLKICYPALEGEEWQIITGYDPKNTPWSYHNAGAWPTLLWQLTVACIKMNR  543

Query  929   PELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMA  750
             PE+A  A+ VAE R+  D+WPEYYDT+  RFIGKQARL QTW++AGYL +K+L+ NP  A
Sbjct  544   PEIAENAIKVAERRIARDKWPEYYDTKGARFIGKQARLFQTWSIAGYLVAKLLISNPKAA  603

Query  749   SLLVWNEDYELLENCVCGLKYNGRRKCSR  663
               L+  ED EL+      L  N +++  R
Sbjct  604   KKLINVEDSELVNALSYALSANPKKRPRR  632



>emb|CDY26937.1| BnaC09g36460D [Brassica napus]
Length=610

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/481 (72%), Positives = 406/481 (84%), Gaps = 0/481 (0%)
 Frame = -3

Query  2105  VSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGE  1926
              + +E EAW LL+ ++V YCG P+GT+AANDP     LNYDQVFIRDFIPS +AFLL GE
Sbjct  121   TNSIEDEAWDLLRQSIVYYCGSPIGTIAANDPNSTSVLNYDQVFIRDFIPSGIAFLLKGE  180

Query  1925  GEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGES  1746
              +IV+NF+L+TLQLQSWEKT+DC+SPGQGLMPASFKV+T+PLDG +   E+VLDPDFGE+
Sbjct  181   YDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVKTVPLDGDDSMTEEVLDPDFGEA  240

Query  1745  AIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLV  1566
             AIGRVAPVDSGLWWIILLRAY K TGD ++QERVDVQTGI++IL LCL DGFDMFPTLLV
Sbjct  241   AIGRVAPVDSGLWWIILLRAYGKCTGDVSVQERVDVQTGIKMILKLCLADGFDMFPTLLV  300

Query  1565  TDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIR  1386
             TDGSCMIDRRMGIHGHPLEIQALFYSAL C REML   D +  L+ A+NNRL ALSFHIR
Sbjct  301   TDGSCMIDRRMGIHGHPLEIQALFYSALVCAREMLTPEDGSADLIRALNNRLVALSFHIR  360

Query  1385  EYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHM  1206
             EYYW+DMKKINEIYRY+TEEYS DA+NKFNIYPDQIP W+V+++P  GGYL+GNLQPAHM
Sbjct  361   EYYWLDMKKINEIYRYQTEEYSYDAVNKFNIYPDQIPSWLVDFMPNRGGYLIGNLQPAHM  420

Query  1205  DFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITG  1026
             DFRFF+LGN+W+I+SSL T++Q+ +IL+F+E KW +L+A MP KICYPA+EGE+WRIITG
Sbjct  421   DFRFFSLGNVWSIVSSLATNDQSHAILDFVEAKWAELVADMPFKICYPAMEGEEWRIITG  480

Query  1025  SDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRH  846
             SDPKNTPWSYHNGGSWPTLLWQ T+A IKMG+PE+A KAV +AE R+ +D+WPEYYDT+ 
Sbjct  481   SDPKNTPWSYHNGGSWPTLLWQLTVASIKMGRPEIAEKAVELAERRIAIDKWPEYYDTKR  540

Query  845   GRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCS  666
              RFIGKQARL QTW++AGYL +K+LL NP  A  L   ED +L     C +  N RR   
Sbjct  541   ARFIGKQARLYQTWSIAGYLVAKLLLANPSAAKFLTSEEDSDLRNAFSCMISANPRRTRG  600

Query  665   R  663
             R
Sbjct  601   R  601



>emb|CAM32308.1| neutral/alkaline invertase [Lolium perenne]
Length=603

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/493 (71%), Positives = 407/493 (83%), Gaps = 0/493 (0%)
 Frame = -3

Query  2192  GRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAAND  2013
             G V +   +      L+G+    L   R +S VE EAW LL+ +VVNYCG PVGT+AAND
Sbjct  91    GDVAVPGQAIGGNASLSGNPEKVLPRRRNLSSVEDEAWDLLRESVVNYCGSPVGTIAAND  150

Query  2012  PADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLM  1833
             P D  P NYDQVFIRDFIPS +AFLL GE EIV+NF+LHTLQLQSWEKT+DC+SPGQGLM
Sbjct  151   PNDSNPANYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLM  210

Query  1832  PASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQ  1653
             PASFKVRT+PLDG     E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD ++Q
Sbjct  211   PASFKVRTIPLDGDENATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQ  270

Query  1652  ERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCT  1473
             ER+DVQTGI++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL   
Sbjct  271   ERIDVQTGIKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLSA  330

Query  1472  REMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNI  1293
             REML   D +  L+ A+NNRL ALSFHIREYYWVDM+K+NEIYRYKTEEYS DA+NKFNI
Sbjct  331   REMLTPEDGSADLIRALNNRLVALSFHIREYYWVDMQKLNEIYRYKTEEYSYDAVNKFNI  390

Query  1292  YPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIE  1113
             YPDQ+ PW+V WIP  GGY +GNLQPAHMDFRFF+LGNLW+I+SSL T +Q+ +IL+ IE
Sbjct  391   YPDQVSPWLVEWIPPKGGYFIGNLQPAHMDFRFFSLGNLWSIVSSLATTQQSHAILDLIE  450

Query  1112  GKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG  933
              KW DL+A+MPLKICYPALE  +W+IITGSDPKNTPWSYHNGGSWPTLLWQ T+A +KM 
Sbjct  451   SKWSDLVAEMPLKICYPALENLEWKIITGSDPKNTPWSYHNGGSWPTLLWQLTVASLKMN  510

Query  932   KPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDM  753
             +PE+A KAV +AE R+  D+WPEYYDT+  RFIGKQ+RL QTW++AGYL +K LL  PD 
Sbjct  511   RPEIAAKAVEIAERRIATDKWPEYYDTKRARFIGKQSRLYQTWSIAGYLVAKQLLDKPDA  570

Query  752   ASLLVWNEDYELL  714
             A +L  +ED E+L
Sbjct  571   ARILWNDEDTEIL  583



>emb|CAA05869.1| alkaline/neutral invertase [Lolium temulentum]
Length=571

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/493 (71%), Positives = 407/493 (83%), Gaps = 0/493 (0%)
 Frame = -3

Query  2192  GRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAAND  2013
             G V +   +      L+G+    L   R +S VE EAW LL+ +VVNYCG PVGT+AAND
Sbjct  59    GDVAVPGQALGGNASLSGNPEKVLPRRRNLSSVEDEAWDLLRESVVNYCGSPVGTIAAND  118

Query  2012  PADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLM  1833
             P D  P NYDQVFIRDFIPS +AFLL GE EIV+NF+LHTLQLQSWEKT+DC+SPGQGLM
Sbjct  119   PNDSNPANYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLM  178

Query  1832  PASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQ  1653
             PASFKVRT+PLDG     E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD ++Q
Sbjct  179   PASFKVRTIPLDGDENATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQ  238

Query  1652  ERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCT  1473
             ER+DVQTGI++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL   
Sbjct  239   ERIDVQTGIKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLSA  298

Query  1472  REMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNI  1293
             REML   D +  L+ A+NNRL ALSFHIREYYWVDM+K+NEIYRYKTEEYS DA+NKFNI
Sbjct  299   REMLTPEDGSADLIRALNNRLVALSFHIREYYWVDMQKLNEIYRYKTEEYSYDAVNKFNI  358

Query  1292  YPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIE  1113
             YPDQ+ PW+V WIP  GGY +GNLQPAHMDFRFF+LGNLW+I+SSL T +Q+ +IL+ IE
Sbjct  359   YPDQVSPWLVEWIPPKGGYFIGNLQPAHMDFRFFSLGNLWSIVSSLATTQQSHAILDLIE  418

Query  1112  GKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG  933
              KW DL+A+MPLKICYPALE  +W+IITGSDPKNTPWSYHNGGSWPTLLWQ T+A +KM 
Sbjct  419   SKWSDLVAEMPLKICYPALENLEWKIITGSDPKNTPWSYHNGGSWPTLLWQLTVASLKMN  478

Query  932   KPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDM  753
             +PE+A KAV +AE R+  D+WPEYYDT+  RFIGKQ+RL QTW++AGYL +K LL  PD 
Sbjct  479   RPEIAAKAVEIAERRIATDKWPEYYDTKRARFIGKQSRLYQTWSIAGYLVAKQLLDKPDA  538

Query  752   ASLLVWNEDYELL  714
             A +L  +ED E+L
Sbjct  539   ARILWNDEDTEIL  551



>gb|KDP45002.1| hypothetical protein JCGZ_01502 [Jatropha curcas]
Length=665

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/495 (70%), Positives = 412/495 (83%), Gaps = 4/495 (1%)
 Frame = -3

Query  2144  NGSSISKLAPEREVS--EVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLP--LNYDQV  1977
             NG+++       +VS   +E EAW LL+ +VV YCG P+GT+AANDP       LNYDQV
Sbjct  159   NGAAVIDRDTSNKVSIDSIEDEAWDLLRDSVVYYCGSPIGTIAANDPTCPTSNLLNYDQV  218

Query  1976  FIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLD  1797
             FIRDFIPS +AFLL GE +IV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLD
Sbjct  219   FIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLD  278

Query  1796  GRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLI  1617
             G +   E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD ++QER+DVQTGI++I
Sbjct  279   GDDSATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKSSGDLSVQERIDVQTGIKMI  338

Query  1616  LNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKS  1437
             L LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C REML   D +  
Sbjct  339   LRLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSAD  398

Query  1436  LVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNW  1257
             L+ A+NNRL ALSFHIREYYW+D++K+NEIYRYKTEEYS DA+NKFNIYPDQIPPW+V+W
Sbjct  399   LIRALNNRLVALSFHIREYYWIDLRKVNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVDW  458

Query  1256  IPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPL  1077
             +P  GGYL+GNLQPAHMDFRFFTLGNLW+++SSL T +Q+ +IL+ +E KW DL+A MP 
Sbjct  459   MPTRGGYLIGNLQPAHMDFRFFTLGNLWSVVSSLATADQSHAILDLLEAKWTDLVADMPF  518

Query  1076  KICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVA  897
             KICYPALEG++W+IITGSDPKNTPWSYHN GSWPTLLWQ T+ACIKM +PE+A +AV VA
Sbjct  519   KICYPALEGQEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRPEIAARAVEVA  578

Query  896   EERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYEL  717
             E R+  D+WPEYYDT+  R IGKQARL QTW++AGYL +K+LL +P  A +L+  ED EL
Sbjct  579   ERRISRDKWPEYYDTKRARLIGKQARLFQTWSIAGYLVAKILLADPSAAKMLITEEDSEL  638

Query  716   LENCVCGLKYNGRRK  672
             +    C +  N RRK
Sbjct  639   VNAFSCMISANPRRK  653



>ref|XP_003630134.1| Alkaline/neutral invertase [Medicago truncatula]
 gb|AET04610.1| alkaline/neutral invertase [Medicago truncatula]
Length=645

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/502 (68%), Positives = 417/502 (83%), Gaps = 1/502 (0%)
 Frame = -3

Query  2180  ITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADK  2001
             +  +  V  +++   +++K      ++ +E+EAW LL+ +VVNYCG P+GT+AA DP   
Sbjct  134   LEQEKEVLSSNVTNGTVTKNLGTISLNSIEEEAWDLLRESVVNYCGNPIGTIAAKDPNST  193

Query  2000  LPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASF  1821
               LNYDQVFIRDFIPS +AFLL GE +IV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASF
Sbjct  194   NVLNYDQVFIRDFIPSGVAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASF  253

Query  1820  KVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVD  1641
             KVRT+PL+G +   E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD ++QERVD
Sbjct  254   KVRTVPLEGDDSATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVD  313

Query  1640  VQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREML  1461
             VQTGI++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRC REML
Sbjct  314   VQTGIKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREML  373

Query  1460  IVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQ  1281
                D +  L+ A+NNRL ALSFHIREYYW+DMK++NEIYRYKTEEYS DA+NKFNIYPDQ
Sbjct  374   TPEDGSADLIRALNNRLVALSFHIREYYWIDMKRLNEIYRYKTEEYSYDAVNKFNIYPDQ  433

Query  1280  IPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWD  1101
             I PW+V W+P  GGYL+GNLQPAHMDFRFF+LGNLW+++SS+ T EQ+ +IL+ IE KW 
Sbjct  434   ISPWLVEWMPNKGGYLIGNLQPAHMDFRFFSLGNLWSVVSSMATEEQSHAILDLIEAKWS  493

Query  1100  DLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPEL  921
             DL+A MPLKICYPALEG++W+IITGSDPKNTPWSYHNGGSWP+LLWQ T ACIKM +P +
Sbjct  494   DLVADMPLKICYPALEGQEWQIITGSDPKNTPWSYHNGGSWPSLLWQLTAACIKMNRPHI  553

Query  920   AMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLL  741
             A KAV +AE R+  D+WPEYYDT+  RFIGKQ++L QTW++AGYL SK+LL +P  A++L
Sbjct  554   AAKAVEIAERRISRDKWPEYYDTKRSRFIGKQSQLFQTWSIAGYLVSKLLLADPSKANIL  613

Query  740   VWNEDYELLENCVCGLKYNGRR  675
             +  ED +L+ N +      G+R
Sbjct  614   ITEEDSDLV-NALINANPKGKR  634



>emb|CDX92345.1| BnaA10g13840D [Brassica napus]
Length=610

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/481 (72%), Positives = 406/481 (84%), Gaps = 0/481 (0%)
 Frame = -3

Query  2105  VSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGE  1926
              + +E EAW LL+ ++V YCG P+GT+AANDP     LNYDQVFIRDFIPS +AFLL GE
Sbjct  121   TNSIEDEAWDLLRQSIVYYCGSPIGTIAANDPNSTSVLNYDQVFIRDFIPSGIAFLLKGE  180

Query  1925  GEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGES  1746
              +IV+NF+L+TLQLQSWEKT+DC+SPGQGLMPASFKV+T+PLDG +   E+VLDPDFGE+
Sbjct  181   YDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVKTVPLDGDDSMTEEVLDPDFGEA  240

Query  1745  AIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLV  1566
             AIGRVAPVDSGLWWIILLRAY K TGD ++QERVDVQTGI++IL LCL DGFDMFPTLLV
Sbjct  241   AIGRVAPVDSGLWWIILLRAYGKCTGDVSVQERVDVQTGIKMILKLCLADGFDMFPTLLV  300

Query  1565  TDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIR  1386
             TDGSCMIDRRMGIHGHPLEIQALFYSAL C REML   D +  L+ A+NNRL ALSFHIR
Sbjct  301   TDGSCMIDRRMGIHGHPLEIQALFYSALVCAREMLTPEDGSDDLIRALNNRLVALSFHIR  360

Query  1385  EYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHM  1206
             EYYW+DMKKINEIYRY+TEEYS DA+NKFNIYPDQIP W+V+++P  GGYL+GNLQPAHM
Sbjct  361   EYYWLDMKKINEIYRYQTEEYSYDAVNKFNIYPDQIPSWLVDFMPNRGGYLIGNLQPAHM  420

Query  1205  DFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITG  1026
             DFRFF+LGNLW+I+SSL T++Q+ +IL+F+E KW +L+A MP KICYPA+EGE+WRIITG
Sbjct  421   DFRFFSLGNLWSIVSSLATNDQSHAILDFVEAKWAELVADMPFKICYPAMEGEEWRIITG  480

Query  1025  SDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRH  846
             SDPKNTPWSYHNGGSWPTLLWQ T+A IKMG+PE+A KAV +AE R+ +D+WPEYYDT+ 
Sbjct  481   SDPKNTPWSYHNGGSWPTLLWQLTVASIKMGRPEIAEKAVELAERRIAIDKWPEYYDTKR  540

Query  845   GRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCS  666
              RFIGKQARL QTW++AGYL +K+LL NP  A  L   ED +L     C +  N RR   
Sbjct  541   ARFIGKQARLYQTWSIAGYLVAKLLLANPSAAKFLTSEEDSDLRNAFSCMISANPRRTRG  600

Query  665   R  663
             R
Sbjct  601   R  601



>ref|XP_011032827.1| PREDICTED: alkaline/neutral invertase CINV1-like [Populus euphratica]
 ref|XP_011032828.1| PREDICTED: alkaline/neutral invertase CINV1-like [Populus euphratica]
Length=663

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/509 (68%), Positives = 419/509 (82%), Gaps = 6/509 (1%)
 Frame = -3

Query  2180  ITDDSTVNKND----LNGSSISKLAPEREVS--EVEKEAWKLLQGAVVNYCGYPVGTVAA  2019
             +T + +VNK +     NG+  +     R+VS    E+EAW+LL+ +VV+YCG P+GT+AA
Sbjct  143   LTSNGSVNKEEESLVTNGAVGTGRDASRKVSVDPTEEEAWELLRDSVVHYCGSPIGTIAA  202

Query  2018  NDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQG  1839
             NDP     LN+DQVFIRDFIPS +AFLL GE +IV+NFLLHTLQLQSWEKT+DC+SPGQG
Sbjct  203   NDPTSSSVLNHDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCHSPGQG  262

Query  1838  LMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYT  1659
             LMPASFKVRT PLDG +   E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K + D +
Sbjct  263   LMPASFKVRTFPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSADLS  322

Query  1658  LQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALR  1479
             +QER+DVQTGI++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL 
Sbjct  323   VQERIDVQTGIKMILRLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALL  382

Query  1478  CTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKF  1299
             C +EML   D +  L+ A+NNRL ALSFHIREYYW+D++K+NEIYRYKTEEYS DA+NKF
Sbjct  383   CAKEMLTPEDGSADLLRALNNRLVALSFHIREYYWIDLRKLNEIYRYKTEEYSYDAVNKF  442

Query  1298  NIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNF  1119
             NIYPDQ+ PW+  W+P  GGYL+GNLQPAHMDFRFF+LGN+W+++S L T +Q+ +IL+ 
Sbjct  443   NIYPDQVSPWLAEWMPNQGGYLIGNLQPAHMDFRFFSLGNMWSVVSGLATRDQSNAILDL  502

Query  1118  IEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIK  939
             IE KW DL+A MPLKICYPALEG++W+IITGSDPKNTPWSYHN GSWPTLLWQ T+ACIK
Sbjct  503   IEAKWSDLVADMPLKICYPALEGQEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTVACIK  562

Query  938   MGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNP  759
             M +PE+A KAV +AE+R+  D+WPEYYDT+  RFIGKQA L QTW++AGYL +K+LL +P
Sbjct  563   MNRPEIAAKAVDIAEKRISRDKWPEYYDTKKARFIGKQAHLFQTWSIAGYLVAKLLLADP  622

Query  758   DMASLLVWNEDYELLENCVCGLKYNGRRK  672
               A +LV +ED EL+    C +  N RRK
Sbjct  623   SAARMLVTDEDPELVNAFSCMISSNPRRK  651



>gb|EYU36087.1| hypothetical protein MIMGU_mgv1a002839mg [Erythranthe guttata]
Length=632

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/511 (70%), Positives = 418/511 (82%), Gaps = 10/511 (2%)
 Frame = -3

Query  2183  EITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPAD  2004
             E+T D+ +  N   GS           +++E EAW LL+ ++V YCG PVGT+AANDP+D
Sbjct  127   ELTLDTAIG-NTFGGSG---------ANDLEDEAWNLLRASMVYYCGNPVGTIAANDPSD  176

Query  2003  KLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPAS  1824
                LNYDQVFIRDFIPS +AFLL GE EIV+NF+LHTLQLQSWEKT+DC+SPGQGLMPAS
Sbjct  177   SNMLNYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPAS  236

Query  1823  FKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERV  1644
             FKVR +PLDG +   E++LDPDFGE+AIGRVAPVDSGLWWIILLRAY K TGD ++QER+
Sbjct  237   FKVRVVPLDGDDTATEEILDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCTGDRSVQERI  296

Query  1643  DVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREM  1464
             DVQTGI++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSAL C REM
Sbjct  297   DVQTGIKMILKLCLSDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALLCAREM  356

Query  1463  LIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPD  1284
             L   D+   L+ A+NNRL ALS HIREYYWVDMKK+NEIYRYKTEEYS DA+NKFNIYPD
Sbjct  357   LAPEDAPSDLITALNNRLVALSIHIREYYWVDMKKLNEIYRYKTEEYSFDAVNKFNIYPD  416

Query  1283  QIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKW  1104
             QIPPW+V W+P  GG+L+GNLQPAHMDFRFF LGNLWAII SL T EQ+ +IL+ IE KW
Sbjct  417   QIPPWLVEWMPNKGGFLIGNLQPAHMDFRFFALGNLWAIICSLATTEQSHAILDLIEAKW  476

Query  1103  DDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPE  924
              DLIA MP+KICYPALEG++WRIITG DPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PE
Sbjct  477   SDLIAGMPMKICYPALEGQEWRIITGCDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPE  536

Query  923   LAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASL  744
             +A KA+ VAE+RL  D+WPEYYDT+  RFIGKQA L QTW++AGYL +K+L++NP+ A++
Sbjct  537   IAEKALKVAEKRLGRDKWPEYYDTKGARFIGKQAHLFQTWSIAGYLVAKLLVENPNAANM  596

Query  743   LVWNEDYELLENCVCGLKYNGRRKCSRFGVR  651
             LV  ED +LL      L  N R K  R G +
Sbjct  597   LVNIEDADLLNTFSWTLSANPRGKRPRKGPK  627



>ref|XP_010658734.1| PREDICTED: alkaline/neutral invertase CINV1-like [Vitis vinifera]
Length=651

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/481 (72%), Positives = 404/481 (84%), Gaps = 0/481 (0%)
 Frame = -3

Query  2105  VSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGE  1926
             V  +E EAW LL+ ++V YCG P+GT+AA DP     LNYDQVFIRDFIPS +AFLL GE
Sbjct  162   VDSIEDEAWDLLRESMVYYCGSPIGTIAAKDPTSSNVLNYDQVFIRDFIPSGIAFLLKGE  221

Query  1925  GEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGES  1746
              +IV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLDG +   E+VLDPDFGE+
Sbjct  222   YDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSATEEVLDPDFGEA  281

Query  1745  AIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLV  1566
             AIGRVAPVDSGLWWIILLRAY K +GD ++QER+DVQTGI++IL LCL DGFDMFPTLLV
Sbjct  282   AIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILRLCLADGFDMFPTLLV  341

Query  1565  TDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIR  1386
             TDGSCMIDRRMGIHGHPLEIQALFYSAL C REML   D +  L+ A+NNRL ALSFHIR
Sbjct  342   TDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNRLVALSFHIR  401

Query  1385  EYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHM  1206
             EYYW+DMKK+NEIYRYKTEEYS DA+NKFNIYPDQI PW+V W+P  GGYL+GNLQPAHM
Sbjct  402   EYYWIDMKKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWMPNKGGYLIGNLQPAHM  461

Query  1205  DFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITG  1026
             DFRFF+LGNLW+IISSL T +Q+ +IL+ +E KW DL+A MPLKICYPALEG++W+IITG
Sbjct  462   DFRFFSLGNLWSIISSLATMDQSHAILDLVEAKWGDLVADMPLKICYPALEGQEWQIITG  521

Query  1025  SDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRH  846
             SDPKNTPWSYHN GSWPTLLWQ T+ACIKM +P++A KAV +AE R+  D+WPEYYDT+ 
Sbjct  522   SDPKNTPWSYHNAGSWPTLLWQLTVACIKMDRPQIAAKAVEIAERRIARDKWPEYYDTKK  581

Query  845   GRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCS  666
              RFIGKQA L QTW++AGYL +K+LL +P  A +L+  ED EL+    C +  N RRK  
Sbjct  582   ARFIGKQACLFQTWSIAGYLVAKLLLSDPTAAKILITEEDSELVNAFSCMISANPRRKRG  641

Query  665   R  663
             R
Sbjct  642   R  642



>ref|XP_002532011.1| beta-fructofuranosidase, putative [Ricinus communis]
 gb|EEF30366.1| beta-fructofuranosidase, putative [Ricinus communis]
Length=663

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/481 (71%), Positives = 404/481 (84%), Gaps = 0/481 (0%)
 Frame = -3

Query  2105  VSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGE  1926
             +  +E EAW LL+ +VV+YCG P+GT+AANDP     LNYDQVFIRDFIPS +AFLL GE
Sbjct  174   IDSIEDEAWDLLRSSVVHYCGSPIGTIAANDPTSSNVLNYDQVFIRDFIPSGIAFLLKGE  233

Query  1925  GEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGES  1746
              +IV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLDG +   E++LDPDFGE+
Sbjct  234   YDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSTTEEILDPDFGEA  293

Query  1745  AIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLV  1566
             AIGRVAPVDSGLWWIILLRAY K +GD ++QER+DVQTGI++IL LCL DGFDMFPTLLV
Sbjct  294   AIGRVAPVDSGLWWIILLRAYGKSSGDLSVQERIDVQTGIKMILRLCLADGFDMFPTLLV  353

Query  1565  TDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIR  1386
             TDGSCMIDRRMGIHGHPLEIQALFYSAL   REML   D +  LV A+NNRL ALSFHIR
Sbjct  354   TDGSCMIDRRMGIHGHPLEIQALFYSALLSAREMLAPEDGSADLVRALNNRLVALSFHIR  413

Query  1385  EYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHM  1206
             EYYW+D++K+NEIYRYKTEEYS DA+NKFNIYPDQI PW+V W+P  GGYL+GNLQPAHM
Sbjct  414   EYYWIDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWMPNQGGYLIGNLQPAHM  473

Query  1205  DFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITG  1026
             DFRFF+LGNLW+++S L T +Q+ +IL+ IE KW DL+A+MP KICYPALEG++W+IITG
Sbjct  474   DFRFFSLGNLWSVVSGLATKDQSHAILDLIEAKWTDLVAEMPFKICYPALEGQEWQIITG  533

Query  1025  SDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRH  846
             SDPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PE+A KAV VAE  +  D+WPEYYDT+ 
Sbjct  534   SDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPEIAAKAVEVAERNISRDKWPEYYDTKR  593

Query  845   GRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCS  666
             GRFIGKQA L QTW++AGYL +K+LL +P  A +L   ED EL+    C +  N RRK  
Sbjct  594   GRFIGKQAHLFQTWSIAGYLVAKILLADPSAAKILTTEEDPELVNAFSCMISANPRRKRG  653

Query  665   R  663
             R
Sbjct  654   R  654



>ref|XP_007015893.1| Alkaline/neutral invertase isoform 1 [Theobroma cacao]
 gb|EOY33512.1| Alkaline/neutral invertase isoform 1 [Theobroma cacao]
Length=623

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/482 (72%), Positives = 408/482 (85%), Gaps = 0/482 (0%)
 Frame = -3

Query  2096  VEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEI  1917
             +E+EAW LL+ +VV YCG P+GT+AA+D +    LNYDQVFIRDFIPS +AFLL GE +I
Sbjct  137   IEEEAWDLLKESVVYYCGNPIGTIAASDTSSSSILNYDQVFIRDFIPSGIAFLLKGEYDI  196

Query  1916  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIG  1737
             V+NF+L+TLQLQSWEKT+DC+SPGQGLMPASFKVRT+P DG +   EDVLDPDFGE+AIG
Sbjct  197   VRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPRDGDDSVTEDVLDPDFGEAAIG  256

Query  1736  RVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDG  1557
             RVAPVDSGLWWIILLRAY K TGD ++QERVDVQTGI++IL LCL DGFDMFPTLLVTDG
Sbjct  257   RVAPVDSGLWWIILLRAYGKCTGDLSVQERVDVQTGIKMILKLCLADGFDMFPTLLVTDG  316

Query  1556  SCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYY  1377
             SCMIDRRMGIHGHPLEIQALFYSAL C REML   D +  L+ A+NNRL ALSFHIREYY
Sbjct  317   SCMIDRRMGIHGHPLEIQALFYSALLCAREMLASEDGSADLIRALNNRLVALSFHIREYY  376

Query  1376  WVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFR  1197
             W+DMKK+NEIYRYKTEEYS DA+NKFNIYPDQIPPW+V ++P  GGYL+GNLQPAHMDFR
Sbjct  377   WIDMKKLNEIYRYKTEEYSFDAVNKFNIYPDQIPPWLVEFMPARGGYLIGNLQPAHMDFR  436

Query  1196  FFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDP  1017
             FF+LGNLW+I+ SL T +Q+ +IL+ +E KW +L+A MPLKICYPALEG++WRIITGSDP
Sbjct  437   FFSLGNLWSIVGSLATVDQSHAILDLVEAKWSELVADMPLKICYPALEGQEWRIITGSDP  496

Query  1016  KNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRF  837
             KNTPWSYHNGGSWPTLLWQ T+ACIKM +PE+A KAV +AE R+  D+WPEYYDTR  RF
Sbjct  497   KNTPWSYHNGGSWPTLLWQLTVACIKMNRPEVAEKAVMLAERRICRDKWPEYYDTRRARF  556

Query  836   IGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRFG  657
             IGKQ+RL QTW++AGYL +K+LL NP  A +L+  ED +L+    C L  N R+K  + G
Sbjct  557   IGKQSRLFQTWSIAGYLVAKLLLANPSAAKILINEEDADLVNAFSCMLSANPRKKRGQKG  616

Query  656   VR  651
              +
Sbjct  617   FK  618



>ref|XP_008355223.1| PREDICTED: alkaline/neutral invertase CINV2-like [Malus domestica]
 ref|XP_008355224.1| PREDICTED: alkaline/neutral invertase CINV2-like [Malus domestica]
 ref|XP_008355225.1| PREDICTED: alkaline/neutral invertase CINV2-like [Malus domestica]
Length=652

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/475 (73%), Positives = 405/475 (85%), Gaps = 0/475 (0%)
 Frame = -3

Query  2096  VEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEI  1917
             +E+EAW LL+ ++V YC  PVGT+AANDP+    LNYDQVFIRDFIPS +AFLL GE +I
Sbjct  169   IEEEAWTLLKNSMVYYCNNPVGTIAANDPSSPGTLNYDQVFIRDFIPSGIAFLLKGEYDI  228

Query  1916  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIG  1737
             V+NF+LHTLQLQSWEKT+DCYSPGQGLMPASFKVRT+PLDG     EDVLDPDFGE+AIG
Sbjct  229   VRNFILHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLDGDEFATEDVLDPDFGEAAIG  288

Query  1736  RVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDG  1557
             RVAPVDSGLWWIILLRAY K +GD ++QERVDVQTGI++IL LCL DGFDMFPTLLVTDG
Sbjct  289   RVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADGFDMFPTLLVTDG  348

Query  1556  SCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYY  1377
             SCMIDRRMGIHGHPLEIQALFYSAL C REML   +++  LV A+NNRL AL FHIRE+Y
Sbjct  349   SCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASADLVRALNNRLVALXFHIREHY  408

Query  1376  WVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFR  1197
             W+DM+K+NEIYRYKTEEYS DA+NKFNIYPDQIP W+V ++P TGGYL+GNLQPAHMDFR
Sbjct  409   WIDMRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPSWLVGFMPSTGGYLIGNLQPAHMDFR  468

Query  1196  FFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDP  1017
             FF+LGNLW+I+SSL T  Q+ +IL+ IE KWD+L+A MP KICYPALEG++W+IITGSDP
Sbjct  469   FFSLGNLWSIVSSLATDLQSHAILDLIEAKWDELVADMPFKICYPALEGQEWQIITGSDP  528

Query  1016  KNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRF  837
             KNTPWSYHNGGSWPTLLWQ T+ACIK+ +PE+A KAV +AE+R+ +D WPEYYDT+  RF
Sbjct  529   KNTPWSYHNGGSWPTLLWQLTVACIKLNRPEIAAKAVEIAEKRISIDNWPEYYDTKRARF  588

Query  836   IGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRK  672
             IGKQA+L QTW+VAGYL +K+LL NP  A  LV  ED EL+    C +  + RRK
Sbjct  589   IGKQAQLYQTWSVAGYLVAKLLLANPSAAKNLVNEEDSELINAFSCMISASPRRK  643



>gb|AFH77954.1| neutral/alkaline invertase [Manihot esculenta]
Length=663

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/521 (67%), Positives = 417/521 (80%), Gaps = 7/521 (1%)
 Frame = -3

Query  2204  QKDGGRVEITDDSTVNK------NDLNGSSISKLAPER-EVSEVEKEAWKLLQGAVVNYC  2046
             Q+  G  E+T +  V +       D     I + A  +  V  +E EAW LL  +VV YC
Sbjct  134   QQKQGNGELTSNGAVKQGKESLPTDGGALGIGRDASNKVTVDSIEDEAWNLLLNSVVYYC  193

Query  2045  GYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKT  1866
             G P+GT+AANDP     LNYDQVFIRDFIPS +AFLL GE +IV+NF+LHTLQLQSWEKT
Sbjct  194   GSPIGTIAANDPTSSNVLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKT  253

Query  1865  VDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRA  1686
             +DC+SPGQGLMPASFKVRT+PLDG +   E+VLDPDFGE+AIGRVAPVDSGLWWIILLRA
Sbjct  254   MDCHSPGQGLMPASFKVRTVPLDGDDSSTEEVLDPDFGEAAIGRVAPVDSGLWWIILLRA  313

Query  1685  YVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEI  1506
             Y K +GD ++QER+DVQTGI++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEI
Sbjct  314   YGKCSGDLSVQERIDVQTGIKMILRLCLSDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEI  373

Query  1505  QALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEE  1326
             QALFYSAL C REML   D +  L+ A+ NRL ALSFHIREYYW+D++K+NEIYRYKTEE
Sbjct  374   QALFYSALLCAREMLAPEDGSADLIRALTNRLVALSFHIREYYWIDLRKLNEIYRYKTEE  433

Query  1325  YSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTH  1146
             YS DA+NKFNIYPDQ+ PW+V WIP  GGYL+GNLQPAHMDFRFF+LGNLW+++S L T 
Sbjct  434   YSYDAVNKFNIYPDQVSPWLVKWIPNQGGYLIGNLQPAHMDFRFFSLGNLWSVVSGLATT  493

Query  1145  EQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLL  966
             EQ+ +IL+ IE KW DL+A MPLKICYPALEG++W+IITGSDPKNTPWSYHN GSWPTLL
Sbjct  494   EQSHAILDLIEAKWIDLVADMPLKICYPALEGQEWQIITGSDPKNTPWSYHNAGSWPTLL  553

Query  965   WQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYL  786
             WQ T+ACIKM +PE+A +A+ VAE R+  D+WPEYYDT+  RFIGKQARL QTW++AGYL
Sbjct  554   WQLTVACIKMNRPEIAARAIGVAERRISWDKWPEYYDTKRARFIGKQARLFQTWSIAGYL  613

Query  785   TSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSR  663
              +K+LL +P  A +L+  ED EL+    C +  N RR+  R
Sbjct  614   VAKLLLADPSAAKMLITEEDPELVNAFSCMISANPRRQRGR  654



>ref|XP_007208045.1| hypothetical protein PRUPE_ppa002614mg [Prunus persica]
 gb|EMJ09244.1| hypothetical protein PRUPE_ppa002614mg [Prunus persica]
Length=652

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/478 (72%), Positives = 406/478 (85%), Gaps = 0/478 (0%)
 Frame = -3

Query  2105  VSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGE  1926
              + +E EAWKLL+ ++V YC  P+GT+AAN+P     LNYDQVFIRDFIPS +AFLL GE
Sbjct  166   TNSIEDEAWKLLKNSMVYYCNNPIGTIAANNPNSTSTLNYDQVFIRDFIPSGIAFLLKGE  225

Query  1925  GEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGES  1746
              +IV+NF+LHTLQLQSWEKT+DCYSPGQGLMPASFKVRT+PLDG +   EDVLDPDFGE+
Sbjct  226   YDIVRNFILHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLDGDDFATEDVLDPDFGEA  285

Query  1745  AIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLV  1566
             AIGRVAPVDSGLWWIILLRAY K +GD ++QERVDVQTGI++IL LCL DGFDMFPTLLV
Sbjct  286   AIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADGFDMFPTLLV  345

Query  1565  TDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIR  1386
             TDGSCMIDRRMGIHGHPLEIQALFYSAL C REML   D++  L+ A+NNRL ALSFHIR
Sbjct  346   TDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDASADLMRALNNRLVALSFHIR  405

Query  1385  EYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHM  1206
             EYYW+DM+K+NEIYRYKTEEYS DA+NKFNIYPDQIP W+V ++P TGGYL+GNLQPAHM
Sbjct  406   EYYWIDMRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPSWLVGFMPSTGGYLIGNLQPAHM  465

Query  1205  DFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITG  1026
             DFRFF+LGNLW+I+SSL T +Q+ +IL+ IE KWD+L+A MP KICYPALEG++W+IITG
Sbjct  466   DFRFFSLGNLWSIVSSLATLDQSHAILDLIEAKWDELVADMPFKICYPALEGQEWQIITG  525

Query  1025  SDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRH  846
             SDPKNTPWSYHNGGSWPTLLWQ T+ACIK+ +PE+A KAV +AE+R+ +D WPEYYDT+ 
Sbjct  526   SDPKNTPWSYHNGGSWPTLLWQLTVACIKLNRPEIAAKAVELAEKRISLDNWPEYYDTKR  585

Query  845   GRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRK  672
              RFIGKQA+L QTW+ AGYL +K+LL NP  A  LV  ED EL     C +  + RRK
Sbjct  586   ARFIGKQAQLFQTWSAAGYLVAKILLANPSAAKNLVNEEDSELANIFSCMISSSPRRK  643



>emb|CDO99885.1| unnamed protein product [Coffea canephora]
Length=652

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/496 (70%), Positives = 412/496 (83%), Gaps = 0/496 (0%)
 Frame = -3

Query  2159  NKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQ  1980
             N N  +  +I     + + S +E EAW+LLQ +V  YCG PVGT+AA DP     LNYDQ
Sbjct  145   NGNPPSDKTIQDGMNKGKSSFIENEAWELLQESVAYYCGSPVGTIAAKDPTSSSVLNYDQ  204

Query  1979  VFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPL  1800
             VFIRDFIPS +AFLL GE +IV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PL
Sbjct  205   VFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPL  264

Query  1799  DGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRL  1620
             DG +   E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD ++QER+DVQTGI++
Sbjct  265   DGDDTATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKM  324

Query  1619  ILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTK  1440
             IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C REML   D + 
Sbjct  325   ILRLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSA  384

Query  1439  SLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVN  1260
              L+ A+NNRL ALSFHIREYYW+DMKK+NEIYRYKTEEYS DA+NKFNIYPDQI PW+V 
Sbjct  385   DLLRALNNRLIALSFHIREYYWIDMKKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVG  444

Query  1259  WIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMP  1080
             W+P  GGYL+GNLQPAHMDFRFF+LGNLW+I+S+L T +Q+ +IL+ +E KW DL+A MP
Sbjct  445   WMPNKGGYLIGNLQPAHMDFRFFSLGNLWSIVSNLATTDQSHAILDLMEAKWADLVADMP  504

Query  1079  LKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAV  900
              KICYPAL+G++W+IITG DPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PE+A KAV V
Sbjct  505   FKICYPALDGQEWQIITGCDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPEIAAKAVEV  564

Query  899   AEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYE  720
             AE+RL  D+WPEYYDT+ GRFIGKQ+RL QTW++AGYL +K+LL NP  A +L+  ED E
Sbjct  565   AEKRLSRDKWPEYYDTKRGRFIGKQSRLFQTWSIAGYLVAKLLLANPGAAKILITEEDSE  624

Query  719   LLENCVCGLKYNGRRK  672
             L+    C +  + RRK
Sbjct  625   LINALSCAICSSPRRK  640



>ref|XP_009120650.1| PREDICTED: alkaline/neutral invertase CINV1 [Brassica rapa]
Length=610

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/481 (72%), Positives = 406/481 (84%), Gaps = 0/481 (0%)
 Frame = -3

Query  2105  VSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGE  1926
              + +E EAW LL+ ++V YCG P+GT+AANDP     LNYDQVFIRDFIPS +AFLL GE
Sbjct  121   TNSIEDEAWDLLRQSIVYYCGSPIGTIAANDPNSTSVLNYDQVFIRDFIPSGIAFLLKGE  180

Query  1925  GEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGES  1746
              +IV+NF+L+TLQLQSWEKT+DC+SPGQGLMPASFKV+T+PLDG +   E+VLDPDFGE+
Sbjct  181   YDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVKTVPLDGDDSMTEEVLDPDFGEA  240

Query  1745  AIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLV  1566
             AIGRVAPVDSGLWWIILLRAY K TGD ++QERVDVQTGI++IL LCL DGFDMFPTLLV
Sbjct  241   AIGRVAPVDSGLWWIILLRAYGKCTGDVSVQERVDVQTGIKMILKLCLADGFDMFPTLLV  300

Query  1565  TDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIR  1386
             TDGSCMIDRRMGIHGHPLEIQALFYSAL C REML   D +  L+ A+NNRL ALSFHIR
Sbjct  301   TDGSCMIDRRMGIHGHPLEIQALFYSALVCAREMLTPEDGSDDLIRALNNRLVALSFHIR  360

Query  1385  EYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHM  1206
             EYYW+DMKKINEIYRY+TEEYS +A+NKFNIYPDQIP W+V+++P  GGYL+GNLQPAHM
Sbjct  361   EYYWLDMKKINEIYRYQTEEYSYNAVNKFNIYPDQIPSWLVDFMPNRGGYLIGNLQPAHM  420

Query  1205  DFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITG  1026
             DFRFF+LGNLW+I+SSL T++Q+ +IL+F+E KW +L+A MP KICYPA+EGE+WRIITG
Sbjct  421   DFRFFSLGNLWSIVSSLATNDQSHAILDFVEAKWAELVADMPFKICYPAMEGEEWRIITG  480

Query  1025  SDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRH  846
             SDPKNTPWSYHNGGSWPTLLWQ T+A IKMG+PE+A KAV +AE R+ +D+WPEYYDT+ 
Sbjct  481   SDPKNTPWSYHNGGSWPTLLWQLTVASIKMGRPEIAEKAVELAERRIAIDKWPEYYDTKR  540

Query  845   GRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCS  666
              RFIGKQARL QTW++AGYL +K+LL NP  A  L   ED +L     C +  N RR   
Sbjct  541   ARFIGKQARLYQTWSIAGYLVAKLLLANPSAAKFLTSEEDSDLRNAFSCMISANPRRTRG  600

Query  665   R  663
             R
Sbjct  601   R  601



>ref|XP_007010262.1| Alkaline/neutral invertase isoform 1 [Theobroma cacao]
 gb|EOY19072.1| Alkaline/neutral invertase isoform 1 [Theobroma cacao]
Length=652

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/478 (72%), Positives = 404/478 (85%), Gaps = 0/478 (0%)
 Frame = -3

Query  2105  VSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGE  1926
             V  +E EAW+LL+ ++V YCG P+GT+AANDP     LNYDQVFIRDFIPS +AFLL GE
Sbjct  163   VDSIEDEAWELLRDSMVYYCGSPIGTIAANDPTSSNVLNYDQVFIRDFIPSGIAFLLKGE  222

Query  1925  GEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGES  1746
              +IV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLDG +   E+VLDPDFGE+
Sbjct  223   YDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSATEEVLDPDFGEA  282

Query  1745  AIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLV  1566
             AIGRVAPVDSGLWWIILLRAY K +GD ++QERVDVQTGI++IL LCL DGFDMFPTLLV
Sbjct  283   AIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILRLCLADGFDMFPTLLV  342

Query  1565  TDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIR  1386
             TDGSCMIDRRMGIHGHPLEIQALFYSAL C REML   D +  L+ A+NNRL ALSFHIR
Sbjct  343   TDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDGSADLIRALNNRLVALSFHIR  402

Query  1385  EYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHM  1206
             EYYW+DM+K+NEIYRYKTEEYS DA+NKFNIYPDQI PW+V W+P  GG+L+GNLQPAHM
Sbjct  403   EYYWIDMRKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWMPNKGGFLIGNLQPAHM  462

Query  1205  DFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITG  1026
             DFRFF+LGNLWA+ S L T +Q+ +IL+ IE KW DL+A MP KICYPALEG +W+IITG
Sbjct  463   DFRFFSLGNLWAVASGLATTDQSHAILDLIEAKWADLVADMPFKICYPALEGREWQIITG  522

Query  1025  SDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRH  846
             SDPKNTPWSYHNGGSWPTLLWQ T+AC+KM +PE+A KA++VAE+R+  D+WPEYYDT+ 
Sbjct  523   SDPKNTPWSYHNGGSWPTLLWQLTVACMKMNRPEIAAKAISVAEKRISRDKWPEYYDTKK  582

Query  845   GRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRK  672
              RFIGKQ+ L QTW++AGYL +K+LL +P+ A +L   ED EL+    C +  N RRK
Sbjct  583   ARFIGKQSHLFQTWSIAGYLVAKLLLADPNAAKILTTEEDSELVNAFSCMISANPRRK  640



>ref|XP_010067152.1| PREDICTED: alkaline/neutral invertase CINV1-like [Eucalyptus 
grandis]
 ref|XP_010067153.1| PREDICTED: alkaline/neutral invertase CINV1-like [Eucalyptus 
grandis]
 gb|KCW65218.1| hypothetical protein EUGRSUZ_G02704 [Eucalyptus grandis]
 gb|KCW65219.1| hypothetical protein EUGRSUZ_G02704 [Eucalyptus grandis]
Length=646

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/495 (70%), Positives = 410/495 (83%), Gaps = 1/495 (0%)
 Frame = -3

Query  2144  NGSSISKLAPER-EVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIR  1968
             NG+ I+     R  V  +E+EAW LL+ +VV YCG P+GT+AANDP     LNYDQVFIR
Sbjct  143   NGAPIASSTIHRANVDPIEEEAWDLLRDSVVYYCGSPIGTIAANDPTSSNVLNYDQVFIR  202

Query  1967  DFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRN  1788
             DFIPS +AFLL GE +IV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLDG +
Sbjct  203   DFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDD  262

Query  1787  GEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNL  1608
                E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY KI+GD ++QER+DVQTGI++IL L
Sbjct  263   SATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKISGDLSVQERIDVQTGIKMILKL  322

Query  1607  CLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVA  1428
             CL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL   REML   D +  L+ 
Sbjct  323   CLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALMSAREMLAPEDGSADLIR  382

Query  1427  AINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPE  1248
             A+NNRL ALSFHIREYYW+D++K+NEIYRYKTEEYS DA+NKFNIYPDQIPPW+V WIP 
Sbjct  383   ALNNRLVALSFHIREYYWIDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWIPN  442

Query  1247  TGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKIC  1068
              GGYL+GNLQPAHMDFRFF+LGN W+I+S L T +Q+ +IL+ IE KW DL++ MPLKIC
Sbjct  443   RGGYLIGNLQPAHMDFRFFSLGNFWSIVSGLATVDQSHAILDLIEAKWADLVSDMPLKIC  502

Query  1067  YPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEER  888
             YPALEG++W+IITGSDPKNTPWSYHN GSWPTLLWQ T+ACIKM + ++A KAV + E R
Sbjct  503   YPALEGQEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRADIAAKAVEIVERR  562

Query  887   LPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLEN  708
             +  D+WPEYYDT+  RFIGKQARL QTW++AGYL +K+LL +P  A +L+ +ED  L+  
Sbjct  563   ISRDRWPEYYDTKRSRFIGKQARLFQTWSIAGYLVAKLLLADPGAAKILITDEDPALVNA  622

Query  707   CVCGLKYNGRRKCSR  663
               C +  N RRK  R
Sbjct  623   FSCMIGANPRRKRGR  637



>ref|XP_008227420.1| PREDICTED: alkaline/neutral invertase CINV2 [Prunus mume]
 ref|XP_008227431.1| PREDICTED: alkaline/neutral invertase CINV2 [Prunus mume]
Length=652

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/478 (72%), Positives = 406/478 (85%), Gaps = 0/478 (0%)
 Frame = -3

Query  2105  VSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGE  1926
              + +E EAWKLL+ +VV YC  P+GT+AAN+P     LNYDQVFIRDFIP+ +AFLL GE
Sbjct  166   TNSIEDEAWKLLKNSVVYYCNNPIGTIAANNPNSTSTLNYDQVFIRDFIPTGIAFLLKGE  225

Query  1925  GEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGES  1746
              +IV+NF+LHTLQLQSWEKT+DCYSPGQGLMPASFKVRT+PLDG +   EDVLDPDFGE+
Sbjct  226   YDIVRNFILHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLDGDDFATEDVLDPDFGEA  285

Query  1745  AIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLV  1566
             AIGRVAPVDSGLWWIILLRAY K +GD ++QERVDVQTGI++IL LCL DGFDMFPTLLV
Sbjct  286   AIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADGFDMFPTLLV  345

Query  1565  TDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIR  1386
             TDGSCMIDRRMGIHGHPLEIQALFYSAL C REML   D++  L+ A+NNRL ALSFHIR
Sbjct  346   TDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDASADLMRALNNRLVALSFHIR  405

Query  1385  EYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHM  1206
             EYYW+DM+K+NEIYRY+TEEYS DA+NKFNIYPDQIP W+V ++P TGGYL+GNLQPAHM
Sbjct  406   EYYWIDMRKLNEIYRYQTEEYSYDAVNKFNIYPDQIPSWLVGFMPSTGGYLIGNLQPAHM  465

Query  1205  DFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITG  1026
             DFRFF+LGNLW+I+SSL T +Q+ +IL+ IE KWD+L+A MP KICYPALEG++W+IITG
Sbjct  466   DFRFFSLGNLWSIVSSLATLDQSHAILDLIEAKWDELVADMPFKICYPALEGQEWQIITG  525

Query  1025  SDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRH  846
             SDPKNTPWSYHNGGSWPTLLWQ T+ACIK+ +PE+A KAV +AE+R+ +D WPEYYDT+ 
Sbjct  526   SDPKNTPWSYHNGGSWPTLLWQLTVACIKLNRPEIAAKAVELAEKRISLDNWPEYYDTKR  585

Query  845   GRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRK  672
              RFIGKQA+L QTW+ AGYL +K+LL NP  A  LV  ED EL     C +  + RRK
Sbjct  586   ARFIGKQAQLFQTWSAAGYLVAKLLLANPSAAKNLVNEEDSELANIFSCMISSSPRRK  643



>ref|NP_197643.1| alkaline/neutral invertase [Arabidopsis thaliana]
 sp|Q9FK88.1|INVE_ARATH RecName: Full=Alkaline/neutral invertase E, chloroplastic; Short=A/N-INVE; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09123.1| alkaline/neutral invertase [Arabidopsis thaliana]
 gb|AAL08305.1| AT5g22510/MQJ16_5 [Arabidopsis thaliana]
 gb|ACI46508.1| At5g22510 [Arabidopsis thaliana]
 gb|AED93035.1| alkaline/neutral invertase [Arabidopsis thaliana]
Length=617

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/509 (69%), Positives = 416/509 (82%), Gaps = 1/509 (0%)
 Frame = -3

Query  2198  DGGRVEITDDSTVNKNDLNGS-SISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVA  2022
             DG   E+  D       +NGS S +  A       +E EAW LL+ +VV YCG P+GT+A
Sbjct  96    DGLSSELKSDLDEMPLPVNGSVSSNGNAQSVGTKSIEDEAWDLLRQSVVFYCGSPIGTIA  155

Query  2021  ANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQ  1842
             ANDP     LNYDQVFIRDFIPS +AFLL GE +IV+NF+L+TLQLQSWEKT+DC+SPGQ
Sbjct  156   ANDPNSTSVLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCHSPGQ  215

Query  1841  GLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDY  1662
             GLMP SFKV+T+PLDG +   E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K TGD 
Sbjct  216   GLMPCSFKVKTVPLDGDDSMTEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCTGDL  275

Query  1661  TLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL  1482
             ++QERVDVQTGI++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL
Sbjct  276   SVQERVDVQTGIKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL  335

Query  1481  RCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINK  1302
              C REML   D +  L+ A+NNRL AL+FHIREYYW+D+KKINEIYRY+TEEYS DA+NK
Sbjct  336   VCAREMLTPEDGSADLIRALNNRLVALNFHIREYYWLDLKKINEIYRYQTEEYSYDAVNK  395

Query  1301  FNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILN  1122
             FNIYPDQIP W+V+++P  GGYL+GNLQPAHMDFRFFTLGNLW+I+SSL +++Q+ +IL+
Sbjct  396   FNIYPDQIPSWLVDFMPNRGGYLIGNLQPAHMDFRFFTLGNLWSIVSSLASNDQSHAILD  455

Query  1121  FIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACI  942
             FIE KW +L+A MPLKICYPA+EGE+WRIITGSDPKNTPWSYHNGG+WPTLLWQ T+A I
Sbjct  456   FIEAKWAELVADMPLKICYPAMEGEEWRIITGSDPKNTPWSYHNGGAWPTLLWQLTVASI  515

Query  941   KMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKN  762
             KMG+PE+A KAV +AE R+ +D+WPEYYDT+  RFIGKQARL QTW++AGYL +K+LL N
Sbjct  516   KMGRPEIAEKAVELAERRISLDKWPEYYDTKRARFIGKQARLYQTWSIAGYLVAKLLLAN  575

Query  761   PDMASLLVWNEDYELLENCVCGLKYNGRR  675
             P  A  L   ED +L     C L  N RR
Sbjct  576   PAAAKFLTSEEDSDLRNAFSCMLSANPRR  604



>ref|XP_009364274.1| PREDICTED: alkaline/neutral invertase CINV2-like [Pyrus x bretschneideri]
Length=624

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/475 (73%), Positives = 406/475 (85%), Gaps = 0/475 (0%)
 Frame = -3

Query  2096  VEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEI  1917
             +E+EAW LL+ ++V YC  PVGT+AANDP+    LNYDQVFIRDFIPS +AFLL GE +I
Sbjct  141   IEEEAWTLLKNSMVYYCNNPVGTIAANDPSSPSTLNYDQVFIRDFIPSGIAFLLKGEYDI  200

Query  1916  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIG  1737
             V+NF+LHTLQLQSWEKT+DCYSPGQGL+PASFKVRT+PLDG     EDVLDPDFGE+AIG
Sbjct  201   VRNFILHTLQLQSWEKTMDCYSPGQGLIPASFKVRTVPLDGDEFATEDVLDPDFGEAAIG  260

Query  1736  RVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDG  1557
             RVAPVDSGLWWIILLRAY K + D ++QERVDVQTGI++IL LCL DGFDMFPTLLVTDG
Sbjct  261   RVAPVDSGLWWIILLRAYGKCSRDLSVQERVDVQTGIKMILKLCLADGFDMFPTLLVTDG  320

Query  1556  SCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYY  1377
             SCMIDRRMGIHGHPLEIQALFYSAL C REML   +++  LV A+NNRL ALSFHIREYY
Sbjct  321   SCMIDRRMGIHGHPLEIQALFYSALLCVREMLAPEEASADLVRALNNRLVALSFHIREYY  380

Query  1376  WVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFR  1197
             W+DM+K+NEIYRYKTEEYS DA+NKFNIYPDQIP W+V ++P TGGYL+GNLQPAHMDFR
Sbjct  381   WIDMRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPSWLVGFMPSTGGYLIGNLQPAHMDFR  440

Query  1196  FFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDP  1017
             FF+LGNLW+I+SSL T  Q+ +IL+ I+ KWD+L+A MP KICYPALEG++W+IITGSDP
Sbjct  441   FFSLGNLWSIVSSLATDLQSHAILDLIDAKWDELVADMPFKICYPALEGQEWQIITGSDP  500

Query  1016  KNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRF  837
             KNTPWSYHNGGSWPTLLWQ T+ACIK+ +PE+A KAV +AE+R+ +D+WPEYYDT+  RF
Sbjct  501   KNTPWSYHNGGSWPTLLWQLTVACIKLNRPEIAAKAVEIAEKRISIDKWPEYYDTKRARF  560

Query  836   IGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRK  672
             IGKQA+L QTW+VAGYL +K+LL NP  A  LV  ED EL+    C +  + RRK
Sbjct  561   IGKQAQLYQTWSVAGYLVAKLLLANPSAAKNLVNEEDSELINAFSCMISASPRRK  615



>ref|XP_009356115.1| PREDICTED: alkaline/neutral invertase CINV1-like [Pyrus x bretschneideri]
 ref|XP_009356116.1| PREDICTED: alkaline/neutral invertase CINV1-like [Pyrus x bretschneideri]
Length=652

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/481 (71%), Positives = 405/481 (84%), Gaps = 0/481 (0%)
 Frame = -3

Query  2105  VSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGE  1926
             +  +E EAW LL+ ++V YCG PVGT+AA DP     LNYDQVFIRDFIPS +AFLL GE
Sbjct  163   IDSLEDEAWDLLRESMVYYCGSPVGTIAAKDPTSSNTLNYDQVFIRDFIPSGIAFLLKGE  222

Query  1925  GEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGES  1746
              +IV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLDG     E+VLDPDFGE+
Sbjct  223   YDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDESTTEEVLDPDFGEA  282

Query  1745  AIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLV  1566
             AIGRVAPVDSGLWWIILLRAY K +GD ++QERVDVQTGI++IL LCL DGFDMFPTLLV
Sbjct  283   AIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILRLCLADGFDMFPTLLV  342

Query  1565  TDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIR  1386
             TDGSCMIDRRMGIHGHPLEIQALFYSAL C REML   D +  L+ A+NNRL ALSFHIR
Sbjct  343   TDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNRLVALSFHIR  402

Query  1385  EYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHM  1206
             EYYWVD++K+NEIYRYKTEEYS DA+NKFNIYPDQI  W+V W+P  GGYL+GNLQPAHM
Sbjct  403   EYYWVDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQISSWLVEWMPNKGGYLIGNLQPAHM  462

Query  1205  DFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITG  1026
             DFRFF+LGNLW+++SS+ T +Q+ +IL+ IE KW DL+A MP KICYPAL+G++W+IITG
Sbjct  463   DFRFFSLGNLWSVVSSVATTDQSHAILDLIEAKWGDLVADMPFKICYPALDGQEWQIITG  522

Query  1025  SDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRH  846
             SDPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PE+A KAV +AE+R+  D+WPEYYDT+ 
Sbjct  523   SDPKNTPWSYHNGGSWPTLLWQLTVACIKMDRPEIAAKAVEIAEKRISRDKWPEYYDTKK  582

Query  845   GRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCS  666
             GRF+GKQARL QTW++AGYL +K+LL +P  A +L+  ED EL+    C +  N RRK  
Sbjct  583   GRFVGKQARLFQTWSIAGYLVAKLLLADPSKAKILITEEDSELVNAFSCMISANPRRKRD  642

Query  665   R  663
             R
Sbjct  643   R  643



>ref|XP_006424304.1| hypothetical protein CICLE_v10028002mg [Citrus clementina]
 gb|ESR37544.1| hypothetical protein CICLE_v10028002mg [Citrus clementina]
Length=643

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/590 (62%), Positives = 442/590 (75%), Gaps = 32/590 (5%)
 Frame = -3

Query  2459  CAFCGSGSNGDQHRDSFCNWL--GRSKNRLVFVVPKVASDM-RSHSTSTEAQVNDKSFKK  2289
             CAF   G + D H  + CN L  G  K R +  +  +  D  R  S   +++ N+ + + 
Sbjct  63    CAF--HGVDRDSHGKTGCNRLKSGCCKCRRIESIDGLTVDNGRQPSFPNKSESNEPNVQD  120

Query  2288  FYIQGGMNVKPLviertetredvvetyEQKDGGRVEITDDSTVNKNDLNGSSISKLAPER  2109
             F +                         Q   G+  I+ +  +N +     SI+    + 
Sbjct  121   FKLD-----------------------RQLKNGKAGISSNDKLNAS----GSITNTVHKV  153

Query  2108  EVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNG  1929
                 VE EAW LL+ ++V YCG PVGT+AANDP D   LNYDQVFIRDFIPS +AFLL G
Sbjct  154   WAKSVEDEAWDLLRESIVYYCGNPVGTIAANDPNDSTILNYDQVFIRDFIPSGIAFLLKG  213

Query  1928  EGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGE  1749
             E +IV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLDG +   E+VLDPDFGE
Sbjct  214   EYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSATEEVLDPDFGE  273

Query  1748  SAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLL  1569
             +AIGRVAPVDSGLWWIILLRAY K +GD ++QERVDVQTGI++IL LCL DGFDMFPTLL
Sbjct  274   AAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADGFDMFPTLL  333

Query  1568  VTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHI  1389
             VTDGSCMIDRRMGIHGHPLEIQALFYSAL   REML   D +  L+ A+NNRL ALSFHI
Sbjct  334   VTDGSCMIDRRMGIHGHPLEIQALFYSALLSAREMLTPEDGSADLIRALNNRLVALSFHI  393

Query  1388  REYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAH  1209
             REYYW+DMKK+NEIYRYKTEEYS DA+NKFNIYPDQIPPW+V ++P  GGYL+GNLQPAH
Sbjct  394   REYYWIDMKKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEFMPHIGGYLIGNLQPAH  453

Query  1208  MDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIIT  1029
             MDFRFF+LGNLW+++SSL T +Q+ +IL+ IE KW +L+A MPLKICYPALEG++WRIIT
Sbjct  454   MDFRFFSLGNLWSVVSSLATVDQSHAILDLIEAKWAELVADMPLKICYPALEGQEWRIIT  513

Query  1028  GSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTR  849
             GSDPKNTPWSYHNGGSWPTLLWQ T+ACIKM + E+A KAV +AE  +  D+WPEYYDT+
Sbjct  514   GSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRVEIAEKAVKLAERHISGDKWPEYYDTK  573

Query  848   HGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVC  699
              GRFIGKQ+RL QTW++AGYL +K+LL NP  A +LV  ED EL+    C
Sbjct  574   RGRFIGKQSRLYQTWSIAGYLVAKLLLDNPAAAKVLVTEEDSELVNAFSC  623



>ref|XP_006287277.1| hypothetical protein CARUB_v10000472mg [Capsella rubella]
 gb|EOA20175.1| hypothetical protein CARUB_v10000472mg [Capsella rubella]
Length=622

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/509 (69%), Positives = 415/509 (82%), Gaps = 1/509 (0%)
 Frame = -3

Query  2198  DGGRVEITDDSTVNKNDLNGS-SISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVA  2022
             DG   E+  D       +NGS S +  A       +E EAW LL+ +VV YCG P+GT+A
Sbjct  101   DGLSSELKSDLDEKPLPVNGSVSSNGNAQSAGTKSIEDEAWDLLRQSVVFYCGSPIGTIA  160

Query  2021  ANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQ  1842
             ANDP     LNYDQVFIRDFIPS +AFLL GE +IV+NF+L+TLQLQSWEKT+DC+SPGQ
Sbjct  161   ANDPNSTSVLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCHSPGQ  220

Query  1841  GLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDY  1662
             GLMPASFKV+T+PLDG +   E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K TGD 
Sbjct  221   GLMPASFKVKTVPLDGDDSMTEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCTGDL  280

Query  1661  TLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL  1482
             ++QERVDVQTGI++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL
Sbjct  281   SVQERVDVQTGIKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL  340

Query  1481  RCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINK  1302
              C REML   D +  L+ A+NNRL AL+FHIREYYW+D+KKINEIYRY+TEEYS DA+NK
Sbjct  341   VCAREMLTPEDGSADLIRALNNRLVALNFHIREYYWLDLKKINEIYRYQTEEYSYDAVNK  400

Query  1301  FNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILN  1122
             FNIYPDQIP W+V+++P  GGYL+GNLQPAHMDFRFF+LGNLW+I+ SL ++EQ+ +IL+
Sbjct  401   FNIYPDQIPSWLVDFMPNRGGYLIGNLQPAHMDFRFFSLGNLWSIVGSLASNEQSHAILD  460

Query  1121  FIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACI  942
             FIE KW +L+A MP KICYPA+EGE+WRIITGSDPKNTPWSYHNGG+WPTLLWQ T+A I
Sbjct  461   FIEAKWAELVADMPFKICYPAMEGEEWRIITGSDPKNTPWSYHNGGAWPTLLWQLTVASI  520

Query  941   KMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKN  762
             KMG+PE+A KAV +AE R+  D+WPEYYDT+  RFIGKQARL QTW++AGYL +K+LL N
Sbjct  521   KMGRPEIAEKAVELAERRIAQDKWPEYYDTKRARFIGKQARLYQTWSIAGYLVAKLLLAN  580

Query  761   PDMASLLVWNEDYELLENCVCGLKYNGRR  675
             P  A  L+  ED +L     C +  N RR
Sbjct  581   PAAAKFLISEEDSDLRNAFSCMISANPRR  609



>ref|XP_006471382.1| PREDICTED: alkaline/neutral invertase CINV1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006471383.1| PREDICTED: alkaline/neutral invertase CINV1-like isoform X2 [Citrus 
sinensis]
 ref|XP_006471385.1| PREDICTED: alkaline/neutral invertase CINV1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006471386.1| PREDICTED: alkaline/neutral invertase CINV1-like isoform X2 [Citrus 
sinensis]
 gb|KDO51341.1| hypothetical protein CISIN_1g006488mg [Citrus sinensis]
 gb|AIN45137.1| neutral/alkaline invertase [Citrus suavissima]
Length=643

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/502 (70%), Positives = 413/502 (82%), Gaps = 4/502 (1%)
 Frame = -3

Query  2204  QKDGGRVEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTV  2025
             Q   G+  I+ +  +N +     SI+    +     VE EAW LL+ ++V YCG PVGT+
Sbjct  126   QLKNGKAGISSNDKLNAS----GSITNTVHKVWAKSVEDEAWDLLRESIVYYCGNPVGTI  181

Query  2024  AANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPG  1845
             AANDP D   LNYDQVFIRDFIPS +AFLL GE +IV+NF+LHTLQLQSWEKT+DC+SPG
Sbjct  182   AANDPNDSTILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPG  241

Query  1844  QGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGD  1665
             QGLMPASFKVRT+PLDG +   E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD
Sbjct  242   QGLMPASFKVRTVPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGD  301

Query  1664  YTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSA  1485
              ++QERVDVQTGI++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSA
Sbjct  302   LSVQERVDVQTGIKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSA  361

Query  1484  LRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAIN  1305
             L   REML   D +  L+ A+NNRL ALSFHIREYYW+DMKK+NEIYRYKTEEYS DA+N
Sbjct  362   LLSAREMLTPEDGSADLIRALNNRLVALSFHIREYYWIDMKKLNEIYRYKTEEYSYDAVN  421

Query  1304  KFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSIL  1125
             KFNIYPDQIPPW+V ++P  GGYL+GNLQPAHMDFRFF+LGNLW+++SSL T +Q+ +IL
Sbjct  422   KFNIYPDQIPPWLVEFMPHIGGYLIGNLQPAHMDFRFFSLGNLWSVVSSLATVDQSHAIL  481

Query  1124  NFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLAC  945
             + IE KW +L+A MPLKICYPALEG++WRIITGSDPKNTPWSYHNGGSWPTLLWQ T+AC
Sbjct  482   DLIEAKWAELVADMPLKICYPALEGQEWRIITGSDPKNTPWSYHNGGSWPTLLWQLTVAC  541

Query  944   IKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLK  765
             IKM + E+A KAV +AE  +  D+WPEYYDT+ GRFIGKQ+RL QTW++AGYL +K+LL 
Sbjct  542   IKMNRVEIAEKAVKLAERHISGDKWPEYYDTKRGRFIGKQSRLYQTWSIAGYLVAKLLLD  601

Query  764   NPDMASLLVWNEDYELLENCVC  699
             NP  A +LV  ED EL+    C
Sbjct  602   NPAAAKVLVTEEDSELVNAFSC  623



>ref|XP_010093212.1| hypothetical protein L484_008994 [Morus notabilis]
 gb|EXB53710.1| hypothetical protein L484_008994 [Morus notabilis]
Length=645

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/490 (70%), Positives = 413/490 (84%), Gaps = 1/490 (0%)
 Frame = -3

Query  2141  GSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDF  1962
             G+ I KL   R  + +E+EAW LL+ ++V YC  P+GT+AANDP+    LNYDQVFIRDF
Sbjct  147   GTIIDKLHDVR-ANLIEEEAWSLLRASIVYYCNNPIGTIAANDPSSTSTLNYDQVFIRDF  205

Query  1961  IPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGE  1782
             IPS +AFLL GE +IV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLDG +  
Sbjct  206   IPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSA  265

Query  1781  FEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCL  1602
              EDVLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD ++QERVDVQTGI++IL LCL
Sbjct  266   TEDVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCL  325

Query  1601  RDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAI  1422
              DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C REML   D++  L+ A+
Sbjct  326   ADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDASADLMRAL  385

Query  1421  NNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETG  1242
             NNRL ALSFHIREYYW+DM+K+NEIYRYKTEEYS +A+NKFNIYPDQIP W+V ++P  G
Sbjct  386   NNRLVALSFHIREYYWIDMRKLNEIYRYKTEEYSYEAVNKFNIYPDQIPTWLVEFMPGKG  445

Query  1241  GYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYP  1062
             GYL+GNLQPAHMDFRFF+LGNLW+I+SSL + +Q+ +IL+ IE KW +L+A+MP KICYP
Sbjct  446   GYLIGNLQPAHMDFRFFSLGNLWSIVSSLASQDQSHAILDLIEAKWAELVAEMPFKICYP  505

Query  1061  ALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLP  882
             ALEG +WRI+TG DPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PE+A+KA+ VAE+R+ 
Sbjct  506   ALEGVEWRIVTGCDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPEIALKALKVAEKRIS  565

Query  881   VDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCV  702
              D+WPEYYDT+ GRF+GKQARL Q W++AGYL +K LL NP  A++LV  ED EL     
Sbjct  566   SDKWPEYYDTKRGRFVGKQARLFQNWSIAGYLVAKHLLANPSAANILVNEEDSELRNAFS  625

Query  701   CGLKYNGRRK  672
             C +  + R++
Sbjct  626   CIINASPRKR  635



>ref|XP_006361445.1| PREDICTED: alkaline/neutral invertase CINV1-like [Solanum tuberosum]
Length=655

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/477 (72%), Positives = 402/477 (84%), Gaps = 2/477 (0%)
 Frame = -3

Query  2096  VEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLP--LNYDQVFIRDFIPSALAFLLNGEG  1923
             +E EAW+LL+ ++V YCG PVGT+AA DP       LNYDQVFIRDFIPS +AFLL GE 
Sbjct  166   IEDEAWELLRESMVYYCGSPVGTIAAKDPTSSTADVLNYDQVFIRDFIPSGIAFLLKGEY  225

Query  1922  EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESA  1743
             EIV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLDG +   E+VLDPDFGE+A
Sbjct  226   EIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSATEEVLDPDFGEAA  285

Query  1742  IGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVT  1563
             IGRVAPVDSGLWWIILLRAY K +GD ++QER+DVQTGI++IL LCL DGFDMFPTLLVT
Sbjct  286   IGRVAPVDSGLWWIILLRAYGKSSGDLSVQERIDVQTGIKMILRLCLADGFDMFPTLLVT  345

Query  1562  DGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIRE  1383
             DGSCMIDRRMGIHGHPLEIQALF+SAL C REML   D +  L+ A+NNRL ALSFHIRE
Sbjct  346   DGSCMIDRRMGIHGHPLEIQALFHSALLCAREMLTPEDGSADLIRALNNRLVALSFHIRE  405

Query  1382  YYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMD  1203
             YYW+DMKK+NEIYRY+TEEYS DA+NKFNIYPDQI PW+V+W+P  GGYL+GNLQPAHMD
Sbjct  406   YYWIDMKKLNEIYRYQTEEYSYDAVNKFNIYPDQISPWLVDWMPSKGGYLIGNLQPAHMD  465

Query  1202  FRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGS  1023
             FRFF+LGNLW+I+ SL T +Q+ +IL+ IE KW DL+A MP KICYPALEG++W+IITG 
Sbjct  466   FRFFSLGNLWSIVCSLTTDDQSHAILDLIEAKWTDLVADMPFKICYPALEGQEWKIITGC  525

Query  1022  DPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHG  843
             DPKNTPWSYHNGG+WPTLLWQ  +A IKM +PE+A KAV VAE+R+  D+WPEYYDT+  
Sbjct  526   DPKNTPWSYHNGGAWPTLLWQLAVASIKMNRPEIAAKAVEVAEKRISRDKWPEYYDTKKA  585

Query  842   RFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRK  672
             RFIGKQARL QTW++AGYL +K+LL NP  A +L+  ED ELL    C +  N RRK
Sbjct  586   RFIGKQARLYQTWSIAGYLVAKLLLANPSAAKILISQEDSELLNAFSCAISSNPRRK  642



>dbj|BAJ89009.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=593

 Score =   752 bits (1942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/488 (71%), Positives = 413/488 (85%), Gaps = 6/488 (1%)
 Frame = -3

Query  2162  VNKNDLNGSSISK--LAPERE---VSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKL  1998
              +  D NG++  +   AP+R     S++E+EAW LL+ +VV+YCG PVGT+AA DP D  
Sbjct  78    ADGRDFNGAAAGQPDHAPQRRRRAASDLEEEAWGLLRESVVSYCGSPVGTIAACDPNDSS  137

Query  1997  PLNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFK  1818
             PLNYDQVFIRDF+PS +AFLL GE +IV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFK
Sbjct  138   PLNYDQVFIRDFVPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFK  197

Query  1817  VRTMPLDGRN-GEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVD  1641
             VR +PL+G + G  E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD T  ER+D
Sbjct  198   VRVVPLEGDDEGATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLTFHERID  257

Query  1640  VQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREML  1461
             VQTGI+LIL LCL DGFDMFPTLLVTDGSCM+DRRMGIHGHPLEIQ+LFYSAL C REML
Sbjct  258   VQTGIKLILKLCLADGFDMFPTLLVTDGSCMMDRRMGIHGHPLEIQSLFYSALLCAREML  317

Query  1460  IVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQ  1281
                D +  L+ A+N+RL ALSFHIREYYW+D +K+NEIYRYKTEEYS DA+NKFNIYPDQ
Sbjct  318   TPEDGSADLIRALNSRLMALSFHIREYYWLDKRKLNEIYRYKTEEYSYDAVNKFNIYPDQ  377

Query  1280  IPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWD  1101
             IPPW+V WIP  GGYL+GNLQPAHMDFRFF+LGNLW+I+SSL T  Q+ +IL+ +E KW 
Sbjct  378   IPPWLVEWIPPEGGYLIGNLQPAHMDFRFFSLGNLWSIVSSLATTRQSHAILDLVEAKWS  437

Query  1100  DLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPEL  921
             DL+A+MPLKICYPALE ++W+ ITGSDPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PE+
Sbjct  438   DLVAEMPLKICYPALEDQEWKYITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPEI  497

Query  920   AMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLL  741
             A +AV VAE R+ VD+WPEYYDT+ GRFIGKQARL QTW++AG+L +K+LL+NP+ + +L
Sbjct  498   AARAVEVAERRISVDKWPEYYDTKRGRFIGKQARLFQTWSIAGFLVAKLLLENPEKSRIL  557

Query  740   VWNEDYEL  717
               NED E 
Sbjct  558   CNNEDEEF  565



>ref|XP_008345689.1| PREDICTED: alkaline/neutral invertase CINV1-like [Malus domestica]
 ref|XP_008345695.1| PREDICTED: alkaline/neutral invertase CINV1-like [Malus domestica]
Length=652

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/481 (71%), Positives = 405/481 (84%), Gaps = 0/481 (0%)
 Frame = -3

Query  2105  VSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGE  1926
             +  +E EAW LL+ ++V YCG PVGT+AA DP     LNYDQVFIRDFIPS +AFLL GE
Sbjct  163   IDSLEDEAWDLLRESMVYYCGSPVGTIAAKDPTSSNTLNYDQVFIRDFIPSGIAFLLKGE  222

Query  1925  GEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGES  1746
              +IV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLDG     E+VLDPDFGE+
Sbjct  223   YDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDESATEEVLDPDFGEA  282

Query  1745  AIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLV  1566
             AIGRVAPVDSGLWWIILLRAY K +GD ++QERVDVQTGI++IL LC+ DGFDMFPTLLV
Sbjct  283   AIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILRLCIADGFDMFPTLLV  342

Query  1565  TDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIR  1386
             TDGSCMIDRRMGIHGHPLEIQALFYSAL C REML   D +  L+ A+NNRL ALSFHIR
Sbjct  343   TDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNRLVALSFHIR  402

Query  1385  EYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHM  1206
             EYYWVD++K+NEIYRYKTEEYS DA+NKFNIYPDQI  W+V W+P  GGYL+GNLQPAHM
Sbjct  403   EYYWVDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQISSWLVEWMPNKGGYLIGNLQPAHM  462

Query  1205  DFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITG  1026
             DFRFF+LGNLW+++SS+ T +Q+ +IL+ IE KW DL+A MP KICYPAL+G++W+IITG
Sbjct  463   DFRFFSLGNLWSVVSSIATTDQSHAILDLIETKWGDLVADMPFKICYPALDGQEWQIITG  522

Query  1025  SDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRH  846
             SDPKNTPWSYHNGGSWPTLLWQ T+ACIKM +PE+A KAV +AE+R+  D+WPEYYDT+ 
Sbjct  523   SDPKNTPWSYHNGGSWPTLLWQLTVACIKMDRPEIAAKAVEIAEKRISRDKWPEYYDTKR  582

Query  845   GRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCS  666
             GRF+GKQARL QTW++AGYL +K+LL +P  A +L+  ED EL+    C +  N RRK  
Sbjct  583   GRFVGKQARLFQTWSIAGYLVAKLLLADPSKAKILITEEDSELVNAFSCMIGANPRRKRG  642

Query  665   R  663
             R
Sbjct  643   R  643



>gb|AFP23358.1| neutral invertase [Litchi chinensis]
Length=650

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/481 (71%), Positives = 407/481 (85%), Gaps = 0/481 (0%)
 Frame = -3

Query  2105  VSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGE  1926
             V+ +E EAW LL+ ++V YCG P+GT+AANDP     LNYDQVFIRDFIPS +AFLL GE
Sbjct  161   VNSIEDEAWDLLRDSMVYYCGSPIGTIAANDPTSSNVLNYDQVFIRDFIPSGIAFLLKGE  220

Query  1925  GEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGES  1746
              +IV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKV T+PLDG +   E+VLDPDFGE+
Sbjct  221   YDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVCTVPLDGDDSATEEVLDPDFGEA  280

Query  1745  AIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLV  1566
             AIGRVAPVDSGLWWIILLRAY K +GD ++QERVDVQTGI++IL LCL DGFDMFPTLLV
Sbjct  281   AIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILRLCLADGFDMFPTLLV  340

Query  1565  TDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIR  1386
             TDGSCM+DRRMGIHGHPLEIQALFYSAL C REML   D +  L+ A+NNRL ALSFHIR
Sbjct  341   TDGSCMVDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNRLVALSFHIR  400

Query  1385  EYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHM  1206
             EYYW+D++K+NEIYRYKTEEYS DA+NKFNIYPDQI PW+V W+P  GGYL+GNLQPAHM
Sbjct  401   EYYWIDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWMPNKGGYLIGNLQPAHM  460

Query  1205  DFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITG  1026
             DFRFF+LGNLW+I+SSL T +Q+ +IL+ I+ KW DL+A MPLKICYPALEG++W+IITG
Sbjct  461   DFRFFSLGNLWSIVSSLATTDQSHAILDLIDTKWADLVADMPLKICYPALEGQEWQIITG  520

Query  1025  SDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRH  846
             SDPKNTPWSYHN GSWPTLLWQ T+ACIKM +PE++ +AV VAE ++  D+WPEYYDT+ 
Sbjct  521   SDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRPEISARAVQVAERQISRDKWPEYYDTKR  580

Query  845   GRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCS  666
              RFIGKQARL QTW++AGYL +K+LL +P  A +L+  ED EL+ +  C +  N RRK  
Sbjct  581   ARFIGKQARLFQTWSIAGYLVAKLLLADPSAAKILITEEDSELVNSFSCMISANPRRKRG  640

Query  665   R  663
             R
Sbjct  641   R  641



>ref|XP_002316508.2| hypothetical protein POPTR_0010s24250g [Populus trichocarpa]
 gb|EEF02679.2| hypothetical protein POPTR_0010s24250g [Populus trichocarpa]
Length=666

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/483 (71%), Positives = 408/483 (84%), Gaps = 1/483 (0%)
 Frame = -3

Query  2120  APEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAF  1941
             +P+  V  +E+EAW+LL+ ++V YCG P+GT+AANDP     LNYDQVFIRDFIPS +AF
Sbjct  171   SPKVSVDPIEEEAWELLRNSMVYYCGSPIGTIAANDPTSSSVLNYDQVFIRDFIPSGIAF  230

Query  1940  LLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNG-EFEDVLD  1764
             LL GE +IV+NFLLHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+ LDG +    E+VLD
Sbjct  231   LLKGEYDIVRNFLLHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVRLDGDDDFATEEVLD  290

Query  1763  PDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDM  1584
             PDFGE+AIGRVAPVDSGLWWIILLRAY K +GD +LQER+DVQTGI++IL LCL DGFDM
Sbjct  291   PDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERIDVQTGIKMILRLCLADGFDM  350

Query  1583  FPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSA  1404
             FPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C REML   D +  L+ A+NNRL A
Sbjct  351   FPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNRLVA  410

Query  1403  LSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGN  1224
             LSFHIREYYW+D++K+NEIYRYKTEEYS DA+NKFNIYPDQI PW+V W+P  GGYL+GN
Sbjct  411   LSFHIREYYWIDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWMPNQGGYLIGN  470

Query  1223  LQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGED  1044
             LQPAHMDFRFF+LGN+W+I+S L T +Q+ +IL+FIE KW DLIA MPLKICYPALEG++
Sbjct  471   LQPAHMDFRFFSLGNIWSIVSGLATRDQSNAILDFIEAKWSDLIADMPLKICYPALEGQE  530

Query  1043  WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPE  864
             W+IITGSDPKNTPWSYHN GSWPTLLWQ T ACIKM +PELA +AV +AE+R+  D+WPE
Sbjct  531   WQIITGSDPKNTPWSYHNAGSWPTLLWQLTAACIKMNRPELAARAVEIAEKRISRDKWPE  590

Query  863   YYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYN  684
             YYDT+  RFIGKQA L QTW++AGYL +K+LL +P  A +LV +ED EL+    C +  +
Sbjct  591   YYDTKKARFIGKQAHLFQTWSIAGYLVAKLLLADPSAARMLVMDEDPELVSAFSCMISTH  650

Query  683   GRR  675
              RR
Sbjct  651   PRR  653



>ref|XP_009393828.1| PREDICTED: alkaline/neutral invertase CINV1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009393829.1| PREDICTED: alkaline/neutral invertase CINV1-like [Musa acuminata 
subsp. malaccensis]
Length=630

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/507 (69%), Positives = 418/507 (82%), Gaps = 5/507 (1%)
 Frame = -3

Query  2186  VEITDDSTVNKNDLNGSSISKLAPEREVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPA  2007
             V+  + S +  ND+   S+++ + +   + VE  AW+LLQ +VV YCG PVGT+AA DP+
Sbjct  116   VDFENGSVIMPNDV---SVNQSSDKTRGNSVEDVAWRLLQESVVYYCGTPVGTIAAKDPS  172

Query  2006  DKLP--LNYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLM  1833
             D     LNYDQVFIRDFIPS +AFLL GE EIV+NF+LHTLQLQSWEKT+DC+SPGQGLM
Sbjct  173   DSGSSVLNYDQVFIRDFIPSGMAFLLMGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLM  232

Query  1832  PASFKVRTMPLDGRNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQ  1653
             PASFK+RT+PLDG +   E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD ++Q
Sbjct  233   PASFKIRTVPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQ  292

Query  1652  ERVDVQTGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCT  1473
             ER+DVQTGI++IL LCL DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C 
Sbjct  293   ERIDVQTGIKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALVCA  352

Query  1472  REMLIVNDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNI  1293
             REML   D +  L+ A+NNRL ALSFHIREYYWVD +K+NEIYRYKTEEYS DA+NKFNI
Sbjct  353   REMLAPEDGSADLIRALNNRLIALSFHIREYYWVDKRKLNEIYRYKTEEYSYDAVNKFNI  412

Query  1292  YPDQIPPWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIE  1113
             YPDQI PW+V W+PE GGY +GNLQPAHMDFRFF+LGNLW+I+SSL T  Q+ +IL+ IE
Sbjct  413   YPDQISPWLVEWMPEKGGYFIGNLQPAHMDFRFFSLGNLWSIVSSLATTHQSLAILDLIE  472

Query  1112  GKWDDLIAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMG  933
              KW DL+A MP KICYPALEG++W+IITGSDPKNTPWSYHNGGSWPTLLWQ T+ACIKM 
Sbjct  473   AKWSDLVADMPFKICYPALEGQEWQIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMN  532

Query  932   KPELAMKAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDM  753
             +PE+A +A+ VAE+R+  D+WPEYYDT+  RFIGKQARL QTW++AG+L  K+LLKNPD 
Sbjct  533   RPEIAARAIEVAEKRIAADRWPEYYDTKRARFIGKQARLYQTWSIAGFLVVKLLLKNPDA  592

Query  752   ASLLVWNEDYELLENCVCGLKYNGRRK  672
             A  +  +ED E++      +  N R++
Sbjct  593   ARNIWNDEDAEIVNALNIIVDSNPRKR  619



>ref|XP_004249987.1| PREDICTED: alkaline/neutral invertase CINV1-like [Solanum lycopersicum]
 ref|XP_010312546.1| PREDICTED: alkaline/neutral invertase CINV1-like [Solanum lycopersicum]
 ref|XP_010312547.1| PREDICTED: alkaline/neutral invertase CINV1-like [Solanum lycopersicum]
 ref|XP_010312548.1| PREDICTED: alkaline/neutral invertase CINV1-like [Solanum lycopersicum]
Length=655

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/477 (72%), Positives = 402/477 (84%), Gaps = 2/477 (0%)
 Frame = -3

Query  2096  VEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLP--LNYDQVFIRDFIPSALAFLLNGEG  1923
             +E EAW+LL+ ++V YCG PVGT+AA DP       LNYDQVFIRDFIPS +AFLL GE 
Sbjct  166   IEDEAWELLRESMVYYCGSPVGTIAAKDPTSSTADVLNYDQVFIRDFIPSGIAFLLKGEY  225

Query  1922  EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESA  1743
             EIV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLDG +   E+VLDPDFGE+A
Sbjct  226   EIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSATEEVLDPDFGEAA  285

Query  1742  IGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVT  1563
             IGRVAPVDSGLWWIILLRAY K +GD ++QER+DVQTGI++IL LCL DGFDMFPTLLVT
Sbjct  286   IGRVAPVDSGLWWIILLRAYGKSSGDLSVQERIDVQTGIKMILRLCLADGFDMFPTLLVT  345

Query  1562  DGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIRE  1383
             DGSCMIDRRMGIHGHPLEIQALF+SAL C REML   D +  L+ A+NNRL ALSFHIRE
Sbjct  346   DGSCMIDRRMGIHGHPLEIQALFHSALLCAREMLTPEDGSADLIRALNNRLVALSFHIRE  405

Query  1382  YYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMD  1203
             YYW+DMKK+NEIYRY+TEEYS DA+NKFNIYPDQI PW+V+W+P  GGYL+GNLQPAHMD
Sbjct  406   YYWIDMKKLNEIYRYQTEEYSYDAVNKFNIYPDQISPWLVDWMPSKGGYLIGNLQPAHMD  465

Query  1202  FRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGS  1023
             FRFF+LGNLW+I+ SL T +Q+ +IL+ IE KW DL+A MP KICYPALEG++W+IITG 
Sbjct  466   FRFFSLGNLWSIVCSLTTDDQSHAILDLIEAKWTDLVADMPFKICYPALEGQEWKIITGC  525

Query  1022  DPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHG  843
             DPKNTPWSYHNGGSWPTLLWQ  +A IKM +PE+A KAV VAE+R+  D+WPEYYDT+  
Sbjct  526   DPKNTPWSYHNGGSWPTLLWQLAVASIKMNRPEIAAKAVEVAEKRISQDKWPEYYDTKKA  585

Query  842   RFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRK  672
             RFIGKQARL QTW++AGYL +K+LL NP  A +L+  ED ELL    C +  N RRK
Sbjct  586   RFIGKQARLFQTWSIAGYLVAKLLLANPSSAKILISQEDSELLNAFSCAISSNPRRK  642



>ref|XP_007015894.1| Alkaline/neutral invertase isoform 2 [Theobroma cacao]
 gb|EOY33513.1| Alkaline/neutral invertase isoform 2 [Theobroma cacao]
Length=624

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/483 (72%), Positives = 408/483 (84%), Gaps = 1/483 (0%)
 Frame = -3

Query  2096  VEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEI  1917
             +E+EAW LL+ +VV YCG P+GT+AA+D +    LNYDQVFIRDFIPS +AFLL GE +I
Sbjct  137   IEEEAWDLLKESVVYYCGNPIGTIAASDTSSSSILNYDQVFIRDFIPSGIAFLLKGEYDI  196

Query  1916  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIG  1737
             V+NF+L+TLQLQSWEKT+DC+SPGQGLMPASFKVRT+P DG +   EDVLDPDFGE+AIG
Sbjct  197   VRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPRDGDDSVTEDVLDPDFGEAAIG  256

Query  1736  RVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDG  1557
             RVAPVDSGLWWIILLRAY K TGD ++QERVDVQTGI++IL LCL DGFDMFPTLLVTDG
Sbjct  257   RVAPVDSGLWWIILLRAYGKCTGDLSVQERVDVQTGIKMILKLCLADGFDMFPTLLVTDG  316

Query  1556  SCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYY  1377
             SCMIDRRMGIHGHPLEIQALFYSAL C REML   D +  L+ A+NNRL ALSFHIREYY
Sbjct  317   SCMIDRRMGIHGHPLEIQALFYSALLCAREMLASEDGSADLIRALNNRLVALSFHIREYY  376

Query  1376  WVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFR  1197
             W+DMKK+NEIYRYKTEEYS DA+NKFNIYPDQIPPW+V ++P  GGYL+GNLQPAHMDFR
Sbjct  377   WIDMKKLNEIYRYKTEEYSFDAVNKFNIYPDQIPPWLVEFMPARGGYLIGNLQPAHMDFR  436

Query  1196  FFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDP  1017
             FF+LGNLW+I+ SL T +Q+ +IL+ +E KW +L+A MPLKICYPALEG++WRIITGSDP
Sbjct  437   FFSLGNLWSIVGSLATVDQSHAILDLVEAKWSELVADMPLKICYPALEGQEWRIITGSDP  496

Query  1016  KNTPWSYHNGGSWPTLLW-QFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGR  840
             KNTPWSYHNGGSWPTLLW Q T+ACIKM +PE+A KAV +AE R+  D+WPEYYDTR  R
Sbjct  497   KNTPWSYHNGGSWPTLLWQQLTVACIKMNRPEVAEKAVMLAERRICRDKWPEYYDTRRAR  556

Query  839   FIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRKCSRF  660
             FIGKQ+RL QTW++AGYL +K+LL NP  A +L+  ED +L+    C L  N R+K  + 
Sbjct  557   FIGKQSRLFQTWSIAGYLVAKLLLANPSAAKILINEEDADLVNAFSCMLSANPRKKRGQK  616

Query  659   GVR  651
             G +
Sbjct  617   GFK  619



>ref|XP_009618314.1| PREDICTED: alkaline/neutral invertase CINV1-like [Nicotiana tomentosiformis]
 ref|XP_009618315.1| PREDICTED: alkaline/neutral invertase CINV1-like [Nicotiana tomentosiformis]
Length=654

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/477 (72%), Positives = 403/477 (84%), Gaps = 2/477 (0%)
 Frame = -3

Query  2096  VEKEAWKLLQGAVVNYCGYPVGTVAANDP--ADKLPLNYDQVFIRDFIPSALAFLLNGEG  1923
             +E EAW+LL+ ++V YCG PVGT+AA DP  ++   LNYDQVFIRDFIPS +AFLL GE 
Sbjct  166   IEDEAWELLRESMVYYCGSPVGTIAAQDPTSSNVGVLNYDQVFIRDFIPSGIAFLLKGEY  225

Query  1922  EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESA  1743
             EIV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVRT+PLDG +   E+VLDPDFGE+A
Sbjct  226   EIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTIPLDGDDSATEEVLDPDFGEAA  285

Query  1742  IGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVT  1563
             IGRVAPVDSGLWWIILLRAY K +GD ++QER+DVQTGI++IL LCL DGFDMFPTLLVT
Sbjct  286   IGRVAPVDSGLWWIILLRAYGKSSGDLSVQERIDVQTGIKMILRLCLADGFDMFPTLLVT  345

Query  1562  DGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIRE  1383
             DGSCMIDRRMGIHGHPLEIQALF+SAL C REML   D +  L+ A+NNRL ALSFHIRE
Sbjct  346   DGSCMIDRRMGIHGHPLEIQALFHSALLCAREMLTPEDGSADLIRALNNRLVALSFHIRE  405

Query  1382  YYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMD  1203
             YYW+DMKK+NEIYRYKTEEYS DA+NKFNIYPDQI PW+V W+P  GGYL+GNLQPAHMD
Sbjct  406   YYWIDMKKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWMPNKGGYLIGNLQPAHMD  465

Query  1202  FRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGS  1023
             FRFF+LGNLW+I+ SL T +Q+ +IL+ IE KW DL+A MP KICYPALEG++W+IITG 
Sbjct  466   FRFFSLGNLWSIVCSLTTDDQSHAILDLIEAKWADLVADMPFKICYPALEGQEWQIITGC  525

Query  1022  DPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHG  843
             DPKNTPWSYHNGG+WPTLLWQ  +A IKM +PE+A KAV VAEER+  D+WPEYYDT+  
Sbjct  526   DPKNTPWSYHNGGAWPTLLWQLAVASIKMNRPEIAAKAVEVAEERISRDKWPEYYDTKKA  585

Query  842   RFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRRK  672
             RF+GKQARL QTW++AGYL +K+LL NP  A +L+  ED ELL    C +  N RRK
Sbjct  586   RFVGKQARLFQTWSIAGYLVAKLLLANPSAAKILITQEDSELLNAFSCAISSNPRRK  642



>ref|XP_002874073.1| hypothetical protein ARALYDRAFT_489110 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50332.1| hypothetical protein ARALYDRAFT_489110 [Arabidopsis lyrata subsp. 
lyrata]
Length=615

 Score =   752 bits (1942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/474 (72%), Positives = 404/474 (85%), Gaps = 0/474 (0%)
 Frame = -3

Query  2096  VEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEI  1917
             +E EAW LL+ +VV YCG P+GT+AANDP+    LNYDQVFIRDFIPS +AFLL GE +I
Sbjct  129   IEDEAWDLLRQSVVFYCGSPIGTIAANDPSSTSVLNYDQVFIRDFIPSGIAFLLKGEYDI  188

Query  1916  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIG  1737
             V+NF+L+TLQLQSWEKT+DC+SPGQGLMP SFKV+T+PLDG +   E+VLDPDFGE+AIG
Sbjct  189   VRNFILYTLQLQSWEKTMDCHSPGQGLMPCSFKVKTVPLDGDDSMTEEVLDPDFGEAAIG  248

Query  1736  RVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDG  1557
             RVAPVDSGLWWIILLRAY K TGD ++QERVDVQTGI++IL LCL DGFDMFPTLLVTDG
Sbjct  249   RVAPVDSGLWWIILLRAYGKCTGDLSVQERVDVQTGIKMILKLCLADGFDMFPTLLVTDG  308

Query  1556  SCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYY  1377
             SCMIDRRMGIHGHPLEIQALFYSAL C REML   D +  L+ A+NNRL AL+FHIREYY
Sbjct  309   SCMIDRRMGIHGHPLEIQALFYSALVCAREMLTPEDGSDDLIRALNNRLVALNFHIREYY  368

Query  1376  WVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFR  1197
             W+D+KKINEIYRY+TEEYS DA+NKFNIYPDQIP W+V+++P  GGYL+GNLQPAHMDFR
Sbjct  369   WLDLKKINEIYRYQTEEYSYDAVNKFNIYPDQIPSWLVDFMPNRGGYLIGNLQPAHMDFR  428

Query  1196  FFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDP  1017
             FFTLGNLW+I+SSL T++Q+ +IL+ IE KW +L+A MPLKICYPA+EGE+WRIITGSDP
Sbjct  429   FFTLGNLWSIVSSLATNDQSHAILDLIEAKWAELVADMPLKICYPAMEGEEWRIITGSDP  488

Query  1016  KNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRF  837
             KNTPWSYHNGG+WPTLLWQ T+A IKMG+PE+A KAV +AE R+ +D+WPEYYDT+  RF
Sbjct  489   KNTPWSYHNGGAWPTLLWQLTVASIKMGRPEIAEKAVELAERRISLDKWPEYYDTKRARF  548

Query  836   IGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRR  675
             IGKQARL QTW++AGYL +K+LL NP  A  L   ED +L     C +  N RR
Sbjct  549   IGKQARLYQTWSIAGYLVAKLLLANPAAAKFLTSEEDSDLRNAFSCMISANPRR  602



>gb|EMS48943.1| hypothetical protein TRIUR3_16260 [Triticum urartu]
Length=659

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/486 (71%), Positives = 410/486 (84%), Gaps = 6/486 (1%)
 Frame = -3

Query  2162  VNKNDLNGSSISKLAPE---REVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPL  1992
             V   DLNG++    AP+   R  S++E+EAW LL+ +VV+YCG PVGT+AA DP D  PL
Sbjct  78    VAGRDLNGAA--DHAPQQRRRAASDLEEEAWALLRESVVSYCGSPVGTIAACDPNDSSPL  135

Query  1991  NYDQVFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVR  1812
             NYDQVFIRDF+PS +AFLL GE +IV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVR
Sbjct  136   NYDQVFIRDFVPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVR  195

Query  1811  TMPLDG-RNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQ  1635
              +PL+G   G  E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD +  ER+DVQ
Sbjct  196   VVPLEGDEEGATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSFHERIDVQ  255

Query  1634  TGIRLILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIV  1455
             TGI+LIL LCL DGFDMFPTLLVTDGSCM+DRRMGIHGHPLEIQ+LFYSAL C REML  
Sbjct  256   TGIKLILKLCLADGFDMFPTLLVTDGSCMMDRRMGIHGHPLEIQSLFYSALLCAREMLTP  315

Query  1454  NDSTKSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIP  1275
              D +  L+ A+NNRL ALSFHIREYYW+D +K+NEIYRYKTEEYS DA+NKFNIYPDQIP
Sbjct  316   EDGSADLIRALNNRLMALSFHIREYYWLDKRKLNEIYRYKTEEYSYDAVNKFNIYPDQIP  375

Query  1274  PWIVNWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDL  1095
             PW+V WIP  GGYL+GNLQPAHMDFRFF+LGNLW+I+SSL T  Q+ +IL+ +E KW DL
Sbjct  376   PWLVEWIPPEGGYLIGNLQPAHMDFRFFSLGNLWSIVSSLATTRQSHAILDLVEAKWSDL  435

Query  1094  IAQMPLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAM  915
             +A+MPLKICYPALE ++W+ ITGSDPKNTPWSYHN GSWPTLLWQ T+ACIKM +PE+A 
Sbjct  436   VAEMPLKICYPALEDQEWKYITGSDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRPEIAA  495

Query  914   KAVAVAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVW  735
             +AV VAE R+  D+WPEYYDT+ GRFIGKQARL QTW++AG+L +K+LL+NP+ + +L  
Sbjct  496   RAVEVAERRISADKWPEYYDTKRGRFIGKQARLFQTWSIAGFLVAKLLLENPEKSRILCN  555

Query  734   NEDYEL  717
             NED E 
Sbjct  556   NEDEEF  561



>gb|EMT12815.1| hypothetical protein F775_30387 [Aegilops tauschii]
Length=591

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/482 (72%), Positives = 409/482 (85%), Gaps = 6/482 (1%)
 Frame = -3

Query  2150  DLNGSSISKLAPE---REVSEVEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQ  1980
             DLNG++    AP+   R  S++E+EAW LL+ +VV+YCG PVGT+AA DP D  PLNYDQ
Sbjct  84    DLNGAA--DHAPQQRRRAASDLEEEAWALLRESVVSYCGSPVGTIAACDPNDSSPLNYDQ  141

Query  1979  VFIRDFIPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPL  1800
             VFIRDF+PS +AFLL GE +IV+NF+LHTLQLQSWEKT+DC+SPGQGLMPASFKVR +PL
Sbjct  142   VFIRDFVPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRVVPL  201

Query  1799  DG-RNGEFEDVLDPDFGESAIGRVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIR  1623
             +G   G  E+VLDPDFGE+AIGRVAPVDSGLWWIILLRAY K +GD +  ER+DVQTGI+
Sbjct  202   EGDEEGATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSFHERIDVQTGIK  261

Query  1622  LILNLCLRDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDST  1443
             LIL LCL DGFDMFPTLLVTDGSCM+DRRMGIHGHPLEIQ+LFYSAL C REML   D +
Sbjct  262   LILKLCLADGFDMFPTLLVTDGSCMMDRRMGIHGHPLEIQSLFYSALLCAREMLTPEDGS  321

Query  1442  KSLVAAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIV  1263
               L+ A+NNRL ALSFHIREYYW+D +K+NEIYRYKTEEYS DA+NKFNIYPDQIPPW+V
Sbjct  322   ADLIRALNNRLMALSFHIREYYWLDKRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLV  381

Query  1262  NWIPETGGYLVGNLQPAHMDFRFFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQM  1083
              WIP  GGYL+GNLQPAHMDFRFF+LGNLW+I+SSL T  Q+ +IL+ +E KW DL+A+M
Sbjct  382   EWIPPEGGYLIGNLQPAHMDFRFFSLGNLWSIVSSLATTRQSHAILDLVEAKWSDLVAEM  441

Query  1082  PLKICYPALEGEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVA  903
             PLKICYPALE ++W+ ITGSDPKNTPWSYHN GSWPTLLWQ T+ACIKM +PE+A +AV 
Sbjct  442   PLKICYPALEDQEWKYITGSDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRPEIAARAVE  501

Query  902   VAEERLPVDQWPEYYDTRHGRFIGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDY  723
             VAE R+  D+WPEYYDT+ GRFIGKQARL QTW++AG+L +K+LL+NP+ + +L  NED 
Sbjct  502   VAERRISTDKWPEYYDTKRGRFIGKQARLFQTWSIAGFLVAKLLLENPEKSRILCNNEDE  561

Query  722   EL  717
             E 
Sbjct  562   EF  563



>ref|XP_010493339.1| PREDICTED: alkaline/neutral invertase CINV1-like [Camelina sativa]
Length=618

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/474 (72%), Positives = 404/474 (85%), Gaps = 0/474 (0%)
 Frame = -3

Query  2096  VEKEAWKLLQGAVVNYCGYPVGTVAANDPADKLPLNYDQVFIRDFIPSALAFLLNGEGEI  1917
             VE EAW LL+ +VV YCG P+GT+AANDP     LNYDQVFIRDFIPS +AFLL GE +I
Sbjct  132   VEDEAWDLLRQSVVFYCGSPIGTIAANDPNSTSVLNYDQVFIRDFIPSGIAFLLKGEYDI  191

Query  1916  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPLDGRNGEFEDVLDPDFGESAIG  1737
             V+NF+L+TLQLQSWEKT+DC+SPGQGLMPASFKV+T+PLDG +   E+VLDPDFGE+AIG
Sbjct  192   VRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVKTVPLDGDDSMTEEVLDPDFGEAAIG  251

Query  1736  RVAPVDSGLWWIILLRAYVKITGDYTLQERVDVQTGIRLILNLCLRDGFDMFPTLLVTDG  1557
             RVAPVDSGLWWIILLRAY K TGD ++QERVDVQTGI++IL LCL DGFDMFPTLLVTDG
Sbjct  252   RVAPVDSGLWWIILLRAYGKCTGDLSVQERVDVQTGIKMILKLCLADGFDMFPTLLVTDG  311

Query  1556  SCMIDRRMGIHGHPLEIQALFYSALRCTREMLIVNDSTKSLVAAINNRLSALSFHIREYY  1377
             SCMIDRRMGIHGHPLEIQALFYSAL C REML   D +  L+ A+NNRL AL+FHIREYY
Sbjct  312   SCMIDRRMGIHGHPLEIQALFYSALVCAREMLTPEDGSADLIRALNNRLVALNFHIREYY  371

Query  1376  WVDMKKINEIYRYKTEEYSMDAINKFNIYPDQIPPWIVNWIPETGGYLVGNLQPAHMDFR  1197
             W+D+KKINEIYRY+TEEYS DA+NKFNIYPDQIP W+V+++P  GGYL+GNLQPAHMDFR
Sbjct  372   WLDLKKINEIYRYQTEEYSYDAVNKFNIYPDQIPSWLVDFMPNRGGYLLGNLQPAHMDFR  431

Query  1196  FFTLGNLWAIISSLGTHEQNKSILNFIEGKWDDLIAQMPLKICYPALEGEDWRIITGSDP  1017
             FF+LGNLW+I+ SL ++EQ+ +IL+FIE KW +L+A MP KICYPA+EGE+WRIITGSDP
Sbjct  432   FFSLGNLWSIVGSLASNEQSHAILDFIEAKWAELVADMPFKICYPAMEGEEWRIITGSDP  491

Query  1016  KNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAMKAVAVAEERLPVDQWPEYYDTRHGRF  837
             KNTPWSYHNGG+WPTLLWQ T+A IKMG+PE+A KAV +AE R+ +D+WPEYYDT+  RF
Sbjct  492   KNTPWSYHNGGAWPTLLWQLTVASIKMGRPEIAEKAVELAERRIALDKWPEYYDTKRARF  551

Query  836   IGKQARLNQTWTVAGYLTSKMLLKNPDMASLLVWNEDYELLENCVCGLKYNGRR  675
             IGKQARL QTW++AGYL +K+LL NP  A  L  +ED +L     C +  N RR
Sbjct  552   IGKQARLYQTWSIAGYLVAKLLLANPAAAKFLTSDEDSDLTNAFSCMISANPRR  605



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9568061452686