BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18450_g1_i4 len=1572 path=[1552:0-121 1674:122-249 @1802@!:250-1233
2786:1234-1571]

Length=1572
                                                                      Score     E

ref|XP_009597476.1|  PREDICTED: putative clathrin assembly protei...    509   2e-171   
ref|XP_009629510.1|  PREDICTED: putative clathrin assembly protei...    489   1e-163   
ref|XP_009794823.1|  PREDICTED: putative clathrin assembly protei...    488   3e-163   
ref|XP_006351813.1|  PREDICTED: putative clathrin assembly protei...    483   2e-161   
emb|CDO97491.1|  unnamed protein product                                482   6e-161   
ref|XP_011087830.1|  PREDICTED: putative clathrin assembly protei...    481   2e-160   
ref|XP_004230562.1|  PREDICTED: putative clathrin assembly protei...    479   1e-159   
ref|XP_009787969.1|  PREDICTED: putative clathrin assembly protei...    479   1e-159   
ref|XP_010313086.1|  PREDICTED: putative clathrin assembly protei...    478   4e-159   
ref|XP_006352083.1|  PREDICTED: putative clathrin assembly protei...    477   1e-158   
gb|EYU18515.1|  hypothetical protein MIMGU_mgv1a003145mg                465   9e-154   
gb|EPS66087.1|  hypothetical protein M569_08691                         446   5e-147   
ref|XP_007043039.1|  ENTH/ANTH/VHS superfamily protein                  444   5e-146   
ref|XP_011018854.1|  PREDICTED: putative clathrin assembly protei...    444   6e-146   
ref|XP_006381338.1|  clathrin assembly family protein                   442   2e-145   
gb|KDP37487.1|  hypothetical protein JCGZ_05926                         437   4e-143   
ref|XP_002523765.1|  clathrin assembly protein, putative                431   8e-141   Ricinus communis
ref|XP_007222060.1|  hypothetical protein PRUPE_ppa003194mg             429   6e-140   
ref|XP_010103874.1|  Putative clathrin assembly protein                 424   4e-138   
ref|XP_008218828.1|  PREDICTED: putative clathrin assembly protei...    422   2e-137   
ref|XP_009354070.1|  PREDICTED: putative clathrin assembly protei...    422   2e-137   
ref|XP_009333624.1|  PREDICTED: putative clathrin assembly protei...    421   5e-137   
ref|NP_171804.1|  putative clathrin assembly protein                    421   8e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002270803.1|  PREDICTED: putative clathrin assembly protei...    418   7e-136   Vitis vinifera
ref|XP_008391377.1|  PREDICTED: putative clathrin assembly protei...    418   8e-136   
ref|XP_010260538.1|  PREDICTED: putative clathrin assembly protei...    417   1e-135   
ref|XP_008339314.1|  PREDICTED: putative clathrin assembly protei...    416   6e-135   
ref|XP_006432449.1|  hypothetical protein CICLE_v10000680mg             414   3e-134   
ref|XP_006494069.1|  PREDICTED: putative clathrin assembly protei...    413   4e-134   
ref|XP_010030073.1|  PREDICTED: putative clathrin assembly protei...    412   1e-133   
ref|XP_004155511.1|  PREDICTED: LOW QUALITY PROTEIN: putative cla...    412   2e-133   
ref|XP_010694962.1|  PREDICTED: putative clathrin assembly protei...    410   9e-133   
ref|XP_010522755.1|  PREDICTED: putative clathrin assembly protei...    409   3e-132   
ref|XP_003524077.1|  PREDICTED: putative clathrin assembly protei...    408   6e-132   
gb|KHN28501.1|  Putative clathrin assembly protein                      407   7e-132   
ref|XP_004137043.1|  PREDICTED: LOW QUALITY PROTEIN: putative cla...    408   8e-132   
ref|XP_006418272.1|  hypothetical protein EUTSA_v10007148mg             405   1e-130   
ref|XP_008455244.1|  PREDICTED: putative clathrin assembly protei...    405   1e-130   
ref|XP_006585453.1|  PREDICTED: putative clathrin assembly protei...    403   7e-130   
ref|XP_006307040.1|  hypothetical protein CARUB_v10008628mg             400   1e-128   
ref|XP_009119579.1|  PREDICTED: putative clathrin assembly protei...    399   2e-128   
ref|XP_002889433.1|  hypothetical protein ARALYDRAFT_470282             399   3e-128   
gb|KGN43681.1|  hypothetical protein Csa_7G058550                       399   5e-128   
ref|XP_004485543.1|  PREDICTED: putative clathrin assembly protei...    397   1e-127   
ref|XP_006396479.1|  hypothetical protein EUTSA_v10028524mg             397   1e-127   
ref|XP_010481505.1|  PREDICTED: putative clathrin assembly protei...    397   1e-127   
ref|XP_010462543.1|  PREDICTED: putative clathrin assembly protei...    393   3e-127   
ref|XP_003547072.1|  PREDICTED: putative clathrin assembly protei...    396   3e-127   
ref|XP_009118718.1|  PREDICTED: putative clathrin assembly protei...    394   2e-126   
gb|KFK42666.1|  hypothetical protein AALP_AA1G024000                    394   2e-126   
ref|XP_009111170.1|  PREDICTED: putative clathrin assembly protei...    392   1e-125   
emb|CDY15448.1|  BnaA08g27320D                                          391   1e-125   
gb|KHN33498.1|  Putative clathrin assembly protein                      391   3e-125   
ref|XP_003593137.1|  hypothetical protein MTR_2g008170                  389   3e-124   
ref|XP_010474909.1|  PREDICTED: putative clathrin assembly protei...    387   1e-123   
ref|XP_009119580.1|  PREDICTED: putative clathrin assembly protei...    383   2e-122   
ref|XP_002874903.1|  hypothetical protein ARALYDRAFT_911949             383   5e-122   
emb|CDX89917.1|  BnaA10g01650D                                          377   1e-121   
emb|CDY32494.1|  BnaA09g51020D                                          380   3e-121   
ref|XP_010065535.1|  PREDICTED: putative clathrin assembly protei...    379   5e-121   
emb|CDY18145.1|  BnaC05g01680D                                          374   2e-120   
ref|XP_010422560.1|  PREDICTED: putative clathrin assembly protei...    378   3e-120   
ref|XP_009405274.1|  PREDICTED: putative clathrin assembly protei...    376   9e-120   
gb|KFK30862.1|  hypothetical protein AALP_AA6G035200                    375   9e-119   
ref|XP_007159072.1|  hypothetical protein PHAVU_002G206000g             373   2e-118   
ref|XP_011092695.1|  PREDICTED: putative clathrin assembly protei...    372   3e-118   
emb|CDX86691.1|  BnaC08g00120D                                          384   4e-118   
ref|XP_006286768.1|  hypothetical protein CARUB_v10003318mg             372   8e-118   
gb|EYU35413.1|  hypothetical protein MIMGU_mgv1a023938mg                370   4e-117   
ref|XP_004516994.1|  PREDICTED: putative clathrin assembly protei...    369   8e-117   
emb|CDY21904.1|  BnaC09g00100D                                          368   2e-116   
emb|CDY22070.1|  BnaA09g00990D                                          368   3e-116   
ref|XP_009111265.1|  PREDICTED: putative clathrin assembly protei...    367   4e-116   
ref|NP_192174.2|  putative clathrin assembly protein                    363   4e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003626768.1|  hypothetical protein MTR_8g008860                  360   3e-113   
dbj|BAC43049.1|  putative protein destination factor                    360   4e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010270464.1|  PREDICTED: putative clathrin assembly protei...    354   4e-111   
ref|XP_009382940.1|  PREDICTED: LOW QUALITY PROTEIN: putative cla...    352   3e-110   
ref|XP_009420267.1|  PREDICTED: putative clathrin assembly protei...    344   6e-107   
ref|XP_010911081.1|  PREDICTED: putative clathrin assembly protei...    339   9e-105   
ref|XP_010911649.1|  PREDICTED: putative clathrin assembly protei...    336   4e-104   
ref|XP_008810593.1|  PREDICTED: putative clathrin assembly protei...    332   4e-102   
ref|XP_006851331.1|  hypothetical protein AMTR_s00050p00195040          330   3e-101   
ref|NP_001146051.1|  uncharacterized protein LOC100279582               320   1e-97    Zea mays [maize]
ref|XP_004984734.1|  PREDICTED: putative clathrin assembly protei...    317   4e-96    
ref|XP_008784532.1|  PREDICTED: putative clathrin assembly protei...    316   5e-96    
gb|AES91572.2|  clathrin assembly plant-like protein, putative          315   6e-96    
ref|XP_006649844.1|  PREDICTED: putative clathrin assembly protei...    316   7e-96    
ref|XP_003609375.1|  epsin N-terminal homology (ENTH) domain-cont...    315   9e-96    
ref|NP_001168322.1|  putative ENTH/ANTH/VHS superfamily protein i...    315   9e-96    Zea mays [maize]
ref|XP_002465482.1|  hypothetical protein SORBIDRAFT_01g039590          314   4e-95    Sorghum bicolor [broomcorn]
gb|EAY98116.1|  hypothetical protein OsI_20032                          308   3e-93    Oryza sativa Indica Group [Indian rice]
gb|AAC78254.1|  predicted protein destination factor                    309   6e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006858414.1|  hypothetical protein AMTR_s00071p00051500          304   7e-92    
ref|XP_004508474.1|  PREDICTED: putative clathrin assembly protei...    303   2e-91    
ref|XP_008242801.1|  PREDICTED: putative clathrin assembly protei...    301   2e-90    
ref|XP_010533141.1|  PREDICTED: probable clathrin assembly protei...    301   3e-90    
ref|XP_010103717.1|  Putative clathrin assembly protein                 299   1e-89    
ref|XP_010937786.1|  PREDICTED: probable clathrin assembly protei...    294   4e-89    
ref|XP_007013503.1|  Epsin N-terminal domain-containing protein /...    297   8e-89    
ref|XP_009368880.1|  PREDICTED: putative clathrin assembly protei...    296   1e-88    
gb|AAV25008.1|  putative clathrin assembly protein                      296   3e-88    Oryza sativa Japonica Group [Japonica rice]
gb|EYU32349.1|  hypothetical protein MIMGU_mgv1a002790mg                296   3e-88    
ref|XP_003541475.1|  PREDICTED: probable clathrin assembly protei...    295   3e-88    
ref|XP_004288787.1|  PREDICTED: putative clathrin assembly protei...    293   1e-87    
gb|EPS73754.1|  hypothetical protein M569_01000                         298   1e-87    
ref|XP_003566218.1|  PREDICTED: putative clathrin assembly protei...    293   2e-87    
ref|NP_001174432.1|  Os05g0426100                                       296   3e-87    
ref|XP_009406985.1|  PREDICTED: putative clathrin assembly protei...    293   4e-87    
gb|KDO58861.1|  hypothetical protein CISIN_1g0079601mg                  284   8e-87    
ref|XP_010324965.1|  PREDICTED: putative clathrin assembly protei...    291   3e-86    
ref|XP_010068201.1|  PREDICTED: putative clathrin assembly protei...    284   3e-86    
ref|XP_006343526.1|  PREDICTED: putative clathrin assembly protei...    290   3e-86    
emb|CDP13525.1|  unnamed protein product                                290   3e-86    
ref|XP_008337266.1|  PREDICTED: putative clathrin assembly protei...    289   7e-86    
ref|XP_002439828.1|  hypothetical protein SORBIDRAFT_09g020870          286   1e-84    Sorghum bicolor [broomcorn]
ref|XP_007203766.1|  hypothetical protein PRUPE_ppa003005mg             283   9e-84    
ref|XP_009803425.1|  PREDICTED: putative clathrin assembly protei...    283   1e-83    
tpg|DAA44659.1|  TPA: putative ENTH/ANTH/VHS superfamily protein ...    281   1e-83    
ref|XP_006475889.1|  PREDICTED: probable clathrin assembly protei...    283   2e-83    
ref|XP_006450877.1|  hypothetical protein CICLE_v10007747mg             283   2e-83    
ref|XP_003526396.1|  PREDICTED: putative clathrin assembly protei...    282   4e-83    
ref|XP_009595075.1|  PREDICTED: putative clathrin assembly protei...    281   4e-83    
ref|XP_009416237.1|  PREDICTED: probable clathrin assembly protei...    281   7e-83    
ref|XP_010323295.1|  PREDICTED: putative clathrin assembly protei...    280   2e-82    
ref|XP_006358291.1|  PREDICTED: putative clathrin assembly protei...    279   3e-82    
gb|KDP30263.1|  hypothetical protein JCGZ_17045                         278   1e-81    
ref|XP_009363999.1|  PREDICTED: putative clathrin assembly protei...    277   2e-81    
emb|CDX75232.1|  BnaA01g04700D                                          276   2e-81    
gb|KHG28158.1|  hypothetical protein F383_15961                         276   5e-81    
ref|XP_008362897.1|  PREDICTED: putative clathrin assembly protei...    276   8e-81    
ref|XP_006362623.1|  PREDICTED: putative clathrin assembly protei...    276   9e-81    
emb|CDX68831.1|  BnaC01g06220D                                          275   1e-80    
gb|KHN22116.1|  Putative clathrin assembly protein                      275   1e-80    
ref|NP_001049708.1|  Os03g0275500                                       275   2e-80    Oryza sativa Japonica Group [Japonica rice]
gb|EEE58789.1|  hypothetical protein OsJ_10324                          269   2e-80    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004240592.1|  PREDICTED: putative clathrin assembly protei...    275   3e-80    
emb|CDX76976.1|  BnaC04g37710D                                          271   2e-79    
ref|XP_009346195.1|  PREDICTED: LOW QUALITY PROTEIN: putative cla...    273   2e-79    
ref|XP_010920611.1|  PREDICTED: probable clathrin assembly protei...    272   4e-79    
ref|XP_009355755.1|  PREDICTED: putative clathrin assembly protei...    272   4e-79    
emb|CDY35361.1|  BnaA04g14860D                                          270   5e-79    
ref|XP_009126233.1|  PREDICTED: probable clathrin assembly protei...    270   1e-78    
ref|XP_011017805.1|  PREDICTED: probable clathrin assembly protei...    270   1e-78    
ref|XP_003558231.1|  PREDICTED: putative clathrin assembly protei...    270   2e-78    
ref|XP_010250161.1|  PREDICTED: probable clathrin assembly protei...    270   3e-78    
ref|XP_008378380.1|  PREDICTED: probable clathrin assembly protei...    269   6e-78    
ref|XP_002324642.2|  hypothetical protein POPTR_0018s12830g             268   8e-78    Populus trichocarpa [western balsam poplar]
ref|XP_009384881.1|  PREDICTED: putative clathrin assembly protei...    267   1e-77    
ref|XP_008367716.1|  PREDICTED: putative clathrin assembly protei...    268   2e-77    
ref|XP_002324864.1|  clathrin assembly family protein                   267   3e-77    Populus trichocarpa [western balsam poplar]
emb|CDY11530.1|  BnaA09g40960D                                          265   4e-77    
gb|KHN08137.1|  Putative clathrin assembly protein                      261   5e-77    
ref|XP_011036564.1|  PREDICTED: putative clathrin assembly protei...    266   6e-77    
gb|KHN07072.1|  Putative clathrin assembly protein                      261   1e-76    
ref|XP_002285168.1|  PREDICTED: putative clathrin assembly protei...    265   2e-76    Vitis vinifera
emb|CDP10437.1|  unnamed protein product                                264   2e-76    
ref|XP_002308069.2|  hypothetical protein POPTR_0006s06580g             263   5e-76    Populus trichocarpa [western balsam poplar]
ref|XP_009794065.1|  PREDICTED: putative clathrin assembly protei...    262   1e-75    
ref|XP_009794064.1|  PREDICTED: putative clathrin assembly protei...    263   1e-75    
ref|XP_009794063.1|  PREDICTED: probable clathrin assembly protei...    263   1e-75    
ref|XP_004962023.1|  PREDICTED: putative clathrin assembly protei...    261   1e-75    
ref|XP_007155030.1|  hypothetical protein PHAVU_003G167300g             260   3e-75    
ref|XP_009621781.1|  PREDICTED: putative clathrin assembly protei...    261   3e-75    
ref|XP_006578140.1|  PREDICTED: putative clathrin assembly protei...    261   5e-75    
ref|XP_009794059.1|  PREDICTED: probable clathrin assembly protei...    259   4e-74    
ref|XP_009117225.1|  PREDICTED: putative clathrin assembly protei...    257   7e-74    
gb|KDP33586.1|  hypothetical protein JCGZ_07157                         258   1e-73    
ref|XP_008443968.1|  PREDICTED: putative clathrin assembly protei...    251   7e-73    
ref|XP_008443967.1|  PREDICTED: putative clathrin assembly protei...    252   2e-72    
ref|XP_011070094.1|  PREDICTED: probable clathrin assembly protei...    250   2e-72    
ref|XP_010241546.1|  PREDICTED: probable clathrin assembly protei...    253   4e-72    
gb|AES73629.2|  clathrin assembly plant-like protein, putative          253   4e-72    
ref|XP_011039677.1|  PREDICTED: putative clathrin assembly protei...    253   7e-72    
ref|XP_003603378.1|  epsin N-terminal homology (ENTH) domain-cont...    252   1e-71    
ref|NP_001174177.1|  Os05g0112101                                       250   1e-71    
ref|XP_010546565.1|  PREDICTED: LOW QUALITY PROTEIN: putative cla...    252   1e-71    
ref|XP_002309633.1|  clathrin assembly family protein                   252   2e-71    Populus trichocarpa [western balsam poplar]
ref|XP_006483372.1|  PREDICTED: putative clathrin assembly protei...    251   3e-71    
ref|XP_006450421.1|  hypothetical protein CICLE_v10007706mg             250   4e-71    
ref|XP_011081548.1|  PREDICTED: putative clathrin assembly protei...    249   1e-70    
ref|XP_010049908.1|  PREDICTED: putative clathrin assembly protei...    249   1e-70    
gb|EEE63786.1|  hypothetical protein OsJ_18609                          246   2e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004501337.1|  PREDICTED: putative clathrin assembly protei...    248   3e-70    
ref|XP_010048955.1|  PREDICTED: putative clathrin assembly protei...    247   8e-70    
ref|XP_009111171.1|  PREDICTED: putative clathrin assembly protei...    243   1e-69    
ref|XP_008219684.1|  PREDICTED: putative clathrin assembly protei...    245   3e-69    
ref|XP_007011846.1|  Epsin N-terminal domain-containing protein /...    246   3e-69    
gb|KHG12375.1|  hypothetical protein F383_17737                         245   3e-69    
ref|XP_002515505.1|  clathrin assembly protein, putative                246   3e-69    Ricinus communis
ref|XP_007011845.1|  Epsin N-terminal domain-containing protein /...    245   5e-69    
emb|CDX76977.1|  BnaC04g37720D                                          242   5e-69    
emb|CBI20038.3|  unnamed protein product                                241   7e-69    
ref|XP_009759128.1|  PREDICTED: putative clathrin assembly protei...    244   1e-68    
ref|XP_010525951.1|  PREDICTED: putative clathrin assembly protei...    244   1e-68    
ref|XP_007225127.1|  hypothetical protein PRUPE_ppa002600mg             243   2e-68    
ref|XP_010696359.1|  PREDICTED: probable clathrin assembly protei...    243   2e-68    
ref|XP_004960513.1|  PREDICTED: probable clathrin assembly protei...    242   4e-68    
ref|XP_007137013.1|  hypothetical protein PHAVU_009G092600g             242   5e-68    
ref|XP_010048010.1|  PREDICTED: putative clathrin assembly protei...    238   6e-67    
ref|XP_004172314.1|  PREDICTED: putative clathrin assembly protei...    237   5e-66    
ref|XP_004136352.1|  PREDICTED: putative clathrin assembly protei...    237   5e-66    
ref|XP_008466416.1|  PREDICTED: putative clathrin assembly protei...    236   6e-66    
gb|KHG13020.1|  hypothetical protein F383_20305                         233   9e-65    
gb|EMT27768.1|  Putative clathrin assembly protein                      228   4e-64    
ref|XP_006405206.1|  hypothetical protein EUTSA_v10000078mg             231   7e-64    
ref|XP_002440464.1|  hypothetical protein SORBIDRAFT_09g001390          227   1e-62    Sorghum bicolor [broomcorn]
ref|NP_567892.1|  ENTH/ANTH/VHS superfamily protein                     225   7e-62    Arabidopsis thaliana [mouse-ear cress]
gb|AAM61646.1|  unknown                                                 225   7e-62    Arabidopsis thaliana [mouse-ear cress]
gb|AAL77661.1|  AT4g32280/F10M6_80                                      225   9e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293772.1|  hypothetical protein CARUB_v10022748mg             226   1e-61    
ref|XP_004291452.1|  PREDICTED: putative clathrin assembly protei...    225   1e-61    
ref|XP_006283312.1|  hypothetical protein CARUB_v10004350mg             224   2e-61    
ref|NP_565595.1|  putative clathrin assembly protein                    224   3e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432743.1|  PREDICTED: probable clathrin assembly protei...    223   3e-61    
ref|XP_010447412.1|  PREDICTED: probable clathrin assembly protei...    223   3e-61    
gb|ACB59217.1|  ENTH                                                    223   4e-61    Brassica oleracea
ref|XP_009140672.1|  PREDICTED: putative clathrin assembly protei...    223   6e-61    
emb|CAA16962.1|  putative protein                                       225   8e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878853.1|  hypothetical protein ARALYDRAFT_481396             222   1e-60    
ref|XP_010417312.1|  PREDICTED: putative clathrin assembly protei...    222   1e-60    
ref|XP_008443969.1|  PREDICTED: putative clathrin assembly protei...    217   1e-60    
ref|XP_010472542.1|  PREDICTED: putative clathrin assembly protei...    221   2e-60    
ref|XP_002869286.1|  hypothetical protein ARALYDRAFT_328503             223   3e-60    
ref|XP_001766329.1|  predicted protein                                  220   4e-60    
ref|XP_010429535.1|  PREDICTED: putative clathrin assembly protei...    220   5e-60    
ref|XP_010437928.1|  PREDICTED: probable clathrin assembly protei...    219   8e-60    
gb|KFK29836.1|  hypothetical protein AALP_AA7G185200                    218   3e-59    
ref|XP_004970790.1|  PREDICTED: putative clathrin assembly protei...    214   4e-58    
ref|XP_007148441.1|  hypothetical protein PHAVU_006G209000g             214   5e-58    
ref|XP_006654911.1|  PREDICTED: probable clathrin assembly protei...    211   6e-58    
ref|XP_002960679.1|  hypothetical protein SELMODRAFT_437722             209   4e-56    
ref|XP_002983358.1|  hypothetical protein SELMODRAFT_234210             208   5e-56    
ref|NP_001168422.1|  putative ENTH/ANTH/VHS superfamily protein         207   2e-55    Zea mays [maize]
ref|XP_006412495.1|  hypothetical protein EUTSA_v10024663mg             207   2e-55    
gb|EYU34984.1|  hypothetical protein MIMGU_mgv1a003921mg                205   4e-55    
ref|XP_008666278.1|  PREDICTED: LOW QUALITY PROTEIN: putative cla...    201   1e-54    
ref|XP_002458865.1|  hypothetical protein SORBIDRAFT_03g041725          203   3e-54    Sorghum bicolor [broomcorn]
tpg|DAA46805.1|  TPA: putative ENTH/ANTH/VHS superfamily protein        199   5e-53    
ref|NP_001044997.1|  Os01g0881100                                       187   8e-49    Oryza sativa Japonica Group [Japonica rice]
gb|EAY76714.1|  hypothetical protein OsI_04669                          186   1e-48    Oryza sativa Indica Group [Indian rice]
ref|XP_008657000.1|  PREDICTED: putative clathrin assembly protei...    187   2e-48    
ref|XP_006646535.1|  PREDICTED: putative clathrin assembly protei...    179   2e-46    
ref|XP_003568997.1|  PREDICTED: probable clathrin assembly protei...    180   6e-46    
gb|EPS72901.1|  hypothetical protein M569_01858                         174   3e-45    
ref|XP_010051791.1|  PREDICTED: putative clathrin assembly protei...    169   1e-43    
gb|AFW86798.1|  putative ENTH/ANTH/VHS superfamily protein              172   2e-43    
ref|XP_006655342.1|  PREDICTED: putative clathrin assembly protei...    168   1e-42    
ref|XP_002285283.1|  PREDICTED: putative clathrin assembly protei...    171   1e-42    Vitis vinifera
emb|CDY37444.1|  BnaC08g45820D                                          161   1e-41    
gb|EYU20257.1|  hypothetical protein MIMGU_mgv1a003119mg                163   5e-40    
gb|AFW81878.1|  putative ENTH/ANTH/VHS superfamily protein              160   2e-39    
gb|EEE62083.1|  hypothetical protein OsJ_16867                          159   4e-39    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010688537.1|  PREDICTED: putative clathrin assembly protei...    159   4e-39    
ref|XP_011017801.1|  PREDICTED: probable clathrin assembly protei...    158   2e-38    
gb|KCW75512.1|  hypothetical protein EUGRSUZ_E04273                     153   2e-37    
ref|XP_011017802.1|  PREDICTED: probable clathrin assembly protei...    154   3e-37    
ref|XP_011017806.1|  PREDICTED: probable clathrin assembly protei...    154   3e-37    
gb|KCW75503.1|  hypothetical protein EUGRSUZ_E04265                     149   9e-37    
emb|CBI21050.3|  unnamed protein product                                151   4e-36    
gb|EMT22200.1|  Putative clathrin assembly protein                      147   8e-35    
ref|NP_001159212.1|  uncharacterized protein LOC100304298               146   9e-35    Zea mays [maize]
gb|EYU25973.1|  hypothetical protein MIMGU_mgv1a025181mg                140   1e-32    
gb|KDP30807.1|  hypothetical protein JCGZ_13750                         140   3e-32    
gb|KCW82739.1|  hypothetical protein EUGRSUZ_C04114                     135   3e-32    
gb|KDO54307.1|  hypothetical protein CISIN_1g039340mg                   135   2e-31    
ref|XP_006447647.1|  hypothetical protein CICLE_v10014695mg             136   3e-31    
ref|XP_002525336.1|  clathrin assembly protein, putative                136   4e-31    Ricinus communis
gb|KDO58860.1|  hypothetical protein CISIN_1g0079602mg                  128   2e-30    
gb|KCW75518.1|  hypothetical protein EUGRSUZ_E04281                     130   2e-30    
emb|CDP10986.1|  unnamed protein product                                134   4e-30    
ref|XP_004251531.1|  PREDICTED: clathrin coat assembly protein AP...    134   5e-30    
ref|XP_004140244.1|  PREDICTED: clathrin coat assembly protein AP...    132   6e-30    
gb|EYU43135.1|  hypothetical protein MIMGU_mgv1a003069mg                132   7e-30    
ref|XP_008449479.1|  PREDICTED: clathrin coat assembly protein AP180    132   7e-30    
ref|XP_002271237.1|  PREDICTED: clathrin coat assembly protein AP180    132   1e-29    Vitis vinifera
ref|NP_563726.1|  clathrin coat assembly protein AP180                  132   2e-29    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002302859.1|  clathrin assembly family protein                   131   2e-29    Populus trichocarpa [western balsam poplar]
ref|XP_002302860.2|  clathrin assembly family protein                   132   2e-29    Populus trichocarpa [western balsam poplar]
ref|XP_011100365.1|  PREDICTED: clathrin coat assembly protein AP...    132   2e-29    
ref|XP_009763522.1|  PREDICTED: clathrin coat assembly protein AP...    132   2e-29    
ref|XP_009594134.1|  PREDICTED: clathrin coat assembly protein AP...    132   3e-29    
ref|XP_010252552.1|  PREDICTED: clathrin coat assembly protein AP...    131   3e-29    
ref|XP_010050619.1|  PREDICTED: probable clathrin assembly protei...    129   3e-29    
gb|EPS71208.1|  hypothetical protein M569_03549                         130   5e-29    
ref|XP_009606083.1|  PREDICTED: clathrin coat assembly protein AP...    131   5e-29    
ref|XP_007214877.1|  hypothetical protein PRUPE_ppa026885mg             129   5e-29    
ref|XP_010522366.1|  PREDICTED: clathrin coat assembly protein AP...    130   7e-29    
ref|XP_006352043.1|  PREDICTED: clathrin coat assembly protein AP...    130   8e-29    
emb|CDY53396.1|  BnaAnng12440D                                          129   9e-29    
ref|XP_008342137.1|  PREDICTED: clathrin coat assembly protein AP180    130   9e-29    
gb|EEC78392.1|  hypothetical protein OsI_18174                          129   9e-29    
ref|XP_009119213.1|  PREDICTED: clathrin coat assembly protein AP180    129   1e-28    
emb|CDY18283.1|  BnaC05g03060D                                          128   1e-28    
ref|XP_002320485.1|  clathrin assembly family protein                   129   1e-28    
ref|XP_009365118.1|  PREDICTED: clathrin coat assembly protein AP180    129   2e-28    
ref|XP_010484563.1|  PREDICTED: LOW QUALITY PROTEIN: clathrin coa...    129   2e-28    
ref|XP_007049176.1|  ENTH/ANTH/VHS superfamily protein, putative        129   2e-28    
ref|XP_009758404.1|  PREDICTED: clathrin coat assembly protein AP...    129   3e-28    
ref|XP_010691746.1|  PREDICTED: clathrin coat assembly protein AP180    129   3e-28    
ref|XP_010457575.1|  PREDICTED: clathrin coat assembly protein AP...    128   3e-28    
ref|XP_006849059.1|  hypothetical protein AMTR_s00028p00200060          127   3e-28    
ref|XP_010556975.1|  PREDICTED: clathrin coat assembly protein AP...    128   3e-28    
ref|XP_011009685.1|  PREDICTED: clathrin coat assembly protein AP...    128   4e-28    
ref|XP_011047195.1|  PREDICTED: clathrin coat assembly protein AP...    127   4e-28    
ref|XP_008230050.1|  PREDICTED: clathrin coat assembly protein AP180    128   5e-28    
ref|XP_008365463.1|  PREDICTED: clathrin coat assembly protein AP...    128   6e-28    
ref|XP_010475177.1|  PREDICTED: clathrin coat assembly protein AP...    127   6e-28    
ref|XP_010110626.1|  Clathrin coat assembly protein                     127   8e-28    
ref|XP_002892260.1|  hypothetical protein ARALYDRAFT_887680             127   8e-28    
ref|XP_008786734.1|  PREDICTED: clathrin coat assembly protein AP180    126   1e-27    
ref|XP_006306965.1|  hypothetical protein CARUB_v10008537mg             127   1e-27    
ref|XP_010038590.1|  PREDICTED: clathrin coat assembly protein AP180    126   1e-27    
ref|XP_011008934.1|  PREDICTED: clathrin coat assembly protein AP...    126   1e-27    
ref|XP_003541269.1|  PREDICTED: clathrin coat assembly protein AP...    127   1e-27    
emb|CDX86594.1|  BnaC08g01090D                                          126   1e-27    
ref|XP_004502049.1|  PREDICTED: clathrin coat assembly protein AP...    127   1e-27    
emb|CDY15531.1|  BnaA08g28150D                                          126   1e-27    
ref|XP_008661186.1|  PREDICTED: putative clathrin assembly protei...    122   2e-27    
gb|KFK42830.1|  hypothetical protein AALP_AA1G044900                    125   3e-27    
ref|XP_001753123.1|  predicted protein                                  125   3e-27    
ref|XP_006357992.1|  PREDICTED: clathrin coat assembly protein AP...    125   4e-27    
ref|XP_003601418.1|  Adhesive plaque matrix protein                     125   4e-27    
ref|XP_011086378.1|  PREDICTED: clathrin coat assembly protein AP...    124   4e-27    
ref|XP_007146105.1|  hypothetical protein PHAVU_006G012900g             125   5e-27    
ref|XP_004305974.1|  PREDICTED: uncharacterized protein LOC101290885    125   6e-27    
ref|XP_009111068.1|  PREDICTED: clathrin coat assembly protein AP...    123   1e-26    
ref|XP_006418069.1|  hypothetical protein EUTSA_v10007033mg             123   1e-26    
ref|XP_004243514.1|  PREDICTED: clathrin coat assembly protein AP180    124   1e-26    
ref|XP_010917235.1|  PREDICTED: clathrin coat assembly protein AP180    122   2e-26    
ref|XP_010270043.1|  PREDICTED: clathrin coat assembly protein AP180    121   5e-26    
emb|CDX76760.1|  BnaC08g33460D                                          118   2e-25    
ref|XP_010431622.1|  PREDICTED: uncharacterized protein LOC104715955    118   9e-25    
ref|XP_001781399.1|  predicted protein                                  117   2e-24    
ref|XP_009408773.1|  PREDICTED: clathrin coat assembly protein AP...    115   3e-24    
ref|XP_002982426.1|  hypothetical protein SELMODRAFT_268581             114   9e-24    
gb|AFW88899.1|  putative ENTH/ANTH/VHS superfamily protein              111   3e-23    
ref|XP_009390454.1|  PREDICTED: putative clathrin assembly protei...    110   3e-22    
ref|XP_009389678.1|  PREDICTED: clathrin coat assembly protein AP...    108   8e-22    
gb|KHN24854.1|  Putative clathrin assembly protein                      101   2e-21    
ref|XP_010533127.1|  PREDICTED: putative clathrin assembly protei...    107   2e-21    
ref|XP_010533128.1|  PREDICTED: putative clathrin assembly protei...    107   3e-21    
ref|NP_001151036.1|  clathrin assembly protein                          107   4e-21    
gb|AFG70208.1|  hypothetical protein 2_2835_01                        99.8    6e-21    
ref|NP_001043956.1|  Os01g0694900                                       106   7e-21    
gb|EEC71324.1|  hypothetical protein OsI_03369                          105   7e-21    
ref|XP_008672590.1|  PREDICTED: uncharacterized protein LOC100276...    105   8e-21    
gb|AFW76126.1|  clathrin assembly protein                               105   1e-20    
ref|NP_001136989.1|  uncharacterized protein LOC100217151               104   2e-20    
gb|KHN05933.1|  Putative clathrin assembly protein                    98.6    3e-20    
gb|AEW08198.1|  hypothetical protein 2_2835_01                        96.7    8e-20    
ref|XP_004969636.1|  PREDICTED: putative clathrin assembly protei...    102   1e-19    
ref|XP_010087990.1|  Putative clathrin assembly protein                 102   1e-19    
ref|XP_010265534.1|  PREDICTED: putative clathrin assembly protei...    101   2e-19    
gb|AEW07858.1|  hypothetical protein 0_13232_01                       94.7    3e-19    
ref|XP_008672589.1|  PREDICTED: uncharacterized protein LOC100276...    100   3e-19    
ref|XP_010913847.1|  PREDICTED: LOW QUALITY PROTEIN: putative cla...    100   4e-19    
gb|KHN17630.1|  Putative clathrin assembly protein                      100   4e-19    
ref|XP_006600479.1|  PREDICTED: putative clathrin assembly protei...    100   4e-19    
ref|XP_010273537.1|  PREDICTED: putative clathrin assembly protei...    100   6e-19    
ref|XP_010541947.1|  PREDICTED: putative clathrin assembly protei...  99.8    7e-19    
ref|XP_008339327.1|  PREDICTED: probable cation-transporting ATPase     100   7e-19    
ref|XP_002311513.1|  clathrin assembly family protein                 99.8    8e-19    
ref|XP_011038608.1|  PREDICTED: putative clathrin assembly protei...  99.4    1e-18    
ref|XP_001755297.1|  predicted protein                                98.6    1e-18    
ref|XP_011023782.1|  PREDICTED: putative clathrin assembly protei...  99.0    1e-18    
ref|XP_011023792.1|  PREDICTED: putative clathrin assembly protei...  98.6    2e-18    
ref|XP_006593512.1|  PREDICTED: putative clathrin assembly protei...  98.2    3e-18    
gb|EPS72077.1|  hypothetical protein M569_02679                       97.4    4e-18    
ref|NP_172944.1|  putative clathrin assembly protein                  97.8    4e-18    
ref|XP_009418441.1|  PREDICTED: putative clathrin assembly protei...  97.4    5e-18    
ref|XP_008799223.1|  PREDICTED: putative clathrin assembly protei...  97.1    6e-18    
ref|XP_006850889.1|  hypothetical protein AMTR_s00025p00161520        96.7    7e-18    
ref|XP_002966589.1|  hypothetical protein SELMODRAFT_230819           96.7    8e-18    
ref|XP_002456192.1|  hypothetical protein SORBIDRAFT_03g031930        96.7    8e-18    
gb|KDO61895.1|  hypothetical protein CISIN_1g040258mg                 96.7    8e-18    
ref|XP_006416959.1|  hypothetical protein EUTSA_v10007171mg           96.7    8e-18    
emb|CDY12401.1|  BnaC08g08040D                                        96.7    8e-18    
ref|XP_010476568.1|  PREDICTED: putative clathrin assembly protei...  96.7    1e-17    
gb|KHN08221.1|  Putative clathrin assembly protein                    91.7    2e-17    
ref|XP_008803559.1|  PREDICTED: putative clathrin assembly protei...  95.5    2e-17    
emb|CDY53525.1|  BnaC05g11150D                                        95.9    2e-17    
ref|XP_010553785.1|  PREDICTED: putative clathrin assembly protei...  95.5    2e-17    
ref|XP_010527791.1|  PREDICTED: putative clathrin assembly protei...  95.5    2e-17    
ref|XP_008799224.1|  PREDICTED: putative clathrin assembly protei...  95.1    2e-17    
emb|CDY45299.1|  BnaA06g09690D                                        95.5    2e-17    
gb|KHN22664.1|  Putative clathrin assembly protein                    95.1    2e-17    
ref|XP_009148877.1|  PREDICTED: putative clathrin assembly protei...  95.1    3e-17    
ref|XP_003533950.1|  PREDICTED: putative clathrin assembly protei...  94.0    5e-17    
ref|XP_010274743.1|  PREDICTED: putative clathrin assembly protei...  94.0    5e-17    
gb|KHN03156.1|  Putative clathrin assembly protein                    94.0    5e-17    
gb|ABK24887.1|  unknown                                               91.7    7e-17    
ref|XP_010921255.1|  PREDICTED: putative clathrin assembly protei...  93.6    7e-17    
ref|XP_010921252.1|  PREDICTED: putative clathrin assembly protei...  93.6    8e-17    
ref|XP_004167932.1|  PREDICTED: LOW QUALITY PROTEIN: putative cla...  93.2    1e-16    
gb|KHN03612.1|  Putative clathrin assembly protein                    93.2    1e-16    
gb|KGN61174.1|  hypothetical protein Csa_2G061530                     93.2    1e-16    
ref|XP_011017841.1|  PREDICTED: putative clathrin assembly protei...  93.2    1e-16    
ref|XP_007014413.1|  ENTH/ANTH/VHS superfamily protein                93.2    1e-16    
ref|XP_004149514.1|  PREDICTED: putative clathrin assembly protei...  93.2    1e-16    
ref|XP_004508453.1|  PREDICTED: putative clathrin assembly protei...  92.8    1e-16    
ref|XP_002870422.1|  hypothetical protein ARALYDRAFT_915653           92.8    1e-16    
ref|XP_009757131.1|  PREDICTED: putative clathrin assembly protei...  92.8    1e-16    
ref|NP_001145773.1|  uncharacterized protein LOC100279280             92.8    1e-16    
gb|AFW80976.1|  hypothetical protein ZEAMMB73_079219                  92.8    1e-16    
ref|XP_009108052.1|  PREDICTED: putative clathrin assembly protei...  92.4    2e-16    
ref|XP_009398623.1|  PREDICTED: putative clathrin assembly protei...  92.4    2e-16    
ref|XP_007013561.1|  ENTH/ANTH/VHS superfamily protein isoform 1      91.7    3e-16    
ref|XP_010044208.1|  PREDICTED: putative clathrin assembly protei...  91.7    3e-16    
ref|XP_011070604.1|  PREDICTED: putative clathrin assembly protei...  91.7    3e-16    
gb|AFW80975.1|  hypothetical protein ZEAMMB73_079219                  91.3    4e-16    
ref|XP_010250225.1|  PREDICTED: putative clathrin assembly protei...  90.9    5e-16    
gb|KDP30243.1|  hypothetical protein JCGZ_17025                       90.9    5e-16    
ref|XP_002531947.1|  clathrin assembly protein, putative              90.9    5e-16    
ref|XP_007013562.1|  ENTH/ANTH/VHS superfamily protein isoform 2      89.7    5e-16    
ref|XP_002324629.1|  hypothetical protein POPTR_0018s12580g           90.9    6e-16    
ref|XP_003542645.1|  PREDICTED: putative clathrin assembly protei...  90.9    6e-16    
ref|XP_006372154.1|  hypothetical protein POPTR_0018s12580g           90.9    6e-16    
gb|AFK40929.1|  unknown                                               90.5    8e-16    
ref|XP_002315872.2|  hypothetical protein POPTR_0010s12020g           90.1    9e-16    
emb|CBI28256.3|  unnamed protein product                              90.1    9e-16    
emb|CDP10454.1|  unnamed protein product                              90.1    1e-15    
ref|XP_008389195.1|  PREDICTED: putative clathrin assembly protei...  90.1    1e-15    
ref|XP_002285448.2|  PREDICTED: putative clathrin assembly protei...  89.7    1e-15    
ref|XP_003549739.1|  PREDICTED: putative clathrin assembly protei...  89.7    1e-15    
ref|XP_010536897.1|  PREDICTED: putative clathrin assembly protei...  89.7    1e-15    
ref|XP_004961341.1|  PREDICTED: putative clathrin assembly protei...  89.7    1e-15    
ref|XP_002315925.2|  hypothetical protein POPTR_0010s12020g           89.4    2e-15    
ref|XP_002441469.1|  hypothetical protein SORBIDRAFT_09g027370        89.4    2e-15    
ref|XP_006344967.1|  PREDICTED: putative clathrin assembly protei...  89.4    2e-15    
gb|KHG16288.1|  hypothetical protein F383_00250                       89.0    2e-15    
gb|EYU34970.1|  hypothetical protein MIMGU_mgv1a003922mg              89.0    2e-15    
ref|NP_198370.1|  putative clathrin assembly protein                  89.0    2e-15    
ref|XP_006286251.1|  hypothetical protein CARUB_v10007821mg           89.0    2e-15    
emb|CDM83847.1|  unnamed protein product                              89.0    2e-15    
ref|XP_010496638.1|  PREDICTED: putative clathrin assembly protei...  89.4    2e-15    
gb|KCW86253.1|  hypothetical protein EUGRSUZ_B02940                   89.0    2e-15    
ref|XP_010924074.1|  PREDICTED: putative clathrin assembly protei...  88.6    3e-15    
ref|XP_011075418.1|  PREDICTED: putative clathrin assembly protei...  88.6    3e-15    
ref|XP_010459007.1|  PREDICTED: putative clathrin assembly protei...  89.0    3e-15    
ref|XP_009363972.1|  PREDICTED: putative clathrin assembly protei...  88.6    3e-15    
ref|XP_011077728.1|  PREDICTED: putative clathrin assembly protei...  88.6    3e-15    
ref|NP_001056232.1|  Os05g0549000                                     88.6    3e-15    
ref|XP_007155057.1|  hypothetical protein PHAVU_003G169400g           88.2    3e-15    
ref|XP_008361112.1|  PREDICTED: putative clathrin assembly protei...  88.2    4e-15    
ref|XP_010904605.1|  PREDICTED: putative clathrin assembly protei...  88.2    4e-15    
gb|EAY98914.1|  hypothetical protein OsI_20869                        88.2    4e-15    
gb|KFK32949.1|  hypothetical protein AALP_AA6G310300                  88.2    5e-15    
ref|XP_004297469.1|  PREDICTED: putative clathrin assembly protei...  87.8    5e-15    
gb|KCW83039.1|  hypothetical protein EUGRSUZ_C04420                   87.4    5e-15    
gb|KDP38746.1|  hypothetical protein JCGZ_04099                       87.8    5e-15    
ref|XP_009351512.1|  PREDICTED: putative clathrin assembly protei...  87.8    5e-15    
gb|EYU18219.1|  hypothetical protein MIMGU_mgv1a003551mg              87.8    5e-15    
ref|XP_009401365.1|  PREDICTED: putative clathrin assembly protei...  87.8    6e-15    
ref|XP_006655551.1|  PREDICTED: putative clathrin assembly protei...  87.4    6e-15    
gb|KFK33381.1|  hypothetical protein AALP_AA5G005800                  87.4    7e-15    
ref|XP_009614798.1|  PREDICTED: putative clathrin assembly protei...  87.4    7e-15    
ref|XP_008385249.1|  PREDICTED: putative clathrin assembly protei...  87.4    7e-15    
ref|XP_010435407.1|  PREDICTED: putative clathrin assembly protei...  87.4    7e-15    
ref|XP_010435408.1|  PREDICTED: putative clathrin assembly protei...  87.4    8e-15    
ref|XP_010654389.1|  PREDICTED: putative clathrin assembly protei...  87.4    8e-15    
ref|XP_002284689.2|  PREDICTED: putative clathrin assembly protei...  87.4    8e-15    
ref|XP_010448345.1|  PREDICTED: putative clathrin assembly protei...  87.4    8e-15    
ref|XP_010433571.1|  PREDICTED: putative clathrin assembly protei...  87.4    8e-15    
ref|XP_011020009.1|  PREDICTED: putative clathrin assembly protei...  87.4    8e-15    
emb|CAN83852.1|  hypothetical protein VITISV_037564                   87.0    1e-14    
ref|XP_010681909.1|  PREDICTED: putative clathrin assembly protei...  87.0    1e-14    
ref|XP_007045208.1|  ENTH/ANTH/VHS superfamily protein                87.0    1e-14    
ref|XP_002308116.2|  hypothetical protein POPTR_0006s07540g           87.0    1e-14    
ref|XP_009627948.1|  PREDICTED: putative clathrin assembly protei...  86.7    1e-14    
ref|XP_009403215.1|  PREDICTED: putative clathrin assembly protei...  86.7    1e-14    
ref|XP_011020010.1|  PREDICTED: putative clathrin assembly protei...  86.3    1e-14    
ref|XP_006657301.1|  PREDICTED: putative clathrin assembly protei...  86.7    1e-14    
ref|XP_006413250.1|  hypothetical protein EUTSA_v10024721mg           86.7    1e-14    
dbj|BAK06048.1|  predicted protein                                    86.7    1e-14    
ref|XP_009785618.1|  PREDICTED: putative clathrin assembly protei...  86.3    1e-14    
gb|KDO64585.1|  hypothetical protein CISIN_1g008579mg                 86.7    1e-14    
ref|XP_006413249.1|  hypothetical protein EUTSA_v10024721mg           86.7    1e-14    
ref|XP_002269299.1|  PREDICTED: putative clathrin assembly protei...  86.3    2e-14    
ref|XP_010687911.1|  PREDICTED: putative clathrin assembly protei...  86.3    2e-14    
ref|XP_004150528.1|  PREDICTED: putative clathrin assembly protei...  86.3    2e-14    
ref|XP_006279508.1|  hypothetical protein CARUB_v10027557mg           86.3    2e-14    
ref|XP_006403061.1|  hypothetical protein EUTSA_v10003447mg           86.3    2e-14    
ref|XP_006646232.1|  PREDICTED: putative clathrin assembly protei...  86.3    2e-14    
emb|CDY09433.1|  BnaA02g25770D                                        86.3    2e-14    
gb|ABR16117.1|  unknown                                               86.3    2e-14    
gb|EMT16298.1|  Putative clathrin assembly protein                    86.3    2e-14    
ref|XP_009396331.1|  PREDICTED: putative clathrin assembly protei...  85.9    2e-14    
emb|CDY52732.1|  BnaC09g53320D                                        85.9    2e-14    
gb|KHG06013.1|  hypothetical protein F383_02907                       85.9    2e-14    
ref|XP_009120244.1|  PREDICTED: putative clathrin assembly protei...  85.9    2e-14    
emb|CDY38276.1|  BnaA10g11240D                                        85.9    2e-14    
ref|XP_008793594.1|  PREDICTED: putative clathrin assembly protei...  85.5    2e-14    
ref|XP_009396332.1|  PREDICTED: putative clathrin assembly protei...  85.9    2e-14    
ref|XP_006448214.1|  hypothetical protein CICLE_v10014774mg           85.9    2e-14    
ref|XP_003569612.1|  PREDICTED: putative clathrin assembly protei...  85.9    2e-14    
ref|XP_009595316.1|  PREDICTED: putative clathrin assembly protei...  85.9    2e-14    
ref|XP_008794954.1|  PREDICTED: putative clathrin assembly protei...  85.5    2e-14    
ref|XP_010443398.1|  PREDICTED: putative clathrin assembly protei...  85.9    3e-14    
ref|XP_010483224.1|  PREDICTED: putative clathrin assembly protei...  85.9    3e-14    



>ref|XP_009597476.1| PREDICTED: putative clathrin assembly protein At1g03050 [Nicotiana 
tomentosiformis]
Length=582

 Score =   509 bits (1310),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 295/481 (61%), Positives = 350/481 (73%), Gaps = 17/481 (4%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDSRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
             FATRRGTRLLNMS+FRDS+SN WDYSA VRTYSLYLDEQ+E RMQ+RRGK SA A     
Sbjct  111   FATRRGTRLLNMSEFRDSKSNSWDYSALVRTYSLYLDEQLEYRMQSRRGKRSAYA-----  165

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRL  1213
                  DE+ E     AI+V  TP+ EMKNE ++SRIQ+ +Q+LDRFLAC+P G AK NR+
Sbjct  166   ----YDEDLEEIGLNAIIVKPTPLREMKNEDIFSRIQYLMQLLDRFLACRPAGLAKTNRI  221

Query  1212  VLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYT  1033
             V VALY +VKESFQ+YY + E++ IL+D+F +L IPDS KVHEIF R+ KQ+ EL  FY 
Sbjct  222   VFVALYPLVKESFQLYYEMTEIITILIDKFHELSIPDSVKVHEIFCRINKQYHELGQFYN  281

Query  1032  WSKAAGISRLSEYPDVENYPKQKLDimee-iirekmeMAGGRIM--rsrepspeveevee  862
             W K  GI R SEYPD+EN P++KLD+++  I  + +    G  M    +    E  +  E
Sbjct  282   WCKTVGIGRSSEYPDIENIPQKKLDLIDAFIREKPILEQNGNAMRYEPKRELVEKTQEPE  341

Query  861   pepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHA  682
             PE E + E+DMN IKALPPP  + I E    E  TE  K Q++G+LLNLGEDAPT EEH 
Sbjct  342   PELEPQQEQDMNAIKALPPP--EGIPEETNQEEKTEVPKTQEVGNLLNLGEDAPTMEEHG  399

Query  681   NQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFPGNFDELM  502
             NQLALALFDG P    + TT    WEAF  S DWETALVQ  SHLSNQKA   G FD LM
Sbjct  400   NQLALALFDGGPATTASSTTSP--WEAFKDSGDWETALVQHTSHLSNQKASLAGGFDTLM  457

Query  501   LDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappss-ADANTTASGADP  325
             LDGMY+QGA+ Q VASSGV+ TGSA+SVAFGSAGRPAMLALPAPPS+ + ANT  +  DP
Sbjct  458   LDGMYQQGAVAQVVASSGVVATGSASSVAFGSAGRPAMLALPAPPSAGSGANTAGTSTDP  517

Query  324   FAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             FAASL++APP YVQMSE+EKKQRLL EEQ MWQQY +DGMHGQVGL +AQ +   +N  G
Sbjct  518   FAASLAIAPPPYVQMSEMEKKQRLLVEEQVMWQQYQRDGMHGQVGLARAQPNPCAYNMGG  577

Query  144   Y  142
             Y
Sbjct  578   Y  578



>ref|XP_009629510.1| PREDICTED: putative clathrin assembly protein At1g03050 [Nicotiana 
tomentosiformis]
 ref|XP_009629511.1| PREDICTED: putative clathrin assembly protein At1g03050 [Nicotiana 
tomentosiformis]
Length=585

 Score =   489 bits (1259),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 282/483 (58%), Positives = 354/483 (73%), Gaps = 18/483 (4%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDSRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
             FATRRGTRLLNMSDFRDSRSN WD SAFVR+Y+LYLDE +E +MQNRRGK SA A  ++E
Sbjct  111   FATRRGTRLLNMSDFRDSRSNSWDCSAFVRSYALYLDEHLEFKMQNRRGKRSAFAYNDDE  170

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRL  1213
                  + +          V  TP+ EMKN+ ++SRI H +Q+L+RFLAC+P G AK NR+
Sbjct  171   EEVRHNVKG---------VKATPLREMKNDRVFSRIHHLMQLLERFLACRPAGLAKNNRV  221

Query  1212  VLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYT  1033
             V+VALY +VKESFQ+YY + E++ IL D+F++L IPDS K+ EIF R+ KQ++ELE FY 
Sbjct  222   VIVALYPLVKESFQLYYDLTEIITILFDKFIELSIPDSVKILEIFFRINKQYEELEQFYD  281

Query  1032  WSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGR--IMrsrepspeveeveep  859
             W K  G++R SEYPD+E  P +KL+ M+++IREK      R   +R+   +  V+E+E+ 
Sbjct  282   WGKTVGVARTSEYPDIEIIPPKKLERMDDLIREKSFREQNRKAAIRNEPTTEHVQEIEKQ  341

Query  858   epeaeaeEDMNTIKALPPP---PEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEE  688
             E + E EEDMN +KALP P   P++   E  + E   +E K Q++GDLLNL ED PT EE
Sbjct  342   ETKTEPEEDMNAVKALPAPEVLPKE--TEENIEEDDKKEVKTQEVGDLLNLSEDVPTTEE  399

Query  687   HANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFPGNFDE  508
             H +QLALALFDG        T+I+  W+AFN S DWETALVQ+ASHLSNQKA FP   D 
Sbjct  400   HGDQLALALFDGGQATTNPATSISP-WQAFNDSGDWETALVQSASHLSNQKASFPRGLDT  458

Query  507   LMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssA-DANTTASGA  331
             L LDGMY+QG + QAVA+SGV+ TGSA+SVAFGSAGRPAMLALPAPP++   A+T A G 
Sbjct  459   LTLDGMYQQGTVAQAVATSGVVATGSASSVAFGSAGRPAMLALPAPPTANGGASTAAPGT  518

Query  330   DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNY  151
             DPFAASL++APPAYVQMSE+EKKQRLL EEQ MWQ+Y ++GM GQV L KAQ +  PHN 
Sbjct  519   DPFAASLAIAPPAYVQMSEMEKKQRLLVEEQLMWQEYQRNGMQGQVALAKAQPNPYPHNI  578

Query  150   YGY  142
              GY
Sbjct  579   GGY  581



>ref|XP_009794823.1| PREDICTED: putative clathrin assembly protein At1g03050 [Nicotiana 
sylvestris]
 ref|XP_009794824.1| PREDICTED: putative clathrin assembly protein At1g03050 [Nicotiana 
sylvestris]
Length=582

 Score =   488 bits (1256),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 291/481 (60%), Positives = 344/481 (72%), Gaps = 17/481 (4%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDSRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
             FATRRGTRLLNMS+FRDS+SN WDYSA VRTYSLYLDEQ+E RMQ+RRGK SA A     
Sbjct  111   FATRRGTRLLNMSEFRDSKSNSWDYSALVRTYSLYLDEQLEYRMQSRRGKRSAYA-----  165

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRL  1213
                  DE+ E     AI+V  TP+ EMKNE ++SRIQ+ +Q+L+RFLAC+P G AK NR+
Sbjct  166   ----YDEDLEEIGPNAIMVKPTPLREMKNEDIFSRIQYLMQLLERFLACRPAGLAKTNRI  221

Query  1212  VLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYT  1033
             V VALY +VKESFQ+YY I E++ IL+D+F +L IPDS KVHEIF R+ KQ+ ELE FY 
Sbjct  222   VFVALYPLVKESFQLYYEITEIITILIDKFHELSIPDSVKVHEIFCRINKQYHELEQFYI  281

Query  1032  WSKAAGISRLSEYPDVENYPKQKLDimee-iirekmeMAGGRIM--rsrepspeveevee  862
             W K  GI R SEYPD+EN P++KLD+++  I  + +    G  M    +    E  +  E
Sbjct  282   WCKTVGIGRSSEYPDIENIPQKKLDLIDAFIREKPILEQNGNAMRYEPKRELVEKAQEPE  341

Query  861   pepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHA  682
              E E + E+DMN IKALPPP  + I E    E  TE  K Q++G+LLNL EDAPT EEH 
Sbjct  342   SELEPQQEQDMNAIKALPPP--EGIPEETNQEEKTEVVKTQEVGNLLNLSEDAPTMEEHG  399

Query  681   NQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFPGNFDELM  502
             NQLALALFDG P      TT    WEAF  S DWETALVQ  SHLSNQKA   G FD LM
Sbjct  400   NQLALALFDGGPETAAPSTTSP--WEAFKDSGDWETALVQHTSHLSNQKASLAGGFDTLM  457

Query  501   LDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADA-NTTASGADP  325
             LDGMY+QGA+ Q VASSGV+ TGSA+SVA GSAGRPAMLALPAPPS+    NT  +  DP
Sbjct  458   LDGMYQQGAVAQVVASSGVVATGSASSVALGSAGRPAMLALPAPPSAGSGPNTAGTSTDP  517

Query  324   FAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             FAASL++APP YVQMSE+EKKQRLL EEQ MWQQY +DGMHGQ+GL  AQ +   +N  G
Sbjct  518   FAASLAIAPPPYVQMSEMEKKQRLLVEEQVMWQQYQRDGMHGQIGLATAQPNPCAYNMGG  577

Query  144   Y  142
             Y
Sbjct  578   Y  578



>ref|XP_006351813.1| PREDICTED: putative clathrin assembly protein At1g03050-like 
[Solanum tuberosum]
Length=582

 Score =   483 bits (1244),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 282/479 (59%), Positives = 351/479 (73%), Gaps = 13/479 (3%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDSRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
             FATRRGTRLLNMSDFRDSRSN WD SAFVR+Y+LYLDE +E RMQNRRGK SA A     
Sbjct  111   FATRRGTRLLNMSDFRDSRSNSWDCSAFVRSYALYLDEHLEFRMQNRRGKRSAFA-----  165

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRL  1213
                  D++EE     A  +  TP+ EMKN+ ++SRI H +Q+L+RFLAC+P G+AK NR+
Sbjct  166   ---YNDDDEEEVRHNARGIKATPLREMKNDRVFSRIHHLMQLLERFLACRPAGSAKNNRV  222

Query  1212  VLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYT  1033
             V+ ALY +VKESFQ+YY + E+  +L D+F++L IPDS KV EIF R+ KQ++E+E FY 
Sbjct  223   VIAALYALVKESFQLYYDLTEITTLLFDKFIELSIPDSVKVLEIFFRINKQYEEIEQFYD  282

Query  1032  WSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGR-IMrsrepspeveeveepe  856
             WSK  G++R +EYPD++  P +KL+ M+++IREK      R  MR+   +  V+E +  E
Sbjct  283   WSKTVGVTRTTEYPDIDIIPPKKLERMDDLIREKSFREQSRKAMRNEPTAEHVQETKRQE  342

Query  855   peaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQ  676
             P+ E EEDMN IKALP P  + + E    E   +  K Q+ GDLLNLGED PT EEH +Q
Sbjct  343   PKTEPEEDMNAIKALPAP--EVLPEEKTEEEEKKTVKTQEEGDLLNLGEDVPTSEEHGDQ  400

Query  675   LALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFPGNFDELMLD  496
             LALALFDG        T+I+  W+AFN S DWETALVQ+ASHLSNQK   PG FD LML+
Sbjct  401   LALALFDGGQATTNPATSISP-WQAFNDSGDWETALVQSASHLSNQKTSLPGGFDTLMLN  459

Query  495   GMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssA-DANTTASGADPFA  319
             GMY+QGA++QAVA SGV+ TGSA+SVA GSAGRPAMLALPAPP++   ANT A G DPFA
Sbjct  460   GMYQQGAVSQAVACSGVVATGSASSVALGSAGRPAMLALPAPPTANGGANTAAPGTDPFA  519

Query  318   ASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYGY  142
             ASL++APPAYVQMSE+EKKQRLL EEQ MWQ+Y K+GM G+VG   AQ +  P+N  GY
Sbjct  520   ASLAIAPPAYVQMSEMEKKQRLLMEEQLMWQEYQKNGMQGKVGFANAQPNPYPYNIGGY  578



>emb|CDO97491.1| unnamed protein product [Coffea canephora]
Length=572

 Score =   482 bits (1240),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 283/483 (59%), Positives = 349/483 (72%), Gaps = 31/483 (6%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD S+SN WDYSAFVRTY+LYLDEQ+E RMQNRRGK  A +    
Sbjct  111   FATRRGTRLLNMSDFRDASKSNSWDYSAFVRTYALYLDEQLEFRMQNRRGKRGAFS----  166

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                  + E++E     AIVV  TP+ EMKNE ++SRI H +Q+L+RFLAC+PTG AK N+
Sbjct  167   ----YDPEDDEQVGPNAIVVRSTPVREMKNEQVFSRIHHLMQLLERFLACRPTGLAKNNK  222

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VKESFQ+YY I E+LGILVDRFM+L++PDS KV+EIF RV+KQ+DEL++FY
Sbjct  223   IVVVALYPIVKESFQLYYDITEILGILVDRFMELNVPDSVKVYEIFCRVSKQYDELDMFY  282

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
              W K+ GI R SEYPDVE  P++KLD+M++ IREK  M   R + +        +  E  
Sbjct  283   GWCKSVGIVRASEYPDVEKIPQKKLDVMDDFIREKSVMEQNRKV-TMIEPKPEAQPAEEN  341

Query  855   peaeaeEDMNTIKALPPPPEDF------IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTP  694
              E E E+D+N +KAL PPPE F       E+  V E    + K Q++GDLLNLGEDAPT 
Sbjct  342   EEPEPEQDINAMKAL-PPPEGFQEENEEKEQEEVKEEEKGKPKTQEVGDLLNLGEDAPTT  400

Query  693   EEHANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFPGNF  514
             EEH ++LALALFDG  + +               + DWETALVQ+ASHLSNQ+    G  
Sbjct  401   EEHGDKLALALFDGNLSTNAP------------ATRDWETALVQSASHLSNQQVSLSGGL  448

Query  513   DELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASG  334
             D ++LDGMY+QGA+ QA+A+SGV  TGSA+SVA GSAGRPAMLALPAPPS+  A+    G
Sbjct  449   DTMVLDGMYQQGAMQQAIAASGVTATGSASSVALGSAGRPAMLALPAPPSADGAH--PPG  506

Query  333   ADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHN  154
             ADPFAAS+S+APPAYVQMSE+EKKQRLL EEQ MWQQY +DGM G VGL K Q +    +
Sbjct  507   ADPFAASISIAPPAYVQMSEMEKKQRLLVEEQVMWQQYARDGMQGHVGLAKVQSNQYHMS  566

Query  153   YYG  145
              YG
Sbjct  567   GYG  569



>ref|XP_011087830.1| PREDICTED: putative clathrin assembly protein At1g03050 [Sesamum 
indicum]
 ref|XP_011087831.1| PREDICTED: putative clathrin assembly protein At1g03050 [Sesamum 
indicum]
Length=592

 Score =   481 bits (1239),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 294/489 (60%), Positives = 349/489 (71%), Gaps = 23/489 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDS--RSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgn  1399
             FATRRGTRLLNMSDFRD+  +S  WDYSAFVRTY+LYLDEQ+E RMQ RRGK S      
Sbjct  111   FATRRGTRLLNMSDFRDTSGKSYAWDYSAFVRTYALYLDEQLEFRMQGRRGKRSGYGYPQ  170

Query  1398  eegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRN  1219
              E  E         +  A     TP+ EM+NE ++SR+ H +Q+L+RFLAC+PTGAAK N
Sbjct  171   VEEEEGGGGGVSPKSGKA-----TPLHEMRNELVFSRVHHLMQLLERFLACRPTGAAKDN  225

Query  1218  RLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVF  1039
             R+V VALY ++KESFQ+ Y I E+LG+L+DRFM+L+IPD  +VHEIF RVAKQ+DEL+ F
Sbjct  226   RVVHVALYPIIKESFQLCYDITEILGVLIDRFMELEIPDMVRVHEIFSRVAKQYDELDAF  285

Query  1038  YTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveep  859
             + WSK AGI+R SEYPDVE   ++KLD+MEE I EK  M   R         E + VEE 
Sbjct  286   HGWSKMAGIARSSEYPDVEKISQKKLDMMEEYIYEKSTMPQER-----GRRAEPQPVEEV  340

Query  858   epeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKE--------QDIGDLLNLGEDA  703
               EAE E DMN IKALPPP E F+EE         ++ E        Q++GDLLNLGEDA
Sbjct  341   IEEAEPEPDMNEIKALPPP-EGFVEENEAEPEEVPKEVEEPKEEKKPQEVGDLLNLGEDA  399

Query  702   PTPEEHANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTASHLSNQKAQF  526
             P+ EE A++LALALFDG      +     TPWEAF   S DWETALVQ+ASHLSNQKA  
Sbjct  400   PSTEEQADKLALALFDGTGPATTSPGNAITPWEAFKQPSGDWETALVQSASHLSNQKASL  459

Query  525   PGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANT  346
             PG FD L+LDGMY+QGA  QAVASSG++ TGSA+SVA GSAGRPAMLALPAPP++    T
Sbjct  460   PGGFDTLILDGMYQQGATAQAVASSGLVATGSASSVALGSAGRPAMLALPAPPAADGKAT  519

Query  345   TASG-ADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQS  169
             ++SG  DPFAASL+VAPPAYVQMSE+EKKQRLL EEQ MWQQY +DGM GQV L K QQ+
Sbjct  520   SSSGNTDPFAASLAVAPPAYVQMSEMEKKQRLLVEEQLMWQQYARDGMQGQVSLAKVQQN  579

Query  168   SQPHNYYGY  142
                 N  GY
Sbjct  580   PYQFNAGGY  588



>ref|XP_004230562.1| PREDICTED: putative clathrin assembly protein At1g03050 [Solanum 
lycopersicum]
Length=581

 Score =   479 bits (1233),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 271/479 (57%), Positives = 340/479 (71%), Gaps = 14/479 (3%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDSRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
             FATRRGTRLLNMSDFRDSRSN WD SAFVR+Y+LYLDE +E RMQNRRGK SA A     
Sbjct  111   FATRRGTRLLNMSDFRDSRSNSWDCSAFVRSYALYLDEHLEFRMQNRRGKRSAFA-----  165

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRL  1213
                  +++EE     A  +  TP+ EMKN+ ++SRI H +Q+L+RFLAC+P G+AK +R+
Sbjct  166   ----YNDDEEEVRHNARGIKATPLREMKNDRIFSRIHHLMQLLERFLACRPAGSAKNSRV  221

Query  1212  VLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYT  1033
             V+ ALY +VKESFQ+YY + E+  +L D+F++L IPDS KV EIF R+ KQ++E+E FY 
Sbjct  222   VIAALYALVKESFQLYYDLTEITTLLFDKFIELSIPDSVKVLEIFFRINKQFEEIEQFYD  281

Query  1032  WSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGR-IMrsrepspeveeveepe  856
             WSK  G++R +EYPD+E  P +KL+ M+++IREK      R  MR+   +  V E + PE
Sbjct  282   WSKTVGVTRTTEYPDIEIIPPKKLERMDDLIREKSFKEQTRKAMRNEPTAEHVRETKTPE  341

Query  855   peaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQ  676
             P+ E EED+N IKALP P  +   E    E   +  K QD GDLLNL ED PT EEH +Q
Sbjct  342   PKTEPEEDINAIKALPAP--EVSPEEKTEEQEEKAVKTQDEGDLLNLSEDVPTSEEHGDQ  399

Query  675   LALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFPGNFDELMLD  496
             LALALFDG        T+I+  W+AFN S DWETALVQ+ASHLSNQK   PG FD LML+
Sbjct  400   LALALFDGGQATTNPATSISP-WQAFNDSGDWETALVQSASHLSNQKTSLPGGFDTLMLN  458

Query  495   GMYRQGALNQAVASSGVLTTGSATSVAFGSAGR-pamlalpappssADANTTASGADPFA  319
             GMY+QG ++QAVA SGV+ TGSA+SVA GSAGR   +     P +++ ANT A G DPFA
Sbjct  459   GMYQQGTVSQAVACSGVVATGSASSVALGSAGRPAMLALPAPPTANSGANTPAPGTDPFA  518

Query  318   ASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYGY  142
             ASL++APPAYVQMSE+EKKQRLL EEQ MWQ+Y K+GM GQVG    Q +  P+N  GY
Sbjct  519   ASLAIAPPAYVQMSEMEKKQRLLMEEQFMWQEYQKNGMQGQVGFANVQTNPYPYNVGGY  577



>ref|XP_009787969.1| PREDICTED: putative clathrin assembly protein At1g03050 [Nicotiana 
sylvestris]
 ref|XP_009787976.1| PREDICTED: putative clathrin assembly protein At1g03050 [Nicotiana 
sylvestris]
Length=585

 Score =   479 bits (1233),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 282/481 (59%), Positives = 349/481 (73%), Gaps = 14/481 (3%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDSRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
             FATRRGTRLLNMSDFRDSRSN WD SAFVR+Y+LYLDE +E +MQNRRGK SA +     
Sbjct  111   FATRRGTRLLNMSDFRDSRSNSWDCSAFVRSYALYLDEHLEFKMQNRRGKRSAFS-----  165

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRL  1213
                  +++EE     A  V  TP+ EMKN+ ++SRI H +Q+L+RFLAC+P G AK NR+
Sbjct  166   ----YNDDEEEARHNAKGVKATPLREMKNDRVFSRIHHLMQLLERFLACRPAGLAKNNRV  221

Query  1212  VLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYT  1033
             V+VALY +VKESFQ+YY + E++ IL D+F++L IPDS KV EIF R+ KQ++ELE FY 
Sbjct  222   VIVALYPLVKESFQLYYDLTEIITILFDKFIELSIPDSVKVLEIFFRINKQYEELEQFYD  281

Query  1032  WSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGR--IMrsrepspeveeveep  859
             W K  G++R SEYPD+E  P +KL+ M+++IREK      R   +R+   +  V+E E+ 
Sbjct  282   WGKTVGLARTSEYPDIEIIPPKKLERMDDLIREKSFREQNRKAAIRNETTTEHVQETEKQ  341

Query  858   epeaeaeEDMNTIKALPPPPE-DFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHA  682
             E + E EED+N +KALP P       E    E   ++   Q++GDLLNL ED PT EEH 
Sbjct  342   ETKTEPEEDINAVKALPAPEVLPKETEEKKEEDDKKDVVTQEVGDLLNLSEDVPTTEEHG  401

Query  681   NQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFPGNFDELM  502
             +QLALALFDG        T+I+  W AFN S DWETALVQ+AS LSNQKA FPG FD   
Sbjct  402   DQLALALFDGGQATTNPTTSISP-WHAFNDSGDWETALVQSASQLSNQKASFPGGFDTST  460

Query  501   LDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssA-DANTTASGADP  325
             LDGMY+QGA+ QAVASSGV+ TGSA+SVAFGSAGRPAMLALPAPP++   A+T A G DP
Sbjct  461   LDGMYQQGAVAQAVASSGVVATGSASSVAFGSAGRPAMLALPAPPTANGGASTAAPGTDP  520

Query  324   FAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             FAASL++APPAYVQMSE+EKKQRLL EEQ MWQ+Y ++GM GQV L KAQ +  PHN  G
Sbjct  521   FAASLAIAPPAYVQMSEMEKKQRLLVEEQLMWQEYQRNGMQGQVALAKAQPNPYPHNIGG  580

Query  144   Y  142
             Y
Sbjct  581   Y  581



>ref|XP_010313086.1| PREDICTED: putative clathrin assembly protein At1g03050 [Solanum 
lycopersicum]
Length=591

 Score =   478 bits (1230),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 279/482 (58%), Positives = 342/482 (71%), Gaps = 18/482 (4%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDSRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
             FATRRGTRLLNMS+FRD+RSN WDYSA VRTYSLYLDEQ+E RMQ+RRGK SA A     
Sbjct  111   FATRRGTRLLNMSEFRDTRSNSWDYSALVRTYSLYLDEQLEYRMQSRRGKRSAYA-----  165

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRL  1213
                 +++ +     T  V   TP++EMKNE+++SR+Q+ +Q+LDRFLAC+P G A+ NR 
Sbjct  166   ---YDEDLDNVDPETVTVKQPTPLSEMKNEHIFSRMQYLVQLLDRFLACRPAGLARNNRT  222

Query  1212  VLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYT  1033
             V VALY +V ESFQ+YY I E++  L+D+F +L IP+S KVHE F R+ KQ+ +LE FY 
Sbjct  223   VFVALYPLVNESFQIYYQIKEIISALIDKFHELSIPESVKVHETFCRINKQYVDLEQFYN  282

Query  1032  WSKAAGISRLSEYPDVENYPKQKLDim---eeiirekmeMAGGRIMrsrepspeveevee  862
             W K  GI R SEYPD+EN PK+KLD++           +    +    +    E  +  E
Sbjct  283   WCKTVGIGRSSEYPDIENIPKKKLDLIDEFIREKSILEQNGNAKRYEPKSEIVEETQEPE  342

Query  861   pepeaeaeEDMNTIKALPPP---PEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPE  691
             PEPE E E+ MN IKALPPP   PE+ I+E    E   E  K QD+ D LNLGEDA T E
Sbjct  343   PEPEPEPEQAMNEIKALPPPEGIPEE-IKEEKHQEESEEVAKTQDVVDFLNLGEDALTME  401

Query  690   EHANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFPGNFD  511
             +H +QLALALFDG        +T T+PWEAFN S DWETALVQ  SHLSNQKA  PG F+
Sbjct  402   QHGDQLALALFDGGGPPTDGPSTTTSPWEAFNNSGDWETALVQHTSHLSNQKASLPGGFN  461

Query  510   ELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADA--NTTAS  337
              +MLDGMY+QGA+ Q VASSGV+ TGSA+SVA GSAGRPAMLALPAPPS+     +TT +
Sbjct  462   TIMLDGMYQQGAVAQVVASSGVVATGSASSVALGSAGRPAMLALPAPPSADGGAQSTTCT  521

Query  336   GADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPH  157
               DPFAASL++APP+YVQMSE+EKKQRLL +EQ MWQQY KDGM GQVGL +  QS+ P+
Sbjct  522   TTDPFAASLAIAPPSYVQMSEMEKKQRLLVDEQVMWQQYQKDGMQGQVGLARTTQSN-PY  580

Query  156   NY  151
              Y
Sbjct  581   AY  582



>ref|XP_006352083.1| PREDICTED: putative clathrin assembly protein At1g03050-like 
[Solanum tuberosum]
Length=596

 Score =   477 bits (1227),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 284/479 (59%), Positives = 352/479 (73%), Gaps = 14/479 (3%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDSRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
             FATR+GTRLLNMS+FRD+RSN WDYS+ VRTYSLYLDEQ+E RMQ+RRGK SA A     
Sbjct  111   FATRQGTRLLNMSEFRDTRSNSWDYSSLVRTYSLYLDEQLEYRMQSRRGKRSAYA-----  165

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRL  1213
                 ++E +     T +V   TP++EMKNE+++SR+Q+ +Q+LDRFLACKP G A+ NR 
Sbjct  166   ---YDEELDNVEPETVVVKQPTPLSEMKNEHIFSRMQYLVQLLDRFLACKPAGLARTNRT  222

Query  1212  VLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYT  1033
             V VALY +V ESFQ+YY I E++ IL+D+F +L IP+S KVHEIF R+ KQ+ +LE FY 
Sbjct  223   VFVALYPLVNESFQIYYQITEIITILIDKFQELSIPESVKVHEIFCRINKQYVDLEQFYN  282

Query  1032  WSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMA-GGRIMrsrepspeveeveepe  856
             W K  GI R SEYPD+EN P++KLD++++ IREK  +   G  MR    S  VE+ +EPE
Sbjct  283   WCKTVGIGRSSEYPDIENIPQKKLDLIDDFIREKSILGQNGNAMRYEPKSELVEKTQEPE  342

Query  855   peaeaeEDMNTIKALPPPP--EDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHA  682
             PE E E+ MN IKALPPP    + I+E    E   E  K QD+ D LNLGE++ T EEH 
Sbjct  343   PEPEPEQAMNEIKALPPPEGIPEEIKEEKHEEENKEVVKTQDVADFLNLGENSLTMEEHG  402

Query  681   NQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFPGNFDELM  502
             +QLA+ALFDG        +T T+PWEAFN S DWETALVQ  SHLSNQKA  PG F+ LM
Sbjct  403   DQLAVALFDGGGPTTDGPSTTTSPWEAFNNSGDWETALVQHTSHLSNQKASLPGGFNTLM  462

Query  501   LDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASG--AD  328
             LDGMY+QGA+ Q VASSGV+ TGSA+SVA GSAGRP+MLALPAPPS+     + +G   D
Sbjct  463   LDGMYQQGAVAQVVASSGVVATGSASSVALGSAGRPSMLALPAPPSADGEAQSIAGTTTD  522

Query  327   PFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNY  151
             PFAASL++APP+YVQMSE+EKKQRLL +EQ MWQQY KDGM GQVGL +  QS+ P+ Y
Sbjct  523   PFAASLAIAPPSYVQMSEMEKKQRLLVDEQVMWQQYQKDGMQGQVGLARTTQSN-PYAY  580



>gb|EYU18515.1| hypothetical protein MIMGU_mgv1a003145mg [Erythranthe guttata]
Length=605

 Score =   465 bits (1196),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 282/485 (58%), Positives = 338/485 (70%), Gaps = 20/485 (4%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDS--RSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgn  1399
             FATRRGTRLLNMSDFRD+  RSN WDYSAFVRTYSLYLDEQ+E RMQ RRGK S   S  
Sbjct  111   FATRRGTRLLNMSDFRDTSGRSNAWDYSAFVRTYSLYLDEQLEFRMQGRRGKRSGYGSQA  170

Query  1398  eegveeed-----eeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTG  1234
             EE                  + A+VV  TPI EMK + ++SRI H +Q+L+RFLAC+PTG
Sbjct  171   EEEEGRGGGGGGGATTTAPTSNAVVVRATPIREMKIDRVFSRIHHLMQLLERFLACRPTG  230

Query  1233  AAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWD  1054
             AAK NR+V VALY +VKESFQ+ Y I E++G+L+DRFM+L++ D  KVHEIF RV+KQ+D
Sbjct  231   AAKENRVVSVALYPIVKESFQLCYDITEIMGVLIDRFMQLEVADMVKVHEIFCRVSKQYD  290

Query  1053  ELEVFYTWSKAAGISRLSEYPDVENYPKQKLDim------eeiirekmeMAGGRIMrsre  892
             EL+ FY W K+ GI+R SEYPDVE   ++KLD+M      +  +                
Sbjct  291   ELDTFYVWCKSFGIARASEYPDVEKITQKKLDMMEDYIHEKSAMVNTKRAVSAEPQPKPV  350

Query  891   pspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEE--KKEQDIGDLLN  718
                      EPEPE+E E+DMN IKAL PPPE F+EE   VE   EE  KK  + GDLLN
Sbjct  351   EEEAGPAEPEPEPESEPEQDMNAIKAL-PPPEGFVEETNEVEETKEENIKKTSEEGDLLN  409

Query  717   LGEDAPTPEEHANQLALALFD-GiptidptkttittPWEAFN-GSEDWETALVQTASHLS  544
             L  DAP+ +E  ++LALALFD G+ +      + TTPWEAF   S DWE ALVQ+ASHLS
Sbjct  410   LSADAPSTQEQGDKLALALFDGGLQSTTTAPGSTTTPWEAFKESSGDWEMALVQSASHLS  469

Query  543   NQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpapps  364
             NQ    PG F+ L+LDGMY+QGA   AVASSG++ TGSA+SVA GSAGRP+MLALPAPP+
Sbjct  470   NQNPSLPGGFNTLILDGMYQQGATAHAVASSGLVATGSASSVALGSAGRPSMLALPAPPT  529

Query  363   sADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLE  184
             +     T S  DPFAASL+VAPPAYVQMSE+EKKQRLL EEQ MWQQY +DGM GQVGL 
Sbjct  530   ADGGAHTNS--DPFAASLAVAPPAYVQMSEMEKKQRLLVEEQMMWQQYARDGMQGQVGLS  587

Query  183   KAQQS  169
             K QQ+
Sbjct  588   KVQQN  592



>gb|EPS66087.1| hypothetical protein M569_08691, partial [Genlisea aurea]
Length=574

 Score =   446 bits (1148),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 269/474 (57%), Positives = 325/474 (69%), Gaps = 17/474 (4%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDS--RSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgn  1399
             FATRRGTRLLN+SDFRDS  RSN WD+SAFVRTY+LYLDEQ+E RMQ RRGK        
Sbjct  111   FATRRGTRLLNLSDFRDSSGRSNAWDFSAFVRTYALYLDEQLEFRMQGRRGKRVGYG---  167

Query  1398  eegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRN  1219
              +   EE+E        A+VV GTP+ EMK + ++SR+ H +Q+L+RFLAC+PTGAA+ N
Sbjct  168   YQSRVEEEEAAAVAVAMAMVVRGTPLREMKVDLIFSRVHHLMQLLERFLACRPTGAAREN  227

Query  1218  RLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVF  1039
             R+VLVALY +VKESF + + IAE+LG+L+DRFM L++P+  ++HEIF RVAKQ+DEL+ F
Sbjct  228   RIVLVALYPIVKESFAICHHIAEILGVLIDRFMNLEVPEMVRIHEIFCRVAKQYDELDDF  287

Query  1038  YTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveep  859
             Y WS++ GI+R SEYPDVE   ++KLD+M+E I EK                   E   P
Sbjct  288   YGWSRSVGIARSSEYPDVEKISQKKLDMMDEYIHEKAAAN----NAPNNHLQIFAESPLP  343

Query  858   epeaeaeEDMNTIKALPPPPEDF-----IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTP  694
             E E   EED N IKAL PPPEDF      EE  VVE   E+  E D+GDLLNLGE  PT 
Sbjct  344   EEEIPTEEDANQIKAL-PPPEDFAVEEEEEEEEVVEESVEKGPESDLGDLLNLGEGLPTE  402

Query  693   EEHANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFPGNF  514
             EEH ++LALALF G P  D    T ++PWEAF    DWETALVQ+A HLSNQK   PG F
Sbjct  403   EEHGDRLALALFSGEPATDAAPETTSSPWEAFAADGDWETALVQSAGHLSNQKPSLPGGF  462

Query  513   DELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASG  334
               LMLDGMYRQ   N A A  GV+TTGSA+SVAFGSAG  +   L  P   +  N+ ++ 
Sbjct  463   TNLMLDGMYRQAEANLAAAQYGVVTTGSASSVAFGSAG--SPATLALPAPPSSENSNSNS  520

Query  333   ADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQ  172
             ADPFAASL  A P YVQMSE+EKKQRL+ EEQ MWQQY +DG+ G VGL   QQ
Sbjct  521   ADPFAASLGFAAPPYVQMSEMEKKQRLMVEEQLMWQQYARDGLQGHVGLANVQQ  574



>ref|XP_007043039.1| ENTH/ANTH/VHS superfamily protein [Theobroma cacao]
 gb|EOX98870.1| ENTH/ANTH/VHS superfamily protein [Theobroma cacao]
Length=582

 Score =   444 bits (1142),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 268/485 (55%), Positives = 344/485 (71%), Gaps = 25/485 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             F+TRRGTR+LNMSDFRD S+SN WDYSAFVRTY+LYLDE++E +MQ RRGK SA      
Sbjct  111   FSTRRGTRILNMSDFRDTSQSNSWDYSAFVRTYALYLDERLEYKMQGRRGKRSAY-----  165

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                    +EEE  N  AIVV  TP+ EMK E ++SR+QH  Q+L+RFLAC+PTG+AK NR
Sbjct  166   -----MHDEEEEENDKAIVVRSTPVREMKTEQIFSRLQHLQQLLERFLACRPTGSAKCNR  220

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V VALY +VKESFQ+YY I E+LGIL+DRFM+LD+ +S KV+E F RV KQ+DELE FY
Sbjct  221   VVSVALYPIVKESFQIYYDITEILGILIDRFMELDVSESVKVYENFSRVGKQFDELENFY  280

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
             +W K+ G++R SEYP++E   ++KLD+++E IR+K  +A G+ +   E   E    +E +
Sbjct  281   SWCKSVGLARASEYPEIEKITQKKLDLIDEFIRDKSVLAQGKSI-RDEVKDEPVPQQEVK  339

Query  855   peaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKE-------QDIGDLLNLGEDAPT  697
                  EEDMN IKAL P PEDF E  A  E   EE+++       Q  GDLLNLGEDA +
Sbjct  340   ETEAREEDMNAIKAL-PAPEDFSEAPAEEEPEQEEEEDNSKAIVVQQEGDLLNLGEDAIS  398

Query  696   PEEHANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFPGN  517
              ++HA++LALALFDG      +       WEAF    DWE+ALVQ+AS+L++Q+    G 
Sbjct  399   SQDHADKLALALFDG---AATSGPPPGPGWEAFKDEADWESALVQSASNLNHQRTTLAGG  455

Query  516   FDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTAS  337
              D L+LDGMY+QG    A+ASSG   TGSA+SVAFGSAGRPAMLALPAPPS    NT  +
Sbjct  456   LDMLLLDGMYQQGQTMAAMASSGYAATGSASSVAFGSAGRPAMLALPAPPSPDGKNTGTN  515

Query  336   GADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPH  157
             G DPFAASL VAPP+YVQMS++EKKQ+LL EE+ MW+QY ++GM G +G+   Q  + P+
Sbjct  516   GGDPFAASLVVAPPSYVQMSDMEKKQKLLVEERAMWEQYKRNGMQGHIGMSNLQ--TYPY  573

Query  156   NYYGY  142
             +  GY
Sbjct  574   SQGGY  578



>ref|XP_011018854.1| PREDICTED: putative clathrin assembly protein At1g03050 [Populus 
euphratica]
Length=581

 Score =   444 bits (1141),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 265/486 (55%), Positives = 331/486 (68%), Gaps = 33/486 (7%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDSRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
             FATRRGTRLLNMSDFRDSRSN WDYSAFVRT +LYLDE++E RMQ RRGK SA       
Sbjct  111   FATRRGTRLLNMSDFRDSRSNSWDYSAFVRTLALYLDERLEFRMQGRRGKRSAFG-----  165

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRL  1213
                    EE+      + V  TP+ +MK + ++SRIQH  Q+L+RFLAC+PTG A+ NR+
Sbjct  166   ------IEEDEEEAGQVSVKSTPVRDMKIDRIFSRIQHLQQLLERFLACRPTGGARHNRV  219

Query  1212  VLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYT  1033
             V+VALY  VKES Q+YY I E+LGIL+DRFM+L+IP++ KV+EIF RV+KQ DEL+ FY+
Sbjct  220   VIVALYSTVKESIQLYYDITEILGILIDRFMELEIPEAVKVYEIFCRVSKQLDELDNFYS  279

Query  1032  WSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepep  853
             W K  GI+R SEYPD+E   ++KLD+M+E I++K  +A  +       +   E V E + 
Sbjct  280   WCKTVGIARTSEYPDIEKITQKKLDLMDEFIQDKSTLAQTK------RATFEEPVNETDE  333

Query  852   eaeaeEDMNTIKALPPPPEDFIEEMAVVE-----APTEEKKE---QDIGDLLNLGEDAPT  697
               + E+DMN IKALPPP  +   E  VVE     A  EEKKE   Q   DLLNL +DA +
Sbjct  334   GKKCEDDMNAIKALPPP--ESYTETPVVEVQEDAAKEEEKKEINTQQEADLLNLHDDALS  391

Query  696   PEEHANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTASHLSNQKAQFPG  520
              EEHAN +ALALFDG     P   T    WEAFN  + DWET LVQ+AS L++QK    G
Sbjct  392   TEEHANNMALALFDG---GAPAGPTQALAWEAFNDDTADWETTLVQSASDLTSQKVTLAG  448

Query  519   NFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTA  340
               D ++LDGMY+ G     ++++G    GSA+SVA GSAGRPAMLALPAPP    + TT+
Sbjct  449   GLDMMLLDGMYQHGVKTAEMSATGYGVHGSASSVALGSAGRPAMLALPAPPVPNSSATTS  508

Query  339   SGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQP  160
             +  DPFAASL+VAPP YVQMSE+EKKQ+LL EEQ +WQQY KDGM GQ    K Q +S  
Sbjct  509   ANLDPFAASLAVAPPPYVQMSEMEKKQKLLVEEQVLWQQYAKDGMQGQAAFAKLQPNS--  566

Query  159   HNYYGY  142
             +N  GY
Sbjct  567   YNVGGY  572



>ref|XP_006381338.1| clathrin assembly family protein [Populus trichocarpa]
 gb|ERP59135.1| clathrin assembly family protein [Populus trichocarpa]
Length=581

 Score =   442 bits (1138),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 262/486 (54%), Positives = 330/486 (68%), Gaps = 33/486 (7%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDSRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
             FATRRGTRLLNMSDFRDSRSN WDYSAFVRT +LYLDE++E RMQ RRGK SA     +E
Sbjct  111   FATRRGTRLLNMSDFRDSRSNSWDYSAFVRTLALYLDERLEFRMQGRRGKRSAFGIEEDE  170

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRL  1213
                 +             V  TP+ +MK ++++SRIQH  Q+L+RFLAC+PTG AK NR+
Sbjct  171   EEAGQAS-----------VKSTPVRDMKIDHIFSRIQHLQQLLERFLACRPTGGAKHNRV  219

Query  1212  VLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYT  1033
             V+VALY  VKES Q+YY I E+LGIL+DRFM+L+IP++ KV+EIF RV+KQ DEL+ FY+
Sbjct  220   VIVALYSTVKESIQLYYDITEILGILIDRFMELEIPEAVKVYEIFCRVSKQLDELDNFYS  279

Query  1032  WSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepep  853
             W K  GI+R SEYPD+E   ++KLD+M+E I++K  +A  +       +   E + E + 
Sbjct  280   WCKTVGIARTSEYPDIEKITQKKLDLMDEFIQDKSTLAQTK------RATFEEPMNETDE  333

Query  852   eaeaeEDMNTIKALPPPPEDFIEEMAVVE-----APTEEKKE---QDIGDLLNLGEDAPT  697
               + E+D+N IKALPPP  +   E  VVE     A  EEKKE   Q   DLLNL +DA +
Sbjct  334   GKKCEDDINAIKALPPP--ESYTETPVVEVQEDAAKEEEKKEINTQQEADLLNLHDDALS  391

Query  696   PEEHANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTASHLSNQKAQFPG  520
              EEHAN +ALALFDG     P        WEAFN  + DWET LVQ+AS L++QK    G
Sbjct  392   TEEHANNMALALFDG---GAPAGPAQALAWEAFNDDTADWETTLVQSASDLTSQKVTLAG  448

Query  519   NFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTA  340
               D ++LDGMY+ G     ++++G    GSA+SVA GSAGRPAMLALPAPP    + TT+
Sbjct  449   GLDMMLLDGMYQHGVKTAEMSATGYGVHGSASSVALGSAGRPAMLALPAPPVPNSSATTS  508

Query  339   SGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQP  160
             +  DPFAASL+VAPP YVQMSE+EKKQ+LL EEQ +WQQY KDGM GQ    K Q +S  
Sbjct  509   ANPDPFAASLAVAPPPYVQMSEMEKKQKLLVEEQLLWQQYAKDGMQGQAAFAKLQPNS--  566

Query  159   HNYYGY  142
             +N  GY
Sbjct  567   YNVGGY  572



>gb|KDP37487.1| hypothetical protein JCGZ_05926 [Jatropha curcas]
Length=585

 Score =   437 bits (1123),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 266/478 (56%), Positives = 332/478 (69%), Gaps = 22/478 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDF D S+SN WDYSAFVRTY+LYLDE++E RMQ RRGK SA     +
Sbjct  111   FATRRGTRLLNMSDFCDGSKSNSWDYSAFVRTYALYLDERLEFRMQGRRGKRSAFGIEED  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             E    E             V  TP+ EMK E ++SRI H  Q+L+RFLAC+PTG AK +R
Sbjct  171   EEAAAEKASR---------VRSTPVREMKIESIFSRIHHLQQLLERFLACRPTGTAKYHR  221

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +++VALY ++KESFQ+YY I E+LGIL+DRFM+L+I DS KV++IF R +KQ+DEL+ FY
Sbjct  222   VIMVALYAIIKESFQLYYDITEILGILIDRFMELEIVDSIKVYDIFSRTSKQFDELDNFY  281

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
              WSK  GI R SEYP+VE   ++KLD+M+E +R+K  +A  R            E E  E
Sbjct  282   GWSKTVGIGRCSEYPEVEKITRKKLDLMDEFVRDKSALAQTR-QVLVYEQKSEIEEEYKE  340

Query  855   peaeaeEDMNTIKALPPP---PEDFIEEMAVVEAPTEEKKEQDIG--DLLNL-GEDAPTP  694
             P  E E+DMN +KALPPP    ++ I E+   EA  ++K+E++I   DLLNL GEDA + 
Sbjct  341   PIRENEDDMNAMKALPPPESCTQEVITEVVEEEAKKDDKQEKNIEEVDLLNLGGEDAVSM  400

Query  693   EEHANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQFPGN  517
             EE+ NQLALALFDG       + T  T W+ F + + DWETALVQ+AS LSNQ+    G 
Sbjct  401   EEYGNQLALALFDG---CPQPQATTDTTWDGFYDNTTDWETALVQSASKLSNQQKTLAGG  457

Query  516   FDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANT-TA  340
             FD ++LDGMY+QGA N  ++S G   TGSA+SVA GS GRP ML LPAP ++   NT T 
Sbjct  458   FDMMLLDGMYQQGAANATMSSVGYAATGSASSVALGSTGRPEMLTLPAPSTTEANNTITL  517

Query  339   SGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSS  166
                DPFAASL+VAPP YVQMSELEKKQ+LL EEQ MWQQY +DGM GQ+GL K Q +S
Sbjct  518   HNTDPFAASLTVAPPPYVQMSELEKKQKLLVEEQLMWQQYARDGMQGQLGLTKLQPNS  575



>ref|XP_002523765.1| clathrin assembly protein, putative [Ricinus communis]
 gb|EEF38614.1| clathrin assembly protein, putative [Ricinus communis]
Length=578

 Score =   431 bits (1107),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 268/482 (56%), Positives = 330/482 (68%), Gaps = 23/482 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDF D SRSN WDYSAFVRTY+LYLDE++E RMQ RRG+ SA      
Sbjct  111   FATRRGTRLLNMSDFCDTSRSNSWDYSAFVRTYALYLDERLEYRMQGRRGRRSAFG----  166

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                     +E+   T  I V  TP+ EMK ++++SRIQH  Q+L+RFLAC+PTG AK NR
Sbjct  167   -------IDEDEEATGTICVRSTPVREMKTDHVFSRIQHLQQLLERFLACRPTGGAKHNR  219

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VKESFQ+YY I E+LGIL+DRFM+L+I DS KV++IF R++KQ+++LE FY
Sbjct  220   VVIVALYPIVKESFQLYYDITEILGILIDRFMELEISDSVKVYDIFCRISKQFEDLESFY  279

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
              W K  GI R S+YPDVE    +KLD+M+E IR+K  +A  +           E  E  +
Sbjct  280   GWCKIIGIGRSSDYPDVEKITPKKLDLMDEFIRDKSALAQTK-HAITFEEMIHETEEGSK  338

Query  855   peaeaeEDMNTIKALPPP---PEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEH  685
                E E+DM  IKALPPP   P + I E  V E   EE    ++ DLLNLGE+  + EE+
Sbjct  339   QVEENEDDMTKIKALPPPEGFPTEEIAEEEVKEGDKEENNTTEV-DLLNLGEELVSTEEY  397

Query  684   ANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTASHLSNQKAQFPGNFDE  508
               QLALALFDG         T   PWEAFN  S+DWET LVQ+ASHLSNQKA   G FD 
Sbjct  398   GTQLALALFDG---GAQPGATTRPPWEAFNDDSKDWETTLVQSASHLSNQKATLAGGFDM  454

Query  507   LMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGAD  328
             ++LDGMY++GA N A ++ G   +GSA+SVA  S GRP MLALP PP+    NT    AD
Sbjct  455   MLLDGMYQRGATNAATSAIGYGGSGSASSVALESTGRPTMLALPPPPTQDGNNTVLPNAD  514

Query  327   PFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYY  148
             PFAASL VAPP YVQMS++EKKQ+LL EEQ MWQQY +DGM GQVG+ K Q +S  +N  
Sbjct  515   PFAASLVVAPPPYVQMSDMEKKQKLLVEEQLMWQQYARDGMQGQVGITKLQPNS--YNMG  572

Query  147   GY  142
             GY
Sbjct  573   GY  574



>ref|XP_007222060.1| hypothetical protein PRUPE_ppa003194mg [Prunus persica]
 gb|EMJ23259.1| hypothetical protein PRUPE_ppa003194mg [Prunus persica]
Length=594

 Score =   429 bits (1102),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 270/487 (55%), Positives = 344/487 (71%), Gaps = 17/487 (3%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             F+TRRGTR LNMSDFRD S SN WDYSAFVRTY+LYLDE++E RMQ+RRGK SA     E
Sbjct  111   FSTRRGTRFLNMSDFRDASTSNSWDYSAFVRTYALYLDERLEFRMQSRRGKRSAFGIDEE  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             E  +E         +       TP+ EMK E L+SR+QH  Q+L+RFLAC+PTG AK NR
Sbjct  171   EDPQEPPHNYANQQS---CPRATPVHEMKAEKLFSRMQHVQQLLERFLACRPTGEAKTNR  227

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VAL+ +VKESFQ+YY I E++G+L+DRFM+L+I D  KV EIF R+ KQ+DEL+ FY
Sbjct  228   VVIVALFPIVKESFQIYYDITEIMGVLIDRFMELEIHDCAKVFEIFCRIGKQFDELDTFY  287

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGR-IMrsrepspeveeveep  859
             +W K  GI+R SEYP+VE    +KL++MEE IR+K  +A GR  +++     ++EE+++ 
Sbjct  288   SWCKTIGIARSSEYPEVEKITPKKLEVMEEYIRDKSALAQGRKSVKALLEQQKIEEIDQE  347

Query  858   epeaeaeEDMNTIKALPPPPEDFIE-----EMAVVEAPTEEKKEQDIGDLLNLGEDAPTP  694
                 E EEDMN +KAL PPPE F+E     E+  V+    +K +Q+ GDLLNLG+DA + 
Sbjct  348   TNRDEEEEDMNAMKAL-PPPESFVEESNNKEIEPVKEEETKKPQQEEGDLLNLGDDAVSS  406

Query  693   EEHANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFPGNF  514
             EEHA++LALALF+G         T    WEAF    DWETALVQ+ASHLS+QKA   G F
Sbjct  407   EEHADKLALALFNG---ATAEAKTRLPAWEAFADEADWETALVQSASHLSHQKASLGGGF  463

Query  513   DELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASG  334
             D L+LDGMY+Q  ++ A+A  G   +GSA+SVA GSAGRPAMLALPAPPSS+D + ++  
Sbjct  464   DVLLLDGMYQQAEISAAMAGPGSGVSGSASSVALGSAGRPAMLALPAPPSSSDHHDSSKS  523

Query  333   ---ADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQ  163
                 DPFAASL V PP+YVQMS+LEKKQ+LL EEQ MWQQY +DGM GQ+GL K Q +  
Sbjct  524   NVHVDPFAASLVVPPPSYVQMSDLEKKQKLLVEEQFMWQQYARDGMQGQLGLTKLQHNPH  583

Query  162   PHNYYGY  142
               N  GY
Sbjct  584   NINMGGY  590



>ref|XP_010103874.1| Putative clathrin assembly protein [Morus notabilis]
 gb|EXB97315.1| Putative clathrin assembly protein [Morus notabilis]
Length=597

 Score =   424 bits (1090),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 260/494 (53%), Positives = 341/494 (69%), Gaps = 28/494 (6%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDSRSNF-WDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             F+TRRGTR LNMSDFRD+ S+  WDYSAFVRTY+LYLDE++E RMQ+RRG+ SA      
Sbjct  111   FSTRRGTRFLNMSDFRDNSSSSSWDYSAFVRTYALYLDERLEYRMQSRRGRRSAFG----  166

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                 +ED++E       ++V  TP+ EMK E ++ R QH  Q+L+RFLAC+PTGAAK NR
Sbjct  167   ---FDEDDDETAMGQQQMIVRATPVREMKTEQVFPRAQHLQQLLERFLACRPTGAAKTNR  223

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY  VKESFQ+YY + E +G+L+DRFM+++IPD  KVH+IF RV KQ+DEL++FY
Sbjct  224   VVIVALYPSVKESFQIYYDLTETMGVLIDRFMEMEIPDCLKVHDIFCRVGKQFDELDIFY  283

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
             +W K  GI+R SEYP+VE    +KL++M++ IR+K   A   +    E   ++ + +E +
Sbjct  284   SWCKIIGIARSSEYPEVEKITPKKLEVMDDFIRDKSANA-QTLRLKAEAENKISDTKEED  342

Query  855   peaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEE----------KKEQDIGDLLNLGED  706
                E  EDMN IKAL P PED + E  + +   E+           ++Q  GDLLNLGE+
Sbjct  343   HPVEEGEDMNAIKAL-PAPEDHVSEPQIEDEKREQLEQEKADNKPHQQQQQGDLLNLGEN  401

Query  705   APTPEEHANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQ  529
             A T E+H ++LALALFDGIP+           WEAF +G  DWETALVQ+AS LS+QK  
Sbjct  402   ALTSEQHGDKLALALFDGIPSAPAMAEPTPPSWEAFSDGGADWETALVQSASGLSHQKMA  461

Query  528   FPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssAD--  355
               G FD  +LDGMY+Q A   AVA SG   +GSA+S+A GS+G+PAMLALPAPP  +   
Sbjct  462   LAGGFDIYVLDGMYKQAAAAAAVAGSGFGASGSASSIALGSSGQPAMLALPAPPVESSNG  521

Query  354   ---ANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLE  184
                A++T+   DPFAASL+VAPP YVQMSE+EKKQ+LL EEQ MWQQY +DGM GQ+G+ 
Sbjct  522   NGAASSTSINVDPFAASLAVAPPPYVQMSEMEKKQKLLVEEQLMWQQYARDGMQGQLGMG  581

Query  183   KAQQSSQPHNYYGY  142
             K Q +  P+N  GY
Sbjct  582   KLQHN--PYNTGGY  593



>ref|XP_008218828.1| PREDICTED: putative clathrin assembly protein At1g03050 [Prunus 
mume]
Length=595

 Score =   422 bits (1086),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 269/484 (56%), Positives = 336/484 (69%), Gaps = 20/484 (4%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             F+TRRGTR LNMSDFRD S SN WDYSAFVRTY+LYLDE++E RMQ+RRGK SA     E
Sbjct  111   FSTRRGTRFLNMSDFRDASTSNSWDYSAFVRTYALYLDERLEFRMQSRRGKRSAFGIDEE  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             E  +E         +       TP+ EMK E L+SR+QH  Q+L+RFLAC+PTG AK NR
Sbjct  171   EDPQEPPHNYANQQS---CPRATPVHEMKAEKLFSRMQHVQQLLERFLACRPTGEAKTNR  227

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VAL+ +VKESFQ+YY I E++G+L+DRFM+L+I D  KV EIF R+ KQ+DEL+ FY
Sbjct  228   VVIVALFPIVKESFQIYYDITEIMGVLIDRFMELEIHDCAKVFEIFCRIGKQFDELDTFY  287

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspevee---ve  865
             +W K  GI+R SEYP+VE    +KL++MEE IR+K  +A GR         +  E    E
Sbjct  288   SWCKTIGIARSSEYPEVEKITPKKLEVMEEYIRDKSALAQGRKSVKALLEQQKIEEIDQE  347

Query  864   epepeaeaeEDMNTIKALPPPPEDFIEEMAVVEA-PTEE---KKEQDIGDLLNLGEDAPT  697
                 + E EEDMN ++AL PPPE F+EE    E  P +E   KK Q  GDLL+LG+DA +
Sbjct  348   TNRDDDEEEEDMNAMRAL-PPPESFVEESNNKEIEPVKEEETKKPQQEGDLLHLGDDAVS  406

Query  696   PEEHANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFPGN  517
              EEHA++LALALF+G         T    WEAF    DWETALVQ++SHLS+QKA   G 
Sbjct  407   SEEHADKLALALFNG---ATAEAKTRLPAWEAFADEADWETALVQSSSHLSHQKASLGGG  463

Query  516   FDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTAS  337
             FD L+LDGMY+Q  ++ A+A  G   +GSA+SVA GSAG PAMLALPAPPSS+D + ++ 
Sbjct  464   FDVLLLDGMYQQAEISAAMAGPGSGVSGSASSVALGSAGLPAMLALPAPPSSSDHHESSK  523

Query  336   G---ADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSS  166
                  DPFAASL V PP+YVQMS+LEKKQ+LL EEQ MWQQY +DGM GQ+GL K Q + 
Sbjct  524   SNVHVDPFAASLVVPPPSYVQMSDLEKKQKLLVEEQFMWQQYARDGMQGQLGLTKLQHN-  582

Query  165   QPHN  154
              PHN
Sbjct  583   -PHN  585



>ref|XP_009354070.1| PREDICTED: putative clathrin assembly protein At1g03050 [Pyrus 
x bretschneideri]
Length=602

 Score =   422 bits (1086),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 267/496 (54%), Positives = 339/496 (68%), Gaps = 27/496 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             F+TRRGTR LNMSDFRD SRSN WD+SAFVRTY+LYLDE++E RMQ+RRGK SA     +
Sbjct  111   FSTRRGTRFLNMSDFRDTSRSNSWDHSAFVRTYALYLDERLEFRMQSRRGKRSAFGFDED  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                 +E     T   +      TP+ EMK + L+SR+QH  Q+L+RFL C+PTG AK NR
Sbjct  171   IEDPQEAANNFTNQQS--CQRATPVHEMKADKLFSRMQHLQQLLERFLGCRPTGVAKNNR  228

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VAL+ +VKESFQ+YY I E++GIL+DRFM+L+IPD  KV+EIF R+ KQ+DEL+ FY
Sbjct  229   VVIVALHAIVKESFQIYYDITEIMGILIDRFMELEIPDCAKVYEIFCRIGKQFDELDTFY  288

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGR------IMrsrepspeve  874
              W K  GI+R SEYP+VE    +KL++M++ IR+K  +A G+      + + +      +
Sbjct  289   GWCKQIGIARSSEYPEVEKITPKKLEVMDDYIRDKSALAQGKRSVKALLDQQKINEANKD  348

Query  873   eveepepeaeaeEDMNTIKALPPPPEDFIE-----EMAVVEAPTEEKKEQDIGDLLNLGE  709
             E      E E EEDMN +KAL PPPE F+E     EM  V+    +K +Q+ GDLLNLGE
Sbjct  349   EESNHGEEEEEEEDMNAMKAL-PPPEGFVEESNNKEMEPVKEEEIKKPQQEEGDLLNLGE  407

Query  708   DAPTPEEHANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQ  529
             DA +  EHA++LALALF+G              WEAF    DWETALVQ+ASHLSNQKA 
Sbjct  408   DALSSNEHADKLALALFNG---ATEQAPAGQLAWEAFADEADWETALVQSASHLSNQKAS  464

Query  528   FPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADAN  349
               G FD L+LDGMY+Q  ++ A+A  G   +GSA+SVA GSAGRPAMLALPAPP+S+ ++
Sbjct  465   LGGGFDLLLLDGMYQQAEISAAMAGPGYGVSGSASSVALGSAGRPAMLALPAPPTSSSSS  524

Query  348   TTASG----ADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
                S      DPFAASL V PP+YVQMS+LEKKQ+LL +EQ MWQQY + GM GQVGL K
Sbjct  525   NHPSKSNVHVDPFAASLVVPPPSYVQMSDLEKKQKLLMDEQFMWQQYARSGMQGQVGLTK  584

Query  180   AQQSSQPH---NYYGY  142
              Q +  PH   N  GY
Sbjct  585   LQHN--PHHNINMGGY  598



>ref|XP_009333624.1| PREDICTED: putative clathrin assembly protein At1g03050 [Pyrus 
x bretschneideri]
Length=603

 Score =   421 bits (1083),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 267/496 (54%), Positives = 342/496 (69%), Gaps = 26/496 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             F+TRRGTR LNMSDFRD SRSN WDYSAFVRTY+LYLDE++E RMQ+RRGK SA     +
Sbjct  111   FSTRRGTRFLNMSDFRDTSRSNSWDYSAFVRTYALYLDERLEFRMQSRRGKRSAFGFDED  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             E  + ++      N  +     TP+ EMK + L+SR+QH  Q+L+RFLAC+PTG AK NR
Sbjct  171   EFEDPQEAANNFTNQQS-CPKATPVHEMKADKLFSRMQHLQQLLERFLACRPTGVAKNNR  229

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V++ALY +VKESFQVYY I E++GIL+DRFM+L+IPD  KV+EIF R+ KQ+DEL++ Y
Sbjct  230   IVIMALYPIVKESFQVYYDITEIMGILIDRFMELEIPDCAKVYEIFCRIGKQFDELDMLY  289

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRI----Mrsrepspeveev  868
              W K  GISR SEYP+VE    +KL++M+E IR+K  +A G+     +  ++   E  + 
Sbjct  290   GWCKQIGISRSSEYPEVERITPKKLEVMDEYIRDKSALAQGKRSVKELLDQQKIDEANKD  349

Query  867   eepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEA-PTEE----KKEQDIGDLLNLGEDA  703
             EE     + EEDMN +KAL PPPE F+EE    E  P +E    K +Q+ GDLLNLGEDA
Sbjct  350   EESNHGEDEEEDMNAMKAL-PPPEGFVEENNNKEIEPVKEEEIKKPQQEEGDLLNLGEDA  408

Query  702   PTPEEHANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFP  523
              +  EHA++LALALF+G              WEAF    DWETALVQ+ASHLSNQKA   
Sbjct  409   VSSNEHADKLALALFNG---ATEQAPAGPPAWEAFANEADWETALVQSASHLSNQKASLG  465

Query  522   GNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADA---  352
             G FD L+LDG+Y+Q  ++  +A  G   +GSA+SVA GSAGRPAMLALPAPP S+ +   
Sbjct  466   GGFDLLLLDGLYQQAEVSATMAGPGYGVSGSASSVALGSAGRPAMLALPAPPPSSSSSSL  525

Query  351   ---NTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
                + ++   DPFAASL V PP+YVQMS+LE+KQ+LL +EQ MW QY +DGM GQ+GL K
Sbjct  526   DHPSKSSVHVDPFAASLVVPPPSYVQMSDLERKQKLLMDEQLMWHQYARDGMQGQIGLTK  585

Query  180   AQQSSQPH---NYYGY  142
              Q +  PH   N  GY
Sbjct  586   LQHN--PHHNINMGGY  599



>ref|NP_171804.1| putative clathrin assembly protein [Arabidopsis thaliana]
 sp|Q9SA65.1|CAP4_ARATH RecName: Full=Putative clathrin assembly protein At1g03050 [Arabidopsis 
thaliana]
 gb|AAD25804.1|AC006550_12 Similar to clathrin assembly protein gb|AF041374 (CALM) from 
Rattus norvegicus [Arabidopsis thaliana]
 gb|ABE65594.1| clathrin assembly protein-like [Arabidopsis thaliana]
 gb|AEE27520.1| putative clathrin assembly protein [Arabidopsis thaliana]
Length=599

 Score =   421 bits (1082),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 255/493 (52%), Positives = 337/493 (68%), Gaps = 28/493 (6%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD SRSN WDYSAFVRTY+LYLDE+++ RMQ R GK   +     
Sbjct  112   FATRRGTRLLNMSDFRDVSRSNSWDYSAFVRTYALYLDERLDFRMQARHGKR-GVYCVGG  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             E  EEE ++     +TAIVV   PI EMK E ++ RIQH  Q+LDRFLAC+PTG A+ NR
Sbjct  171   EADEEEQDQAAADLSTAIVVRSQPIAEMKTEQIFIRIQHLQQLLDRFLACRPTGNARNNR  230

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VKESFQ+YY + E++GIL++RFM+LDIPDS KV++IF RV+KQ++EL+ FY
Sbjct  231   VVIVALYPIVKESFQIYYDVTEIMGILIERFMELDIPDSIKVYDIFCRVSKQFEELDQFY  290

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGR-IMrsrepspeveeveep  859
             +W K  GI+R SEYP++E   ++KLD+M+E IR+K  +   +     +  + E ++    
Sbjct  291   SWCKNMGIARSSEYPEIEKITQKKLDLMDEFIRDKSALEHTKQSKSVKSEADEDDDEART  350

Query  858   epeaeaeEDMNTIKALPPPP----EDFIEEMAVVEAPTEEKKEQDIGDLLNLGE-DAPTP  694
             E   E +EDMN IKALP PP    +D   E    E    EKK++++GDLL+LG  +    
Sbjct  351   EEVNEEQEDMNAIKALPEPPPKEEDDVKPEEEAKEEVIIEKKQEEMGDLLDLGNTNGGEA  410

Query  693   EEHANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQFPGN  517
              +  + LALALFDG P    + +     WEAF + S DWETALVQTA++LS QK++  G 
Sbjct  411   GQAGDSLALALFDG-PYASGSGSESGPGWEAFKDDSADWETALVQTATNLSGQKSELGGG  469

Query  516   FDELMLDGMYRQGALNQAVASSGVL-TTGSATSVAFGSAGRpamlalpappssADANTTA  340
             FD L+L+GMY+ GA+N AV +S     +GSA+S+AFGSAGRPA   L  P     A +TA
Sbjct  470   FDMLLLNGMYQHGAVNAAVKTSTAYGASGSASSMAFGSAGRPAATMLALP-----APSTA  524

Query  339   SG----------ADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVG  190
             +G           DPFAASL VAPPAYVQM+++EKKQR+L EEQ MW QY++DG  G + 
Sbjct  525   NGNAGNINSPVPMDPFAASLEVAPPAYVQMNDMEKKQRMLMEEQMMWDQYSRDGRQGHMN  584

Query  189   LEKAQQSSQPHNY  151
             L + Q  +QP++Y
Sbjct  585   LRQNQ--NQPYSY  595



>ref|XP_002270803.1| PREDICTED: putative clathrin assembly protein At1g03050 [Vitis 
vinifera]
 ref|XP_010657582.1| PREDICTED: putative clathrin assembly protein At1g03050 [Vitis 
vinifera]
 ref|XP_010657583.1| PREDICTED: putative clathrin assembly protein At1g03050 [Vitis 
vinifera]
Length=582

 Score =   418 bits (1074),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 260/491 (53%), Positives = 327/491 (67%), Gaps = 31/491 (6%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD--SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgn  1399
             F+TRRGTR+LNMSDFRD  S+SN WDYSAFVRTY+LYLDE++E RMQ +RGK SA     
Sbjct  111   FSTRRGTRILNMSDFRDHSSQSNSWDYSAFVRTYALYLDERLEFRMQGKRGKRSAFEYEE  170

Query  1398  eegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRN  1219
             +E       +             TP+ +MK   ++SRI H  Q+L+RFLAC+PTG AK N
Sbjct  171   DEEEGGAAAQ----------ARNTPVCDMKTVDIFSRINHLQQLLERFLACRPTGEAKSN  220

Query  1218  RLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVF  1039
             R+VLVALY +VKESFQ+YY I E++GIL++RFM+L++ D  KVHEIF+RV KQ+DEL+ F
Sbjct  221   RVVLVALYPIVKESFQIYYDITEIMGILIERFMELEVQDCVKVHEIFYRVLKQFDELDSF  280

Query  1038  YTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveep  859
             YTW ++ GI+R SEYP+VE    +KLD+M+E IR+K  +A  R           E V E 
Sbjct  281   YTWCRSTGIARSSEYPEVEKIALKKLDLMDEFIRDKAALAQSR---KNRIVGPEEPVVEA  337

Query  858   epeaeaeEDMNTIKALPPP-------PEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAP  700
             +     EE++N IKALP P        E+  E     +   +E   Q+ GDLLNLG+DA 
Sbjct  338   KEPEPVEENINAIKALPAPEGWEVPVEEEKEEPKEEEKKEKKEINVQEEGDLLNLGDDAV  397

Query  699   TPEEHANQLALALFDGiptidptkttittPWEAF--NGSEDWETALVQTASHLSNQKAQF  526
             T +EH +QLALALFDG              WEAF  + + DWETALVQ+AS LS QK   
Sbjct  398   TTQEHGSQLALALFDG----GAVANPAAPAWEAFTTDDAADWETALVQSASGLSQQKTNL  453

Query  525   PGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANT  346
              G FD L+LDGMY+Q  + QA        +GSA+SVAFGS GRPAMLALPAPP+S D  +
Sbjct  454   GGGFDMLLLDGMYQQATMAQATTGGTFGASGSASSVAFGSIGRPAMLALPAPPTSNDGAS  513

Query  345   TASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSS  166
             T S  DPFAASL+VAPP YVQMSE+EKKQ+LL EEQ +WQQY +DGM G +G+ K Q S 
Sbjct  514   TRS-VDPFAASLAVAPPTYVQMSEMEKKQKLLMEEQFLWQQYARDGMPGHLGIPKFQGS-  571

Query  165   QPHNYYGY*YS  133
              P+N  GY +S
Sbjct  572   -PYNNGGYTHS  581



>ref|XP_008391377.1| PREDICTED: putative clathrin assembly protein At1g03050 [Malus 
domestica]
Length=603

 Score =   418 bits (1075),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 264/496 (53%), Positives = 339/496 (68%), Gaps = 26/496 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             F+TRRGTR LNMSDFRD SRSN WDYSAFVRTY+LYLDE++E RMQ+RRGK SA     +
Sbjct  111   FSTRRGTRFLNMSDFRDTSRSNSWDYSAFVRTYALYLDERLEFRMQSRRGKRSAFGFDED  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             E  + ++      N  +     TP+ EMK + L+SR+QH  Q+L+RFLAC+PTG AK NR
Sbjct  171   EFEDPQEAANNFTNQQS-CPKATPVHEMKADKLFSRMQHLQQLLERFLACRPTGVAKNNR  229

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VKESFQVYY I E++GIL+DRFM+L+IPD  KV+EIF R+ KQ+DEL++ Y
Sbjct  230   VVIVALYPIVKESFQVYYDITEIMGILIDRFMELEIPDCAKVYEIFCRIGKQFDELDMLY  289

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRI----Mrsrepspeveev  868
              W K  GI+  SEYP+VE    +KL++M+E IR+K  +A G+     +  ++        
Sbjct  290   GWCKQIGIACSSEYPEVERITPKKLEVMDEYIRDKSALAQGKRSVKELLDQQKIDVANND  349

Query  867   eepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEA-PTEE----KKEQDIGDLLNLGEDA  703
             +E     + EEDMN +KAL PPPE F+EE    E  P +E    K +Q+ GDLLNLGEDA
Sbjct  350   KESNHGEDEEEDMNAMKAL-PPPEGFVEENNNKEKEPVKEEQIKKPQQEEGDLLNLGEDA  408

Query  702   PTPEEHANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFP  523
              +  EHA++LALALF+G              WEAF    DWE ALVQ+ASHLSNQKA   
Sbjct  409   VSSNEHADKLALALFNG---ATEQAPAGPPAWEAFANEADWEAALVQSASHLSNQKASLG  465

Query  522   GNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADA---  352
             G FD L+LDG+Y+Q  ++ A+A  G   +GSA+SVA GSAGRPAMLALPAPP S+ +   
Sbjct  466   GGFDLLLLDGLYQQAEVSAAMAGPGYGVSGSASSVALGSAGRPAMLALPAPPPSSSSSSL  525

Query  351   ---NTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
                + ++   DPFAASL V PP+YVQMS+LE+KQ+LL +EQ MW QY +DGM GQ+GL K
Sbjct  526   DHPSKSSVHVDPFAASLVVPPPSYVQMSDLERKQKLLMDEQLMWHQYARDGMQGQIGLTK  585

Query  180   AQQSSQPH---NYYGY  142
              Q +  PH   N  GY
Sbjct  586   LQHN--PHHNINMGGY  599



>ref|XP_010260538.1| PREDICTED: putative clathrin assembly protein At1g03050 [Nelumbo 
nucifera]
Length=582

 Score =   417 bits (1073),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 249/482 (52%), Positives = 316/482 (66%), Gaps = 20/482 (4%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLN+SDFRD   SN WDYSAFVRTY+LYLD+++E RMQ +R +  A      
Sbjct  110   FATRRGTRLLNLSDFRDGCHSNSWDYSAFVRTYALYLDQRIEFRMQGKRSRSKA------  163

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                    E           +  TP+ EMK E +++RIQH  Q L+RFLAC+PTG A+ NR
Sbjct  164   ----ARKEVAGEEPKAPTSLRSTPVREMKTERIFNRIQHLQQFLERFLACRPTGEARTNR  219

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY VVKESFQ+YY IAE++ ILVDRFM+ ++P+  KVHEIF R++KQ++EL+ F+
Sbjct  220   IVIVALYPVVKESFQIYYDIAEVVAILVDRFMEFEVPNCVKVHEIFTRLSKQFEELDKFF  279

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
             +W K+ G++R SEYP+VE    +KL  M+E+IR+K  ++  R +   +    V   E+ E
Sbjct  280   SWCKSVGVARSSEYPEVEKITSKKLQFMDELIRDKSIISQSRKI-RNQEIQTVIVEEQTE  338

Query  855   peaeaeEDMNTIKALPPPPE--DFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHA  682
              + E  EDM T KALPPP E  + I E        +E  EQ   DLLNL +++ T E+ A
Sbjct  339   EDEEVVEDMTTTKALPPPEESSEDIVEEVKELEVVQESNEQQEVDLLNLFDESVTVEDQA  398

Query  681   NQLALALFDGiptidptkttittPWEAFNG--SEDWETALVQTASHLSNQKAQFPGNFDE  508
             ++LALALFDG      ++    TPWEAFN   S DWETALV++ASHLSNQK +  G F+ 
Sbjct  399   DKLALALFDGGCASASSEPAAATPWEAFNSDDSTDWETALVESASHLSNQKMELGGGFNM  458

Query  507   LMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGR-pamlalpappssADANTTASGA  331
             LMLDGMY+Q A + A  S     TGSA+SVAFGS G    +     P S  DA  T SG 
Sbjct  459   LMLDGMYQQQAASNATMSH-YGATGSASSVAFGSVGMPAMLALPAPPASGDDATATTSGG  517

Query  330   DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNY  151
             DPFAASLSV PP+YVQMSE+EKKQ+LL EEQ MWQQY KDGM G V     Q S  P+N 
Sbjct  518   DPFAASLSVLPPSYVQMSEMEKKQKLLVEEQLMWQQYAKDGMQGHVPGTNLQVS--PYNV  575

Query  150   YG  145
              G
Sbjct  576   GG  577



>ref|XP_008339314.1| PREDICTED: putative clathrin assembly protein At1g03050 [Malus 
domestica]
Length=601

 Score =   416 bits (1069),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 265/495 (54%), Positives = 339/495 (68%), Gaps = 26/495 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             F+TRRGTR LNMSDFRD SRSN WD+SAFVRTY+LYLD+++E RMQ+RRGK SA     +
Sbjct  111   FSTRRGTRFLNMSDFRDTSRSNSWDHSAFVRTYALYLDQRLEFRMQSRRGKRSAFGFDED  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                 +E+    T   +      TP+ EMK + L+SR+QH  Q+L+RFL C+PTG AK NR
Sbjct  171   IEDPQEEANNFTNQQS--CQRATPVHEMKADKLFSRMQHLQQLLERFLGCRPTGVAKNNR  228

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V VALY +VKESFQ+Y  I E++GIL+DRFM+L+IPD  KV+EIF R+ KQ+DEL++FY
Sbjct  229   VVXVALYAIVKESFQIYNDITEIMGILIDRFMELEIPDCAKVYEIFCRIGKQFDELDMFY  288

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGR-----IMrsrepspevee  871
              W K  GI+R SEYP+VE    +KL++M++ IR+K  +A G+     ++  ++     ++
Sbjct  289   GWCKQIGIARSSEYPEVEKITPKKLEVMDDYIRDKSALAQGKRSVKALLDQQKIDEANKD  348

Query  870   veepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEA-PTEE----KKEQDIGDLLNLGED  706
              E      E EEDMN + AL PPPE F+EE    E  P +E    K +Q+ GDLLNLGED
Sbjct  349   EESNHGGEEEEEDMNAMXAL-PPPEGFVEESNNKEIEPVKEEEIKKPQQEEGDLLNLGED  407

Query  705   APTPEEHANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQF  526
             A +  EHA++LALALF+G              WEAF    DWETALVQ+ASHLSNQKA  
Sbjct  408   ALSSNEHADKLALALFNG---ATEQAPAGLPAWEAFADEADWETALVQSASHLSNQKASL  464

Query  525   PGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANT  346
              G FD L+LDGMY+Q  ++ A+A  G   +GSA+SVA GSAGRPAMLALPAPP+S+ ++ 
Sbjct  465   GGGFDLLLLDGMYQQAEISAAMAGPGYGVSGSASSVALGSAGRPAMLALPAPPTSSSSSN  524

Query  345   TASG----ADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKA  178
               S      DPFAASL V PP+YVQMS+LEKKQ+LL +EQ MWQQY + GM GQVGL K 
Sbjct  525   HPSXSNVHVDPFAASLVVPPPSYVQMSDLEKKQKLLMDEQFMWQQYARGGMQGQVGLTKL  584

Query  177   QQSSQPH---NYYGY  142
             Q +  PH   N  GY
Sbjct  585   QHN--PHHNINMGGY  597



>ref|XP_006432449.1| hypothetical protein CICLE_v10000680mg [Citrus clementina]
 gb|ESR45689.1| hypothetical protein CICLE_v10000680mg [Citrus clementina]
Length=583

 Score =   414 bits (1063),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 261/488 (53%), Positives = 333/488 (68%), Gaps = 30/488 (6%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             F+TRRGTRLLNMSDFRD SRSN WDYSAFVRTY+LYLDE++E RMQ RRGK S       
Sbjct  111   FSTRRGTRLLNMSDFRDTSRSNSWDYSAFVRTYALYLDERLEFRMQGRRGKRSMFG----  166

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                   DE+EE  ++       TP+ +MK E+L+SRIQH  Q+L+RFLAC+PTG+AK NR
Sbjct  167   -----IDEDEEEASSAPACARATPVRDMKIEHLFSRIQHLQQVLERFLACRPTGSAKNNR  221

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY VVKESFQ+YY I E+LGIL+DRFM+L++PDS KV++IF RV+KQ+DEL+ FY
Sbjct  222   VVIVALYPVVKESFQIYYDITEILGILIDRFMELEVPDSVKVYDIFCRVSKQYDELDSFY  281

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRI---Mrsrepspeveeve  865
              W K  GI+R SEYP+VE    +KL++M++ IR+K  +A  +     +      + ++  
Sbjct  282   GWCKTVGIARSSEYPEVERITYKKLELMDDFIRDKSALAQSKKNVDFQLTNEPEQEQDDN  341

Query  864   epepeaeaeEDMNTIKALPPPPEDF--IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPE  691
             + + E   +EDMN  KALP P E     EE        E K  +   DLLNLGED+ T +
Sbjct  342   DKDAETTNQEDMNETKALPAPEESTPAEEEKKEENVKQETKDTEKEADLLNLGEDSATCD  401

Query  690   EHANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQFPGNF  514
             E A++LALALFD             T WEAF + + DWETALVQ+AS+L++Q A   G F
Sbjct  402   EQADKLALALFDSGNAPVDQAGAGRTAWEAFKDETADWETALVQSASNLNHQTAALGGGF  461

Query  513   DELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASG  334
             D L+LDGMY+QGA   AVA +    +GSA+SVA GSAGRPAMLALPA        TT +G
Sbjct  462   DMLLLDGMYQQGA--TAVAMASAEASGSASSVALGSAGRPAMLALPA------PPTTQAG  513

Query  333   A----DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSS  166
             A    DPFAAS +VAPP +VQMS+LEKKQ+LL EEQ MWQQY +DGM GQ+G+ K Q ++
Sbjct  514   ATLPTDPFAASCAVAPPPFVQMSDLEKKQKLLVEEQLMWQQYARDGMQGQLGITKLQPNT  573

Query  165   QPHNYYGY  142
               +N  GY
Sbjct  574   --YNMGGY  579



>ref|XP_006494069.1| PREDICTED: putative clathrin assembly protein At1g03050-like 
[Citrus sinensis]
Length=583

 Score =   413 bits (1062),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 262/488 (54%), Positives = 335/488 (69%), Gaps = 30/488 (6%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             F+TRRGTRLLNMSDFRD SRSN WDYSAFVRTY+LYLDE++E RMQ RRGK S       
Sbjct  111   FSTRRGTRLLNMSDFRDTSRSNSWDYSAFVRTYALYLDERLEFRMQGRRGKRSMFG----  166

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                   DE+EE  ++       TP+ +MK E+L+SRIQH  Q+L+RFLAC+PTG+AK NR
Sbjct  167   -----IDEDEEEASSAPACARATPVRDMKIEHLFSRIQHLQQVLERFLACRPTGSAKNNR  221

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY VVKESFQ+YY I E+LGIL+DRFM+L++PDS KV++IF RV+KQ+DEL+ FY
Sbjct  222   VVIVALYPVVKESFQIYYDITEILGILIDRFMELEVPDSVKVYDIFCRVSKQYDELDSFY  281

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRI---Mrsrepspeveeve  865
             +W K  GI+R SEYP+VE    +KL++M++ IR+K  +A  +     +      + ++  
Sbjct  282   SWCKTVGIARSSEYPEVERITYKKLELMDDFIRDKSALAQSKQNVDFQLTNEPEQEQDDN  341

Query  864   epepeaeaeEDMNTIKALPPPPEDF--IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPE  691
             + + E   +EDMN  KALP P E     EE        E K  +   DLLNLGED+ T +
Sbjct  342   DKDAETTNQEDMNETKALPAPEESTPAEEEKKEENVKQETKDTEKEADLLNLGEDSATCD  401

Query  690   EHANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQFPGNF  514
             E A++LALALFD             T WEAF + + DWE ALVQ+AS+L++Q A   G F
Sbjct  402   EQADKLALALFDSDNAPVDQAAAGRTAWEAFKDETADWEMALVQSASNLNHQTAALGGGF  461

Query  513   DELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASG  334
             D L+LDGMY+QGA   AVA +    +GSA+SVA GSAGRPAMLALPAPP      TT +G
Sbjct  462   DMLLLDGMYQQGA--TAVAMASAEASGSASSVALGSAGRPAMLALPAPP------TTQAG  513

Query  333   A----DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSS  166
             A    DPFAAS +VAPP +VQMS+LEKKQ+LL EEQ MWQQY +DGM GQ+G+ K Q ++
Sbjct  514   ATLPTDPFAASCAVAPPPFVQMSDLEKKQKLLVEEQLMWQQYARDGMQGQLGITKLQPNT  573

Query  165   QPHNYYGY  142
               +N  GY
Sbjct  574   --YNMGGY  579



>ref|XP_010030073.1| PREDICTED: putative clathrin assembly protein At1g03050 [Eucalyptus 
grandis]
 gb|KCW57033.1| hypothetical protein EUGRSUZ_I02696 [Eucalyptus grandis]
Length=591

 Score =   412 bits (1060),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 261/488 (53%), Positives = 345/488 (71%), Gaps = 22/488 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLN+SDFRD SRSN WD+SAFVRTY+LYLDE++E RMQ RRGK SA      
Sbjct  111   FATRRGTRLLNLSDFRDTSRSNSWDHSAFVRTYALYLDERLEYRMQGRRGKRSAYG----  166

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                 +++E E+        V  TP+ EMK E ++S++ H  Q+L+RFLACKPTG AK NR
Sbjct  167   ---VDDEEGEDNAGIVPAAVKATPVREMKIEQIFSKMHHLQQLLERFLACKPTGGAKDNR  223

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V VALY +VKESFQ+YY + E++GIL+DRFM+L+IPD  KV+EIF R  KQ++EL++FY
Sbjct  224   VVFVALYPIVKESFQIYYEMTEIMGILIDRFMELEIPDCVKVYEIFSRTGKQFEELDIFY  283

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
              WSK  G++R ++YP+VE   ++KLD+M+E I++K  +A G+   S E   E    E  +
Sbjct  284   GWSKNVGVARSADYPEVEKVTQKKLDLMDEFIKDKSALARGKREGSVEQKNETPVQETSK  343

Query  855   peaeaeEDMNTIKALPPPPEDFIE-----EMAVVEAPTEEKKEQDI---GDLLNLGEDAP  700
                E EED N +KAL P PE+ +E     + A    P +E+K+ ++   GDLLNLG+DA 
Sbjct  344   EANEEEEDPNAVKAL-PAPENLMEASTGDQDAESLEPKQEEKKANVQLEGDLLNLGDDAV  402

Query  699   TPEEHANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQFP  523
             T EEH ++LALALFDG  T     TT  +PWEAF + + DWE ALV++AS+L+NQK    
Sbjct  403   TREEHGDKLALALFDG-GTPTSVATTTASPWEAFSDNTPDWEAALVESASNLTNQKKALG  461

Query  522   GNFDELMLDGMYRQGALNQAVASS-GVLTTGSATSVAFGSAGRpamlalpappssADANT  346
             G FD L+L+GMY +G +  A+  + G  ++GSA+SVA GSAGRPAMLALPAPP+S  +N 
Sbjct  462   GGFDMLLLEGMYHRGTMVAAMGGTAGNGSSGSASSVALGSAGRPAMLALPAPPTSEGSN-  520

Query  345   TASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSS  166
               +G+DPF ASL+VAPP YVQMSE+EKKQ+LL EEQ MWQQY  +G  GQVG+    Q++
Sbjct  521   MPTGSDPFMASLAVAPPPYVQMSEMEKKQKLLMEEQMMWQQYANNGRQGQVGVTNV-QAN  579

Query  165   QPHNYYGY  142
              P+N  GY
Sbjct  580   YPYNTGGY  587



>ref|XP_004155511.1| PREDICTED: LOW QUALITY PROTEIN: putative clathrin assembly protein 
At1g03050-like [Cucumis sativus]
Length=591

 Score =   412 bits (1058),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 247/475 (52%), Positives = 330/475 (69%), Gaps = 22/475 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             F+TRRGTR LNMSDFRD S+SN WDYSAFVRTY+LYLDE++E RMQ+RRG+ SA    N 
Sbjct  111   FSTRRGTRFLNMSDFRDTSQSNSWDYSAFVRTYALYLDERLEFRMQSRRGRRSAFGEDNN  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             +    ++E+       AI+V  TP+ +M +E ++SR QH  Q+L+RFLAC+PTGAAK NR
Sbjct  171   DNDNNDEEDHSK----AIIVRATPMRDMTSEQIFSRTQHLQQLLERFLACRPTGAAKNNR  226

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +VLVALY VV+ESFQ+YY I E++GIL+DRFM L++ D  KV+EIF RV KQ+DELE+FY
Sbjct  227   VVLVALYPVVRESFQIYYDITEIMGILIDRFMDLNVQDCVKVYEIFCRVGKQFDELEMFY  286

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
             +W +  GI+R +EYP+VE    +KL++M+E I+++  +A  +  R +    E+ E E  E
Sbjct  287   SWCRTIGIARSAEYPEVEKITPKKLEVMDEFIKDRSALAQCQNDREKPNLNEITEEEHKE  346

Query  855   peaeaeEDMNTIKALPPPPEDFIEEMAVV-----------EAPTEEKKEQDIGDLLNLGE  709
              E E E D+N+IKALPPP +   EE+  +           +   ++     +GDLLNLGE
Sbjct  347   EEEEEEVDVNSIKALPPPEDIKEEEITAIEVEEEEKEIKEDEMKKDNDNSMMGDLLNLGE  406

Query  708   D-APTPEEHANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTASHLSNQK  535
             + A   E +A++LA ALFDG  +     +    PW+AFN  S DWETALVQ+ASHL NQK
Sbjct  407   EHAMIREANADKLATALFDG--SGPVDSSVKALPWQAFNDDSADWETALVQSASHLPNQK  464

Query  534   AQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamla--lpappss  361
             A   G FD L+LDGMY+Q A+   +A SG   +GSA+S+A GSAGRPAMLA   P  P  
Sbjct  465   ADLGGGFDMLLLDGMYKQTAVKSTMAGSGYGVSGSASSMALGSAGRPAMLALPAPTTPEG  524

Query  360   ADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQ  196
             +  ++++  +DPFAAS++VAPP YVQMSE+E+KQ+LL EEQ MWQQY +DG   Q
Sbjct  525   SGTSSSSVVSDPFAASVAVAPPPYVQMSEMERKQKLLVEEQLMWQQYARDGRQIQ  579



>ref|XP_010694962.1| PREDICTED: putative clathrin assembly protein At1g03050 [Beta 
vulgaris subsp. vulgaris]
Length=606

 Score =   410 bits (1055),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 252/483 (52%), Positives = 330/483 (68%), Gaps = 19/483 (4%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDSRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKH---------  1420
             F TRRGTR+LNMSDFRDSRSN WDYSAFVR Y+LYLDE++E +MQ RR  H         
Sbjct  108   FTTRRGTRMLNMSDFRDSRSNSWDYSAFVRMYALYLDERLEYKMQGRRKPHHHSTRAYLY  167

Query  1419  SALASgneegveeedeeeetgntTAIVVTGTPI--TEMKNEYLYSRIQHYIQILDRFLAC  1246
             S      EE  ++E  ++   ++ +   T TP+  +++  E + S++ H  Q+L+RFLA 
Sbjct  168   SNEQQQQEERYQQEQYQDNNSSSVSSSSTRTPMPNSDLTLEQILSKMHHLQQLLERFLAT  227

Query  1245  KPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVA  1066
             +PTG+AK NR+V+VALY  V++SFQ+YY I ++LGIL+D+FM++DIPD  KVHEIF R++
Sbjct  228   RPTGSAKHNRIVIVALYSAVRDSFQIYYDITDILGILIDQFMEIDIPDCIKVHEIFCRIS  287

Query  1065  KQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsreps  886
             KQ+DEL+ +Y W K  G+ R SEYPDVE   ++KLD+M+E IR+K   A  + +   +  
Sbjct  288   KQFDELDSYYLWCKDIGVVRSSEYPDVERITQKKLDLMDEFIRDKAANAKHK-LAIMDRR  346

Query  885   peveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDI----GDLLN  718
              E +E E    E +  EDMNTIKALPP  E F  E    + P  +KK+++      DLLN
Sbjct  347   EEEKEPEPVSQEDKEPEDMNTIKALPPA-EGFPPEEEEEKEPEPDKKDEEPEPKEADLLN  405

Query  717   LGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQ  538
             LG+DAPT EEH ++LALALFDG              WE FN + DWETALVQ+AS+L +Q
Sbjct  406   LGDDAPTSEEHGDKLALALFDGAMGDASGPAPPPM-WEVFNDNSDWETALVQSASYLPHQ  464

Query  537   KAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssA  358
             K    G FD ++LDGMY+QG  N A+A++ V  +GSA+SVA GS G P +LALPAPPSS+
Sbjct  465   KPSLGGGFDTMLLDGMYQQGVTNAAIAANRVGGSGSASSVALGSIGNPQLLALPAPPSSS  524

Query  357   DANTTASG-ADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
              ++T ++G  DPFAASL VAPP +VQMSELEKKQR L EEQ MWQQY +DGM G V L K
Sbjct  525   GSDTISTGNVDPFAASLGVAPPPFVQMSELEKKQRRLVEEQLMWQQYQRDGMQGHVALSK  584

Query  180   AQQ  172
              QQ
Sbjct  585   IQQ  587



>ref|XP_010522755.1| PREDICTED: putative clathrin assembly protein At1g03050 [Tarenaya 
hassleriana]
 ref|XP_010522756.1| PREDICTED: putative clathrin assembly protein At1g03050 [Tarenaya 
hassleriana]
Length=607

 Score =   409 bits (1052),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 254/499 (51%), Positives = 336/499 (67%), Gaps = 25/499 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGK---HSALAS  1405
             FATRRGTRLLNMSDFRD SRSN WDYSAFVRTY+LYLDE+++ RMQ R GK   +S    
Sbjct  112   FATRRGTRLLNMSDFRDASRSNSWDYSAFVRTYALYLDERLDFRMQGRHGKRGIYSVSEE  171

Query  1404  gneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAK  1225
               +   + + + EE+  ++AIVV   PI+EMK E +++R+ H  Q+LDRFLAC+PTG+A+
Sbjct  172   EEDRDHDRDRDREESDLSSAIVVRSMPISEMKTEQIFTRVHHLQQLLDRFLACRPTGSAR  231

Query  1224  RNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELE  1045
              NR+V+VALY +VKESFQ+YY I E+LGIL+DRFM+LDIP+S KV++IF RV+KQ+DEL+
Sbjct  232   NNRVVVVALYPIVKESFQIYYDITEILGILIDRFMELDIPNSIKVYDIFCRVSKQFDELD  291

Query  1044  VFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeve  865
               +TW K  GI+R SEYP+VE   ++KLD+M+E IR+K  +   +       S   E  E
Sbjct  292   SCFTWYKNMGIARSSEYPEVEKITQKKLDLMDEFIRDKSALVQTQ-KTKSLKSEADEGSE  350

Query  864   epepeaeaeEDMNTIKALPPPPEDFIEEMAV--------VEAPTEEKKEQDIGDLLNLGE  709
             + + E+EA+EDMN+IKALP PP    E            +E   +++++Q  GDLLNL  
Sbjct  351   KADNESEAQEDMNSIKALPEPPPKVQEPENEQETEEGLEIEKQNQQQQQQQEGDLLNLA-  409

Query  708   DAPTPEEHANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKA  532
             D        + LALALFDG      ++T    PWEAF + + DWETALVQ+ ++LS QK 
Sbjct  410   DTAGETSGGDSLALALFDG----AVSETATAPPWEAFKDDAADWETALVQSETNLSGQKT  465

Query  531   QFPGNFDELMLDGMYRQGALNQAV-ASSGVLTTGSATSVAFGSAGRpamlalpappssAD  355
             Q  G FD L+LDGMY+ GA   AV AS+    +GSA+SVAFGSAGRPA   L  P     
Sbjct  466   QLGGGFDMLLLDGMYQHGATTAAVNASTAYGASGSASSVAFGSAGRPAPTMLALPAPPPT  525

Query  354   ANTTASGA-----DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVG  190
              N+  +G+     DPFAASL+VAPP YVQM ++EKKQRLL EEQ MW+QY+KDG  G +G
Sbjct  526   GNSNGNGSGPVNLDPFAASLAVAPPPYVQMQDMEKKQRLLKEEQIMWEQYSKDGKQGHLG  585

Query  189   LEKAQQSSQPHNYYGY*YS  133
               +    + P++   + YS
Sbjct  586   FRQNLNPNFPYSPSPFSYS  604



>ref|XP_003524077.1| PREDICTED: putative clathrin assembly protein At4g02650-like 
[Glycine max]
Length=585

 Score =   408 bits (1048),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 258/484 (53%), Positives = 329/484 (68%), Gaps = 32/484 (7%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFR-DSRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHS--ALASg  1402
             F+TRRGTRLLNMSDFR +S+ N WD+ AFVRTY+LYLDE++E  MQN+RGK S  A+   
Sbjct  111   FSTRRGTRLLNMSDFRGNSKYNSWDFCAFVRTYALYLDERLEYMMQNKRGKRSRFAIDEE  170

Query  1401  neegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKR  1222
              EE +E E            ++  TP+ EMK E L+S++QH   +++RFLAC+PTG AK 
Sbjct  171   EEETMERESRYSREREKNREILKVTPLCEMKTEELFSKMQHLQLLVERFLACRPTGRAKT  230

Query  1221  NRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEV  1042
             +R+V+VALY +VKESFQ+Y +I E+L I +DRF+ +++PD  KV++IF RV KQ+DEL++
Sbjct  231   HRIVIVALYPIVKESFQIYDNITEILCIFIDRFIGMELPDCIKVYDIFCRVGKQYDELDL  290

Query  1041  FYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveevee  862
             FY+WSK+ GI+R +EYP++E    +KL++M             + +R +    ++   EE
Sbjct  291   FYSWSKSVGIARSTEYPEIERVTTKKLEVM------------DQYIRDKAQHKKLYIQEE  338

Query  861   pepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPT------EEKKEQDIGDLLNLGEDAP  700
                E E EEDMN IKAL P PE F EE   V+  T      EEK  Q  GDLLNLG+D  
Sbjct  339   NNEEEEPEEDMNAIKAL-PAPEYFNEEPEEVKEETKEEDIKEEKLVQTEGDLLNLGDDMV  397

Query  699   TPEEHANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFPG  520
             T +EH + LALALFDG     PT  T   PW AF+ + DWETALVQ++S+LSNQK    G
Sbjct  398   TSQEHGDSLALALFDG---ALPTSATQALPWHAFDDAADWETALVQSSSNLSNQKPSLGG  454

Query  519   NFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTA  340
              FD L+LDGMYRQ A N    S G+   GSA+SVA GSAGRPAMLALPAPP+S   ++  
Sbjct  455   GFDTLLLDGMYRQAATNMQRQSHGM--NGSASSVALGSAGRPAMLALPAPPTSGSGSSLD  512

Query  339   SGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQP  160
             S ADPFAASL+VAPPAYVQMSE+EKKQRLL EEQ+MWQQY + GM G V   K     QP
Sbjct  513   S-ADPFAASLAVAPPAYVQMSEIEKKQRLLMEEQEMWQQYARSGMQGNVAFTKL----QP  567

Query  159   HNYY  148
             +N Y
Sbjct  568   NNTY  571



>gb|KHN28501.1| Putative clathrin assembly protein [Glycine soja]
Length=585

 Score =   407 bits (1047),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 258/484 (53%), Positives = 329/484 (68%), Gaps = 32/484 (7%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFR-DSRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHS--ALASg  1402
             F+TRRGTRLLNMSDFR +S+ N WD+ AFVRTY+LYLDE++E  MQN+RGK S  A+   
Sbjct  111   FSTRRGTRLLNMSDFRGNSKYNSWDFCAFVRTYALYLDERLEYMMQNKRGKRSRFAIDEE  170

Query  1401  neegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKR  1222
              EE +E E            ++  TP+ EMK E L+S++QH   +++RFLAC+PTG AK 
Sbjct  171   EEETMERESRYSREREKNREILKVTPLCEMKTEELFSKMQHLQLLVERFLACRPTGRAKT  230

Query  1221  NRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEV  1042
             +R+V+VALY +VKESFQ+Y +I E+L I +DRF+ +++PD  KV++IF RV KQ+DEL++
Sbjct  231   HRIVIVALYPIVKESFQIYDNITEILCIFIDRFIGMELPDCIKVYDIFCRVGKQYDELDL  290

Query  1041  FYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveevee  862
             FY+WSK+ GI+R +EYP++E    +KL++M             + +R +    ++   EE
Sbjct  291   FYSWSKSVGIARSTEYPEIERVTTKKLEVM------------DQYIRDKAQHKKLYIQEE  338

Query  861   pepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPT------EEKKEQDIGDLLNLGEDAP  700
                E E EEDMN IKAL P PE F EE   V+  T      EEK  Q  GDLLNLG+D  
Sbjct  339   NNEEEEPEEDMNAIKAL-PAPEYFHEEPEEVKEETKEEDIKEEKLVQTEGDLLNLGDDMV  397

Query  699   TPEEHANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFPG  520
             T +EH + LALALFDG     PT  T   PW AF+ + DWETALVQ++S+LSNQK    G
Sbjct  398   TSQEHGDSLALALFDG---ALPTSATQALPWHAFDDAADWETALVQSSSNLSNQKPSLGG  454

Query  519   NFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTA  340
              FD L+LDGMYRQ A N    S G+   GSA+SVA GSAGRPAMLALPAPP+S   ++  
Sbjct  455   GFDTLLLDGMYRQAATNMQRQSHGM--NGSASSVALGSAGRPAMLALPAPPTSGSGSSLD  512

Query  339   SGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQP  160
             S ADPFAASL+VAPPAYVQMSE+EKKQRLL EEQ+MWQQY + GM G V   K     QP
Sbjct  513   S-ADPFAASLAVAPPAYVQMSEIEKKQRLLMEEQEMWQQYARSGMQGNVAFTKL----QP  567

Query  159   HNYY  148
             +N Y
Sbjct  568   NNTY  571



>ref|XP_004137043.1| PREDICTED: LOW QUALITY PROTEIN: putative clathrin assembly protein 
At1g03050-like [Cucumis sativus]
Length=592

 Score =   408 bits (1048),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 246/476 (52%), Positives = 329/476 (69%), Gaps = 23/476 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             F+TRRGTR LNMSDFRD S+SN WDYSAFVRTY+LYLDE++E RMQ+RRG+ SA    N 
Sbjct  111   FSTRRGTRFLNMSDFRDTSQSNSWDYSAFVRTYALYLDERLEFRMQSRRGRRSAFGEDNN  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             +    ++E+       AI+V  TP+ +M +E ++SR QH  Q+L+RFLAC+PTGAAK NR
Sbjct  171   DNDNNDEEDHSK----AIIVRATPMRDMTSEQIFSRTQHLQQLLERFLACRPTGAAKNNR  226

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +VLVALY VV+ESFQ+YY I E++GIL+DRFM L++ D  KV+EIF RV KQ+DELE+FY
Sbjct  227   VVLVALYPVVRESFQIYYDITEIMGILIDRFMDLNVQDCVKVYEIFCRVGKQFDELEMFY  286

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRI-Mrsrepspeveeveep  859
             +W +  GI+R +EYP+VE    +KL++M+E I+++  +A  +      +P  E+ E E  
Sbjct  287   SWCRTIGIARSAEYPEVEKITPKKLEVMDEFIKDRSALAQCQNDREKTQPQLEITEEEHK  346

Query  858   epeaeaeEDMNTIKALPPPPEDFIEEMAVV-----------EAPTEEKKEQDIGDLLNLG  712
             E   E E D+N+IKALPPP +   EE+  +           +   ++     +GDLLNLG
Sbjct  347   EEXKEEEVDVNSIKALPPPEDIKEEEITAIEVEEEEKEIKEDEMKKDNDNSMMGDLLNLG  406

Query  711   ED-APTPEEHANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTASHLSNQ  538
             E+ A   E +A++LA ALFDG  +     +    PW+AFN  S DWETALVQ+ASHL NQ
Sbjct  407   EEHAMIREANADKLATALFDG--SGPVDSSVKALPWQAFNDDSADWETALVQSASHLPNQ  464

Query  537   KAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamla--lpapps  364
             KA   G FD L+LDGMY+Q A+   +A SG   +GSA+S+A GSAGRPAMLA   P  P 
Sbjct  465   KADLGGGFDMLLLDGMYKQTAVKSTMAGSGYGVSGSASSMALGSAGRPAMLALPAPTTPE  524

Query  363   sADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQ  196
              +  ++++  +DPFAAS++VAPP YVQMSE+E+KQ+LL EEQ MWQQY +DG   Q
Sbjct  525   GSGTSSSSVVSDPFAASVAVAPPPYVQMSEMERKQKLLVEEQLMWQQYARDGRQIQ  580



>ref|XP_006418272.1| hypothetical protein EUTSA_v10007148mg [Eutrema salsugineum]
 gb|ESQ36625.1| hypothetical protein EUTSA_v10007148mg [Eutrema salsugineum]
Length=593

 Score =   405 bits (1040),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 251/486 (52%), Positives = 334/486 (69%), Gaps = 17/486 (3%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD SRSN WDYSAFVRTY+LYLDE+++ RMQ R GK   +     
Sbjct  112   FATRRGTRLLNMSDFRDVSRSNSWDYSAFVRTYALYLDERLDFRMQARHGKR-GVYCVGG  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             E  E+E +      +TAIVV   PI EMK E +++R+QH  Q+LDRFLAC+PTG A+ NR
Sbjct  171   ETEEDEQDNPAADLSTAIVVRSQPIAEMKTEQIFTRVQHLQQLLDRFLACRPTGTARNNR  230

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VKESFQ+YY + E++GIL+DRFM+LDIPDS KV++IF RV+KQ++EL+ FY
Sbjct  231   VVIVALYPIVKESFQIYYDVTEIMGILIDRFMELDIPDSIKVYDIFCRVSKQFEELDQFY  290

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
             +W K  GI+R SEYP++E   ++KLD+M+E IR+K  +   +       S E ++    E
Sbjct  291   SWCKNMGIARSSEYPEIEKITQKKLDLMDEFIRDKSALEQTK-KSKSVKSDEEDDDARTE  349

Query  855   peaeaeEDMNTIKALPPPPEDFIEEMAVVEAP----TEEKKEQDIGDLLNLGE-DAPTPE  691
                E +EDMN IKALP PP    E+    E      T EKK++++GDLLNL + +     
Sbjct  350   EVNEEQEDMNAIKALPEPPPKEEEDAKPEEEAKEEVTVEKKQEEVGDLLNLVDINGVEAT  409

Query  690   EHANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQFPGNF  514
             E  + LALALFDG P    + +     WEAF + S DWETALVQ+A++LS QK +  G F
Sbjct  410   ETGDSLALALFDG-PYASGSGSESGPGWEAFKDDSADWETALVQSATNLSGQKTELGGGF  468

Query  513   DELMLDGMYRQGALNQAVASSGVL-TTGSATSVAFGSAGRpamlalpappssADANTTAS  337
             D L+L+GMY+ GA++ AV +S     +GSA+S+AFGSAGRPA   L  P  +  AN  ++
Sbjct  469   DMLLLNGMYQHGAVSAAVKNSTAYGASGSASSMAFGSAGRPAATMLALPAPAT-ANGNSN  527

Query  336   G---ADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSS  166
             G    DPFAASL VAPP YVQM+++EKKQR+L EEQ MW QY+++G  G + L ++Q  +
Sbjct  528   GPVPMDPFAASLVVAPPPYVQMNDMEKKQRMLMEEQMMWHQYSREGRQGHMNLRQSQ--N  585

Query  165   QPHNYY  148
             QP+  Y
Sbjct  586   QPNYSY  591



>ref|XP_008455244.1| PREDICTED: putative clathrin assembly protein At1g03050 [Cucumis 
melo]
Length=609

 Score =   405 bits (1041),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 253/491 (52%), Positives = 336/491 (68%), Gaps = 36/491 (7%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALA----  1408
             F+TRRGTR LNMSDFRD S SN WDYSAFVRTY+LYLDE++E RMQ+RRG+ SA      
Sbjct  111   FSTRRGTRFLNMSDFRDASLSNSWDYSAFVRTYALYLDERLEFRMQSRRGRRSAFGLDEE  170

Query  1407  -----------SgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILD  1261
                          +     + D  +E  N+ AIV+  TPI +M ++ ++SR QH  Q+L+
Sbjct  171   DEHHHHQQQNSCSSNNNNIDNDNNDEEDNSKAIVIRATPIRDMTSDQIFSRTQHLQQLLE  230

Query  1260  RFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEI  1081
             RFLAC+PTGAAK NR+VLVALY +V+ESFQ+YY I E++GIL+DRFM+L I D  KV+EI
Sbjct  231   RFLACRPTGAAKNNRVVLVALYPIVRESFQIYYDITEIMGILIDRFMELKIQDCVKVYEI  290

Query  1080  FHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMr  901
             F RV KQ+DELE+FY+W K  GI+R SEYP+VE    +KL++M+E I+++  +A  +   
Sbjct  291   FCRVGKQFDELELFYSWCKTIGIARSSEYPEVEKITPKKLEVMDEFIKDRSALAQCQ-KD  349

Query  900   srepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVV------------EAPT  757
               +  P++E  EE     E EEDMN++KALPPP ED  EE                +   
Sbjct  350   REKAQPQLEIAEEEHKVEEEEEDMNSVKALPPP-EDVKEEETTATEVKEEEKEIKEDEMK  408

Query  756   EEKKEQDIGDLLNLGED-APTPEEHANQLALALFDGiptidptkttittPWEAFNG-SED  583
             ++ +   +GDLLNLGE+ A   EE+A++LALALFDG   +D +   +   W+AFN  S D
Sbjct  409   KDNENSMMGDLLNLGEEHAMIREENADKLALALFDGSGPVDSSVKALP--WQAFNDESAD  466

Query  582   WETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSA  403
             WE+ALVQ+AS+LSNQ+A   G FD L+LDGMY+Q A+   +A SG   +GSA+S+A GSA
Sbjct  467   WESALVQSASNLSNQRADLGGGFDMLLLDGMYKQTAVKSTMAGSGYGVSGSASSMALGSA  526

Query  402   GRpamlalpa--ppssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMW  229
             GRPAMLALPA   P  +  ++++  +DPFAAS++VAPP YVQMSE+E+KQ+LL EEQ MW
Sbjct  527   GRPAMLALPAPPTPEGSGTSSSSVVSDPFAASVAVAPPPYVQMSEMERKQKLLVEEQLMW  586

Query  228   QQYTKDGMHGQ  196
             QQY +DG   Q
Sbjct  587   QQYARDGRQIQ  597



>ref|XP_006585453.1| PREDICTED: putative clathrin assembly protein At1g03050-like 
[Glycine max]
 gb|KHN26723.1| Putative clathrin assembly protein [Glycine soja]
Length=593

 Score =   403 bits (1035),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 258/489 (53%), Positives = 341/489 (70%), Gaps = 21/489 (4%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDS-RSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             F+TRRGTRLLNMSDFRDS +S  WD+SAFVRTY+LYLDE++E +MQ+RRGK S  +    
Sbjct  112   FSTRRGTRLLNMSDFRDSLKSGSWDFSAFVRTYALYLDERLEYKMQSRRGKRSMYS----  167

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                +E++EE E      I+V  TP+ +MK E ++S++QH   +L+RFLAC+PTG AK +R
Sbjct  168   --FDEDEEEREREKEKEIIVRSTPVRDMKLEQIFSKMQHLQLLLERFLACRPTGGAKNHR  225

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VKESFQ+YY I+E+LGIL+DRF  +D+ D  KV++IF RV KQ+DEL++F+
Sbjct  226   IVIVALYPIVKESFQIYYDISEILGILIDRFPDMDVSDCVKVYDIFCRVGKQFDELDLFF  285

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
              WSK+ GI+R SEYP++E    +KL++MEE I++K  +A   I        + +E E+  
Sbjct  286   GWSKSIGIARSSEYPEIERVTLKKLEVMEEFIKDKSALAQSNI--PEAIEYKHQEEEKEA  343

Query  855   peaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKE--QDIGDLLNLGEDAPTPEEHA  682
              E+E EED+N  KALPPPPE+ IEE         ++++  Q  GDLLNLG+D  T E H 
Sbjct  344   YESEPEEDVNATKALPPPPEEIIEEPVEEVKEEPKEEKVVQTEGDLLNLGDDMMTSEAHG  403

Query  681   NQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFPGNFDELM  502
              +LALALFDG         T   PW AF+   DWETALVQ+A++L NQK  + G FD L+
Sbjct  404   EKLALALFDGAAPAAAGGATQALPWHAFDEGGDWETALVQSATNLGNQKPTYGGGFDTLL  463

Query  501   LDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPF  322
             LDGMY+QG +N A+   G   +GSA+SVA GSAGRPAMLALPAPP+S  + + ++ +DPF
Sbjct  464   LDGMYKQGEMNAAMQGQGYGVSGSASSVALGSAGRPAMLALPAPPTSW-SGSDSNNSDPF  522

Query  321   AASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQ-------  163
             AASL+VAPP+YVQMSE+EKKQRLL EEQ MWQQY K+GM GQ  L K   ++        
Sbjct  523   AASLAVAPPSYVQMSEMEKKQRLLLEEQMMWQQYAKEGMQGQAALAKLHSNNNNNNSYTG  582

Query  162   --PHNYYGY  142
               P NY  Y
Sbjct  583   GYPQNYGNY  591



>ref|XP_006307040.1| hypothetical protein CARUB_v10008628mg [Capsella rubella]
 gb|EOA39938.1| hypothetical protein CARUB_v10008628mg [Capsella rubella]
Length=602

 Score =   400 bits (1028),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 249/489 (51%), Positives = 334/489 (68%), Gaps = 17/489 (3%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD SRSN WDYSAFVRTY+LYLDE+++ RMQ + GK   +     
Sbjct  112   FATRRGTRLLNMSDFRDVSRSNSWDYSAFVRTYALYLDERLDFRMQAKHGKR-GVYCVGG  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             E  E+E ++     +TAIVV   PI EMK E +++R+QH  Q+LDRFLAC+PTG A+ NR
Sbjct  171   ETEEDEQDQAAADLSTAIVVRSQPIAEMKTEQIFTRVQHLQQLLDRFLACRPTGNARNNR  230

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VKES+Q+YY + E++GIL+DRFM+LDIPDS KV++IF RV+KQ++EL+ FY
Sbjct  231   VVIVALYPIVKESYQIYYDVTEIMGILIDRFMELDIPDSIKVYDIFCRVSKQFEELDQFY  290

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGR-IMrsrepspeveeveep  859
             +W K  GI+R SEYP+VE   ++KLD+M+E IR+K  +   +     +  + E ++ E  
Sbjct  291   SWCKNMGIARSSEYPEVEKITQKKLDLMDEFIRDKSALEQTKNSKSVKSEADEEDDDERT  350

Query  858   epeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTE-----EKKEQDIGDLLNLGE-DAPT  697
             +   E +EDMN IKALP PP    EE    E   +     EKK++++GDLL+LG  +   
Sbjct  351   QEVNEEQEDMNAIKALPEPPSKEEEEDEKPEEEAKEEVIIEKKQEEMGDLLDLGNANGGE  410

Query  696   PEEHANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQFPG  520
               E  + LALALFDG P    + +     WEAF + S DWETALVQTA+ LS QK++  G
Sbjct  411   AAEAGDSLALALFDG-PYASGSGSESGPGWEAFKDDSADWETALVQTATKLSGQKSELGG  469

Query  519   NFDELMLDGMYRQGALNQAVASSGVL-TTGSATSVAFGSAGRpamlalpappssADANTT  343
              FD L+L+GMY+ GA+N AV +S     +GSA+S+AFGSAGRPA   L  P  +     +
Sbjct  470   GFDMLLLNGMYQHGAVNAAVKTSTAYGASGSASSMAFGSAGRPAATMLALPAPATANGNS  529

Query  342   ASGA-----DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKA  178
              +       DPFAASL VAPP YVQM+++EKKQR+L EEQ MW QY++DG  G + L + 
Sbjct  530   GNNNSPVPMDPFAASLEVAPPPYVQMNDMEKKQRMLMEEQMMWDQYSRDGRQGHMNLRQN  589

Query  177   QQSSQPHNY  151
             Q  +QP++Y
Sbjct  590   QNQNQPYSY  598



>ref|XP_009119579.1| PREDICTED: putative clathrin assembly protein At1g03050 isoform 
X1 [Brassica rapa]
Length=591

 Score =   399 bits (1025),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 251/484 (52%), Positives = 329/484 (68%), Gaps = 17/484 (4%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD SRSN WDYSAFVRTY+LYLDE+++ RMQ R GK      G  
Sbjct  112   FATRRGTRLLNMSDFRDVSRSNSWDYSAFVRTYALYLDERLDFRMQTRHGKRGVYCVGGG  171

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             + VE+E ++ E   +TAIVV   PI EMK E +++R+QH  Q+LDRFLAC+PTG A+ NR
Sbjct  172   DAVEDEKDKHEADLSTAIVVRSQPIAEMKTEKIFTRVQHLQQLLDRFLACRPTGGARNNR  231

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VKESFQ+YY I E++G+L++RFM+LDI DS KV++IF RV+KQ++EL+ FY
Sbjct  232   VVIVALYPIVKESFQIYYDITEIMGVLIERFMELDIADSIKVYDIFCRVSKQFEELDQFY  291

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
             +W K  GI+R SEYP++E   ++KLD+M+E I++K  +   +       S E ++ E  E
Sbjct  292   SWCKNMGIARSSEYPEIEKITQKKLDLMDEFIKDKSTLDQTK----ESQSVEEDDDERAE  347

Query  855   peaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTE--EKKEQDIGDLLNLGE-DAPTPEEH  685
                E EEDMN IKALP PP    EE           EKK++++GDLL+L + +     E 
Sbjct  348   EVNEEEEDMNAIKALPAPPPKEEEEEEEQPEEEVIIEKKQEEVGDLLDLVDINGNEALEA  407

Query  684   ANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTASHLSNQKAQFPGNFDE  508
              + LALALFDG P    +       WEAFN    DWETALVQTA+ LS QK +  G FD 
Sbjct  408   GDSLALALFDG-PYASGSGAETGPGWEAFNDDGADWETALVQTATKLSGQKTELGGGFDM  466

Query  507   LMLDGMYRQGALNQAVASSGVL-TTGSATSVAFGSAGRpamlalpappssADANTTASGA  331
             L+L+GMY+ G +N AV +S     +GSA+S+AFGSAGRPA   L  P  +  AN  ++G 
Sbjct  467   LLLNGMYQHGTVNAAVQTSTAYGASGSASSMAFGSAGRPAATMLALPAPAT-ANGNSNGT  525

Query  330   ---DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQP  160
                DPFAASL VAPPAYVQM+++EKKQR L EEQ MW QY+++G  G + L  +Q  ++P
Sbjct  526   VPMDPFAASLEVAPPAYVQMNDMEKKQRKLMEEQMMWDQYSREGRQGHMNL--SQNQNKP  583

Query  159   HNYY  148
                Y
Sbjct  584   SYSY  587



>ref|XP_002889433.1| hypothetical protein ARALYDRAFT_470282 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65692.1| hypothetical protein ARALYDRAFT_470282 [Arabidopsis lyrata subsp. 
lyrata]
Length=599

 Score =   399 bits (1025),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 249/488 (51%), Positives = 330/488 (68%), Gaps = 18/488 (4%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD SRSN WDYSAFVRTY+LYLDE+++ RMQ R GK   +     
Sbjct  112   FATRRGTRLLNMSDFRDVSRSNSWDYSAFVRTYALYLDERLDFRMQARHGKR-GVYCVGG  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             E  E E ++     +TAIVV   PI EMK E ++ RIQH  Q+LDRFLAC+PTG A+ NR
Sbjct  171   EAEEGEQDQAAADLSTAIVVRSQPIAEMKTEQIFIRIQHLQQLLDRFLACRPTGNARNNR  230

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VKESFQ+YY + E++GIL+DRFM+LDIPDS KV++IF RV+KQ++EL+ FY
Sbjct  231   VVIVALYPIVKESFQIYYDVTEIMGILIDRFMELDIPDSIKVYDIFCRVSKQFEELDQFY  290

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGR-IMrsrepspeveeveep  859
             +W K  GI+R SEYP++E   ++KLD+M+E IR+K  +   +        + E E+    
Sbjct  291   SWCKNMGIARSSEYPEIEKITQKKLDLMDEFIRDKSALEQTKQSKSVNSEADEEEDDART  350

Query  858   epeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTE----EKKEQDIGDLLNLGE-DAPTP  694
                 E +EDMN IKALP PP    E+    E   E    EKK++++GDLL+LG  +    
Sbjct  351   AEVNEEQEDMNAIKALPEPPPKEEEDEKPEEEAKEEVIIEKKQEEMGDLLDLGNTNGGEA  410

Query  693   EEHANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQFPGN  517
              +  + LALALFDG P    + +     WEAF + S DWETALVQTA++LS QK++  G 
Sbjct  411   AQAEDSLALALFDG-PYASGSGSESGPGWEAFKDDSADWETALVQTATNLSGQKSELGGG  469

Query  516   FDELMLDGMYRQGALNQAVASSGVL-TTGSATSVAFGSAGRpamlalpappssADANTTA  340
             FD L+L+GMY+ GA+N AV +S     +GSA+S+AFGSAGRPA   L  P  +     + 
Sbjct  470   FDMLLLNGMYQHGAVNAAVKTSTAYGASGSASSMAFGSAGRPAATMLALPAPAMANGNSG  529

Query  339   SGA-----DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQ  175
             +       DPFAASL VAPP YVQM+++EKKQR+L EEQ MW QY+++G  G + L + Q
Sbjct  530   NNNSPVPMDPFAASLEVAPPPYVQMNDMEKKQRMLMEEQIMWDQYSREGRQGHMNLRQNQ  589

Query  174   QSSQPHNY  151
               +QP++Y
Sbjct  590   --NQPYSY  595



>gb|KGN43681.1| hypothetical protein Csa_7G058550 [Cucumis sativus]
Length=618

 Score =   399 bits (1025),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 252/498 (51%), Positives = 334/498 (67%), Gaps = 41/498 (8%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALA----  1408
             F+TRRGTR LNMSDFRD S+SN WDYSAFVRTY+LYLDE++E RMQ+RRG+ SA      
Sbjct  111   FSTRRGTRFLNMSDFRDTSQSNSWDYSAFVRTYALYLDERLEFRMQSRRGRRSAFGLDEE  170

Query  1407  ------------------SgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQ  1282
                               S N E   + D  +E  ++ AI+V  TP+ +M +E ++SR Q
Sbjct  171   DEHHHHHQQQQQHINSSSSNNNEDNNDNDNNDEEDHSKAIIVRATPMRDMTSEQIFSRTQ  230

Query  1281  HYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPD  1102
             H  Q+L+RFLAC+PTGAAK NR+VLVALY VV+ESFQ+YY I E++GIL+DRFM L++ D
Sbjct  231   HLQQLLERFLACRPTGAAKNNRVVLVALYPVVRESFQIYYDITEIMGILIDRFMDLNVQD  290

Query  1101  SKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeM  922
               KV+EIF RV KQ+DELE+FY+W +  GI+R +EYP+VE    +KL++M+E I+++  +
Sbjct  291   CVKVYEIFCRVGKQFDELEMFYSWCRTIGIARSAEYPEVEKITPKKLEVMDEFIKDRSAL  350

Query  921   AGGRI-MrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTE---  754
             A  +      +P  E+ E E  E E E E D+N+IKALPPP +   EE+  +E   E   
Sbjct  351   AQCQNDREKTQPQLEITEEEHKEEEEEEEVDVNSIKALPPPEDIKEEEITAIEVEEEEKE  410

Query  753   --------EKKEQDIGDLLNLGED-APTPEEHANQLALALFDGiptidptkttittPWEA  601
                     +     +GDLLNLGE+ A   E +A++LA ALFDG   +D +   +   W+A
Sbjct  411   IKEDEMKKDNDNSMMGDLLNLGEEHAMIREANADKLATALFDGSGPVDSSVKALP--WQA  468

Query  600   FNG-SEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSAT  424
             FN  S DWETALVQ+ASHL NQKA   G FD L+LDGMY+Q A+   +A SG   +GSA+
Sbjct  469   FNDDSADWETALVQSASHLPNQKADLGGGFDMLLLDGMYKQTAVKSTMAGSGYGVSGSAS  528

Query  423   SVAFGSAGRpamla--lpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLL  250
             S+A GSAGRPAMLA   P  P  +  ++++  +DPFAAS++VAPP YVQMSE+E+KQ+LL
Sbjct  529   SMALGSAGRPAMLALPAPTTPEGSGTSSSSVVSDPFAASVAVAPPPYVQMSEMERKQKLL  588

Query  249   WEEQQMWQQYTKDGMHGQ  196
              EEQ MWQQY +DG   Q
Sbjct  589   VEEQLMWQQYARDGRQIQ  606



>ref|XP_004485543.1| PREDICTED: putative clathrin assembly protein At1g03050-like 
isoform X1 [Cicer arietinum]
 ref|XP_004485544.1| PREDICTED: putative clathrin assembly protein At1g03050-like 
isoform X2 [Cicer arietinum]
Length=597

 Score =   397 bits (1021),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 261/480 (54%), Positives = 334/480 (70%), Gaps = 9/480 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             F+TRRGTRLLNMSDFRD S+S  WD+SAFVRTYSLYLDE++E +MQ+RRGK        +
Sbjct  111   FSTRRGTRLLNMSDFRDNSKSGSWDFSAFVRTYSLYLDERLEYKMQSRRGKRGMFG--FD  168

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             E  EE D E E      +V+  TP+ EMK E ++S++QH   +L+RFLAC+PTG AK +R
Sbjct  169   EDEEERDREREGEKDKEMVMRSTPVREMKIEQIFSKMQHLQLLLERFLACRPTGGAKNHR  228

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V VALY +VKESFQ YY I+E+L IL+DRF  +D+ D  KV++IF RV KQ+DEL++FY
Sbjct  229   IVTVALYPIVKESFQTYYDISEILSILIDRFADMDVTDCVKVYDIFCRVGKQFDELDLFY  288

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
              WSK+ GI+R SEYP+++    +KL++MEE I++K  +A  +  ++     + EE E  E
Sbjct  289   GWSKSIGIARSSEYPELDKVTPKKLEVMEEFIKDKNMLAQSK--KANAQEEKNEEEEAKE  346

Query  855   peaeaeEDMNTIKAL--PPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHA  682
             PE E EED+N IKAL  P    + +EE  + E P EEK  Q  GDLLNLG+D  T EEH 
Sbjct  347   PEPEPEEDINAIKALPPPEEIAEEVEEEPIQEEPKEEKVVQTEGDLLNLGDDRVTNEEHG  406

Query  681   NQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFPGNFDELM  502
             N+LALALFDG         T   PW AF+   DWETALVQ+AS L NQK    G FD L+
Sbjct  407   NKLALALFDG-AAPTSEGGTKALPWHAFDEGADWETALVQSASSLVNQKPVLGGGFDTLL  465

Query  501   LDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASG-ADP  325
             LDGMY+Q  +N A+   G   +GSA+SVA GSAGRPAMLALPAPP+S  A+ + SG  DP
Sbjct  466   LDGMYKQREMNAAMQGPGYGVSGSASSVALGSAGRPAMLALPAPPTSGTASDSNSGYVDP  525

Query  324   FAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             FAASL++APP+YVQMSE+E+KQRLL EEQ  WQQY KD + G   L+K   +S  ++Y G
Sbjct  526   FAASLAIAPPSYVQMSEMERKQRLLVEEQLAWQQYEKDRVQGHAALKKQNPASNNNSYMG  585



>ref|XP_006396479.1| hypothetical protein EUTSA_v10028524mg [Eutrema salsugineum]
 gb|ESQ37932.1| hypothetical protein EUTSA_v10028524mg [Eutrema salsugineum]
Length=602

 Score =   397 bits (1021),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 247/481 (51%), Positives = 329/481 (68%), Gaps = 22/481 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD SRS+ WDYSAFVRTY+LYLDE+++ RMQ RRGKH      + 
Sbjct  112   FATRRGTRLLNMSDFRDASRSDSWDYSAFVRTYALYLDERLDFRMQGRRGKHG----DDS  167

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                ++  E +    + A+VV   P+TEMK E +++R+Q   Q+LDRFLAC+PTG AK NR
Sbjct  168   GEEDDHRETKTDIRSRALVVKSKPVTEMKTEKIFTRVQRLQQLLDRFLACRPTGNAKNNR  227

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V VALY +VKESFQ+YY+I E++G+L+DRFM+LDI DS KV++IF RV+KQ+DEL+ FY
Sbjct  228   VVTVALYPIVKESFQIYYNITEIMGVLIDRFMELDIHDSIKVYDIFSRVSKQFDELDPFY  287

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAG-GRIMrsrepspeveeveep  859
              W K  G++R SEYP++E   ++KLD+M+E I++K  +A   +   S++ +   E+ ++ 
Sbjct  288   GWCKNMGVARSSEYPELEKITQKKLDLMDEFIKDKSALAAQTQKSSSKKSNKSEEDEKKT  347

Query  858   epeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEE---KKEQDIGDLLNL-GEDAPTPE  691
             E   E +ED+N IKALP P  +  +E    +  +EE   +K+Q+ GDLL+L GE   T  
Sbjct  348   EEVQEIQEDLNAIKALPAPNHEEGKEETETKKDSEEVVSRKDQE-GDLLDLTGEADETAG  406

Query  690   EHANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTASHLSNQKAQFPGNF  514
                + LALALFDG      T+T     WEAFN  S DWETALV++A+ LS QK++  G F
Sbjct  407   TVGDSLALALFDG---AVATETASGPGWEAFNDDSADWETALVKSATRLSGQKSELGGGF  463

Query  513   DELMLDGMYRQGALNQAV-ASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTAS  337
             D L+LDGMY+ GA+N AV AS+   ++GSA+SVAFGSAGRPA   L  P     AN   +
Sbjct  464   DSLLLDGMYQYGAVNAAVKASTAYGSSGSASSVAFGSAGRPAASMLALPAPPQMANGNRN  523

Query  336   GA------DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQ  175
             G+      DPFAASL VAPP YVQM+++EKKQRL  EEQ MW QY ++G  G +     Q
Sbjct  524   GSKTPVTVDPFAASLEVAPPPYVQMNDMEKKQRLFIEEQIMWDQYNRNGRQGHMNFRLNQ  583

Query  174   Q  172
             Q
Sbjct  584   Q  584



>ref|XP_010481505.1| PREDICTED: putative clathrin assembly protein At1g03050 [Camelina 
sativa]
Length=602

 Score =   397 bits (1021),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 249/489 (51%), Positives = 330/489 (67%), Gaps = 17/489 (3%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD SRSN WDYSAFVRTY+LYLDE+++ RMQ R GK   +     
Sbjct  112   FATRRGTRLLNMSDFRDVSRSNSWDYSAFVRTYALYLDERLDFRMQARHGKR-GVYCIGG  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             E   +E ++     +TAIVV   PI EMK E ++ RIQH  Q+LDRFLAC+PTG A+ NR
Sbjct  171   ENDGDEKDQAAPDLSTAIVVRSQPIAEMKTEQIFIRIQHLQQLLDRFLACRPTGNARNNR  230

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY VVKESFQ+YY + E++GIL+DRFM+LDI DS KV++IF  V+KQ++EL+ FY
Sbjct  231   VVIVALYPVVKESFQIYYDVTEIMGILIDRFMELDISDSIKVYDIFCWVSKQFEELDQFY  290

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGR-IMrsrepspeveeveep  859
             +W K  GI+R SEYP+VE   ++KLD+M+E IR+K  +   +    ++  + E E     
Sbjct  291   SWCKNMGIARSSEYPEVEKITQKKLDLMDEFIRDKSALEQTKNTKSTKSEADEEEGDART  350

Query  858   epeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPT-----EEKKEQDIGDLLNLGE-DAPT  697
             E   E +EDMN IKALP PP    EE    E        E+K+E+ +GD L+LG  +   
Sbjct  351   EEVNEEQEDMNAIKALPEPPPKEEEEEKPEEEAKEEVVIEKKQEETMGDFLDLGNTNGNE  410

Query  696   PEEHANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQFPG  520
               E  + LALALFDG P    + +     WEAF + S DWETALVQTA++LS QK++  G
Sbjct  411   AAEAGDSLALALFDG-PYASGSGSDPGPGWEAFKDDSADWETALVQTATNLSAQKSELGG  469

Query  519   NFDELMLDGMYRQGALNQAVASSGVL-TTGSATSVAFGSAGRpamlalpappssADANTT  343
              FD L+L+GMY+ GA+N AV +S     +GSA+S+AFGSAGRPA   L     + +  ++
Sbjct  470   GFDMLLLNGMYQHGAVNTAVKTSTAYGASGSASSMAFGSAGRPAATMLALQAPATENGSS  529

Query  342   ASGA-----DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKA  178
              + +     DPFAASL VAPP YVQM+++EKKQR+L EEQ MW QY++DG  G + L + 
Sbjct  530   GNNSSPVPMDPFAASLEVAPPPYVQMNDMEKKQRMLMEEQMMWDQYSRDGRQGNMNLRQN  589

Query  177   QQSSQPHNY  151
             Q  +QP++Y
Sbjct  590   QNQNQPYSY  598



>ref|XP_010462543.1| PREDICTED: putative clathrin assembly protein At1g03050 [Camelina 
sativa]
Length=502

 Score =   393 bits (1010),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 246/477 (52%), Positives = 323/477 (68%), Gaps = 17/477 (4%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD SRSN WDYSAFVRTY+LYLDE+++ RMQ R GK   +     
Sbjct  10    FATRRGTRLLNMSDFRDVSRSNSWDYSAFVRTYALYLDERLDFRMQARHGKR-GVYCIGG  68

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             E   +E ++     +TAIVV   PI EMK E ++ RIQH  Q+LDRFLAC+PTG A+ NR
Sbjct  69    ETDGDEKDQAAPDLSTAIVVRSQPIAEMKTEQIFIRIQHLQQLLDRFLACRPTGNARNNR  128

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VKES Q+YY + E++GIL+DRFM+LDI DS KV++IF RV+KQ++EL+ FY
Sbjct  129   VVIVALYPIVKESCQIYYDVTEIMGILIDRFMELDISDSIKVYDIFCRVSKQFEELDQFY  188

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGR-IMrsrepspeveeveep  859
             +W K  GI+R SEYP+VE   ++KLD+M+E IR+K  +   +    ++  + E E     
Sbjct  189   SWCKNMGIARSSEYPEVEKITQKKLDLMDEFIRDKSALEQTKNTKSTKSEADEEEGDART  248

Query  858   epeaeaeEDMNTIKALPPPPEDFIEEMAVVEAP-----TEEKKEQDIGDLLNLGE-DAPT  697
             +   E +EDMN IKALP PP    EE    E        E+K+E+ +GDLL+LG  +   
Sbjct  249   DEVNEEQEDMNAIKALPEPPPKEEEEEKPEEEAKEEVVIEKKQEETMGDLLDLGNTNGGE  308

Query  696   PEEHANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQFPG  520
               E  + LALALFDG P    + +     WEAF + S DWETALVQTA++LS QK++  G
Sbjct  309   GAEAGDSLALALFDG-PYASGSGSDSGPGWEAFKDDSADWETALVQTATNLSAQKSELGG  367

Query  519   NFDELMLDGMYRQGALNQAVASSGVL-TTGSATSVAFGSAGRpamlalpappssADANTT  343
              FD L+L+GMY+ GA+N AV +S     +GSA+S+AFGSAGRPA   L  P  +     +
Sbjct  368   GFDMLLLNGMYQHGAVNTAVKTSTAYGASGSASSMAFGSAGRPAATMLALPAPATANGNS  427

Query  342   ASGA-----DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGL  187
             A+ +     DPFAASL VAPP YVQM+++EKKQR+L EEQ MW QY++DG  G + L
Sbjct  428   ANNSSPVPMDPFAASLEVAPPPYVQMNDMEKKQRMLMEEQMMWDQYSRDGRQGHMNL  484



>ref|XP_003547072.1| PREDICTED: putative clathrin assembly protein At1g03050-like 
[Glycine max]
Length=596

 Score =   396 bits (1018),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 257/492 (52%), Positives = 338/492 (69%), Gaps = 24/492 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             F+TRRGTRLLNMSDFRD S+S+ WD+SAFVRTY+LYLDE++E +MQ+RRG  S       
Sbjct  112   FSTRRGTRLLNMSDFRDNSKSDSWDFSAFVRTYALYLDERLEYKMQSRRGMRSMYG----  167

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                  +++EEE      I+V  TP+ +MK + ++S++QH   +L+RFLAC+PTG AK +R
Sbjct  168   ----LDEDEEEREREKEIIVRSTPVRDMKLDQIFSKMQHLQLLLERFLACRPTGGAKNHR  223

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VKESF++YY I+E+L IL+DRF  +++ D  KV++IF RV KQ+DEL++F+
Sbjct  224   IVIVALYPIVKESFRIYYDISEILSILIDRFPDMEVSDCVKVYDIFCRVGKQFDELDLFF  283

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMA-GGRIMrsrepspeveeveep  859
              WSK+ GI+R SEYP++E    +KL++MEE I++K  +A   ++      + E E   EP
Sbjct  284   GWSKSIGIARSSEYPEIERVTLKKLEVMEEFIKDKSALAQSNKLEAIEYKTQEEEVAYEP  343

Query  858   epeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEE--KKEQDIGDLLNLGEDAPTPEEH  685
             EPE E EED+N   ALPPPPE+  EE         +  K  Q  GDLLNLG+D  T EEH
Sbjct  344   EPEPEPEEDVNATNALPPPPEEINEEAVEEVKEEPKEGKVVQTEGDLLNLGDDMMTSEEH  403

Query  684   ANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTASHLSNQKAQFPGNFDE  508
               +LALALFDG      T  T   PW AF+ G+ DWET LVQ+A++LSNQK  + G FD 
Sbjct  404   GEKLALALFDGAVPEAATGATQALPWHAFDEGAADWETTLVQSATNLSNQKPTYGGGFDT  463

Query  507   LMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGAD  328
             L+LDGMY+QG +N A+   G   +GSA+SVA GSAGRP+MLALPAPP+S   + + S +D
Sbjct  464   LLLDGMYKQGEVNAAMQGQGYGVSGSASSVALGSAGRPSMLALPAPPTSRSGSDSIS-SD  522

Query  327   PFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQ-----  163
             PFAASL+VAPP+YVQMSE+EKKQR L EEQ MWQQY KDGM GQ  L K   ++      
Sbjct  523   PFAASLAVAPPSYVQMSEMEKKQRFLVEEQMMWQQYAKDGMQGQAALAKLHSNNNNNNNS  582

Query  162   -----PHNYYGY  142
                  P NY  Y
Sbjct  583   YTGGYPQNYGNY  594



>ref|XP_009118718.1| PREDICTED: putative clathrin assembly protein At1g03050 [Brassica 
rapa]
Length=597

 Score =   394 bits (1012),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 243/489 (50%), Positives = 334/489 (68%), Gaps = 21/489 (4%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD SRSN WDYSAFVRTY+LYLD++++LRMQ R GK   +     
Sbjct  112   FATRRGTRLLNMSDFRDVSRSNSWDYSAFVRTYALYLDDRLDLRMQARHGKR-GVYCVGG  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             + V+++ ++ E   + AIVV   P  EMK E +++R+QH  Q+LDRFLAC+P G+A+ NR
Sbjct  171   DTVDDKQDKPEADLSKAIVVRSQPTAEMKTEEIFTRVQHLQQLLDRFLACRPAGSARNNR  230

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VKESFQ+YY + E++G+L++RFM+L+IPDS KV++IF RV+KQ++EL+ FY
Sbjct  231   VVIVALYPIVKESFQIYYDVTEIMGVLIERFMELEIPDSIKVYDIFCRVSKQFEELDQFY  290

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
             +W K  GI+R SEYP++E   ++KL++M+E IR+K  +             + +E  E E
Sbjct  291   SWCKNMGIARSSEYPEIEKITQKKLELMDEFIRDKTALEETN-NSKSVNEEDDDEAREEE  349

Query  855   peaeaeEDMNTIKALPPPPEDFIEEMAVVEAP-----TEEKKEQDIGDLLNLGEDAPTPE  691
                E EEDMN IKALP PP    EE    E        EE K++++ DLL+L  D  + E
Sbjct  350   VNEEQEEDMNAIKALPAPPPKEDEEEKTEEEAEEPVIIEENKKEEVADLLDL-VDISSGE  408

Query  690   EHA--NQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQFPG  520
               A  + LALALFDG P    + +     WEAF +   DWETALVQ+A++LS QK +  G
Sbjct  409   AGAAGDSLALALFDG-PYASGSGSESGPGWEAFKDDGADWETALVQSATNLSGQKTELGG  467

Query  519   NFDELMLDGMYRQGALNQAVASSGVL-TTGSATSVAFGSAGRpamlalpappssADANTT  343
              FD L+L+GMY+ G +N AV +S     +GSA+S+AFGSAGRPA   L  P  +  AN +
Sbjct  468   GFDMLLLNGMYQHGTVNAAVQNSTAYGASGSASSMAFGSAGRPAATMLALPAPAT-ANGS  526

Query  342   ASGA----DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQ  175
             ++G     DPFAASL VAPPAYVQM+E+EKKQR+L EEQ MW+Q++++G  G + +  +Q
Sbjct  527   SNGPVVPMDPFAASLVVAPPAYVQMNEMEKKQRMLMEEQIMWEQFSREGRQGHMNI--SQ  584

Query  174   QSSQPHNYY  148
               +QP+  Y
Sbjct  585   NQNQPNYSY  593



>gb|KFK42666.1| hypothetical protein AALP_AA1G024000 [Arabis alpina]
Length=599

 Score =   394 bits (1012),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 250/494 (51%), Positives = 331/494 (67%), Gaps = 27/494 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD S SN WDYSAFVRTY+LYLDE+++ RMQ R GK   +     
Sbjct  112   FATRRGTRLLNMSDFRDVSLSNSWDYSAFVRTYALYLDERLDFRMQARHGKR-GVYCVGG  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             E  E+E ++  +  +TAIVV   PI EMK E +++R+QH  Q+LDRFLAC+PTG A+ NR
Sbjct  171   ETEEDEQDQTASDLSTAIVVRSQPIAEMKTEQIFTRVQHLQQLLDRFLACRPTGNARNNR  230

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VKESFQ+YY + E++GIL++RFM+LDIPDS KV++IF RV+KQ++ELE FY
Sbjct  231   VVIVALYPIVKESFQIYYDVTEIMGILIERFMELDIPDSIKVYDIFCRVSKQFEELEQFY  290

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
             +WSK  GI+R SEYP++E   ++KLD+M+E IR+K  +   R       S E ++    E
Sbjct  291   SWSKNMGIARSSEYPEIEKITQKKLDLMDEFIRDKSALEQTR-KSKSVKSDEEDDDARTE  349

Query  855   peaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTE----EKKEQDIGDLLNL-----GEDA  703
                E  EDMN IKALP PP    EE    E   E    E+K++++GDL+NL     GE A
Sbjct  350   EVNEEPEDMNAIKALPEPPPKDEEEEKPEEEAKEEVIIEEKQEEVGDLMNLVDINDGEAA  409

Query  702   PTPEEHANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTASHLSNQKAQF  526
                 +  + LALALFDG P    + +     WEAF   S DWETALVQ+A++LS QK + 
Sbjct  410   ----QAGDSLALALFDG-PYASGSGSDSGPGWEAFKEDSADWETALVQSATNLSGQKTEL  464

Query  525   PGNFDELMLDGMYRQGALNQAVASSGVL-TTGSATSVAFGSAGR-pamlalpappssADA  352
              G FD L+L+GMY+ G +N AV +S     +GSA+S+AFGSAGR  A +     PS+ + 
Sbjct  465   GGGFDMLLLNGMYQHGTVNAAVQTSTAYGASGSASSMAFGSAGRPAATMLALPAPSAGNG  524

Query  351   NTTASGA----DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLE  184
             NT  S      DPFAASL VAPP YVQ++++EKKQR+L EEQ MW QY+++G  G + + 
Sbjct  525   NTGTSNGMVPVDPFAASLEVAPPPYVQLNDMEKKQRMLMEEQMMWDQYSREGRQGHMNI-  583

Query  183   KAQQSSQPHNYYGY  142
               +Q+    NY  Y
Sbjct  584   --RQNQNKPNYSSY  595



>ref|XP_009111170.1| PREDICTED: putative clathrin assembly protein At1g03050 isoform 
X1 [Brassica rapa]
Length=590

 Score =   392 bits (1006),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 245/464 (53%), Positives = 328/464 (71%), Gaps = 13/464 (3%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD SRSN WDYSAFVRTY+LYLDE+++ RMQ R GK   + S   
Sbjct  112   FATRRGTRLLNMSDFRDVSRSNSWDYSAFVRTYALYLDERLDYRMQTRHGKR-GVYSVGG  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             + VE++ +  E   +TAIVV   PI EMK E +++RIQH  Q+LDRFLAC+PTG+A+ NR
Sbjct  171   DAVEDKKDNPEANLSTAIVVRSQPIAEMKTEQIFTRIQHLQQLLDRFLACRPTGSARNNR  230

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY + KESF++YY + E++G+L++RFM+LDIPDS KV++IF RV+KQ+DEL+ FY
Sbjct  231   VVIVALYPIAKESFKIYYDVTEIMGVLIERFMELDIPDSIKVYDIFCRVSKQFDELDQFY  290

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
             +W K  GI+R SEYP++E   ++KLD+M+E IR+K  +   +   +   + E ++ E  E
Sbjct  291   SWCKNMGIARSSEYPEIEKITQKKLDLMDEFIRDKSSLEETK-QSNSVEADEEDDDERTE  349

Query  855   peaeaeEDMNTIKALPPPP---EDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEH  685
                E +EDMN IKALP PP   E   EE    E  TEEKKE+++GDL++LG++    E  
Sbjct  350   EVNEEQEDMNAIKALPAPPPKEEKREEEAKEEEVVTEEKKEEEVGDLVDLGDNVVAGEAG  409

Query  684   ANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQFPGNFDE  508
              + LALALFDG P    + +     WEAF + S DWE ALVQ+A++LS QK +  G FD 
Sbjct  410   GDSLALALFDG-PYASGSGSASGPGWEAFDDDSADWEAALVQSATNLSGQKTELGGGFDM  468

Query  507   LMLDGMYRQGALNQAVASSGVL-TTGSATSVAFGSAGRpamlalpappssADANTTASGA  331
             L+L+GMY+ G +N AV +S     +GSA+S+AFGSAGRPA   L  P  +   N +++G 
Sbjct  469   LLLNGMYQHGTVNAAVQNSTAYGASGSASSMAFGSAGRPAATMLALPAPAT-VNGSSNGP  527

Query  330   ---DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDG  208
                DPFAASL VAPP YVQM+++EKKQR+L EEQ MW QY++ G
Sbjct  528   VTMDPFAASLVVAPPHYVQMNDMEKKQRMLMEEQMMWDQYSRGG  571



>emb|CDY15448.1| BnaA08g27320D [Brassica napus]
Length=572

 Score =   391 bits (1004),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 236/464 (51%), Positives = 316/464 (68%), Gaps = 31/464 (7%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD SRSN WDYSAFVRTY+LYLDE+++ RMQ R GK   + S   
Sbjct  112   FATRRGTRLLNMSDFRDVSRSNSWDYSAFVRTYALYLDERLDYRMQTRHGKR-GVYSVGG  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             + VE++ +  E   +TAIVV   PI EMK E +++RIQH  Q+LDRFLAC+PTG+A+ NR
Sbjct  171   DDVEDKKDNPEADLSTAIVVRSQPIAEMKTEQIFTRIQHLQQLLDRFLACRPTGSARNNR  230

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY + KESF++YY + E++G+L++RFM+LDIP+S KV++IF RV+KQ+DEL+ FY
Sbjct  231   VVIVALYPIAKESFKIYYDVTEIMGVLIERFMELDIPNSIKVYDIFCRVSKQFDELDQFY  290

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
             +W K  GI+R SEYP++E   ++KLD                     +     +   E  
Sbjct  291   SWCKNMGIARSSEYPEIEKITQKKLD-------------------LMDEFIRDKSSLEET  331

Query  855   peaeaeEDMNTIKALPPPP---EDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEH  685
              ++ ++EDMN IKALP PP   E   EE    E  TEEKKE+++GDL++LG++    E  
Sbjct  332   KQSNSQEDMNAIKALPAPPPKEEKREEEAKEEEVVTEEKKEEEVGDLVDLGDNVVAGESG  391

Query  684   ANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQFPGNFDE  508
              + LALALFDG P    + +     WEAF + S DWE ALVQ+A++LS QK +  G FD 
Sbjct  392   GDSLALALFDG-PYASGSVSASGPGWEAFDDDSADWEAALVQSATNLSGQKTELGGGFDM  450

Query  507   LMLDGMYRQGALNQAVASSGVL-TTGSATSVAFGSAGRpamlalpappssADANTTASGA  331
             L+L+GMY+ G +N AV +S     +GSA+S+AFGSAGRPA   L  P  +   N +++G 
Sbjct  451   LLLNGMYQHGTVNAAVQNSTAYGASGSASSMAFGSAGRPAATMLALPAPAT-VNGSSNGP  509

Query  330   ---DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDG  208
                DPFAASL VAPP YVQM+++EKKQR+L EEQ MW QY++ G
Sbjct  510   VTMDPFAASLVVAPPHYVQMNDMEKKQRMLMEEQMMWDQYSRGG  553



>gb|KHN33498.1| Putative clathrin assembly protein [Glycine soja]
Length=598

 Score =   391 bits (1005),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 256/494 (52%), Positives = 337/494 (68%), Gaps = 26/494 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             F+TRRGTRLLNMSDFRD S+S+ WD+SAFVRTY+LYLDE++E +MQ+RRG  S       
Sbjct  112   FSTRRGTRLLNMSDFRDNSKSDSWDFSAFVRTYALYLDERLEYKMQSRRGMRSMYG----  167

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                  +++EEE      I+V  TP+ +MK + ++S++QH   +L+RFLAC+PTG AK +R
Sbjct  168   ----FDEDEEEREREKEIIVRSTPVRDMKLDQIFSKMQHLQLLLERFLACRPTGGAKNHR  223

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VKESF++YY I+E+L IL+DRF  +++ D  KV++IF RV KQ+DEL++F+
Sbjct  224   IVIVALYPIVKESFRIYYDISEILSILIDRFPDMEVSDCVKVYDIFCRVGKQFDELDLFF  283

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrs---repspeveeve  865
              WSK+ GI+R SEYP++E    +KL++MEE I++K  +A    + +   +    EV    
Sbjct  284   GWSKSIGIARSSEYPEIERVTLKKLEVMEEFIKDKSALAQSNKLEAIEYKTQEEEVAYEP  343

Query  864   epepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEE--KKEQDIGDLLNLGEDAPTPE  691
             EPEPE E EED+N   ALPPPPE+  EE         +  K  Q  GDLLNL +D  T E
Sbjct  344   EPEPEPEPEEDVNATNALPPPPEEINEEAVEEVKEEPKEGKVVQTEGDLLNLSDDMMTSE  403

Query  690   EHANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTASHLSNQKAQFPGNF  514
             EH  +LALALFDG      T  T   PW AF+ G+ DWET LVQ+A++LSNQK  + G F
Sbjct  404   EHGEKLALALFDGAVPEAATGATQALPWHAFDEGAADWETTLVQSATNLSNQKPTYGGGF  463

Query  513   DELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASG  334
             D L+LDGMY+QG +N A+   G   +GSA+SVA GSAGRP+MLALPAPP+S   + + S 
Sbjct  464   DTLLLDGMYKQGEVNAAMQGQGYGVSGSASSVALGSAGRPSMLALPAPPTSRSGSDSIS-  522

Query  333   ADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQ---  163
             +DPFAASL+VAPP+YVQMSE+EKKQR L EEQ MWQQY KDGM GQ  L K   ++    
Sbjct  523   SDPFAASLAVAPPSYVQMSEMEKKQRFLVEEQMMWQQYAKDGMQGQAALAKLHSNNNNNN  582

Query  162   -------PHNYYGY  142
                    P NY  Y
Sbjct  583   NSYTGGYPQNYGNY  596



>ref|XP_003593137.1| hypothetical protein MTR_2g008170 [Medicago truncatula]
 gb|AES63388.1| clathrin assembly plant-like protein, putative [Medicago truncatula]
Length=607

 Score =   389 bits (998),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 251/488 (51%), Positives = 323/488 (66%), Gaps = 14/488 (3%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDS-RSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALA----  1408
             F+TRRGTRLLNMSDFRDS +S  WD+SAFVRTYSLYLDE++E +MQ+RRGK S       
Sbjct  111   FSTRRGTRLLNMSDFRDSSQSGSWDFSAFVRTYSLYLDERLEYKMQSRRGKRSMFGYDED  170

Query  1407  ----SgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKP  1240
                     E   E + E+E      IVV  TP+ EMK E ++S++QH   +L+RFLAC+P
Sbjct  171   EEERERERERERESEREKERDKGREIVVRSTPVREMKLEQIFSKMQHLQLLLERFLACRP  230

Query  1239  TGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQ  1060
             TG AK +R+V+VALY +VKESFQ YY I+E+L IL+DRF  +D+ D  KV++IF R+ KQ
Sbjct  231   TGTAKSHRIVIVALYPIVKESFQSYYDISEILSILIDRFSDMDVADCIKVYDIFCRIGKQ  290

Query  1059  WDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspe  880
             +DEL++FY WSK  GI R SEYP+++    +KL++MEE I++K  +A       +E +  
Sbjct  291   FDELDLFYGWSKNIGICRSSEYPEIDKVTPKKLEVMEEFIKDKNMLAQSNKADVQEENNS  350

Query  879   veeveepepeaeaeEDMNTIKAL--PPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGED  706
              EE +EPEPE E EEDMN +KAL  P  P + + E    E   EEK  Q  GDLLNLG+D
Sbjct  351   DEEAKEPEPEPEPEEDMNAVKALPPPEEPAEEVVEEPKEEETKEEKIVQTEGDLLNLGDD  410

Query  705   APTPEEHANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQF  526
               T EEH ++LALALFDG             PW AF+ S DWETALVQ+ SHL NQ+   
Sbjct  411   RVTTEEHGDKLALALFDGAAPATSEGGIKALPWHAFDESADWETALVQSTSHLGNQQPAL  470

Query  525   PGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGR-pamlalpappssADAN  349
              G FD L+LDGMY+QG +N A+   G   +GSA+SVA GSAGR   +     P S    N
Sbjct  471   GGGFDTLLLDGMYKQGEMNAAMQGVGYGGSGSASSVALGSAGRPAMLALPAPPTSGTGVN  530

Query  348   TTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQS  169
             +T+   DPFAASL++APP+YVQMSE+EKKQRLL EEQ +WQQY +D + G   L+  QQ 
Sbjct  531   STSGYVDPFAASLAIAPPSYVQMSEMEKKQRLLVEEQLIWQQYERDRVQGHAALK--QQP  588

Query  168   SQPHNYYG  145
                ++Y G
Sbjct  589   GSNNSYMG  596



>ref|XP_010474909.1| PREDICTED: putative clathrin assembly protein At1g03050 [Camelina 
sativa]
Length=602

 Score =   387 bits (994),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 248/489 (51%), Positives = 332/489 (68%), Gaps = 17/489 (3%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD SRSN WDYSAFVRTY+LYLDE+++ RMQ R GK   +     
Sbjct  112   FATRRGTRLLNMSDFRDVSRSNSWDYSAFVRTYALYLDERLDFRMQARHGKR-GVYCIGG  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             E   +E ++     +TAIVV   PI EMK E ++ RIQH  Q+LDRFLAC+PTG A+ NR
Sbjct  171   ETDGDEKDQAAPDLSTAIVVRSQPIAEMKTEQIFIRIQHLQQLLDRFLACRPTGNARNNR  230

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VKESFQ+YY + E++GIL+DRFM+LDI DS KV++IF RV+KQ++EL+ FY
Sbjct  231   VVIVALYPIVKESFQIYYDVTEIMGILIDRFMELDISDSIKVYDIFCRVSKQFEELDQFY  290

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGR-IMrsrepspeveeveep  859
             +W K  GI+R SEYP+VE   ++KL++M+E IR+K  +   +    ++  + E ++    
Sbjct  291   SWCKNMGIARSSEYPEVEKITQKKLELMDEFIRDKSALEQTKNTKSTKSEADEEDDDARK  350

Query  858   epeaeaeEDMNTIKAL-----PPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGE-DAPT  697
             E   E +EDMN IKAL         E+  EE A  E   E+K+E+ +GDLL+LG  +   
Sbjct  351   EEVNEEQEDMNAIKALPEPPPKEEEEEKPEEEAKEEVVIEKKEEETMGDLLDLGNTNGGG  410

Query  696   PEEHANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQFPG  520
               E  + LALALFDG P    + +     WEAF + S DWETALVQTA++LS QK++  G
Sbjct  411   AAEAGDSLALALFDG-PYATGSGSDSGPGWEAFKDDSADWETALVQTATNLSAQKSELGG  469

Query  519   NFDELMLDGMYRQGALNQAVASSGVL-TTGSATSVAFGSAGRpamlalpappssADANTT  343
              FD L+L+GMY+ GA+N AV +S     +GSA+S+AFGSAGRPA   L  P  +     +
Sbjct  470   GFDMLLLNGMYQHGAVNTAVKTSTAYGASGSASSMAFGSAGRPAATMLALPAPATANGNS  529

Query  342   ASGA-----DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKA  178
             A+       DPFAASL VAPP YVQM+++EKKQR+L EEQ MW QY++DG  G + + + 
Sbjct  530   ANNNSPVPMDPFAASLEVAPPPYVQMNDMEKKQRMLMEEQMMWDQYSRDGRQGHMNIRQN  589

Query  177   QQSSQPHNY  151
             Q  +QP++Y
Sbjct  590   QNQNQPYSY  598



>ref|XP_009119580.1| PREDICTED: putative clathrin assembly protein At1g03050 isoform 
X2 [Brassica rapa]
Length=565

 Score =   383 bits (983),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 243/486 (50%), Positives = 317/486 (65%), Gaps = 47/486 (10%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD SRSN WDYSAFVRTY+LYLDE+++ RMQ R GK      G  
Sbjct  112   FATRRGTRLLNMSDFRDVSRSNSWDYSAFVRTYALYLDERLDFRMQTRHGKRGVYCVGGG  171

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             + VE+E ++ E   +TAIVV   PI EMK E +++R+QH  Q+LDRFLAC+PTG A+ NR
Sbjct  172   DAVEDEKDKHEADLSTAIVVRSQPIAEMKTEKIFTRVQHLQQLLDRFLACRPTGGARNNR  231

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VKESFQ+YY I E++G+L++RFM+LDI DS KV++IF RV+KQ++EL+ FY
Sbjct  232   VVIVALYPIVKESFQIYYDITEIMGVLIERFMELDIADSIKVYDIFCRVSKQFEELDQFY  291

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
             +W K  GI+R SEYP++E   ++KLD+M+E I++K  +   +       S E ++ E  E
Sbjct  292   SWCKNMGIARSSEYPEIEKITQKKLDLMDEFIKDKSTLDQTK----ESQSVEEDDDERAE  347

Query  855   peaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTE--EKKEQDIGDLLNL---GEDAPTPE  691
                E EEDMN IKALP PP    EE           EKK++++GDLL+L    E  P   
Sbjct  348   EVNEEEEDMNAIKALPAPPPKEEEEEEEQPEEEVIIEKKQEEVGDLLDLVDINETGP---  404

Query  690   EHANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTASHLSNQKAQFPGNF  514
                                        WEAFN    DWETALVQTA+ LS QK +  G F
Sbjct  405   --------------------------GWEAFNDDGADWETALVQTATKLSGQKTELGGGF  438

Query  513   DELMLDGMYRQGALNQAVASSGVL-TTGSATSVAFGSAGRpamlalpappssADANTTAS  337
             D L+L+GMY+ G +N AV +S     +GSA+S+AFGSAGRPA   L  P  +  AN  ++
Sbjct  439   DMLLLNGMYQHGTVNAAVQTSTAYGASGSASSMAFGSAGRPAATMLALPAPAT-ANGNSN  497

Query  336   GA---DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSS  166
             G    DPFAASL VAPPAYVQM+++EKKQR L EEQ MW QY+++G  G + L  +Q  +
Sbjct  498   GTVPMDPFAASLEVAPPAYVQMNDMEKKQRKLMEEQMMWDQYSREGRQGHMNL--SQNQN  555

Query  165   QPHNYY  148
             +P   Y
Sbjct  556   KPSYSY  561



>ref|XP_002874903.1| hypothetical protein ARALYDRAFT_911949 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51162.1| hypothetical protein ARALYDRAFT_911949 [Arabidopsis lyrata subsp. 
lyrata]
Length=603

 Score =   383 bits (983),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 243/473 (51%), Positives = 322/473 (68%), Gaps = 16/473 (3%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD S+S+ WDYSAFVRTY+LYLDE+++ RMQ RRGK S    G+ 
Sbjct  112   FATRRGTRLLNMSDFRDASQSDSWDYSAFVRTYALYLDERLDYRMQGRRGKRSG-GDGDS  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                ++  E      + A VV    +TEMK E ++ R+QH  Q+LDRFLAC+PTG AK NR
Sbjct  171   GEDDDHRETSTNIRSKAFVVKSKTVTEMKTEKIFVRVQHLQQLLDRFLACRPTGNAKNNR  230

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VKESFQ+YY+I E++G+L+DRFM+LDI DS KV+EIF RV+KQ+DEL+ FY
Sbjct  231   VVIVALYPIVKESFQLYYNITEIMGVLIDRFMELDIHDSIKVYEIFCRVSKQFDELDPFY  290

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAG-GRIMrsrepspeveeveep  859
              W K  G++R SEYP++E   ++KLD+M+E IR+K  +A       S + +   EE  + 
Sbjct  291   GWCKNMGVARSSEYPELEKITQKKLDLMDEFIRDKSALAAQSTKSSSNKSNKSEEEENKT  350

Query  858   epeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEE--KKEQDIGDLLNLGEDA-PTPEE  688
             E   E +ED+N+IKALP P  +  EE    +  +EE   ++   GDLL+L ++A  T   
Sbjct  351   EEIQENQEDLNSIKALPAPKHEEEEEKMETKKDSEEVVSRQGQEGDLLDLTDEAGETAGT  410

Query  687   HANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTASHLSNQKAQFPGNFD  511
               + LALALFDG      T++     WEAFN  S DWET LV++A+ LS QK +  G FD
Sbjct  411   VGDSLALALFDG---AVSTESASGPGWEAFNDNSADWETDLVKSATRLSGQKNELGGGFD  467

Query  510   ELMLDGMYRQGALNQAV-ASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASG  334
              L+LDGMY+ GA+N AV  S+   ++GSA+SVAFGSAGR    ++ A P+ A+ N   S 
Sbjct  468   TLLLDGMYQYGAVNAAVKTSTAYGSSGSASSVAFGSAGR-PAASMLALPAPANGNRIGSK  526

Query  333   A----DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGL  187
             +    DPFAASL VAPPAYVQM+++EKKQRLL EEQ MW QY ++G  G +  
Sbjct  527   SPVMVDPFAASLEVAPPAYVQMNDMEKKQRLLMEEQIMWDQYNRNGRQGHMNF  579



>emb|CDX89917.1| BnaA10g01650D [Brassica napus]
Length=469

 Score =   377 bits (969),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 239/464 (52%), Positives = 315/464 (68%), Gaps = 15/464 (3%)
 Frame = -1

Query  1539  MSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgneegveeedeeee  1363
             MSDFRD SRSN WDYSAFVRTY+LYLDE+++ RMQ R GK      G  + VE+E ++ E
Sbjct  1     MSDFRDVSRSNSWDYSAFVRTYALYLDERLDFRMQTRHGKRGVYCVGGGDAVEDEKDKHE  60

Query  1362  tgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVK  1183
                +TAIVV   PI EMK E +++R+QH  Q+LDRFLAC+PTG A+ NR+V+VALY +VK
Sbjct  61    ADLSTAIVVRSQPIAEMKTEKIFTRVQHLQQLLDRFLACRPTGGARNNRVVIVALYPIVK  120

Query  1182  ESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRL  1003
             ESFQ+YY I E++G+L++RFM+LDIPDS KV++IF RV+KQ++EL+ FY+W K  GI+R 
Sbjct  121   ESFQIYYDITEIMGVLIERFMELDIPDSIKVYDIFCRVSKQFEELDQFYSWCKNMGIARS  180

Query  1002  SEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNT  823
             SEYP++E   ++KLD+M+E I++K  +   +       S E ++ E  E   E EEDMN 
Sbjct  181   SEYPEIEKITQKKLDLMDEFIKDKSTLDQTK----ESQSVEEDDDERAEEVNEEEEDMNA  236

Query  822   IKALPPPPEDFIEEMAVVEAPTE--EKKEQDIGDLLNLGE-DAPTPEEHANQLALALFDG  652
             IKALP PP    EE           EKK++++GDLL+L + +     E  + LALALFDG
Sbjct  237   IKALPAPPPKEEEEEEEQPEEEVIIEKKQEEVGDLLDLVDINGNEALEAGDSLALALFDG  296

Query  651   iptidptkttittPWEAFN-GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGA  475
              P    +       WEAFN    DWETALVQTA+ LS QK +  G FD L+L+GMY+ G 
Sbjct  297   -PYASGSGAETGPGWEAFNDDGADWETALVQTATKLSGQKTELGGGFDMLLLNGMYQHGT  355

Query  474   LNQAVASSGVL-TTGSATSVAFGSAGRpamlalpappssADANTTASGA---DPFAASLS  307
             +N AV +S     +GSA+S+AFGSAGRPA   L  P  +  AN  ++G    DPFAASL 
Sbjct  356   VNAAVQTSTAYGASGSASSMAFGSAGRPAATMLALPAPAT-ANGNSNGTVPMDPFAASLE  414

Query  306   VAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQ  175
             VAPPAYVQM+++EKKQR L EEQ MW QY+++G  G + L + Q
Sbjct  415   VAPPAYVQMNDMEKKQRKLMEEQMMWDQYSREGRQGHMNLSQNQ  458



>emb|CDY32494.1| BnaA09g51020D [Brassica napus]
Length=572

 Score =   380 bits (976),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 234/491 (48%), Positives = 322/491 (66%), Gaps = 50/491 (10%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD SRSN WDYSAFVRTY+LYLD++++LRMQ R GK   +     
Sbjct  112   FATRRGTRLLNMSDFRDVSRSNSWDYSAFVRTYALYLDDRLDLRMQARHGKR-GVYCVGG  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             + V+++ ++ E   + AIVV   P  EMK E +++R+QH  Q+LDRFLAC+P G+A+ NR
Sbjct  171   DTVDDKQDKPEADLSKAIVVRSQPTAEMKTEEIFTRVQHLQQLLDRFLACRPAGSARNNR  230

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VKESFQ+YY + E++G+L++RFM+L+IPDS KV++IF RV+KQ++EL+ FY
Sbjct  231   VVIVALYPIVKESFQIYYDVTEIMGVLIERFMELEIPDSIKVYDIFCRVSKQFEELDQFY  290

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
             +W K  GI+R SEYP++E   ++KL++M+E IR+K  +             + +E  E E
Sbjct  291   SWCKNMGIARSSEYPEIEKITQKKLELMDEFIRDKTALEETN-NSKSVNEEDDDEAREEE  349

Query  855   peaeaeEDMNTIKALPPPPEDFIEEMAVVEAP-----TEEKKEQDIGDLLNL----GEDA  703
                E EEDMN IKALP PP    EE    E        EE+K++++GDLL+L     E  
Sbjct  350   VNEEQEEDMNAIKALPAPPPKEDEEEKTEEEAEEPVIIEEEKQEEVGDLLDLVDISSESG  409

Query  702   PTPEEHANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQF  526
             P                              WEAF +   DWETALVQ+A++LS QK + 
Sbjct  410   P-----------------------------GWEAFKDDGADWETALVQSATNLSGQKTEL  440

Query  525   PGNFDELMLDGMYRQGALNQAVASSGVL-TTGSATSVAFGSAGRpamlalpappssADAN  349
              G FD L+L+GMY+ G +N AV +S     +GSA+S+AFGSAGRPA   L  P  +  AN
Sbjct  441   GGGFDMLLLNGMYQHGTVNAAVQNSTAYGASGSASSMAFGSAGRPAATMLALPAPAT-AN  499

Query  348   TTASGA----DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
              +++G     DPFAASL VAPPAYVQM+E+EKKQR+L EEQ MW+Q++++G  G + + +
Sbjct  500   GSSNGPVVPMDPFAASLVVAPPAYVQMNEMEKKQRMLMEEQIMWEQFSREGRQGHMNIRQ  559

Query  180   AQQSSQPHNYY  148
              Q  +QP+  Y
Sbjct  560   NQ--NQPNYSY  568



>ref|XP_010065535.1| PREDICTED: putative clathrin assembly protein At1g03050 [Eucalyptus 
grandis]
 gb|KCW63066.1| hypothetical protein EUGRSUZ_G00657 [Eucalyptus grandis]
Length=576

 Score =   379 bits (974),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 241/483 (50%), Positives = 316/483 (65%), Gaps = 28/483 (6%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FA RRGTR LNMSDFRD SRSN WD+SAFVRTY+LYLDEQ+E +M  RR K        E
Sbjct  112   FAMRRGTRFLNMSDFRDASRSNSWDFSAFVRTYALYLDEQLEYKMLGRRRKRGKYGLDEE  171

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             E  + +             +  TP+ EMK + ++S++QH+ Q+L+RFLACKPTG AK +R
Sbjct  172   EEEDGQAS-----------IKNTPVPEMKCDQMFSKMQHFQQLLERFLACKPTGRAKNDR  220

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             ++ VALY +VKESFQ+YY + E++ ILVDRF  ++I D  K +EIF R+ KQ+D LE FY
Sbjct  221   VIFVALYPIVKESFQLYYEMTEIMAILVDRFTGMEIADCVKAYEIFSRMGKQFDALEAFY  280

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
             TW K  GI+R SEYP++E   ++KLD+M+++IR+K  +A G   R+    P+   V+E  
Sbjct  281   TWCKNVGIARTSEYPEIERITQKKLDLMDDVIRDKAAVAKGE--RAPNAKPKNVIVQETV  338

Query  855   peaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDI---GDLLNLGEDAPTPEEH  685
                 +E DMN+IKALPPP  + + E AV E   EE K++D     DLLNLG++A  P EH
Sbjct  339   EAEASEPDMNSIKALPPP--EGLSEPAVAE--KEEPKKEDAQQQADLLNLGDNAAAPAEH  394

Query  684   ANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQFPGNFDE  508
              +++A ALFDG     P        WEAF N + DWE++LVQ+AS LSNQK    G  D 
Sbjct  395   GDKMAWALFDG--DALPVGPDPAPKWEAFGNDTADWESSLVQSASSLSNQKTTLAGGLDM  452

Query  507   LMLDGMYRQGALNQAVASSGVLT-TGSATSVAFGSAGRpamlalpappssADANTTASGA  331
                +GMY+ GA   A  +S      GSA+SV    AG+PAMLALPAPP+      T +  
Sbjct  453   WSFNGMYQHGATAAAARTSAACAGNGSASSVTVRPAGQPAMLALPAPPAPV-GGATRNFV  511

Query  330   DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNY  151
             DPFAASL+VAPP YVQ+S+LEKKQR L +EQ +WQQY++DGM GQ+G+   Q +S  HN 
Sbjct  512   DPFAASLTVAPPPYVQISDLEKKQRHLVDEQLLWQQYSRDGMRGQLGMANLQANS--HNM  569

Query  150   YGY  142
              GY
Sbjct  570   GGY  572



>emb|CDY18145.1| BnaC05g01680D [Brassica napus]
Length=466

 Score =   374 bits (960),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 238/465 (51%), Positives = 314/465 (68%), Gaps = 20/465 (4%)
 Frame = -1

Query  1539  MSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgneegveeedeeee  1363
             MSDFRD SRSN WDYSAFVRTY+LYLDE+++ RMQ R GK      G  + VE+E ++ E
Sbjct  1     MSDFRDVSRSNSWDYSAFVRTYALYLDERLDFRMQTRHGKRGVYCVGGGDAVEDEKDKPE  60

Query  1362  tgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPT-GAAKRNRLVLVALYQVV  1186
                +TAIVV   PI EMK E +++R+QH  Q+LDRFLAC+PT G A+ NR+V+VALY +V
Sbjct  61    ADLSTAIVVRSQPIAEMKTEKIFTRVQHLQQLLDRFLACRPTAGGARNNRVVIVALYPIV  120

Query  1185  KESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISR  1006
             KESFQ+YY + EM+GIL++RFM+LDIPDS KV++IF RV+KQ++EL+ FY+W K  GI+R
Sbjct  121   KESFQIYYDVTEMMGILIERFMELDIPDSIKVYDIFCRVSKQFEELDQFYSWCKNMGIAR  180

Query  1005  LSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMN  826
              SEYP++E   ++KLD+M+E I++K            +        E+ +  AE EEDMN
Sbjct  181   SSEYPEIEKITQKKLDLMDEFIKDKS--------TLDQTKESQSVEEDDDERAEEEEDMN  232

Query  825   TIKALPPPPEDFIEEMAVVEAPTE--EKKEQDIGDLLNLGE-DAPTPEEHANQLALALFD  655
              IKALP PP    EE           EKK++++GDLL+L + +     E  + LALALFD
Sbjct  233   AIKALPAPPPKEEEEEEEQPEEEVIIEKKQEEVGDLLDLVDINGGEALEAGDSLALALFD  292

Query  654   GiptidptkttittPWEAFN-GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQG  478
             G P    + +     WEAFN    DWETALVQTA+ LS QK +  G FD L+L+GMY+ G
Sbjct  293   G-PYASGSGSETGPGWEAFNDDGADWETALVQTATKLSGQKTELGGGFDMLLLNGMYQHG  351

Query  477   ALNQAVASSGVL-TTGSATSVAFGSAGRpamlalpappssADANTTASGA---DPFAASL  310
              +N AV +S     +GSA+S+AFGSAGRPA   L  P  +  AN  ++G    DPFAASL
Sbjct  352   TVNAAVQTSTAYGASGSASSMAFGSAGRPAATMLALPAPAT-ANGNSNGTVPMDPFAASL  410

Query  309   SVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQ  175
              VAPPAYVQM+++EKKQR+L EEQ MW QY+++G  G + L + Q
Sbjct  411   EVAPPAYVQMNDMEKKQRMLMEEQMMWDQYSREGRQGHMNLRQNQ  455



>ref|XP_010422560.1| PREDICTED: putative clathrin assembly protein At4g02650 [Camelina 
sativa]
Length=602

 Score =   378 bits (971),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 236/466 (51%), Positives = 312/466 (67%), Gaps = 13/466 (3%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             F T RGTRLLNMSDFRD S+S+ WDYSAFVRTY+LYLDE+++ RMQ +RGKH      + 
Sbjct  112   FGTGRGTRLLNMSDFRDASQSDSWDYSAFVRTYALYLDERLDFRMQGKRGKHGG-DCDSG  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                ++  E +    + A+VV   P+ EMK E ++ R+ H  Q+LDRFLAC+PTG AK NR
Sbjct  171   GQEDDHQETKTDIRSRALVVKSKPVAEMKTEKIFIRVHHLQQLLDRFLACRPTGNAKNNR  230

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VKESFQ+YY I E++G+ +DRFM+LDI DS KV+EIF RV+KQ+DEL+ FY
Sbjct  231   VVIVALYPIVKESFQIYYYITEIMGVFIDRFMELDIHDSIKVYEIFCRVSKQFDELDPFY  290

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
              W K  G++R SEYP++E   ++KLD+M+E I++K  +A  +  +S       EE  + E
Sbjct  291   GWCKNMGVARSSEYPELEKITQKKLDLMDEFIKDKSALA-AQTTKSSSKKSVEEEENKTE  349

Query  855   peaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEE--KKEQDIGDLLNLGEDA-PTPEEH  685
                E +ED+N+IKALP P     EE    +   EE   +    GDLL+L ++A  T    
Sbjct  350   ETKEIQEDLNSIKALPEPEHVEEEEKMETKGDVEEVASRHDQEGDLLDLTDEAGATAGTV  409

Query  684   ANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTASHLSNQKAQFPGNFDE  508
              + LALALFDG      T++     WEAFN  S DWETALV++A+ LS QK++  G FD 
Sbjct  410   GDSLALALFDG---AVGTESASGPGWEAFNDDSTDWETALVKSATRLSGQKSELGGGFDS  466

Query  507   LMLDGMYRQGALNQAV-ASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASG-  334
             L+LDGMY+ GA+N  V  S+   ++GSA+SVAFGSAGRPA   L  P      N + S  
Sbjct  467   LLLDGMYQYGAVNAGVKTSTAYGSSGSASSVAFGSAGRPAASMLALPAPPPTTNRSTSSV  526

Query  333   -ADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHG  199
               DPFAASL VAPPAYVQM+++E+KQRLL EEQ MW QY ++G  G
Sbjct  527   MVDPFAASLEVAPPAYVQMNDMERKQRLLMEEQIMWDQYNRNGRQG  572



>ref|XP_009405274.1| PREDICTED: putative clathrin assembly protein At1g03050 [Musa 
acuminata subsp. malaccensis]
Length=585

 Score =   376 bits (966),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 238/486 (49%), Positives = 310/486 (64%), Gaps = 32/486 (7%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTR+LNMSDFRD SRS+ WD+SAFVRTY+LYLDE+++ RM  RR +  + ++  +
Sbjct  111   FATRRGTRMLNMSDFRDTSRSDAWDFSAFVRTYALYLDERLDYRMHGRRKRRGSRSNIYK  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             E  EE+          A     TP+ EMK E +++R Q   Q+L+RFLAC+PTGAAK NR
Sbjct  171   EEEEEKAAA-------ASTSKATPVREMKTERIFTRTQQLQQLLERFLACRPTGAAKHNR  223

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V VALY +VKESFQ+Y  +A+++ I VDRFM+L +PD  +VH+IF R++KQ+DELEVFY
Sbjct  224   IVAVALYPLVKESFQIYLDLADIMSIFVDRFMELQVPDCIRVHDIFSRLSKQFDELEVFY  283

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
              WSK+AGI R SEYP+VE    +KLDIM+E IR+K  +   +  +    +      +   
Sbjct  284   GWSKSAGICRSSEYPEVERITTKKLDIMDEFIRDKAALTHTK-RQRSLEADRDASDDAKP  342

Query  855   peaeaeEDMNTIKALPPP---PEDFIEEMAVVEAPTEEKKEQD-----IGDLLNLGEDAP  700
             PE E E +MN +++ P P    ED  EE AV E  T+   E+        DLLNL EDA 
Sbjct  343   PEEEPEHNMNAVESSPEPEDDTEDTKEEHAVAEVKTDVADEKQEEEEAEADLLNLKEDAM  402

Query  699   TPEEHANQLALALFDGiptidptkttittPWEAF---NGSEDWETALVQTASHLSNQKAQ  529
             T EEH + LALALFDG              WEAF   + S DWETALVQT+S+LS QKA 
Sbjct  403   TSEEHGDMLALALFDG------NMADAAPKWEAFTNNDNSSDWETALVQTSSNLSGQKAS  456

Query  528   FPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADAN  349
             F G FD ++LDGMY Q     AV    + +   ++ V    A +     + A P+  +  
Sbjct  457   FGGGFDMMLLDGMYNQA--QAAVGHGHLGSGSGSSVVVHAPAPQ----PVLALPAPLEGG  510

Query  348   TTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQS  169
             TT+ G DPFAASL V PP+YVQMSE+E+KQ LL EEQQ+W+QY+KDGM GQ+ L K QQ 
Sbjct  511   TTSGGRDPFAASLMVPPPSYVQMSEMERKQHLLVEEQQLWKQYSKDGMQGQLALAKLQQQ  570

Query  168   SQPHNY  151
               P  Y
Sbjct  571   FPPAAY  576



>gb|KFK30862.1| hypothetical protein AALP_AA6G035200 [Arabis alpina]
Length=606

 Score =   375 bits (962),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 242/475 (51%), Positives = 317/475 (67%), Gaps = 26/475 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDSR-SNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHS-ALASgn  1399
             FATRRGTRLLNMSDFRD+  SN WDYSAFVRTY+LYLDE+++ RMQ RR KH       +
Sbjct  112   FATRRGTRLLNMSDFRDAHLSNSWDYSAFVRTYALYLDERLDFRMQGRRQKHKHGSGGSD  171

Query  1398  eegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRN  1219
                 ++  E        AIVV   P+ EM+ E ++ R+QH  Q+LDRFLAC+PTG AK N
Sbjct  172   SGEEDDHRETSTALRWRAIVVKSKPVVEMETEKIFIRVQHLQQLLDRFLACRPTGNAKNN  231

Query  1218  RLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVF  1039
             R+V+VALY +VKESFQ+YY++ E++G+L+DRFM+LDI DS KV+EIF RV+KQ+DEL+ F
Sbjct  232   RVVIVALYPIVKESFQIYYNVTEIMGVLIDRFMELDIHDSIKVYEIFSRVSKQFDELDPF  291

Query  1038  YTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveep  859
             Y W K  G++R SEYP++E   ++KLD+M+E IR+K  +A   +  S + S + E+ EE 
Sbjct  292   YGWCKKMGVARPSEYPELEKVTQKKLDLMDEFIRDKSALAAQTLKSSSKNSNKSEDEEEK  351

Query  858   epeaea--eEDMNTIKALPPPPEDFIEEMA-------VVEAPTEEKKEQDIGDLLNLGED  706
             + E     +ED N+IKALP P ++  EE         + E  + + +E   GDLL+L  D
Sbjct  352   KTEEIKEIQEDFNSIKALPAPNQEEEEEKEEIETKRDIQEVVSRQDQE---GDLLDLAGD  408

Query  705   A-PTPEEHANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKA  532
             A        + LALALFDG      T T     WEAF + S DWET+LV++A+ LS QK+
Sbjct  409   AGEMAVAVGDSLALALFDG---AVATDTAYGPGWEAFDDDSADWETSLVKSATRLSGQKS  465

Query  531   QFPGNFDELMLDGMYRQGALNQAV-ASSGVLTTGSATSVAFGSAGRpamlalpappssAD  355
             +  G FD L+LDGMY+ GA+N AV AS+   ++GSA+SVAFGSAG PA L L  P     
Sbjct  466   ELGGGFDTLLLDGMYQYGAVNAAVKASTAYGSSGSASSVAFGSAGTPAALMLALPAPPPM  525

Query  354   ANTTASGA------DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDG  208
             AN    G+      DPFAASL VAPP YVQM+++EKKQRLL EEQ MW QY ++G
Sbjct  526   ANGNGIGSKNPVTLDPFAASLEVAPPPYVQMNDMEKKQRLLMEEQMMWDQYNRNG  580



>ref|XP_007159072.1| hypothetical protein PHAVU_002G206000g [Phaseolus vulgaris]
 gb|ESW31066.1| hypothetical protein PHAVU_002G206000g [Phaseolus vulgaris]
Length=591

 Score =   373 bits (958),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 224/486 (46%), Positives = 301/486 (62%), Gaps = 30/486 (6%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALAS---  1405
             FATRRGTR LNMSDFRD S+ N W++SAFVRTY+LYLDE++E +MQN+RGK S  A    
Sbjct  111   FATRRGTRFLNMSDFRDNSKHNSWEFSAFVRTYALYLDERLEYKMQNKRGKRSRFACDDE  170

Query  1404  -gneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAA  1228
                 E   E             +VT TPI+EMK   ++S++QH   +L+RF+AC+PTG A
Sbjct  171   EEIMEKEIERGRYIRERERDREMVTATPISEMKTSIVFSKMQHLQLVLERFIACRPTGKA  230

Query  1227  KRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDEL  1048
             + +RLV VALY +VKESFQ+Y +I E+L I +DRF+ ++IP+  +V++IF RV KQ+DEL
Sbjct  231   RTHRLVTVALYPIVKESFQIYNNITEILSIFIDRFVGMEIPECIRVYDIFCRVGKQYDEL  290

Query  1047  EVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveev  868
             ++FY+WSK  GI+R +EYP++E    +KL++M++ I++K +    RI        E E  
Sbjct  291   DLFYSWSKNIGIARSTEYPEIERVTTKKLEVMDQYIKDKAKNKKLRIQEENNEESESEPE  350

Query  867   eepepeaeaeEDMNTIKALPPP------PEDFIEEMAVVEAPTEEKKEQDIGDLLNLGED  706
              + +        +N IKALP P      P + ++E    E P EEK  Q  GDLL+LG+D
Sbjct  351   PDED--------INAIKALPAPEYLCQEPAENVKEEIKEEEPKEEKLVQTEGDLLDLGDD  402

Query  705   APTPEEHANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQF  526
               T +E    LALALFDG      +  T   PW AF+   DWETALVQ++S+LSNQK   
Sbjct  403   METSQECGANLALALFDG--AAPTSSATQALPWHAFDDVADWETALVQSSSNLSNQKPSL  460

Query  525   PGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANT  346
              G FD L+LDGMYRQ  +N A+ +      GS +S+    A R           +   + 
Sbjct  461   GGGFDTLLLDGMYRQAEMNAAMQAHNYGMNGSGSSM----AQRLTGGPAMLALPAPQTSG  516

Query  345   TASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSS  166
              ++  DPFAASL+VAPPAYVQMSE+EK+Q+LL EEQ MWQQY    MHG     K     
Sbjct  517   GSASVDPFAASLAVAPPAYVQMSEIEKRQKLLMEEQVMWQQYA-SSMHGNAAFTKP----  571

Query  165   QPHNYY  148
             QP+N Y
Sbjct  572   QPNNTY  577



>ref|XP_011092695.1| PREDICTED: putative clathrin assembly protein At4g02650 [Sesamum 
indicum]
Length=584

 Score =   372 bits (956),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 236/479 (49%), Positives = 301/479 (63%), Gaps = 22/479 (5%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRDSRSNF--WDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             A R GTR LNMS F+DS      WDYSAFVR Y+LYLDE++E RM+ R G++   A   E
Sbjct  112   AKRHGTRFLNMSHFQDSSGKLDAWDYSAFVRNYALYLDEKLEFRMEGR-GQNGGSAYNEE  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             +  E     +        +V  TP+ EM+NE ++S++ H  Q+L+R L C+PTGAAK NR
Sbjct  171   DDEEVVTSNDA-------LVRATPVCEMQNESIFSKVDHLTQLLERVLLCRPTGAAKHNR  223

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V VALY +VKESFQ+ Y   E++G L++RFMKL+IPD  +VH +F R++KQ+DEL+ FY
Sbjct  224   IVAVALYAIVKESFQLCYDTTEVIGTLIERFMKLEIPDMIRVHAVFCRISKQYDELDAFY  283

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
              W   A I   S+YP  E  P+QKLD+M++ + +K  M   R   +R         E   
Sbjct  284   DWCTTARIVPPSDYPKFEKIPQQKLDMMDDFVHQKSAMLRKRKAATRAKPKSKHVEETKA  343

Query  855   peaeaeEDMNTIKALPPPPEDFIE--EMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHA  682
              EAE  +  + I  + P  +  +E  E   +    E++K ++IGDLLNL EDAP+ EE  
Sbjct  344   AEAEHVK--HVINEVSPAAQ-LVEAREKNEINEAKEDEKTREIGDLLNLDEDAPSIEEQE  400

Query  681   NQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQFPGNFDEL  505
             +  ALALFD          +  TPWEA  N S DWETALVQ+ASHLSNQKA  P  FD L
Sbjct  401   HAFALALFDA-VPATTAPASTPTPWEALKNSSGDWETALVQSASHLSNQKASLPKGFDTL  459

Query  504   MLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANT-TASGAD  328
             ML  MY+ GA+   V   G   TGS++SVA GSAGR AMLALPAPP++   N   +S  D
Sbjct  460   MLYRMYQPGAMAPTV---GPTATGSSSSVAQGSAGRTAMLALPAPPAANAGNDGPSSSTD  516

Query  327   PFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNY  151
             PFAASL+V PP YVQMSE+EKKQR L EEQ  WQQY K GM GQVGL   QQ + PH Y
Sbjct  517   PFAASLAVLPPGYVQMSEMEKKQRFLVEEQLFWQQYAKGGMPGQVGLANVQQQN-PHQY  574



>emb|CDX86691.1| BnaC08g00120D [Brassica napus]
Length=1011

 Score =   384 bits (985),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 237/463 (51%), Positives = 321/463 (69%), Gaps = 14/463 (3%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD SRSN WD SAFVRTY+LYLDE+++ RMQ R GK   +     
Sbjct  112   FATRRGTRLLNMSDFRDVSRSNSWDCSAFVRTYALYLDERLDYRMQTRHGKR-GVYCVGG  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             + VE++ +  E   +TAIVV   PI EMK E +++RIQH  Q+LDRFLAC+PT +A+ NR
Sbjct  171   DAVEDKKDNSEADLSTAIVVRSQPIAEMKTEQIFTRIQHLQQLLDRFLACRPTESARNNR  230

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY + KESF++YY + E++G+L++RFM+LDIPDS KV++IF RV+KQ++EL+ FY
Sbjct  231   VVIVALYPIAKESFKIYYDVTEIMGVLIERFMELDIPDSIKVYDIFCRVSKQFEELDQFY  290

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
             +W K  GI+R SEYP++E   + KLD+M+E IR+K  +   +   +   + E ++ E  E
Sbjct  291   SWCKNMGIARSSEYPEIEKITQTKLDLMDEFIRDKSSLEETK-QSNSVEADEDDDDERTE  349

Query  855   peaeaeEDMNTIKALPPPP----EDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEE  688
                E +EDMN IKALP PP    +   E         E+K+E+++GDLL+LG++      
Sbjct  350   EVNEEQEDMNAIKALPAPPPKEEKREEEAKEEEVVTEEKKEEEEVGDLLDLGDNVVAGGA  409

Query  687   HANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQFPGNFD  511
               + LALALFDG P    + +     WEAF + S DWETALVQ+A++LS QK +  G FD
Sbjct  410   GGDSLALALFDG-PYTSGSGSASGPGWEAFDDDSADWETALVQSATNLSGQKTELGGGFD  468

Query  510   ELMLDGMYRQGALNQAV-ASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASG  334
              L+L+GMY+ G +N AV AS+     GSA+SVAFGSAGRPA   L  P  +  AN +++G
Sbjct  469   MLLLNGMYQHGTVNAAVQASTAYGAGGSASSVAFGSAGRPAATMLALPAPAT-ANGSSNG  527

Query  333   A---DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTK  214
                 DPFAASL VAPP YVQM++++KKQR+L EEQ MW QY++
Sbjct  528   PVPMDPFAASLVVAPPHYVQMNDMKKKQRMLMEEQMMWDQYSR  570



>ref|XP_006286768.1| hypothetical protein CARUB_v10003318mg [Capsella rubella]
 gb|EOA19666.1| hypothetical protein CARUB_v10003318mg [Capsella rubella]
Length=608

 Score =   372 bits (955),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 235/479 (49%), Positives = 314/479 (66%), Gaps = 24/479 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD S S+ WDYSAFVRTY+LYLDE+++ RMQ +  K      G+ 
Sbjct  112   FATRRGTRLLNMSDFRDASLSHSWDYSAFVRTYALYLDERLDFRMQGK--KGKHGGDGDS  169

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                ++  E      + AIVV   P+TEMK E ++ R+QH  Q+LDRFLAC+PTG AK NR
Sbjct  170   GDEDDRRETCTDLRSRAIVVKSKPVTEMKTEKIFIRVQHLQQLLDRFLACRPTGTAKNNR  229

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VKESFQ+YY+I E++G+L+DRFM+LDI DS KV++IF RV+KQ+DEL+ FY
Sbjct  230   VVIVALYPIVKESFQIYYNITEIMGVLIDRFMELDIHDSIKVYDIFCRVSKQFDELDPFY  289

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
              W K  G++R SEYP++E   ++KLD+M+E I++K  +A   I          +  ++ E
Sbjct  290   GWCKNMGVARSSEYPELEKITQKKLDLMDEFIKDKSALAAQTIK--SSSKKSNKSEKKTE  347

Query  855   peaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDI-------GDLLNLGEDA-P  700
                E  ED+N+IKALP P  +  EE    E    ++  +++       G+LL+L ++A  
Sbjct  348   ETTETHEDLNSIKALPAPKHEEEEEENEEEKMETKRDFEEVASRQDQEGNLLDLTDEAGE  407

Query  699   TPEEHANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTASHLSNQKAQFP  523
                   + LALALFDG      T++     WEAFN  S DWETALV++A+ LS QK++  
Sbjct  408   MAGSIGDSLALALFDG---AVATESVSGPGWEAFNDDSTDWETALVKSATRLSGQKSELG  464

Query  522   GNFDELMLDGMYRQGALNQAV-ASSGVLTTGSATSVAFGSAGRpamlalpappssADANT  346
             G FD L+LDGMY+ G +N AV AS+   ++GSA+SVAFGSAGRPA   L  P      N 
Sbjct  465   GGFDSLLLDGMYQYGTVNAAVKASTAYGSSGSASSVAFGSAGRPAASMLALPAPPPTTNG  524

Query  345   TASGA------DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGL  187
                G+      DPFAASL VAPP YVQM+++EKKQRLL EEQ MW QY ++G  G +  
Sbjct  525   NRIGSKSPVMMDPFAASLEVAPPPYVQMNDMEKKQRLLMEEQIMWDQYNRNGRQGHMNF  583



>gb|EYU35413.1| hypothetical protein MIMGU_mgv1a023938mg [Erythranthe guttata]
Length=599

 Score =   370 bits (950),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 225/484 (46%), Positives = 310/484 (64%), Gaps = 27/484 (6%)
 Frame = -1

Query  1572  FATRRGTRLL-NMSDFRDS--RSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASg  1402
             + TRRG RLL ++S FRD+  +++ WD+S+FVR Y+ YLDE++ELRMQ + GKH   +S 
Sbjct  123   YLTRRGARLLLDVSGFRDASGKTDAWDHSSFVRAYAAYLDERLELRMQGQNGKHGGYSSY  182

Query  1401  neegveeedeeeetgntTAIVVTG-TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAK  1225
             +E+  E+           A   TG  P +EMKNE ++SR+Q+ +++L+RFLAC+P GAAK
Sbjct  183   HEDEEEDGGGGGGG----AAKGTGDIPTSEMKNETVFSRVQNLMKLLERFLACRPAGAAK  238

Query  1224  RNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELE  1045
              NR+V VAL+ +VKESF++Y  I E+  +L +RFM+L+IPD  +V+EIF  ++KQ++EL+
Sbjct  239   HNRVVAVALHHIVKESFELYTDITEITAVLTERFMQLEIPDMVRVYEIFCHLSKQYEELD  298

Query  1044  VFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeve  865
              FY W +  GI R S+YP +E   ++KLD+M++ I +K  M+  R+  S        + +
Sbjct  299   AFYEWGRTVGIMRFSDYPYIEKITQKKLDMMDDFIHQKSAMSKNRMRASTAEPKPKPKPK  358

Query  864   epepeaeaeE----DMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPT  697
                 E + E     D+  IKAL PPPE F +E    +    +K  Q++GDLLNL EDAP+
Sbjct  359   PKPIEEKKEAEPQEDLFAIKAL-PPPERFEDEK--TDEVKNQKITQEVGDLLNLSEDAPS  415

Query  696   PEEHANQLALALFD-GiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQFP  523
               E   ++ALALFD G  +   T TT T PWEAF + S DWETALV + SHLSNQKA  P
Sbjct  416   HAEEGQKMALALFDCGSKSTTTTTTTNTPPWEAFKDSSGDWETALVHSVSHLSNQKASLP  475

Query  522   GNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTT  343
             G FD L+LDGMY+ G +  A  S      GSA+SVA  SA          P   A     
Sbjct  476   GGFDTLILDGMYKHGEM-AAAYSKDCSANGSASSVAVRSA--------VGPTVLALPPPN  526

Query  342   ASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQS-S  166
               GADPFAAS+ +APP+YVQM E+E+KQRLL +EQQ+WQQY ++GM G VGL K Q   +
Sbjct  527   GGGADPFAASVGIAPPSYVQMPEMERKQRLLVQEQQLWQQYARNGMQGHVGLSKMQNGVT  586

Query  165   QPHN  154
              P+N
Sbjct  587   YPYN  590



>ref|XP_004516994.1| PREDICTED: putative clathrin assembly protein At1g03050-like 
isoform X1 [Cicer arietinum]
 ref|XP_004516995.1| PREDICTED: putative clathrin assembly protein At1g03050-like 
isoform X2 [Cicer arietinum]
Length=603

 Score =   369 bits (948),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 222/495 (45%), Positives = 316/495 (64%), Gaps = 35/495 (7%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             F+TR+GTRLLNMSDFRD S+SN WD+S+FVRTY+LYLDE++E +MQ++RG+ S  A   E
Sbjct  111   FSTRQGTRLLNMSDFRDTSKSNSWDFSSFVRTYALYLDERIEYKMQHKRGRRSRFAYDEE  170

Query  1395  egveeedeeeetgntTAI--------------VVTGTPITEMKNEYLYSRIQHYIQILDR  1258
             E  EE+  E                       V+  T + EM++E L+S++QH   +L+R
Sbjct  171   EEEEEQPRERARERERDRDRDRYRERDKDREGVMRSTSLYEMRSELLFSKMQHLQLLLER  230

Query  1257  FLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIF  1078
             FLAC+PTG AK +R+V+VALY +VKESFQ Y+ + E+LGI +DRF  +++PD  KV+++F
Sbjct  231   FLACRPTGRAKSHRIVIVALYPIVKESFQTYHDMTEILGIFIDRFTDMEVPDCIKVYDMF  290

Query  1077  HRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrs  898
              RV KQ+DEL++FY+WSK+ GI+R SEYP++E    +KL+++++ I++K  +A  + + +
Sbjct  291   CRVGKQYDELDLFYSWSKSIGIARSSEYPEIERVTTKKLELIDQFIKDKSLIAQTKKLNA  350

Query  897   repspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDI---GD  727
             +E        EE         + N IKALPPP E   E+   V+   + K+E+ +   GD
Sbjct  351   QEEKNNETNEEEKGELQ----EDNEIKALPPPEEFNEEQTGEVKEEQDSKEEKTVQTEGD  406

Query  726   LLNLGEDAPTPEEH-ANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASH  550
             LL+L +   T +E+  N+LALALFDG      T   +   W AF+ + DWET LVQ++S+
Sbjct  407   LLDLRDSMVTKQEYDGNKLALALFDGEAQTTSTTQALP--WHAFDDAADWETTLVQSSSN  464

Query  549   LSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpap  370
             L NQK    G FD L+LD MY+Q + N ++   G+   GSA+S A     R   +     
Sbjct  465   LPNQKPSLGGGFDSLLLDSMYKQSSTNASM--QGISGYGSASSFA----KRSEAMLALPA  518

Query  369   pssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDG-MHGQV  193
             P S+ ++++    DPFAAS  VAPPAYVQMSE+EKKQRLL EEQ MWQQY + G M+GQV
Sbjct  519   PQSSRSSSSLETEDPFAASRVVAPPAYVQMSEIEKKQRLLAEEQAMWQQYARSGSMNGQV  578

Query  192   GLEKAQQSSQPHNYY  148
                  Q   QP+N+Y
Sbjct  579   SFTTQQ---QPNNFY  590



>emb|CDY21904.1| BnaC09g00100D [Brassica napus]
Length=599

 Score =   368 bits (945),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 238/490 (49%), Positives = 319/490 (65%), Gaps = 26/490 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDSR-SNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD+  S+ WDYSAFVRTY+LYLDE+++ RMQ R+GK+      ++
Sbjct  112   FATRRGTRLLNMSDFRDADGSDSWDYSAFVRTYALYLDERLDFRMQRRKGKNGDGGGDDD  171

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
              G ++  E      + A+VV   P+ EMK E ++ R+QH  Q+LDRFLAC+PTG AK NR
Sbjct  172   SGDDDHRETSANVRSRALVVKTKPVKEMKTEKIFIRVQHLQQLLDRFLACRPTGNAKNNR  231

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V+VALY +VK+SFQ+Y +I E++G+L+DRFM+LD+ DS KV++IF RV+KQ DEL+ F+
Sbjct  232   VVIVALYPIVKDSFQIYCNITEIMGVLIDRFMELDVHDSIKVYDIFSRVSKQLDELDPFH  291

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
              W K  G+ R SEYP++E   ++KLDIM+E I++K  +A   +M             E E
Sbjct  292   GWCKKMGVVRSSEYPELEKITQKKLDIMDEFIKDKSLLAAQALM----SPSRKSNKSEEE  347

Query  855   peaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKE----QDI-GDLLNL-GEDAPTP  694
                + +ED+N +KALP P  +  EE        ++ +E    QD  GDLL+L GE   T 
Sbjct  348   EVKDIQEDLNAVKALPAPELEEEEEEKEETETKKDVQEVVSGQDQEGDLLDLTGEAGDTT  407

Query  693   EEHANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQFPGN  517
                 + LALALFDG      T+      WEAF + S DWETALV++A+ LS QK++  G 
Sbjct  408   LSVGDSLALALFDG---AVATEAASGPGWEAFDDDSADWETALVKSATRLSAQKSELGGG  464

Query  516   FDELMLDGMYRQGALNQAV-ASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTA  340
             FD L+LDGMY+ GALN AV AS+   ++GSA+SVAFGSAGRPA   L  P     +N   
Sbjct  465   FDHLLLDGMYQYGALNAAVNASTAYGSSGSASSVAFGSAGRPAASMLALPAPPPASNGNG  524

Query  339   SGA----DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQ  172
               +    DPFAASL V PP+YVQMS++EKKQRL+ EEQ MW QY ++G  G +      Q
Sbjct  525   GRSLVTMDPFAASLEVVPPSYVQMSDMEKKQRLVMEEQMMWDQYNRNGRLGHM------Q  578

Query  171   SSQPHNYYGY  142
             + Q H +  Y
Sbjct  579   NQQQHFHVPY  588



>emb|CDY22070.1| BnaA09g00990D [Brassica napus]
Length=602

 Score =   368 bits (944),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 234/495 (47%), Positives = 318/495 (64%), Gaps = 33/495 (7%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDSR-SNFWDYSAFVRTYSLYLDEQVELRMQNRRGKH------SA  1414
             FATRRGTRLLNMSDFRD+  S+ WDYSAFVRTY+LYLDE+++ RMQ R+GK+        
Sbjct  112   FATRRGTRLLNMSDFRDADGSDSWDYSAFVRTYALYLDERLDFRMQRRKGKNVDGGGGGG  171

Query  1413  LASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTG  1234
                  +E  ++  E      + A+VV   P+ EMK E ++ R+QH  Q+LDRFLAC+PTG
Sbjct  172   DDDSGDEEEDDHREANANVRSRALVVKTKPVKEMKTEKIFIRVQHLQQLLDRFLACRPTG  231

Query  1233  AAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWD  1054
              AK NR+V+VALY +VK+SFQ+Y ++ E++G+L+DRFM+LD+ DS KV++IF RV+KQ D
Sbjct  232   NAKNNRVVIVALYPIVKDSFQIYCNVTEIMGVLIDRFMELDVHDSIKVYDIFSRVSKQLD  291

Query  1053  ELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeve  874
             EL+ F+ W K  G++R SEYP++E   ++KLDIM+E I++K  +A   +M          
Sbjct  292   ELDPFHGWCKKMGVARSSEYPELEKITQKKLDIMDEFIKDKSLLAAQALM----SPSRKS  347

Query  873   eveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKE----QDI-GDLLNL-G  712
                E E   + +ED+N +KALP P ++  EE        ++ +E    QD  GDLL+L G
Sbjct  348   NKSEEEEVKDIQEDLNAVKALPAPEQEEEEEEKEETETKKDFEEVVPRQDQEGDLLDLTG  407

Query  711   EDAPTPEEHANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQK  535
             E   T     + LALALFDG      T+      WEAF + S DWETALV++A+ LS QK
Sbjct  408   EAGDTTLSVGDSLALALFDG---AVATEAASGPGWEAFDDDSADWETALVKSATRLSAQK  464

Query  534   AQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssAD  355
             ++  G FD L+LDGMY+ GA+N AV  +   ++GSA+SVAFGSAGRPA   L  P     
Sbjct  465   SELGGGFDHLLLDGMYQYGAVNAAV--NAYGSSGSASSVAFGSAGRPAASMLALPAPPPT  522

Query  354   ANTTASGA----DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGL  187
             +N     +    DPFAASL V PP+YVQMS++EKKQRL+ EEQ MW QY ++G  G +  
Sbjct  523   SNGNGGRSLVTMDPFAASLEVVPPSYVQMSDMEKKQRLVMEEQMMWDQYNRNGRLGHM--  580

Query  186   EKAQQSSQPHNYYGY  142
                 Q+ Q H +  Y
Sbjct  581   ----QNQQQHFHVPY  591



>ref|XP_009111265.1| PREDICTED: putative clathrin assembly protein At4g02650 [Brassica 
rapa]
Length=601

 Score =   367 bits (943),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 235/494 (48%), Positives = 319/494 (65%), Gaps = 32/494 (6%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDSR-SNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD+  S+ WDYSAFVRTY+LYLDE+++ RMQ R+GK+   + G +
Sbjct  112   FATRRGTRLLNMSDFRDADGSDSWDYSAFVRTYALYLDERLDFRMQRRKGKNGDGSGGGD  171

Query  1395  egveee-----deeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGA  1231
             +   +E      E      + A+VV   P+ EMK E ++ R+QH  Q+LDRFLAC+PTG 
Sbjct  172   DDSGDEEEDDHREANANVRSRALVVKTKPVKEMKTEKIFIRVQHLQQLLDRFLACRPTGN  231

Query  1230  AKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDE  1051
             AK NR+V+VALY +VK+SFQ+Y ++ E++G+L+DRFM+LD+ DS KV++IF RV+KQ DE
Sbjct  232   AKNNRVVIVALYPIVKDSFQIYCNVTEIMGVLIDRFMELDVHDSIKVYDIFSRVSKQLDE  291

Query  1050  LEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspevee  871
             L+ F+ W K  G++R SEYP++E   ++KLDIM+E I++K  +A   +M           
Sbjct  292   LDPFHGWCKKMGVARSSEYPELEKITQKKLDIMDEFIKDKSLLAAQALM----SPSRKSN  347

Query  870   veepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKE----QDI-GDLLNL-GE  709
               E E   + +ED+N +KALP P ++  EE        ++ +E    QD  GDLL L GE
Sbjct  348   KSEEEEVKDIQEDLNAVKALPAPEQEEEEEEKEETETKKDVQEVVSRQDQEGDLLGLTGE  407

Query  708   DAPTPEEHANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKA  532
                T     + LALALFDG      T+      WEAF + S DWETALV++A+ LS QK+
Sbjct  408   AGDTTLSVGDSLALALFDG---AVATEAASGPGWEAFDDDSADWETALVKSATRLSAQKS  464

Query  531   QFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADA  352
             +  G FD L+LDGMY+ GA+N AV  +   ++GSA+SVAFGSAGRPA   L  P     +
Sbjct  465   ELGGGFDHLLLDGMYQYGAVNAAV--NAYGSSGSASSVAFGSAGRPAASMLALPAPPPTS  522

Query  351   NTTASGA----DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLE  184
             N     +    DPFAASL V PP+YVQMS++EKKQRL+ EEQ MW QY ++G  G +   
Sbjct  523   NGNGGRSLVTMDPFAASLEVVPPSYVQMSDMEKKQRLVMEEQMMWDQYNRNGRLGYM---  579

Query  183   KAQQSSQPHNYYGY  142
                Q+ Q H +  Y
Sbjct  580   ---QNQQQHFHVPY  590



>ref|NP_192174.2| putative clathrin assembly protein [Arabidopsis thaliana]
 sp|Q8GX47.2|CAP3_ARATH RecName: Full=Putative clathrin assembly protein At4g02650 [Arabidopsis 
thaliana]
 gb|AEE82209.1| putative clathrin assembly protein [Arabidopsis thaliana]
Length=611

 Score =   363 bits (931),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 243/479 (51%), Positives = 321/479 (67%), Gaps = 20/479 (4%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD S+S+ WDYSAFVRTY+LYLDE+++ RMQ RRGK  +   G  
Sbjct  112   FATRRGTRLLNMSDFRDASQSDSWDYSAFVRTYALYLDERLDYRMQGRRGKKKSGGGGGG  171

Query  1395  egveeede----eeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAA  1228
             +G   E++          + AIVV   P+ EMK E +++R+QH  Q+LDRFLAC+PTG A
Sbjct  172   DGDSGEEDDHRGTSNDIRSKAIVVKSKPVAEMKTEKIFNRVQHLQQLLDRFLACRPTGNA  231

Query  1227  KRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDEL  1048
             K NR+V+VA+Y +VKESFQ+YY+I E++G+L++RFM+LDI DS KV+EIF RV+KQ+DEL
Sbjct  232   KNNRVVIVAMYPIVKESFQLYYNITEIMGVLIERFMELDIHDSIKVYEIFCRVSKQFDEL  291

Query  1047  EVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveev  868
             + FY W K   ++R SEYP++E   ++KLD+M+E IR+K  +A      S + S + EE 
Sbjct  292   DPFYGWCKNMAVARSSEYPELEKITQKKLDLMDEFIRDKSALAAQTTKSSSKRSNKSEEE  351

Query  867   eepep-eaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKE----QDI-GDLLNLGED  706
             E       E +ED+N+IKALP P +   EE        ++ +E    QD  GDLL+L ++
Sbjct  352   ESKTEYIQENQEDLNSIKALPAPEQKEEEEEEEKMETKKDVEEVVSRQDQEGDLLDLTDE  411

Query  705   AP-TPEEHANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTASHLSNQKA  532
             A  T     + LALALFDG   +  T++     WEAFN  S DWET LV++A+ LS QK+
Sbjct  412   AGVTAGTVGDSLALALFDG---VVGTESASGPGWEAFNDNSADWETDLVRSATRLSGQKS  468

Query  531   QFPGNFDELMLDGMYRQGALNQAV-ASSGVLTTGSATSVAFGSAGRpamlalpappssAD  355
             +  G FD L+LDGMY+ GA+N AV  S+   ++GSA+SVAFGSAG PA   L  P     
Sbjct  469   ELGGGFDTLLLDGMYQYGAVNAAVKTSTAYGSSGSASSVAFGSAGSPAASMLALPAPPPT  528

Query  354   ANTTASG---ADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGL  187
             AN   +     DPFAASL VAPPAYVQM+++EKKQRLL EEQ MW QY + G  G +  
Sbjct  529   ANGNRNSPVMVDPFAASLEVAPPAYVQMNDMEKKQRLLMEEQIMWDQYNRSGRQGHMNF  587



>ref|XP_003626768.1| hypothetical protein MTR_8g008860 [Medicago truncatula]
 gb|AET01244.1| clathrin assembly plant-like protein [Medicago truncatula]
Length=588

 Score =   360 bits (923),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 227/490 (46%), Positives = 308/490 (63%), Gaps = 35/490 (7%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALA----  1408
             F+T+RGTRLLNMSDFRD S+SN WDYS+FVRTY+LYLDE++E RMQ +RG+    A    
Sbjct  111   FSTQRGTRLLNMSDFRDKSKSNSWDYSSFVRTYALYLDERLEYRMQYKRGRSGRFAYDED  170

Query  1407  SgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAA  1228
                +    + +   E      IVV  TP+ EMK + L+SR+QH   +L+RF+AC+PTG A
Sbjct  171   EEEQSRESKRERYRERDRDKEIVVRSTPLREMKTDDLFSRMQHLQLLLERFMACRPTGRA  230

Query  1227  KRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDEL  1048
             K +R+V+VALY +VKESFQ Y+ +  +LGI +DRF ++++P+  KV+++F RV KQ+DEL
Sbjct  231   KTHRMVIVALYPIVKESFQTYHDMTSILGIFIDRFTEMEVPEYYKVYDVFCRVGKQYDEL  290

Query  1047  EVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveev  868
             ++FY+WSK+ GI R SEYP++E    +KLD+M++ IR+K  ++    + ++E + E  E 
Sbjct  291   DLFYSWSKSIGIGRSSEYPEIEKVTTKKLDLMDQFIRDKSLVSQANKLITQEENNEKNEE  350

Query  867   eepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKE-----QDIGDLLNLGEDA  703
             E    E      MN IKAL PPPE F EE    E   +++KE     Q  GDLL+L +  
Sbjct  351   ENEVEED-----MNEIKAL-PPPEGFNEEQVEEEIKEQDQKEEEKIVQTEGDLLDLTDSM  404

Query  702   PTPEEHANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFP  523
                +   N+LALALFD       + T    PW AF+   DWET LVQ++++L NQK    
Sbjct  405   TNQDYVGNKLALALFD-ELPNTTSNTIQALPWHAFDDVSDWETTLVQSSTNLPNQKPSLG  463

Query  522   GNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTT  343
             G FD L+LD MY     NQ  +  G+   GSA+SVA  S      L            T+
Sbjct  464   GGFDTLLLDSMY-----NQKPSLQGMNGYGSASSVAIRSEATMLALPA--------PPTS  510

Query  342   ASGA-DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSS  166
              +G+ DPFAAS+ VAPPAYVQMSE+E +QRLL EEQ +WQQY K+GM GQVG    QQ +
Sbjct  511   RNGSQDPFAASMLVAPPAYVQMSEMETRQRLLAEEQAIWQQYAKNGMQGQVGFATQQQPN  570

Query  165   QPHNYY--GY  142
                N+Y  GY
Sbjct  571   S--NFYMGGY  578



>dbj|BAC43049.1| putative protein destination factor [Arabidopsis thaliana]
Length=611

 Score =   360 bits (924),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 242/479 (51%), Positives = 320/479 (67%), Gaps = 20/479 (4%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD S+S+ WDYSAFVRTY+LYLDE+++ RMQ RRGK  +   G  
Sbjct  112   FATRRGTRLLNMSDFRDASQSDSWDYSAFVRTYALYLDERLDYRMQGRRGKKKSGGGGGG  171

Query  1395  egveeede----eeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAA  1228
             +G   E++          + AIVV   P+ EMK E +++R+QH  Q+LDRFLAC+PTG A
Sbjct  172   DGDSGEEDDHRGTSNDIRSKAIVVKSKPVAEMKTEKIFNRVQHLQQLLDRFLACRPTGNA  231

Query  1227  KRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDEL  1048
             K NR+V+VA+Y +VKESFQ+YY+I E++G+L++RFM+LDI DS KV+EIF RV+KQ+DEL
Sbjct  232   KNNRVVIVAMYPIVKESFQLYYNITEIMGVLIERFMELDIHDSIKVYEIFCRVSKQFDEL  291

Query  1047  EVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveev  868
             + FY W K   ++R SEYP++E   ++KLD+M+E IR+K  +A      S + S + EE 
Sbjct  292   DPFYGWCKNMAVARSSEYPELEKITQKKLDLMDEFIRDKSALAAQTTKSSSKRSNKSEEE  351

Query  867   eepep-eaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKE----QDI-GDLLNLGED  706
             E       E +ED+N+IKALP P +   EE        ++ +E    QD  GDLL+L ++
Sbjct  352   ESKTEYIQENQEDLNSIKALPAPEQKEEEEEEEKMETKKDVEEVVSRQDQEGDLLDLTDE  411

Query  705   AP-TPEEHANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTASHLSNQKA  532
             A  T     + LALALFDG   +  T++     W AFN  S DWET LV++A+ LS QK+
Sbjct  412   AGVTAGTVGDSLALALFDG---VVGTESASGPGWGAFNDNSADWETDLVRSATRLSGQKS  468

Query  531   QFPGNFDELMLDGMYRQGALNQAV-ASSGVLTTGSATSVAFGSAGRpamlalpappssAD  355
             +  G FD L+LDGMY+ GA+N AV  S+   ++GSA+SVAFGSAG PA   L  P     
Sbjct  469   ELGGGFDTLLLDGMYQYGAVNAAVKTSTAYGSSGSASSVAFGSAGSPAASMLALPAPPPT  528

Query  354   ANTTASG---ADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGL  187
             AN   +     DPFAASL VAPPAYVQM+++EKKQRLL EEQ MW QY + G  G +  
Sbjct  529   ANGNRNSPVMVDPFAASLEVAPPAYVQMNDMEKKQRLLMEEQIMWDQYNRSGRQGHMNF  587



>ref|XP_010270464.1| PREDICTED: putative clathrin assembly protein At4g02650 [Nelumbo 
nucifera]
Length=590

 Score =   354 bits (908),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 240/498 (48%), Positives = 312/498 (63%), Gaps = 39/498 (8%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQN-RRGKHSALASgn  1399
             F TR GTRLLN+SDFRD S+SN WD+SAFVRT++LYLDE++E RM   RR +  A  +  
Sbjct  111   FCTRHGTRLLNLSDFRDASKSNSWDFSAFVRTFALYLDERLEYRMHGGRRVRRKAFRADE  170

Query  1398  eegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRN  1219
             +   +       T              EM  E +++R+Q+ +Q+L+RFLAC+PTG AK N
Sbjct  171   DNEEDSPPPPVCTTPVH----------EMNTEQIFARVQNLMQLLERFLACRPTGKAKNN  220

Query  1218  RLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVF  1039
             RLV+VALY ++KESFQ+YY IAE++ ILVDRFM+L + D  KVH IF R++KQ+D+L++F
Sbjct  221   RLVVVALYPILKESFQIYYDIAEVMAILVDRFMELAVADCVKVHGIFTRLSKQFDQLDIF  280

Query  1038  YTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveep  859
             Y WSK+ GI+R SE P VE    +KL +M++ IR+K  M+  +    ++    +   ++ 
Sbjct  281   YNWSKSTGIARSSECPKVERILPKKLQLMDDFIRDKSIMS--QRTPKKQDLETLIVEDQR  338

Query  858   epeaeaeEDMNTIKALPPPPEDF----------IEEMAVVEAPTEEKKEQDIGDLLNLGE  709
                AE  E++  IKAL PPPE F           EE+   E  TE+   Q   DLLNL +
Sbjct  339   VHAAEVVENLTRIKAL-PPPEHFSEIKIEEVKVKEEVERKEKVTEKSNPQQEADLLNLWD  397

Query  708   DAP---TPEEHANQLALALFDGiptidptkttittPWEAFN--GSEDWETALVQTASHLS  544
             DA      EEH  +LALALFDG        +     W  F   GS DWET LV++AS+LS
Sbjct  398   DADAAVASEEHGEKLALALFDG-----TAASPAVPAWGGFTLGGSADWETELVESASNLS  452

Query  543   NQKAQFPGNFDELMLDGMYRQGALNQAVASSGVL-TTGSATSVAFGSAGRpamlalpapp  367
             N K +  G FD LMLDGMYRQ     A  + G     GSA+SV   S+G+P MLAL  PP
Sbjct  453   NHKLELGGGFDMLMLDGMYRQQKTAYAPTTMGNYGAAGSASSVVLASSGKPPMLALLPPP  512

Query  366   ssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGL  187
             +S +  T   G DPFAASLSV PP YVQ+SE+EKKQRLL EEQ MWQQY +DGM GQ+GL
Sbjct  513   NSCNGATEVYG-DPFAASLSVPPPPYVQISEMEKKQRLLAEEQFMWQQYARDGMQGQLGL  571

Query  186   EKAQQSSQPHNYYGY*YS  133
             EK Q +  P+N  GY Y+
Sbjct  572   EKLQMN--PYNMGGYNYA  587



>ref|XP_009382940.1| PREDICTED: LOW QUALITY PROTEIN: putative clathrin assembly protein 
At1g03050 [Musa acuminata subsp. malaccensis]
Length=581

 Score =   352 bits (902),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 231/483 (48%), Positives = 305/483 (63%), Gaps = 26/483 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTR+LNMSDFRD S ++ WD+S+FVRTY+LYLDE+++ RM      H        
Sbjct  111   FATRRGTRMLNMSDFRDNSGADAWDFSSFVRTYALYLDERLDYRM------HGRRKRRGS  164

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                  +DEEEE     A     TP+ EM  + +++R +H   +L+RFLAC+PTGAAK +R
Sbjct  165   RSNINDDEEEEAAAAAATSSKATPVREMTTDRIFARTRHLQHMLERFLACRPTGAAKHDR  224

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V VALY +VKESFQ+YY + E++ I +DRFM L++P+   +HEIF R+AKQ+DEL++FY
Sbjct  225   IVAVALYPLVKESFQIYYDLTEIMNIFIDRFMDLEVPECVCIHEIFSRLAKQFDELDLFY  284

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
              WSK+AG+ R SEYP+VE    +KLD+M+E IR+K  +A  +  RS E   +        
Sbjct  285   GWSKSAGVCRSSEYPEVERISPKKLDVMDEFIRDKAALAHAKEQRSLEADRDPPTTRTRP  344

Query  855   peaeaeEDMNTIKALPPPPED---FIEEMAVV--EAPTEEKKEQDIGDLLNLGEDAPTPE  691
              + E E +MN+IK LP P  D     +E AV   +   EE+KE++  DLLNL EDA T E
Sbjct  345   EDDEPEYEMNSIKTLPAPEADAEATQQEQAVAEVKVDKEEEKEEEEVDLLNLKEDAMTGE  404

Query  690   EHANQLALALFDGiptidptkttittPWEAF-NG-SEDWETALVQTASHLSNQKAQFPGN  517
             EH N LALALFD         +      EAF NG S +WE ALV+TAS+LS QKA   G 
Sbjct  405   EHGNMLALALFD-----RHMSSDAAPKCEAFPNGDSSNWEMALVETASNLSGQKASLGGG  459

Query  516   FDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTAS  337
             FD ++LDGMY      +A A++G     S ++ +      PA   L  P  + D  T   
Sbjct  460   FDMMLLDGMY-----TKAQATAGYGCASSGSASSVVVHAPPAKPMLALPAPAVDGATYGG  514

Query  336   GADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPH  157
             G DPFAASL V PP+YVQMS++EKKQ LL EEQ++WQQY KDGM GQ+ L K QQ  Q +
Sbjct  515   GGDPFAASLMVPPPSYVQMSDMEKKQHLLTEEQRVWQQYAKDGMQGQLALAKLQQ--QQY  572

Query  156   NYY  148
              Y+
Sbjct  573   QYH  575



>ref|XP_009420267.1| PREDICTED: putative clathrin assembly protein At1g03050 [Musa 
acuminata subsp. malaccensis]
Length=624

 Score =   344 bits (883),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 220/467 (47%), Positives = 294/467 (63%), Gaps = 55/467 (12%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDSR-SNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATR G+R+LNMS FRDS  S+ WD+SAFVRT++LYLDE+++ RM  RR   S+ ++  E
Sbjct  181   FATRCGSRMLNMSHFRDSSGSDAWDFSAFVRTFALYLDERLDYRMHGRRKWRSSRSNIYE  240

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             E V+EE        ++      TP+ EM  +++++R +H   +L+RFLAC+PTGAAK+NR
Sbjct  241   EEVDEETAAAAEAASSK---ASTPLKEMTTDHVFARTRHLQHMLERFLACRPTGAAKQNR  297

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +V VALY +VKESFQ+YY +AE++ I VDRF  L++PD   VHEIF R AKQ DEL++FY
Sbjct  298   VVHVALYPLVKESFQIYYDLAEIMNIFVDRFTDLEVPDCVSVHEIFSRHAKQLDELDLFY  357

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
              WSK+AGI R SEYPDV     +KL++++E IR+K  +A  +            E +   
Sbjct  358   DWSKSAGICRCSEYPDVVRITPKKLEVIDEFIRDKATLAHAK-------RQPSPEPDPAP  410

Query  855   peaeaeEDMNTIKALPPPPEDF---IEEMAVV-----EAPTEEKKEQDIGDLLNLGEDAP  700
             P+ E++ +M+ IKALPPP  D     +E+AVV     ++  ++K+E++  D LNL EDA 
Sbjct  411   PQDESQCEMDGIKALPPPAADAEGSKQELAVVVKVKDDSLEKKKEEEEAVDFLNLKEDAM  470

Query  699   TPEEHANQLALALFDGiptidptkttittPWEAF--NGSEDWETALVQTASHLSNQKAQF  526
             T EEH  +LALALFDG              WEAF  +   DWET LVQTAS+LS QKA F
Sbjct  471   TGEEHGEKLALALFDG-----GLSADAAPKWEAFVNDDPSDWETTLVQTASNLSGQKASF  525

Query  525   PGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANT  346
              G  + ++L GMY Q A  QA    G + +GSA+SVA                       
Sbjct  526   GGGLEMVLLGGMYAQ-AQAQAGVGHGYVVSGSASSVA-----------------------  561

Query  345   TASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGM  205
                  DPFAASL V PP+YVQMS++EK+QRLL EEQQ+WQQY K GM
Sbjct  562   ----GDPFAASLMVPPPSYVQMSDMEKQQRLL-EEQQVWQQYAKVGM  603



>ref|XP_010911081.1| PREDICTED: putative clathrin assembly protein At2g25430 [Elaeis 
guineensis]
Length=633

 Score =   339 bits (869),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 218/522 (42%), Positives = 298/522 (57%), Gaps = 71/522 (14%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRM----QNRRGKHSALA  1408
             +ATRRGTRLLNMSDFRD + SN WD+SAFVRTY+LYLD+++E  +    Q+  G  +   
Sbjct  110   YATRRGTRLLNMSDFRDDTHSNSWDHSAFVRTYALYLDQRLECMVYEQKQHGSGNGNGRP  169

Query  1407  SgneegveeedeeeetgntTAIVVTG-------------------TPITEMKNEYLYSRI  1285
               +  G  +       G ++     G                   TP+ +MK E +  R+
Sbjct  170   YQSPRGEPDPYTYGSYGRSSYSSPQGNGSAGYYDERRRGEERKPPTPLRDMKPERVLGRM  229

Query  1284  QHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIP  1105
              H  Q+LDRFLAC+PTGAAK +R++L+ALY +V+ESFQ+Y  I E+L +L+DRF  +D P
Sbjct  230   HHLQQLLDRFLACRPTGAAKHSRMILIALYPIVRESFQLYADICEILAVLLDRFFDMDYP  289

Query  1104  DSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekme  925
             D  K  E +   AKQ DEL +FY W K  G++R SEYP+V+    + L+ +EE +R++  
Sbjct  290   DCVKAFEAYASAAKQIDELCLFYGWCKDTGVARSSEYPEVQRITVKLLETLEEFMRDRAR  349

Query  924   MAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIE-----EMAVVEAP  760
                         +   +E      + E  +DMN+IKALP P  D+ E     E  VV+ P
Sbjct  350   RP----------TSPPKEAAPETVDEEPAQDMNSIKALPAP-SDYTEQKPEPEPEVVQPP  398

Query  759   TEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN-----  595
               +K++Q+  DLLNL +DAP+ E+ +N+LALALF G    + T  +    WEAF      
Sbjct  399   --KKQQQEESDLLNLRDDAPSAEDQSNKLALALFSGPGAANSTNGS----WEAFPSNGAP  452

Query  594   ----------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQA  463
                             G  DWE ALV+TAS+L  QKA   G FD L+L+GMY QGA+ Q 
Sbjct  453   GQGEVTSAWQTPAAEPGKADWELALVETASNLVKQKATLGGGFDPLLLNGMYDQGAVRQH  512

Query  462   VASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQ  283
             V +   ++TGSA+SVA    G+     L  P    D      G DPFAASLS  PP+YVQ
Sbjct  513   VNAQ--MSTGSASSVALPGLGQKTTPVLALPAP--DGTVETIGQDPFAASLSYPPPSYVQ  568

Query  282   MSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPH  157
             M+++EKKQ+ L +EQQMWQQY++DGM GQ  L K   S  P+
Sbjct  569   MADMEKKQQWLVQEQQMWQQYSRDGMQGQASLAKLNNSYFPN  610



>ref|XP_010911649.1| PREDICTED: putative clathrin assembly protein At1g03050 [Elaeis 
guineensis]
Length=585

 Score =   336 bits (861),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 221/470 (47%), Positives = 302/470 (64%), Gaps = 17/470 (4%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
             ATRRG R+LN++DFRD SRS+ WD+SAFVRTY+LYLDE++E R+  RR +  + +S   +
Sbjct  112   ATRRGMRMLNLADFRDTSRSDAWDFSAFVRTYALYLDERLEYRVHGRRKRRRSRSSICTD  171

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRL  1213
               EEE    E     A     TP+ EMK + L+ R Q   Q+++R LAC+PTGAAK NR+
Sbjct  172   EEEEEAAVVEAAAARA-----TPVREMKTDRLFIRTQRLQQLMERVLACRPTGAAKNNRI  226

Query  1212  VLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYT  1033
             V VALY +VKESFQ+YY +AE++ I +DRFM+L +P+  +VH IF R+++Q+++LEVFY 
Sbjct  227   VHVALYPLVKESFQIYYDLAEIMNIFIDRFMELQVPECVRVHGIFSRLSRQFEDLEVFYG  286

Query  1032  WSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepep  853
             W +  GI R S+YP+VE    +KLD+M++ IR+K  +A   I + R+  PE ++ + PE 
Sbjct  287   WCRTVGICRSSDYPEVERITAKKLDVMDDFIRDKSRLAD--IKKHRDFDPEPDDAKPPEE  344

Query  852   eaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGED-APTPEEHANQ  676
             E E ++D++ IKAL PPPED+  E        E ++ ++  DLLNL +D A T E++ + 
Sbjct  345   EEEPDDDISNIKAL-PPPEDYYSEPPAEHKEEELQQLEEEVDLLNLKDDHAVTGEQYGDS  403

Query  675   LALALFDGiptidptkttittPWEAFN--GSEDWETALVQTASHLSNQKAQFPGNFDELM  502
             LALALFDG      T +     WEAF    S DWETALVQ+AS+LS QKA   G FD L+
Sbjct  404   LALALFDG-----NTASDTAPKWEAFTDCDSSDWETALVQSASNLSGQKAALGGGFDMLL  458

Query  501   LDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPF  322
             LDGMY Q   +   A+      GS ++ +           L  P       T   G DPF
Sbjct  459   LDGMYAQAHTSATAAAQAQGYGGSGSASSVAIRAPALQPMLALPAPPTSGGTNILGGDPF  518

Query  321   AASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQ  172
              ASL V PP+YVQMS++EKKQ+LL EEQQ+W+QY +DGM GQ+GL   QQ
Sbjct  519   TASLMVPPPSYVQMSDMEKKQQLLSEEQQLWKQYARDGMQGQLGLATLQQ  568



>ref|XP_008810593.1| PREDICTED: putative clathrin assembly protein At2g25430 [Phoenix 
dactylifera]
 ref|XP_008810594.1| PREDICTED: putative clathrin assembly protein At2g25430 [Phoenix 
dactylifera]
Length=630

 Score =   332 bits (851),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 213/527 (40%), Positives = 289/527 (55%), Gaps = 71/527 (13%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVEL------RMQNRRGKHSA  1414
             +ATRRGTRLLNMSDFRD + SN WD+SAFVRTY+LYLD+++E       ++  R G    
Sbjct  110   YATRRGTRLLNMSDFRDDAHSNSWDHSAFVRTYALYLDQRLECIVYEQKQLGGRNGNSRP  169

Query  1413  LASgneegveeedeeeetgntTAIVVTG----------------TPITEMKNEYLYSRIQ  1282
               S   E            + ++    G                TP+ +MK E +  R+ 
Sbjct  170   YQSPRGEPDPYTYGSYGRSSYSSPPGIGSGGYDERQRGEERKPPTPLRDMKPERVLGRMH  229

Query  1281  HYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPD  1102
             H  Q+LDRFLAC+PTGAAK +R++L+ALY +V+ESFQ+Y  I E+L +L+DRF  +D PD
Sbjct  230   HLQQLLDRFLACRPTGAAKHSRMILIALYPIVRESFQLYADICEILAVLLDRFFDMDYPD  289

Query  1101  SKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeM  922
               K  E +   AKQ DEL +FY W K  G++R SEYP+V+    + L+ +EE +R++   
Sbjct  290   CVKAFEAYASAAKQIDELCLFYGWCKDTGVARSSEYPEVQRITDRLLETLEEFMRDRARR  349

Query  921   AGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMA------VVEAP  760
                             E      + E  +DMN+IKALP P  D  E+        V E P
Sbjct  350   P----------KSPPREPAPETGDEEPAQDMNSIKALPAP-SDCTEQRPEPEPEKVAEPP  398

Query  759   TEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN-----  595
               +K++Q+  DLLNL +DAP+ E+ +N+LALALF G    +    +    WEAF      
Sbjct  399   --KKQQQEETDLLNLRDDAPSAEDQSNKLALALFSGPGAANRANGS----WEAFPSNGAP  452

Query  594   ----------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQA  463
                             G  DWE ALV+TAS+L  QKA   G FD L+L+GMY QGA+ Q 
Sbjct  453   GQGEVTSAWQTPAAEPGKADWELALVETASNLVKQKATLGGGFDPLLLNGMYDQGAVRQH  512

Query  462   VASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQ  283
               ++  ++TGSA+SVA    G+     L  P    D      G DPFAASLS  PP+YVQ
Sbjct  513   --ANAQMSTGSASSVALPGLGQKTTPVLALPAP--DGTIETIGQDPFAASLSYPPPSYVQ  568

Query  282   MSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYGY  142
             M+++E KQ+ L  EQ+MWQQY +DGM GQ  L +   S  P+    Y
Sbjct  569   MADMESKQQFLVREQRMWQQYARDGMQGQASLARLNNSYFPNPAMPY  615



>ref|XP_006851331.1| hypothetical protein AMTR_s00050p00195040 [Amborella trichopoda]
 gb|ERN12912.1| hypothetical protein AMTR_s00050p00195040 [Amborella trichopoda]
Length=629

 Score =   330 bits (845),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 219/501 (44%), Positives = 287/501 (57%), Gaps = 54/501 (11%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRM----QNRRGKHSA--  1414
             +ATRRGTRLLNMSDFRD S+S+ WDYSAFVRTY+LYLDE++EL++    Q  R +     
Sbjct  110   YATRRGTRLLNMSDFRDESQSHAWDYSAFVRTYALYLDERLELKVYESKQGSRDRRPPDY  169

Query  1413  ----------LASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQIL  1264
                         S      +    + +           TP+ EMK E +  ++QH  Q+L
Sbjct  170   DRDSNDYNYNARSPGHYDRDRGYYDRDRDERRPPAAPSTPLREMKIERVLGKMQHLQQLL  229

Query  1263  DRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHE  1084
             DRFLAC+PTG AK++R+VL+ALY +V+ESFQ+Y  I E+L +L+DRF  ++     K  +
Sbjct  230   DRFLACRPTGTAKQSRMVLIALYPIVRESFQLYADICEVLAVLLDRFFDMEYAHCVKAFD  289

Query  1083  IFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIM  904
             ++   AKQ DEL   Y W K  G++R SEYP+V+    + LD ++E +R++      R  
Sbjct  290   VYTSAAKQIDELAALYGWCKNTGVARSSEYPEVQRISDKLLDTLDEFVRDRANQ--DRKP  347

Query  903   rsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDL  724
             +S EP        E     E E DM +IKALP PPE + E+   + +   EK +Q+ GDL
Sbjct  348   KSPEPEAPAPPPPEEPKLEEEEPDMRSIKALPAPPE-WDEQQQQLPS---EKPKQETGDL  403

Query  723   LNLGEDAPTPEEHANQLALALF--DGiptidptkttittPWEAF----------------  598
             +NL EDA T E+ AN+ ALALF  DG      +       WEAF                
Sbjct  404   VNLSEDAVTLEDQANKFALALFSADGAKAASGSS------WEAFPSSGKEEVTSAWQLAE  457

Query  597   NGSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVL--TTGSAT  424
              G  +WE ALV++AS+LS QKA   G FD L+LDGMY QG   Q     GVL  + GSA+
Sbjct  458   TGKAEWELALVESASNLSKQKATLAGGFDPLLLDGMYEQGESKQ---QQGVLLNSGGSAS  514

Query  423   SVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWE  244
             SV    A R         P  A      SG DPFAASL+V PP YVQMS+LEKKQ+ L +
Sbjct  515   SVVL-PAHRGGTFLALPAPPGAPV-VAQSGEDPFAASLAVPPPPYVQMSDLEKKQQFLTQ  572

Query  243   EQQMWQQYTKDGMHGQVGLEK  181
             EQQ+WQQY KDGM GQ+GL K
Sbjct  573   EQQLWQQYAKDGMQGQLGLAK  593



>ref|NP_001146051.1| uncharacterized protein LOC100279582 [Zea mays]
 gb|ACL53111.1| unknown [Zea mays]
 gb|ACN36345.1| unknown [Zea mays]
 tpg|DAA44661.1| TPA: LOW QUALITY PROTEIN: putative ENTH/ANTH/VHS superfamily 
protein isoform 1 [Zea mays]
 tpg|DAA44662.1| TPA: LOW QUALITY PROTEIN: putative ENTH/ANTH/VHS superfamily 
protein isoform 2 [Zea mays]
Length=639

 Score =   320 bits (821),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 213/524 (41%), Positives = 288/524 (55%), Gaps = 69/524 (13%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR------------  1429
             ATRRGTRLLN+SDFRD + S  WD+SAFVRTY+LYLD+++E  +  R+            
Sbjct  111   ATRRGTRLLNLSDFRDEAHSGSWDHSAFVRTYALYLDQRLEFFLHERKQGSNAGSSSSTN  170

Query  1428  ----------------GKHSALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYL  1297
                             G+ S   S        +D  E  G         TP+ +MK E +
Sbjct  171   GPSPRDRDRWGSPDPYGRRSPSYSSPPGYGGYDDYRERNGGNNDDKRPPTPVRDMKPEQV  230

Query  1296  YSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMK  1117
              +R+ H  Q+LDRFLAC+PTG AK +R+VLVALYQ+V+ESFQ+Y  I E+L +L+DRF  
Sbjct  231   LARMHHLQQLLDRFLACRPTGGAKHSRMVLVALYQIVRESFQLYADICEVLAVLLDRFFD  290

Query  1116  LDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiir  937
             ++  +  K  E +   AKQ DEL  FY W K  G++R SEYP+V+    + L+ +EE +R
Sbjct  291   MEYAECVKAFEAYASAAKQIDELCAFYAWCKDTGVARSSEYPEVQRVTDKLLETLEEFMR  350

Query  936   ekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPT  757
             ++ +                 E E    + E E DMN+IKALP P ED+ E         
Sbjct  351   DRAKRP----------KSPSPEPEPEPVKEEPEPDMNSIKALPAP-EDYKEPEPEKVEEE  399

Query  756   EEKKE--QDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN----  595
              + +   Q  GDL++L ED  + +E  N+LALALF G P    +  +    WEAF     
Sbjct  400   VKPEPPLQPQGDLVDLREDTVSADEQGNRLALALFQGPPAAGGSNGS----WEAFPSNGG  455

Query  594   --------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVA  457
                           G  DWE ALV+TAS+LSNQK    G  D L+L+GMY QG + Q V 
Sbjct  456   NEVTSAWQNPAAEPGKADWELALVETASNLSNQKPAMSGGMDPLLLNGMYDQGVVRQHVG  515

Query  456   SSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMS  277
             +   +TTGSA+SVA  + G+   +     P   D +    G DPFAASL+V PP+YVQM+
Sbjct  516   AQ--VTTGSASSVALPAPGQKTQMLALPAP---DGSMQTVGGDPFAASLAVPPPSYVQMA  570

Query  276   ELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             +LEKKQ+LL +EQ MWQQY +DGM GQ  L +  ++  P   YG
Sbjct  571   DLEKKQQLLTQEQIMWQQYQRDGMQGQSSLNRLDRAPNPAMPYG  614



>ref|XP_004984734.1| PREDICTED: putative clathrin assembly protein At2g25430-like 
[Setaria italica]
Length=641

 Score =   317 bits (811),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 209/508 (41%), Positives = 280/508 (55%), Gaps = 65/508 (13%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR------------  1429
             ATRRGTRLLN+SDFRD + S  WD+SAFVRTY+LYLD+++E  +  R+            
Sbjct  111   ATRRGTRLLNLSDFRDEAHSGSWDHSAFVRTYALYLDQRLEFFLHERKQGSNAGSSANGP  170

Query  1428  ------------GKHSALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRI  1285
                         G+ S   S        +D  E  G         TP+ +MK E + +R+
Sbjct  171   SPRDRWGSPDPYGRRSPSYSSPPGYGGYDDYRERNGGNNDDKRPPTPVRDMKPERVLARM  230

Query  1284  QHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIP  1105
              H  Q+LDRFLAC+PTG AK +R+VLVALYQ+V+ESFQ+Y  I E+L +L+DRF  ++  
Sbjct  231   HHLQQLLDRFLACRPTGGAKHSRMVLVALYQIVRESFQLYADICEVLAVLLDRFFDMEYA  290

Query  1104  DSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekme  925
             +  K  E +   AKQ DEL  FY W K  G++R SEYP+V+    + L+ +EE +R++ +
Sbjct  291   ECVKAFEAYASAAKQIDELCAFYAWCKDTGVARSSEYPEVQRVTDKLLETLEEFMRDRAK  350

Query  924   MAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKK  745
                              E E    + E E DMN IKALP P EDF            + +
Sbjct  351   RP----------KSPPREPEPEPVKEEPEPDMNEIKALPAP-EDFKVPEPEKVEEEVKPE  399

Query  744   E--QDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN--------  595
                Q  GDL++L ED  + +E  N+LALALF G P    +  +    WEAF         
Sbjct  400   PPPQPQGDLVDLREDTVSADEQGNRLALALFQGPPAAGGSNGS----WEAFPSNGGNEVT  455

Query  594   ----------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGV  445
                       G  DWE ALV+TAS+LS QK    G  D L+L+GMY QGA+ Q V+    
Sbjct  456   SAWQNPAAEPGKADWELALVETASNLSKQKPAMSGGMDPLLLNGMYDQGAVRQHVSQQ--  513

Query  444   LTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEK  265
             +TTGSA+SVA  + G+   +     P   D +    G DPFAASL++ PP+YVQM++LEK
Sbjct  514   VTTGSASSVALPAPGQKTQVLALPAP---DGSMQTVGGDPFAASLTIPPPSYVQMADLEK  570

Query  264   KQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             KQ+ L +EQ MWQQY +DGM GQ  L K
Sbjct  571   KQQFLTQEQMMWQQYQRDGMQGQSSLNK  598



>ref|XP_008784532.1| PREDICTED: putative clathrin assembly protein At2g25430 [Phoenix 
dactylifera]
Length=640

 Score =   316 bits (810),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 213/528 (40%), Positives = 281/528 (53%), Gaps = 82/528 (16%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLY----LDEQVELRMQNRRGK-----  1423
             +ATRRGTRLLNM+DFRD + SN WD+SAFVRTY+LY    L+  V  + Q+  GK     
Sbjct  110   YATRRGTRLLNMADFRDDTHSNSWDHSAFVRTYALYLDQRLECMVYEQKQHGSGKSRSYQ  169

Query  1422  -----------HSALASgneegveeedeeeetgntTAIVV------------TGTPITEM  1312
                        HS     +            +       V              TP+ +M
Sbjct  170   SPRDHYRSPPRHSDYREPDAYTYGSYGRSSSSSPPGNGSVGYEERQRGEERKPPTPLRDM  229

Query  1311  KNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILV  1132
             K E +  R+    Q+LDRFLAC+PTGAAK +R++L+ALY +V+ESFQ+Y  I E+L +L+
Sbjct  230   KPERVLGRMHQLQQLLDRFLACRPTGAAKHSRMILIALYPIVRESFQLYADICEILAVLL  289

Query  1131  DRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDim  952
             DRF  +D PD  K  E +   AKQ DEL  FY W K  G++R SEYP+V+    + L+ +
Sbjct  290   DRFFDMDYPDCVKAFEAYASAAKQIDELCAFYGWCKDTGVARSSEYPEVQRITDKLLETL  349

Query  951   eeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMA-  775
             EE +R+K                   E      E E  +DMN+IKALP P  D+ E+   
Sbjct  350   EEFMRDKARRP----------KSPPRETAPETLEEEPAQDMNSIKALPAP-SDYKEQQPE  398

Query  774   -----VVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                  VVE P   K++Q   DL+NL +DA + E+ +++LALALF G      T  +    
Sbjct  399   PEPEKVVEPP---KRQQQDTDLVNLRDDASSAEDQSSKLALALFSGPGAATGTNGS----  451

Query  609   WEAFN---------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDG  493
             WEAF                      G  DWE ALV+T S+L+ QKA   G FD L+L+G
Sbjct  452   WEAFPSNGAPGQGEVTSAWQTPAAEPGKADWELALVETTSNLAKQKAALAGGFDPLLLNG  511

Query  492   MYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAAS  313
             MY QGA+ Q V +   ++TGSA+SVA    G+     L  P    D      G DPFAAS
Sbjct  512   MYDQGAVRQQVKAQ--VSTGSASSVALPGLGQKTTPVLALPAP--DGTVETIGQDPFAAS  567

Query  312   LSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQS  169
             LS  PP+YVQM+++E KQ+LL  EQQ+WQQY KDGM GQ  L K   S
Sbjct  568   LSFPPPSYVQMADMENKQQLLVHEQQIWQQYAKDGMQGQASLAKLNNS  615



>gb|AES91572.2| clathrin assembly plant-like protein, putative [Medicago truncatula]
Length=601

 Score =   315 bits (807),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 205/492 (42%), Positives = 291/492 (59%), Gaps = 36/492 (7%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
             ATR G R+ NMSDFRD + S+ WD++ FVR Y++YLD++VE  + N++ K    +   E 
Sbjct  111   ATRSGMRVFNMSDFRDEAHSSSWDHAGFVRVYAMYLDQKVEFLVYNKKLKGVVDSGDGEF  170

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRL  1213
             G  + +EE+            TP+ EMK E +  R++H +QILD  L CKP GAAK NRL
Sbjct  171   GSVKRNEEKSDV---------TPVREMKAERVLDRLKHLLQILDSVLGCKPHGAAKNNRL  221

Query  1212  VLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYT  1033
             VLVA+YQ+V++SF++Y  I ++LG+L+DRFM+++     +  E +   +K  DEL  FY 
Sbjct  222   VLVAIYQIVRDSFKLYVEICDVLGVLMDRFMEMEYAHCVQAFEFYVSASKMMDELAGFYG  281

Query  1032  WSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepep  853
             W K  GI+R SEYP+V+      L  +E  ++E  +         + P  ++E       
Sbjct  282   WCKDTGIARSSEYPEVQKITDSLLGTLEGFLKEMSDRT-------KSPEKKLEVKVITLK  334

Query  852   eaeaeEDMNTIKALPPPPEDFI----EEMAVVEAPTEEKK-EQDIGDLLNLGEDAPTPEE  688
             E E E   N +KALP P    +    ++  V   P E  + +Q+ G+L+NL ED  + +E
Sbjct  335   EQEPEAYANEVKALPAPEVKNLTPRPQQPPVALQPKETPRVQQETGELVNLREDGVSADE  394

Query  687   HANQLALALFDGiptidpt-------kttittPWE---AFNGSEDWETALVQTASHLSNQ  538
               N+ ALALF G  T+           + +T+ WE   A  G  DWE ALV+T+S+LS Q
Sbjct  395   QGNKFALALFSGASTVKTEGLWEEFGSSKVTSAWETPAAEIGKADWELALVETSSNLSKQ  454

Query  537   KAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssA  358
             KA   G FD L+L+GMY QGA+ Q V+++ V + GSA+SVA    G+ A+  L  P    
Sbjct  455   KADLGGGFDSLILNGMYDQGAVRQHVSTTEV-SGGSASSVALPGVGKSAIPILALPAP--  511

Query  357   DANTTASGA-DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             D    A G  DPFAASLSV PP+YVQ++E+E+KQ LL +EQQ+WQQY +DGM GQ+GL +
Sbjct  512   DGTMQAVGTQDPFAASLSVPPPSYVQIAEMERKQHLLVQEQQLWQQYGRDGMQGQLGLTR  571

Query  180   AQQSSQPHNYYG  145
                 SQP   YG
Sbjct  572   VGAGSQPMMSYG  583



>ref|XP_006649844.1| PREDICTED: putative clathrin assembly protein At2g25430-like 
[Oryza brachyantha]
Length=643

 Score =   316 bits (809),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 213/508 (42%), Positives = 281/508 (55%), Gaps = 63/508 (12%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
             ATRRGTRLLN+SDFRD + S  WD+SAFVRTY++YLD+++E  +  R+   +A +S N  
Sbjct  111   ATRRGTRLLNLSDFRDEAHSGSWDHSAFVRTYAMYLDQRLEFFLHERKQGSNASSSANGP  170

Query  1392  gveeedeeeetgntTAIVVTG--------------------------TPITEMKNEYLYS  1291
                +     +     +   +                           TP+ +MK E +  
Sbjct  171   SPRDRWGSPDPYGRRSPSYSSPPGNGYGGYDDYRERNGNNADDKKPPTPVRDMKPERVLG  230

Query  1290  RIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLD  1111
             R+ H  Q+LDRFLAC+PTG AK +R+VLVALYQ+V+ESFQ+Y  I E+L +L+DRF  ++
Sbjct  231   RMHHLQQLLDRFLACRPTGGAKHSRMVLVALYQIVRESFQLYADICEVLAVLLDRFFDME  290

Query  1110  IPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirek  931
               +  K  E +   AKQ DEL  FY W K  G++R SEYP+V+    + L+ +EE +   
Sbjct  291   YAECVKAFEAYASAAKQIDELCAFYGWCKETGVARSSEYPEVQRVTDKLLETLEEFM---  347

Query  930   meMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEE  751
                   R    R  SP  E   EP  E E E+DMN IKALP P +    E   VE    E
Sbjct  348   ------RDRAKRPKSPPREPEPEPVKEEEPEQDMNDIKALPAPEDYKEPEPEKVEEVKPE  401

Query  750   KKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN--------  595
                Q  GDL++L E+  T +E  N+LALALF G P    +  +    WEAF         
Sbjct  402   PPPQPQGDLVDLREETVTADEQGNRLALALFQGPPAAGGSNGS----WEAFPSNGGNEVT  457

Query  594   ----------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGV  445
                       G  DWE ALV+TAS+LS QKA   G  D L+L+GMY QGA+ Q V +   
Sbjct  458   SAWQNPAAEPGKADWELALVETASNLSKQKATMTGGMDSLLLNGMYDQGAVRQHVNAQ--  515

Query  444   LTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEK  265
             +TTGSA+SVA    G+   +     P   D +    G DPFAASLS  PP+YVQM+E+EK
Sbjct  516   VTTGSASSVALPQPGQKTQVLALPAP---DGSMQNVGGDPFAASLSFPPPSYVQMAEMEK  572

Query  264   KQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             KQ+ L +EQ MWQQY +DGM GQ  L K
Sbjct  573   KQQFLTQEQMMWQQYQRDGMQGQASLSK  600



>ref|XP_003609375.1| epsin N-terminal homology (ENTH) domain-containing protein [Medicago 
truncatula]
Length=630

 Score =   315 bits (808),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 205/492 (42%), Positives = 291/492 (59%), Gaps = 36/492 (7%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
             ATR G R+ NMSDFRD + S+ WD++ FVR Y++YLD++VE  + N++ K    +   E 
Sbjct  111   ATRSGMRVFNMSDFRDEAHSSSWDHAGFVRVYAMYLDQKVEFLVYNKKLKGVVDSGDGEF  170

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRL  1213
             G  + +EE+            TP+ EMK E +  R++H +QILD  L CKP GAAK NRL
Sbjct  171   GSVKRNEEKSDV---------TPVREMKAERVLDRLKHLLQILDSVLGCKPHGAAKNNRL  221

Query  1212  VLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYT  1033
             VLVA+YQ+V++SF++Y  I ++LG+L+DRFM+++     +  E +   +K  DEL  FY 
Sbjct  222   VLVAIYQIVRDSFKLYVEICDVLGVLMDRFMEMEYAHCVQAFEFYVSASKMMDELAGFYG  281

Query  1032  WSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepep  853
             W K  GI+R SEYP+V+      L  +E  ++E  +         + P  ++E       
Sbjct  282   WCKDTGIARSSEYPEVQKITDSLLGTLEGFLKEMSDRT-------KSPEKKLEVKVITLK  334

Query  852   eaeaeEDMNTIKALPPPPEDFI----EEMAVVEAPTEEKK-EQDIGDLLNLGEDAPTPEE  688
             E E E   N +KALP P    +    ++  V   P E  + +Q+ G+L+NL ED  + +E
Sbjct  335   EQEPEAYANEVKALPAPEVKNLTPRPQQPPVALQPKETPRVQQETGELVNLREDGVSADE  394

Query  687   HANQLALALFDGiptidpt-------kttittPWE---AFNGSEDWETALVQTASHLSNQ  538
               N+ ALALF G  T+           + +T+ WE   A  G  DWE ALV+T+S+LS Q
Sbjct  395   QGNKFALALFSGASTVKTEGLWEEFGSSKVTSAWETPAAEIGKADWELALVETSSNLSKQ  454

Query  537   KAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssA  358
             KA   G FD L+L+GMY QGA+ Q V+++ V + GSA+SVA    G+ A+  L  P    
Sbjct  455   KADLGGGFDSLILNGMYDQGAVRQHVSTTEV-SGGSASSVALPGVGKSAIPILALPAP--  511

Query  357   DANTTASGA-DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             D    A G  DPFAASLSV PP+YVQ++E+E+KQ LL +EQQ+WQQY +DGM GQ+GL +
Sbjct  512   DGTMQAVGTQDPFAASLSVPPPSYVQIAEMERKQHLLVQEQQLWQQYGRDGMQGQLGLTR  571

Query  180   AQQSSQPHNYYG  145
                 SQP   YG
Sbjct  572   VGAGSQPMMSYG  583



>ref|NP_001168322.1| putative ENTH/ANTH/VHS superfamily protein isoform 1 [Zea mays]
 gb|ACN27805.1| unknown [Zea mays]
 gb|ACR35021.1| unknown [Zea mays]
 gb|AFW88820.1| putative ENTH/ANTH/VHS superfamily protein isoform 1 [Zea mays]
 gb|AFW88821.1| putative ENTH/ANTH/VHS superfamily protein isoform 2 [Zea mays]
Length=634

 Score =   315 bits (808),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 212/516 (41%), Positives = 285/516 (55%), Gaps = 69/516 (13%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR------------  1429
              TRRGTRLLN+SDFRD + S  WD+SAFVRTY+LYLD+++E  +  R+            
Sbjct  111   GTRRGTRLLNLSDFRDEAHSGSWDHSAFVRTYALYLDQRLEFFLHERKQGLNAGSSSSAN  170

Query  1428  ----------------GKHSALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYL  1297
                             G+ S   S        +D  E  G         TP+ +MK E +
Sbjct  171   GPSPRDRDRWGSPDPYGRRSPSYSSPPGYGGYDDYRERNGGNNDDKRPPTPVRDMKPERV  230

Query  1296  YSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMK  1117
              +R+ H  Q+LDRFLAC+PTG AK++R+VLVALYQ+V+ESFQ+Y  I E+L +L+DRF  
Sbjct  231   LARMHHLQQLLDRFLACRPTGGAKQSRMVLVALYQIVRESFQLYSDICEVLAVLLDRFFD  290

Query  1116  LDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiir  937
             ++  +  K  E +   AKQ DEL  FY+W K  G++R SEYP+V+    + L+ +EE +R
Sbjct  291   MEYAECVKAFEAYASAAKQIDELSAFYSWCKDTGVARSSEYPEVQRVTDKLLETLEEFMR  350

Query  936   ekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPT  757
             ++ +                 E E    + E E DMN+IKALP P ED+ E   V     
Sbjct  351   DRAKRP----------KSPPREPEPEPVKEEPEPDMNSIKALPAP-EDYKEPEPVKVEEE  399

Query  756   EEKKE--QDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN----  595
              + +   Q  GDL++L ED  + +E  N+LALALF G P       +    WEAF     
Sbjct  400   VKPEPPPQPQGDLVDLREDTVSADEQGNRLALALFQGPPAAGGNNGS----WEAFPSNGG  455

Query  594   --------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVA  457
                           G  DWE ALV+TAS+LS QK    G  D L+L+GMY QG + Q V 
Sbjct  456   NEVTSAWQNPAAEPGKADWELALVETASNLSMQKPAMSGGMDPLLLNGMYDQGVVRQHV-  514

Query  456   SSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMS  277
              S  +TTGSA+SVA  + G+   +     P   D +    G DPFAASL+V PP+YVQM+
Sbjct  515   -SAQVTTGSASSVALPAPGQKTQMLALPAP---DGSMQTVGGDPFAASLAVPPPSYVQMA  570

Query  276   ELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQS  169
             +LEKKQ+LL +EQ MWQQY +DGM GQ  L K  Q+
Sbjct  571   DLEKKQQLLSQEQIMWQQYQRDGMQGQSSLNKLDQA  606



>ref|XP_002465482.1| hypothetical protein SORBIDRAFT_01g039590 [Sorghum bicolor]
 gb|EER92480.1| hypothetical protein SORBIDRAFT_01g039590 [Sorghum bicolor]
Length=645

 Score =   314 bits (804),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 215/512 (42%), Positives = 282/512 (55%), Gaps = 69/512 (13%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR------------  1429
             ATRRGTRLLN+SDFRD + S  WD+SAFVRTY+LYLD+++E  +  R+            
Sbjct  111   ATRRGTRLLNLSDFRDEAHSGSWDHSAFVRTYALYLDQRLEFFLHERKQGSNNGSSSSHN  170

Query  1428  ----------------GKHSALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYL  1297
                             G+ S   S        +D  E  G         TP+ +MK E +
Sbjct  171   GPSPRDRDRWGSPDPYGRRSPSYSSPPGYGGYDDYRERNGGNNDDKRPPTPVRDMKPERV  230

Query  1296  YSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMK  1117
              +R+ H  Q+LDRFLAC+PTG AK +R+VLVALYQ+V+ESFQ+Y  I E+L +L+DRF  
Sbjct  231   LARMHHLQQLLDRFLACRPTGGAKHSRMVLVALYQIVRESFQLYADICEVLAVLLDRFFD  290

Query  1116  LDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiir  937
             ++  +  K  E +   AKQ DEL  FY+W K  G++R SEYP+V+    + L+ +EE +R
Sbjct  291   MEYAECVKAFEAYASAAKQIDELCAFYSWCKDTGVARSSEYPEVQRVTDKLLETLEEFMR  350

Query  936   ekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF--IEEMAVVEA  763
             ++ +                 E E    + E E DMN+IKALP P ED+   E   V E 
Sbjct  351   DRAKRP----------KSPPREPEPEPVKEEPEPDMNSIKALPAP-EDYKEPEPEKVEEE  399

Query  762   PTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN----  595
                E   Q  GDL++L ED  T +E  N+LALALF       P        WEAF     
Sbjct  400   VKPEPPPQPQGDLVDLREDTVTADEQGNRLALALF----QGPPAAGGGNGSWEAFPSNGG  455

Query  594   --------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVA  457
                           G  DWE ALV+TAS+LS QK    G  D L+L+GMY QG + Q V 
Sbjct  456   NEVTSAWQNPAAEPGKADWELALVETASNLSKQKPAMSGGMDPLLLNGMYDQGVVRQHV-  514

Query  456   SSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMS  277
              S  +TTGSA+SVA  + G+   +     P   D +  A G DPFAASL+V PP+YVQM+
Sbjct  515   -SAQVTTGSASSVALPAPGQKTQMLALPAP---DGSMQAVGGDPFAASLAVPPPSYVQMA  570

Query  276   ELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             +LEKKQ+LL +EQ MWQQY +DGM GQ  L K
Sbjct  571   DLEKKQQLLTQEQVMWQQYQRDGMQGQSSLNK  602



>gb|EAY98116.1| hypothetical protein OsI_20032 [Oryza sativa Indica Group]
Length=603

 Score =   308 bits (789),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 203/483 (42%), Positives = 278/483 (58%), Gaps = 45/483 (9%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHS-------  1417
             +ATRRGTR+LNMSDF D SR++ WD+SAFVRTY+ YLD+++E RMQ + G  +       
Sbjct  113   YATRRGTRMLNMSDFCDRSRTDAWDFSAFVRTYAAYLDDRLEYRMQAKHGGAARPGQPLR  172

Query  1416  ----ALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLA  1249
                 A         +    +EE     A+V   TP +EM  E L ++ Q    +LDRF+A
Sbjct  173   EQLYASTGNRFNYDDFIMRDEEADKAVALVARETPTSEMTLEQLLAKAQQLQHLLDRFIA  232

Query  1248  CKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRV  1069
             C+P GAAK NR+V V+LY +VKES Q+Y  + E++  LV++F +++  D ++VH +F  +
Sbjct  233   CRPVGAAKTNRVVSVSLYPLVKESVQLYCELTEVMAALVEQFPEMEADDCERVHAVFCGL  292

Query  1068  AKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrep  889
             AKQ DELE  YTW K A + R S+ P+VE   ++KL++M+E +R++   A          
Sbjct  293   AKQLDELEALYTWCKDAYVCRQSDVPEVELITQKKLELMDEFVRDRRAAAA---------  343

Query  888   speveeveepepeaeaeEDMNTIKALPPPPEDFI----EEMAVVEAPTEEKKEQDI----  733
               +  E    E     E+D++  KALP P E       E+ A    P E +    I    
Sbjct  344   --QSPEPPRREASPVVEDDVSATKALPAPEEPVAAAQEEQNAGETVPAEPEAPPLIADGD  401

Query  732   GDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTA  556
              D LNL  DA + EEH  QLALALFDG P             +AF+  S DWETALVQ+A
Sbjct  402   ADFLNLKGDAMSGEEHGRQLALALFDGNPAGSAPAP------DAFDPSSTDWETALVQSA  455

Query  555   SHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalp  376
             S L++Q+A+  G    L+LDGMY Q A +  VA++    +GSA+SVA    G       P
Sbjct  456   SALAHQRAELGGGLSMLVLDGMYSQAAASSTVANAQAF-SGSASSVAMRPPG------AP  508

Query  375   appssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQ  196
                  A   T+ +  DPFAAS++VAPPAYVQMS++E KQ  L EEQ +WQQY K+GM GQ
Sbjct  509   MLALPAPPGTSGASGDPFAASMAVAPPAYVQMSDMETKQHQLVEEQMVWQQYGKNGMSGQ  568

Query  195   VGL  187
               L
Sbjct  569   GAL  571



>gb|AAC78254.1| predicted protein destination factor [Arabidopsis thaliana]
 emb|CAB80758.1| predicted protein destination factor [Arabidopsis thaliana]
Length=676

 Score =   309 bits (792),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 218/438 (50%), Positives = 291/438 (66%), Gaps = 20/438 (5%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD S+S+ WDYSAFVRTY+LYLDE+++ RMQ RRGK  +   G  
Sbjct  112   FATRRGTRLLNMSDFRDASQSDSWDYSAFVRTYALYLDERLDYRMQGRRGKKKSGGGGGG  171

Query  1395  egveeede----eeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAA  1228
             +G   E++          + AIVV   P+ EMK E +++R+QH  Q+LDRFLAC+PTG A
Sbjct  172   DGDSGEEDDHRGTSNDIRSKAIVVKSKPVAEMKTEKIFNRVQHLQQLLDRFLACRPTGNA  231

Query  1227  KRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDEL  1048
             K NR+V+VA+Y +VKESFQ+YY+I E++G+L++RFM+LDI DS KV+EIF RV+KQ+DEL
Sbjct  232   KNNRVVIVAMYPIVKESFQLYYNITEIMGVLIERFMELDIHDSIKVYEIFCRVSKQFDEL  291

Query  1047  EVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveev  868
             + FY W K   ++R SEYP++E   ++KLD+M+E IR+K  +A      S + S + EE 
Sbjct  292   DPFYGWCKNMAVARSSEYPELEKITQKKLDLMDEFIRDKSALAAQTTKSSSKRSNKSEEE  351

Query  867   eepep-eaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKE----QDI-GDLLNLGED  706
             E       E +ED+N+IKALP P +   EE        ++ +E    QD  GDLL+L ++
Sbjct  352   ESKTEYIQENQEDLNSIKALPAPEQKEEEEEEEKMETKKDVEEVVSRQDQEGDLLDLTDE  411

Query  705   AP-TPEEHANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTASHLSNQKA  532
             A  T     + LALALFDG   +  T++     WEAFN  S DWET LV++A+ LS QK+
Sbjct  412   AGVTAGTVGDSLALALFDG---VVGTESASGPGWEAFNDNSADWETDLVRSATRLSGQKS  468

Query  531   QFPGNFDELMLDGMYRQGALNQAV-ASSGVLTTGSATSVAFGSAGRpamlalpappssAD  355
             +  G FD L+LDGMY+ GA+N AV  S+   ++GSA+SVAFGSAG PA   L  P     
Sbjct  469   ELGGGFDTLLLDGMYQYGAVNAAVKTSTAYGSSGSASSVAFGSAGSPAASMLALPAPPPT  528

Query  354   ANTTASG---ADPFAASL  310
             AN   +     DPFAASL
Sbjct  529   ANGNRNSPVMVDPFAASL  546



>ref|XP_006858414.1| hypothetical protein AMTR_s00071p00051500 [Amborella trichopoda]
 gb|ERN19881.1| hypothetical protein AMTR_s00071p00051500 [Amborella trichopoda]
Length=586

 Score =   304 bits (778),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 201/499 (40%), Positives = 273/499 (55%), Gaps = 76/499 (15%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDSRS---NFWDYSAFVRTYSLYLDEQVEL-----RMQNRRGKHS  1417
             +ATRRGTRLLNMSDFRD+ S   + WD+SA VRT ++YLDE++E      + Q RR   S
Sbjct  110   YATRRGTRLLNMSDFRDASSRSTDSWDFSALVRTVAMYLDERLEFSRHGTKHQRRRRTSS  169

Query  1416  ALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPT  1237
               +                          TP+ E++ + L++R+QH  QILDRFLACKPT
Sbjct  170   GDSP----------------------YAATPVRELRPDRLFARMQHLHQILDRFLACKPT  207

Query  1236  GAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQW  1057
             GAAK+N LV+VAL+ +VKESFQ+Y  +AE +G ++DRF  +++P+  KV E F R  KQ 
Sbjct  208   GAAKQNHLVVVALHPIVKESFQMYSEMAEAMGAMIDRFTDMEVPECVKVLEAFGRAGKQI  267

Query  1056  DELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspev  877
             DELE FY W K   + R++EYPD++   ++KLD+ME+ IR+K      R+        + 
Sbjct  268   DELEQFYNWFKTVAMLRIAEYPDLDKITQKKLDLMEDFIRDKCVSQSKRLQDPETEGEDA  327

Query  876   eeveepepeaeaeEDMNTIKALPPPP--------EDFIEEMAVV---EAPTEEKKEQDIG  730
                            M  IKALP PP        ED   E A V   + P  E  ++   
Sbjct  328   ---------------MTGIKALPAPPVNEEEATGEDIRREAAEVAKKKEPETEPAQEGSR  372

Query  729   DLLNLGEDAPTPEEH-ANQLALALFDGiptidptkttittPWEAF---NGSEDWETALVQ  562
             DL++L  D      H  +QLAL +  G         + T  WEAF       DWE ALVQ
Sbjct  373   DLISLDTDGAFANAHPGDQLALTVLGG---EAEVGQSGTDKWEAFTDEGDKADWELALVQ  429

Query  561   -TASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVA-FGSAGRpam  388
              T   L +QK    G FD L+LDG+Y     +QA  +S +  TGSA+S+A  G+ G   +
Sbjct  430   STTGGLQSQKPALGGGFDMLLLDGLY-----DQAPKTSSIAYTGSASSMAGAGATGGQLL  484

Query  387   lalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDG  208
                  P ++   N      DPF+AS SVAPPAYVQM ++ K+Q LL +EQQ+WQ Y  DG
Sbjct  485   ALPAPPGAAYSTN------DPFSASTSVAPPAYVQMWDMGKRQALLVQEQQLWQHYAMDG  538

Query  207   MHGQVGLEKAQQSSQPHNY  151
             M GQ+G+ + QQ +    Y
Sbjct  539   MQGQLGMAQLQQQTGVGGY  557



>ref|XP_004508474.1| PREDICTED: putative clathrin assembly protein At2g25430-like 
[Cicer arietinum]
Length=615

 Score =   303 bits (777),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 199/497 (40%), Positives = 279/497 (56%), Gaps = 52/497 (10%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
             ATR G R+LNM+DFRD + SN WD++ FVR Y++YLDE+VE  +  R+ ++   +   E 
Sbjct  118   ATRGGMRVLNMNDFRDEAHSNSWDHACFVRVYAMYLDEKVEFLVYQRKVRNVVESVDGEF  177

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRL  1213
               + E    E           TP  EM+ E +  R++H ++ILD  L CKP GAAK NRL
Sbjct  178   ERKNEKRSSEV----------TPTREMRAERVLDRLKHLLRILDGVLGCKPKGAAKNNRL  227

Query  1212  VLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYT  1033
             VLVAL Q V++SF+VY  + ++LG+L+DRF +++     K  E +   +K  D+L  FY 
Sbjct  228   VLVALQQTVRDSFKVYVEVCDVLGVLMDRFNEMEYTHCVKAFEFYVSASKMMDDLAGFYG  287

Query  1032  WSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepep  853
             W K  GI+R S+YP+V+      L  +E  +         + M  R  SPE +   +   
Sbjct  288   WCKDMGIARSSDYPEVQKITDNLLGTLEGFL---------KGMSGRTKSPEEKLDVKVTV  338

Query  852   eaeaeEDMNTIKALPPP-PEDFIEEMAVVEA-----PTEEKKEQDI-GDLLNLGEDAPTP  694
               E +  ++ +KALP P  ++F       +      P E   +Q+  GDL+NL +D  T 
Sbjct  339   IKENDLGIDEVKALPAPETKNFTPPPLPQQPRLAPEPKEAPHQQETDGDLVNLRDDGVTA  398

Query  693   EEHANQLALALFDGiptidptkttittPWEAFNGSE---------------DWETALVQT  559
             +E  N+LALALF G   +    +     WE+F  SE               DWE ALV+T
Sbjct  399   DEQGNKLALALFSGASNVRTEGS-----WESFPSSEVTSAWQTPAAELGKADWELALVET  453

Query  558   ASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlal  379
             +S+LS QKA   G FD L+L+GMY QGA+ Q V+++ V   GSA+SVA    G+ A   L
Sbjct  454   SSNLSKQKADLGGGFDSLVLNGMYDQGAVRQHVSTTEV-NGGSASSVALPGLGKNATPIL  512

Query  378   pappssADANTTASGA-DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMH  202
               P    D      G  DPFAASLSV PP+YVQ++E+E+KQ LL +EQQ+WQQY +DGM 
Sbjct  513   ALPAP--DGTVQVVGTQDPFAASLSVPPPSYVQIAEMERKQHLLVQEQQIWQQYGRDGMQ  570

Query  201   GQVGLEKAQQSSQPHNY  151
             GQVGL +    + P NY
Sbjct  571   GQVGLSRVGAGTSP-NY  586



>ref|XP_008242801.1| PREDICTED: putative clathrin assembly protein At2g25430 [Prunus 
mume]
Length=613

 Score =   301 bits (770),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 204/507 (40%), Positives = 284/507 (56%), Gaps = 51/507 (10%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             +ATRRG R+LN+SDFRD + SN WD++ F+R Y++YLDE+VE  +  R+   +     ++
Sbjct  110   YATRRGMRVLNLSDFRDEAHSNAWDHARFLRFYAMYLDEKVEFEVYERKSGGTDGGRLDQ  169

Query  1395  egv-----------eeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLA  1249
             E              +  ++           + TPI EM+ E +  R+   +++LDR LA
Sbjct  170   ERDYREERKEFDYGNDVSDQSLEREQKRETKSSTPIREMRPERVLGRLNDLLRVLDRILA  229

Query  1248  CKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRV  1069
             C+P GAAK +RLV+VALYQV+KESF++Y +I E LG+L+DRF +++  D  K  +++   
Sbjct  230   CRPAGAAKSSRLVIVALYQVLKESFRLYVAICEALGVLLDRFTEMEYADCVKAFDVYVNA  289

Query  1068  AKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrep  889
             AK  DEL  FY W K  GI+R SEYP+V+    + L  +E           G +      
Sbjct  290   AKMIDELVGFYGWCKDTGIARSSEYPEVQRITDKLLSSLE-----------GFLKEKTNR  338

Query  888   speveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGE  709
                +EE  + + E + + +   +KALPPP             P     +    DL+NL +
Sbjct  339   PKSMEEKGQVDSEPKQDMNYEVMKALPPPENYTPPPPPPEAQPKASHPQPVTEDLVNLRD  398

Query  708   DAPTPEEHANQLALALFDGiptidptkttittPWEAF------------------NGSED  583
             D  T +E  N+LALALF G PT   T  +    WEAF                  +G  D
Sbjct  399   DGVTADEQGNKLALALFSGPPTTTNTNGS----WEAFPSDGEPQVTSAWQTPAAESGKAD  454

Query  582   WETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSA  403
             WE ALV+TAS+LS QKA   G FD L+L+GMY QGA+ Q V++S  L+ GSA+SVA   A
Sbjct  455   WELALVETASNLSKQKADLAGGFDPLLLNGMYDQGAVRQHVSTSQ-LSGGSASSVAMPGA  513

Query  402   GRpamlalpappssADANTTASGA-DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQ  226
             G+     L  P    D    A G  DPFAASL+V PP+YVQ++E+E+KQ LL +EQ +WQ
Sbjct  514   GKAVTPLLALPAP--DGTVQAVGQQDPFAASLAVPPPSYVQIAEMERKQYLLSQEQLLWQ  571

Query  225   QYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             QY +DGM GQVGL  A+ SS    YYG
Sbjct  572   QYGRDGMQGQVGL--AKISSGGSGYYG  596



>ref|XP_010533141.1| PREDICTED: probable clathrin assembly protein At4g32285 [Tarenaya 
hassleriana]
 ref|XP_010533142.1| PREDICTED: probable clathrin assembly protein At4g32285 [Tarenaya 
hassleriana]
 ref|XP_010533144.1| PREDICTED: probable clathrin assembly protein At4g32285 [Tarenaya 
hassleriana]
Length=632

 Score =   301 bits (770),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 199/501 (40%), Positives = 272/501 (54%), Gaps = 56/501 (11%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR--GKHSALAS-  1405
             ++TRRG R+LNM+DFRD + S+ WD++ FVR Y++YL+E++E  +  RR  GK       
Sbjct  110   YSTRRGLRVLNMADFRDEAHSHSWDHAGFVRVYAMYLEEKLEFEVSERRSRGKEGKFEED  169

Query  1404  ----gneegveeedeeeetgntTAIVVTG----TPITEMKNEYLYSRIQHYIQILDRFLA  1249
                                    +   TG    TPI EMK E +   ++  ++IL R LA
Sbjct  170   WRDREEGRDNYGRRSRSYGDLGESSATTGREKSTPIREMKPERVLGNLEKLLKILSRVLA  229

Query  1248  CKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRV  1069
             C+PTG AK +RLVLVALYQVV+ESF +Y SI E L +L++ F++++  D+ K  + +   
Sbjct  230   CRPTGYAKNSRLVLVALYQVVRESFGLYTSICEALSVLLNSFIEMEYGDAVKCFDAYVGS  289

Query  1068  AKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrep  889
             AK  DEL  FY+W K  GI+R SEYP+V++   + L   E             I++  + 
Sbjct  290   AKMIDELVGFYSWCKDTGIARSSEYPEVQSITDESLATFES------------ILKDMKN  337

Query  888   speveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVV-------EAPTEEKKEQDIG  730
                     + + + E E DMN IKALP P                  E P  + K+Q   
Sbjct  338   RSTSPVRSQVQKKEEQEPDMNEIKALPAPENHNPPPPPPPPQPMAKPEQPKPQPKQQVTD  397

Query  729   DLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN---------------  595
             DL+NL +D  T +E  N +ALALF G  T+ P  +     WEAF                
Sbjct  398   DLVNLRDDGVTADEQGNTMALALFSGQATVKPDGS-----WEAFPSDGESDVKSAWQNPA  452

Query  594   ---GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSAT  424
                G  DWE ALV+TAS+LS QKA   G  D ++L+GMY QGA+NQ V SS  L  GS++
Sbjct  453   AEIGKPDWELALVETASNLSRQKADLGGGMDPILLNGMYDQGAVNQHV-SSAQLQGGSSS  511

Query  423   SVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWE  244
             SVA  S  +     L  P          S  DPF+ASL+V PPAYVQ++++EKKQ LL +
Sbjct  512   SVALPSLEKTKTTILALPAPDGTVKPVGS-VDPFSASLTVPPPAYVQIADMEKKQHLLVQ  570

Query  243   EQQMWQQYTKDGMHGQVGLEK  181
             EQQ WQQYT+DGMHGQ+G+ K
Sbjct  571   EQQAWQQYTQDGMHGQMGMAK  591



>ref|XP_010103717.1| Putative clathrin assembly protein [Morus notabilis]
 gb|EXB96859.1| Putative clathrin assembly protein [Morus notabilis]
Length=626

 Score =   299 bits (766),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 199/495 (40%), Positives = 280/495 (57%), Gaps = 46/495 (9%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVEL---------RMQNRRGK  1423
             F+TRRG R+LN+SDFRD + SN WD++ FVR Y+ YLDE+VE          R ++   +
Sbjct  110   FSTRRGMRVLNLSDFRDEAHSNSWDHAGFVRLYAAYLDERVESFVFEKKSRDRRESGENR  169

Query  1422  HSALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACK  1243
                            D  +          T TP+ EM  E + +++   ++ILDR LAC+
Sbjct  170   DEYGHGLPRRSRSYGDLNDLEQRREGAGATTTPMREMWPEMVLAKLNQLLRILDRILACR  229

Query  1242  PTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAK  1063
             P GAAK NRLV+VALY+++KESF  Y  + E L +L+DRF +++  D  K   ++   AK
Sbjct  230   PAGAAKSNRLVIVALYRIIKESFGTYVEVCEALKVLLDRFTEMEYGDCVKAFNVYVGAAK  289

Query  1062  QWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepsp  883
               DEL  FY W K  GI R SEYP+V+    + L  +E  +         + M +R  SP
Sbjct  290   MIDELAGFYGWCKDMGIGRSSEYPEVQRITDKLLGTLEGFL---------KEMENRPKSP  340

Query  882   eveeveepepeaeaeEDMNTIKALPPPPEDFIEEMA------VVEAPTEEKKEQDIGDLL  721
             +    E+     E  +DMN IKALP   E++           VV  P++ ++E +  DL+
Sbjct  341   QRSREEKELVGEETLQDMNEIKALPAL-ENYSPPPPRPPPSEVVTKPSQAQQETE--DLV  397

Query  720   NLGEDAPTPEEHANQLALALFDGiptidptktt-----------ittPWE---AFNGSED  583
             NLG+D  + +E  N+LALALF G  T   T  +           +T+ W+   A +G  D
Sbjct  398   NLGDDGVSADEQGNKLALALFSGPATTTNTNGSWDASPTDGEPEMTSAWQNPAAESGKAD  457

Query  582   WETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSA  403
             WE ALV++AS+LS QKA  PG FD L+L+GMY QG + Q V S+  ++ GSA+SVA    
Sbjct  458   WELALVESASNLSKQKADLPGGFDPLLLNGMYDQGTVRQHV-STAQMSGGSASSVALPGP  516

Query  402   GRpamlalpappssADANTTASG-ADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQ  226
             G+ A   L  P    D    A G  DPF ASLSV PP+YVQ++++E+KQ+LL +EQ +WQ
Sbjct  517   GKSASPVLALPAP--DGTKQAVGNQDPFTASLSVPPPSYVQIADIERKQQLLVQEQHVWQ  574

Query  225   QYTKDGMHGQVGLEK  181
             QY ++GM GQVGL K
Sbjct  575   QYGREGMQGQVGLAK  589



>ref|XP_010937786.1| PREDICTED: probable clathrin assembly protein At4g32285, partial 
[Elaeis guineensis]
Length=493

 Score =   294 bits (752),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 196/494 (40%), Positives = 273/494 (55%), Gaps = 70/494 (14%)
 Frame = -1

Query  1491  FVRTYSLYLDEQVEL----RMQNRRGKHSALASgneegveeedeeeetgntTAIVVTG--  1330
             FVRTY+LYLD+++E     + Q+  G  +     +  G  +       G ++     G  
Sbjct  1     FVRTYALYLDQRLECMVYEQKQHGSGNGNGRPYQSPRGEPDPYTYGSYGRSSYSSPQGNG  60

Query  1329  -----------------TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVA  1201
                              TP+ +MK E +  R+ H  Q+LDRFLAC+PTGAAK +R++L+A
Sbjct  61    SAGYYDERRRGEERKPPTPLRDMKPERVLGRMHHLQQLLDRFLACRPTGAAKHSRMILIA  120

Query  1200  LYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKA  1021
             LY +V+ESFQ+Y  I E+L +L+DRF  +D PD  K  E +   AKQ DEL +FY W K 
Sbjct  121   LYPIVRESFQLYADICEILAVLLDRFFDMDYPDCVKAFEAYASAAKQIDELCLFYGWCKD  180

Query  1020  AGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaea  841
              G++R SEYP+V+    + L+ +EE +R++              +   +E      + E 
Sbjct  181   TGVARSSEYPEVQRITVKLLETLEEFMRDRARRP----------TSPPKEAAPETVDEEP  230

Query  840   eEDMNTIKALPPPPEDFIE-----EMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQ  676
              +DMN+IKALP P  D+ E     E  VV+ P  +K++Q+  DLLNL +DAP+ E+ +N+
Sbjct  231   AQDMNSIKALPAP-SDYTEQKLEPEPEVVQPP--KKQQQEESDLLNLRDDAPSAEDQSNK  287

Query  675   LALALFDGiptidptkttittPWEAFN---------------------GSEDWETALVQT  559
             LALALF G    + T  +    WEAF                      G  DWE ALV+T
Sbjct  288   LALALFSGPGAANSTNGS----WEAFPSNGAPGQGEVTSAWQTPAAEPGKADWELALVET  343

Query  558   ASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlal  379
             AS+L  QKA   G FD L+L+GMY QGA+ Q V +   ++TGSA+SVA    G+     L
Sbjct  344   ASNLVKQKATLGGGFDPLLLNGMYDQGAVRQHVNAQ--MSTGSASSVALPGLGQKTTPVL  401

Query  378   pappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHG  199
               P    D      G DPFAASLS  PP+YVQM+++EKKQ+ L +EQQMWQQY++DGM G
Sbjct  402   ALPAP--DGTVETIGQDPFAASLSYPPPSYVQMADMEKKQQWLVQEQQMWQQYSRDGMQG  459

Query  198   QVGLEKAQQSSQPH  157
             Q  L K   S  P+
Sbjct  460   QASLAKLNNSYFPN  473



>ref|XP_007013503.1| Epsin N-terminal domain-containing protein / clathrin assembly 
protein-related [Theobroma cacao]
 gb|EOY31122.1| Epsin N-terminal domain-containing protein / clathrin assembly 
protein-related [Theobroma cacao]
Length=633

 Score =   297 bits (761),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 200/507 (39%), Positives = 276/507 (54%), Gaps = 56/507 (11%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRM-QNRRGKHSALASgn  1399
             +ATRRG R+LN+SDFRD + SN WD++ FVR Y++YLDE+VE  + + ++G         
Sbjct  110   YATRRGMRILNLSDFRDEAHSNSWDHAGFVRFYAMYLDEKVEFSVFEKKKGDGEGRFEER  169

Query  1398  eegveeedeeeetgntTAIVVTG------------------TPITEMKNEYLYSRIQHYI  1273
             +E    E  +        +                      TP+ EM+ E +  R+   +
Sbjct  170   DERNRREYGDFRDDYDHGMGRRSRSYGDLSDSVRREQRREVTPMREMRPERVLGRLNQLL  229

Query  1272  QILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKK  1093
             +ILDR L C+P G AK +RLVLVALYQ++KESF +Y  I E LGIL+DRF +++  D  K
Sbjct  230   RILDRVLGCRPAGIAKNSRLVLVALYQILKESFGLYVEICEALGILLDRFTEMEYADCVK  289

Query  1092  VHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGG  913
               + +   AK  DEL  FY W K  GI+R SEYP+V+    + L  +E  +         
Sbjct  290   GFDTYVSAAKMIDELVGFYGWCKEMGIARSSEYPEVQRITDKLLGTLEGFL---------  340

Query  912   RIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDI  733
             + M +    PE    E+P  + E E +MN IKALP P               + + +QD 
Sbjct  341   KEMTNGPKGPERNREEKPPVKEEPEANMNEIKALPAPESYTPPPPPPEPEQPKMQAQQDT  400

Query  732   GDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAF---------------  598
              DL+NL +DA + +E  N+LALALF G PT +   +     WEAF               
Sbjct  401   EDLVNLKDDAVSADEQGNRLALALFSGPPTSNANGS-----WEAFPSNGQPEVTSAWQTP  455

Query  597   ---NGSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSA  427
                 G  DWE ALV++AS+LS QKA   G FD L+L+GMY QGA+ Q V+++  L+ GSA
Sbjct  456   AAEAGKADWELALVESASNLSKQKAALAGGFDPLLLNGMYDQGAVRQHVSTT-QLSGGSA  514

Query  426   TSVAFGSAGRpamlalpappssADANTTASG-ADPFAASLSVAPPAYVQMSELEKKQRLL  250
             +SVA    G+     L  P    D      G  DPFAASL+V PP+YVQ++++E+KQ LL
Sbjct  515   SSVALPGPGKTNTQVLALPAP--DGTVQPVGHQDPFAASLAVPPPSYVQIADMEQKQHLL  572

Query  249   WEEQQMWQQYTKDGMHGQVGLEKAQQS  169
              +EQQ+WQQY +DGM GQ  L K   S
Sbjct  573   VQEQQLWQQYGRDGMQGQASLAKITAS  599



>ref|XP_009368880.1| PREDICTED: putative clathrin assembly protein At2g25430 [Pyrus 
x bretschneideri]
Length=612

 Score =   296 bits (758),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 205/506 (41%), Positives = 282/506 (56%), Gaps = 53/506 (10%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNR--RGKHSA-----  1414
             A+RRG R+LN+S FRD + S  WD++ FVR Y++YL+E+VE  +  R  RG+  +     
Sbjct  111   ASRRGLRVLNLSGFRDEAHSGSWDHAGFVRLYAMYLEEKVEFEVYERKSRGREGSGGFDQ  170

Query  1413  -------LASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRF  1255
                          E    + +              TP+TEM+ E +  R+   +++LDR 
Sbjct  171   ERERTNREERREFEYENYQSDRALEREKRRESKDSTPVTEMQPERVLGRLNDLLRVLDRI  230

Query  1254  LACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFH  1075
             L CKP GAAK +RLV+VALY+VVKESF++Y  I E L +L+D+F +++  D  K  + + 
Sbjct  231   LGCKPAGAAKSSRLVIVALYEVVKESFRLYVEICEALRVLLDKFTEMEYADCLKAFDAYV  290

Query  1074  RVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsr  895
               AK  DEL  FY W K  GI+R SEYP+V+    Q L  +E  ++ K            
Sbjct  291   NAAKMIDELVGFYGWCKDMGIARSSEYPEVQRITDQLLTSLEGFLKGKTSRP--------  342

Query  894   epspeveeveepepeaeaeEDMN-TIKALPPPPEDFIEEMAVVEAPTEEKKEQDIG-DLL  721
               SPE    E    + EA+ED+N  +KALPPP E++       EA  +  + Q +  DL+
Sbjct  343   -KSPERNRDENVRVDEEAKEDVNYEVKALPPP-ENYTAPPTPPEARPKPSQPQPVTEDLV  400

Query  720   NLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAF------------------N  595
             NL ++  T +E  N+ ALALF G PT   T  +    WEAF                  +
Sbjct  401   NLRDEGITADEQGNKFALALFSGQPTSTNTNGS----WEAFPSNGEPEVTSAWQTPAAES  456

Query  594   GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVA  415
             G  DWE ALV+TAS+LS QKA   G FD L+L+GMY QGA+ Q V++S  L  GSA+SVA
Sbjct  457   GKADWELALVETASNLSKQKADLAGGFDSLLLNGMYDQGAVRQHVSTSQ-LNGGSASSVA  515

Query  414   FGSAGRpamlalpappssADANTTASGA-DPFAASLSVAPPAYVQMSELEKKQRLLWEEQ  238
                AG+ A   L  P    D    A G  DPFAASL+V PP+YVQ++++E+KQ LL +EQ
Sbjct  516   MPGAGKAAKQVLALPAP--DGTVHAVGQQDPFAASLTVPPPSYVQIADIERKQHLLSQEQ  573

Query  237   QMWQQYTKDGMHGQVGLEKAQQSSQP  160
              +WQQY +DGM GQ+GL K     QP
Sbjct  574   LLWQQYRRDGMQGQLGLAKISGGPQP  599



>gb|AAV25008.1| putative clathrin assembly protein [Oryza sativa Japonica Group]
Length=666

 Score =   296 bits (759),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 201/483 (42%), Positives = 276/483 (57%), Gaps = 45/483 (9%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHS-------  1417
             +ATRRGTR+LNMSDF D SR++ WD+SAFVRTY+ YLD+++E RMQ + G  +       
Sbjct  176   YATRRGTRMLNMSDFCDHSRTDAWDFSAFVRTYAAYLDDRLEYRMQAKHGGAARPGQPLR  235

Query  1416  ----ALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLA  1249
                 A         +    ++E     A+V   TP +EM  E L ++ Q    +LDRF+A
Sbjct  236   EQLYASPGNRFNYDDFIMRDDEADKAVALVARETPTSEMTLEQLLAKAQQLQHLLDRFIA  295

Query  1248  CKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRV  1069
             C+P GAAK NR+V V+LY +VKES Q+Y  + E++  LV++F +++  D ++VH +F  +
Sbjct  296   CRPVGAAKTNRVVSVSLYPLVKESVQLYCELTEVMAALVEQFPEMEADDCERVHAVFCGL  355

Query  1068  AKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrep  889
             AKQ DELE  YTW K A + R S+ P+VE   ++KL++M+E +R++   A          
Sbjct  356   AKQLDELEALYTWCKDAYVCRQSDVPEVELITQKKLELMDEFVRDRRAAAA---------  406

Query  888   speveeveepepeaeaeEDMNTIKALPPPPEDFI----EEMAVVEAPTEEKKEQDI----  733
               +  E    E     E+D++  KALP P E       E+ A    P E +    I    
Sbjct  407   --QSPEPPRREASPVVEDDVSATKALPAPEEPVAAAQEEQNAGETVPAEPEAPPLIADGD  464

Query  732   GDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTA  556
              D LNL  DA + EEH  QLALALFDG P             +AF+  S DWETALVQ+A
Sbjct  465   ADFLNLKGDAMSGEEHGRQLALALFDGNPAGSAPAP------DAFDPSSTDWETALVQSA  518

Query  555   SHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalp  376
             S L++Q+A+  G    L+LDGMY Q A     A++    +GSA+SVA    G       P
Sbjct  519   SALAHQRAELGGGLSMLVLDGMYSQAAAASTAANAQAF-SGSASSVAMRPPG------AP  571

Query  375   appssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQ  196
                  A   T+ +  DPFAAS++VAPPAYVQMS++E KQ  L EEQ +WQQY K+GM GQ
Sbjct  572   MLALPAPPGTSGASGDPFAASMAVAPPAYVQMSDMETKQHQLVEEQMVWQQYGKNGMSGQ  631

Query  195   VGL  187
               L
Sbjct  632   GAL  634



>gb|EYU32349.1| hypothetical protein MIMGU_mgv1a002790mg [Erythranthe guttata]
Length=637

 Score =   296 bits (757),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 200/520 (38%), Positives = 275/520 (53%), Gaps = 64/520 (12%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRM---------------  1441
             +ATRRGTRLLNMSDFRD + SN WD SAFVRTY+LYLD+++EL +               
Sbjct  107   YATRRGTRLLNMSDFRDEAHSNSWDQSAFVRTYALYLDQRLELMIYERKLSSNGAEVERF  166

Query  1440  ------QNRRGKHSALASgneegveeedeeeetgntTAIVVTG-----TPITEMKNEYLY  1294
                   QN R    +    +    +         +      T      TP+ EMK + ++
Sbjct  167   GGRDDRQNYRSPQESNRGYDYNDSQNNGMRRARSSGDVRESTNERKDVTPLREMKPDRIF  226

Query  1293  SRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKL  1114
              ++ H  ++LDRFL+C+PTG AK  R+VLVALY +VKESF++Y  + E+L +L+D+F  +
Sbjct  227   GKMGHLQRLLDRFLSCRPTGLAKNERMVLVALYSIVKESFKLYADVCEVLAVLLDKFFDM  286

Query  1113  DIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiire  934
             +  D  K  + +   AKQ DEL   Y W K  G++R SEYP+V+    + L+ +EE +R+
Sbjct  287   EYQDCVKAFDAYASAAKQIDELIGLYNWCKDTGVARSSEYPEVQKITSKLLETLEEFVRD  346

Query  933   kmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTE  754
                    R    + P  ++E +  P  E E  ++MN IKALP P           E    
Sbjct  347   -------RSKAIKSPERKLEILPPPPQEEEPVQNMNEIKALPAPENYTPPPPPPPEPEAP  399

Query  753   EKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN-------  595
             +   Q+   L++L E+A T ++  N+ ALALF G        +     WEAF        
Sbjct  400   KPVPQEPTYLVDLRENAVTADDQGNKFALALFAGPAAQTGNGS-----WEAFPTNGEPEV  454

Query  594   -----------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSG  448
                        G  DWE ALV+TASHLS QKA   G  D L+L+GMY QG + Q V++S 
Sbjct  455   SSAWQNPAAEPGKADWELALVETASHLSQQKAAMGGGLDPLLLNGMYDQGMVRQHVSNS-  513

Query  447   VLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELE  268
              LT GSA+SVA    G              +     +G DPFAASL V PPAYVQM+++E
Sbjct  514   QLTGGSASSVAL--VGPGGGKTPVLALPGPEGTVVTAGQDPFAASLCVPPPAYVQMADME  571

Query  267   KKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYY  148
             KKQ LL +EQ +WQQY+++GM GQ  L K      P  YY
Sbjct  572   KKQNLLVQEQMVWQQYSREGMQGQASLAKM----GPGGYY  607



>ref|XP_003541475.1| PREDICTED: probable clathrin assembly protein At4g32285-like 
[Glycine max]
Length=612

 Score =   295 bits (755),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 196/493 (40%), Positives = 271/493 (55%), Gaps = 59/493 (12%)
 Frame = -1

Query  1569  ATRRGT-RLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             +TR GT R+LNMSDFRD + SN WD   FVR YSLYLD +V+     R+     + S   
Sbjct  111   STRLGTSRILNMSDFRDDAHSNSWDQVGFVRVYSLYLDAKVDFVAYRRKLSGGVVESVEF  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                    E E            TP+ EM  E +  R+   +++LDR L C+P+GAAK N 
Sbjct  171   RDEFGSAERERNEV--------TPVREMGAERVLKRLNRLLRMLDRVLGCRPSGAAKNNS  222

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             LVLVALYQVV++SF++Y  + ++LG+L+DRF +++     K  + +   AK  DEL  FY
Sbjct  223   LVLVALYQVVRDSFKLYAEVCDVLGVLLDRFTEMEYEHCVKAFDSYVSAAKMMDELVGFY  282

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
              W K  GI+R SEYPDV+    + L  +E  ++         +    +      EV+   
Sbjct  283   GWCKDTGIARSSEYPDVQRITDKLLGTLEGFLK--------EMSCRPKSPERKLEVKVTV  334

Query  855   peaeaeEDMNTIKALP---------PPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDA  703
              E++ E DMN +KALP         PPP    +   +  AP  +K+     DL++L ED 
Sbjct  335   NESQPEADMNKVKALPAPETESFTPPPPMSVAQPNKI--APNSQKQ---TSDLVDLREDG  389

Query  702   PTPEEHANQLALALFDGiptidptkttittPWEAF------------------NGSEDWE  577
              + +E  N+LALALF G  T+    +     WEAF                   G  DWE
Sbjct  390   VSADEQGNKLALALFSGAATVRTEGS-----WEAFPSNGESEVKSAWETPAAEAGKADWE  444

Query  576   TALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGR  397
              ALV+  S+LS QKA   G FD L+L+GMY QGA+ Q V+++  L+ GSA+SVA    G+
Sbjct  445   LALVENTSNLSRQKADLAGGFDPLLLNGMYDQGAVRQHVSTTQ-LSGGSASSVALPGPGK  503

Query  396   pamlalpappssADANTTASGA-DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQY  220
              A   L  P    D    A G  DPFAASL+V PP+YVQ++++E+KQ LL +EQQ+WQQY
Sbjct  504   SATPVLALPAP--DGTVQAVGPQDPFAASLTVPPPSYVQIADMERKQHLLVQEQQLWQQY  561

Query  219   TKDGMHGQVGLEK  181
              +DGM GQ+GL +
Sbjct  562   GRDGMQGQLGLSR  574



>ref|XP_004288787.1| PREDICTED: putative clathrin assembly protein At2g25430-like 
[Fragaria vesca subsp. vesca]
Length=592

 Score =   293 bits (750),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 205/513 (40%), Positives = 274/513 (53%), Gaps = 89/513 (17%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRM--QNRRGKHSALASgn  1399
             A RRG R+LNM  FRD + SN WD++ FV+++ +YLDE+VE  +  +N RG  +    G 
Sbjct  111   AARRGVRVLNMQGFRDEAHSNSWDHALFVKSFGMYLDEKVEFEVGERNSRGVDNKYEDGG  170

Query  1398  eegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRN  1219
                                  T TP+ EMK E +  R+   +++L R LAC+P G AK +
Sbjct  171   RR------------------FTVTPVKEMKPERVLLRLNDLLRVLHRVLACRPAGMAKSS  212

Query  1218  RLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVF  1039
             RLV++ALY VVKESF +Y  I E LG+L+DRF +++  +  K  +++   AK  DEL +F
Sbjct  213   RLVIIALYGVVKESFSLYIEICEALGVLLDRFGEMEYGECVKAFDVYVNAAKMIDELLLF  272

Query  1038  YTWSKAAGISRLSEYPDV-----------ENYPKQKLDimeeiirekmeMAGGRIMrsre  892
             Y W K  GI+R SEYP+V           E Y K+K +             GG+      
Sbjct  273   YNWCKDVGIARTSEYPEVLRITDKLLGTLEGYLKEKKN-------------GGK------  313

Query  891   pspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEK---KEQDIGD-L  724
                  E  E    E E ++DMN IKALP P E F           + K   K Q + D L
Sbjct  314   --SSPEREERVYVEEEVKQDMNEIKALPAP-ESFTPSPPQPAPVVQPKPADKPQRVTDEL  370

Query  723   LNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN-----------------  595
             +NL +D  T +E  N+LALALF G P  +P  +     WEAF+                 
Sbjct  371   VNLRDDGVTADEQGNKLALALFSGPPATNPNGS-----WEAFDSNGEAEVTSAWQTPAAE  425

Query  594   -GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSV  418
              G  DWE ALV+T S+LS QKA   G FD L+L+GMY QG + Q V++S  L+ GSA+SV
Sbjct  426   SGKADWELALVETVSNLSKQKADLAGGFDPLLLNGMYDQGTVRQHVSASQ-LSGGSASSV  484

Query  417   AFG-SAGRpamlalpappssADANTTASGA-DPFAASLSVAPPAYVQMSELEKKQRLLWE  244
             A     G+ +   L  P    D    A G  DPFAASL+V PP+YVQ++++E+KQ LL +
Sbjct  485   AMPLPPGKNSTPVLALPAP--DGTVQAVGQQDPFAASLAVPPPSYVQIADMERKQHLLTQ  542

Query  243   EQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             EQ +WQQY KDGM GQV L K    S    YYG
Sbjct  543   EQLLWQQYGKDGMQGQVSLAKLSGGS---GYYG  572



>gb|EPS73754.1| hypothetical protein M569_01000 [Genlisea aurea]
Length=821

 Score =   298 bits (764),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 204/514 (40%), Positives = 287/514 (56%), Gaps = 76/514 (15%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNR------------  1432
             +AT+RGTRLLN+SDFRD + S+ WD+S+FVRTY+LYLD+++E+ + +R            
Sbjct  296   YATKRGTRLLNLSDFRDEAHSSSWDHSSFVRTYALYLDQKLEMVIYDRKQSGGGSDHDRF  355

Query  1431  ------------------RGKHSALASgneegveeedeeeetgntTAIVVTGTPITEMKN  1306
                               R +H+           +  E  +     A     TP+ EMK 
Sbjct  356   NYRSPPGSNRKYDYDYDSRDEHNNGGMRRSRSYGDMGEASQERKDAA-----TPLREMKP  410

Query  1305  EYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDR  1126
             E +  ++ H  ++LDRFL C+PTG AK  R++LVALY +VK+SF++Y ++ E+L +L+D+
Sbjct  411   EGILGKMAHLQRLLDRFLCCRPTGLAKNERMILVALYLIVKDSFKLYATVCEVLAVLLDK  470

Query  1125  FMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimee  946
             F  ++ PD  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    Q L+ +EE
Sbjct  471   FFDMEYPDCVKTFDAYADSAKQIDELIGFYGWCKDIGVARSSEYPEVQKITNQLLETLEE  530

Query  945   iirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVE  766
              +R + +          +      E      EAEA  DMN IKALPPP E++  +     
Sbjct  531   FVRHRSKSG--------KSPQRKVEALPAASEAEAAPDMNEIKALPPP-ENYSPQPPPEP  581

Query  765   APTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFNG--  592
              P +  +     DLL+L E+  T ++  N+ ALALF G    +   +     WEAF    
Sbjct  582   EPPKPVRATP--DLLDLREEGVTADDQGNRFALALFAGPSAKNADGS-----WEAFRSDG  634

Query  591   ----------------SEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAV  460
                               DWE ALV++ASHLS QKA   G  D L+LDGMY QG + Q V
Sbjct  635   ELEVTSAWQNPAAQPDKADWELALVESASHLSKQKAAMGGGMDPLLLDGMYDQGMIRQHV  694

Query  459   ASSGVLTTGSATSVAF-GSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQ  283
             +SS  L+ GSA+SVA  G +G+  +LALPAP    D +  A G DPF ASLS+ PP+YVQ
Sbjct  695   SSSQ-LSGGSASSVALPGPSGKTPVLALPAP----DGSVRAVGQDPFEASLSIPPPSYVQ  749

Query  282   MSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             M+++EKKQ+LL +EQ +W QY +DGM GQV L K
Sbjct  750   MADMEKKQQLLVQEQVVWNQYARDGMQGQVSLAK  783



>ref|XP_003566218.1| PREDICTED: putative clathrin assembly protein At1g03050 [Brachypodium 
distachyon]
Length=608

 Score =   293 bits (750),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 206/486 (42%), Positives = 286/486 (59%), Gaps = 44/486 (9%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSA------  1414
             +ATRRGTR+LNMSDF D SR + WD+SAFVRTY+ YLD+++E RMQ R+G + +      
Sbjct  115   YATRRGTRMLNMSDFCDRSRRDAWDFSAFVRTYAAYLDDRLEYRMQARQGPNGSNRFCKL  174

Query  1413  ------LASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFL  1252
                     S      E+ D  ++ G   A+V+   P +EM  E L +++Q   Q+LDRF+
Sbjct  175   LKDELYSQSPGRPREEDADHGDQAGKAVALVLRDKPASEMTLEQLLAKVQQLQQLLDRFI  234

Query  1251  ACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPD-SKKVHEIFH  1075
             AC+P GAA+ NR+V V+LY +VKES Q+Y  + E    L++RF  ++  D  ++VH +F 
Sbjct  235   ACRPVGAARTNRVVTVSLYPLVKESAQLYLELTEARAALIERFPDMEAADDCERVHGVFC  294

Query  1074  RVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGR-----  910
              +AKQ +EL+ FY W K A + R S+ P+VE    +KL++M+E +R++      +     
Sbjct  295   GLAKQIEELDAFYAWCKDAYVCRQSDVPEVEPVTHKKLELMDEFVRDRRAAELSQQTLLP  354

Query  909   IMrsrepspeveeveepepeaeaeEDMNTIKALPPPP--EDFIEEMAVVEAPTEEKKEQD  736
                S  P P   E EEP  E E E  MN  KALPPP   +   EE+ ++   T E  E++
Sbjct  355   PSYSPSPEPPSPEPEEPPAEEEEEHAMNATKALPPPVAVQREQEEVDLLPLLTTETVEEE  414

Query  735   IGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN--GSEDWETALVQ  562
               D LNL  DA + EEH  QLALALFDG P             E F+   S DWETALV+
Sbjct  415   -ADFLNLKADAMSGEEHGQQLALALFDGKPPTS----------ELFDPSSSADWETALVE  463

Query  561   TASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLT-TGSATSVAFGSAGRpaml  385
             +AS L++Q+A   G  D L+LDGMY     + A AS+     +GSA+SV      RP + 
Sbjct  464   SASALASQQAVLGGGLDMLVLDGMY-----SHATASTNAQAFSGSASSVTL----RPPVA  514

Query  384   alpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGM  205
              +     +     + + ADPFAAS++V PPA+VQMS+++ KQRLL EEQ  WQQY K+GM
Sbjct  515   PMLLALPAPPGMCSGAAADPFAASMAVPPPAFVQMSDMQTKQRLLTEEQMAWQQYGKNGM  574

Query  204   HGQVGL  187
              GQ GL
Sbjct  575   QGQRGL  580



>ref|NP_001174432.1| Os05g0426100 [Oryza sativa Japonica Group]
 dbj|BAH93160.1| Os05g0426100 [Oryza sativa Japonica Group]
Length=768

 Score =   296 bits (759),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 201/483 (42%), Positives = 276/483 (57%), Gaps = 45/483 (9%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHS-------  1417
             +ATRRGTR+LNMSDF D SR++ WD+SAFVRTY+ YLD+++E RMQ + G  +       
Sbjct  278   YATRRGTRMLNMSDFCDHSRTDAWDFSAFVRTYAAYLDDRLEYRMQAKHGGAARPGQPLR  337

Query  1416  ----ALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLA  1249
                 A         +    ++E     A+V   TP +EM  E L ++ Q    +LDRF+A
Sbjct  338   EQLYASPGNRFNYDDFIMRDDEADKAVALVARETPTSEMTLEQLLAKAQQLQHLLDRFIA  397

Query  1248  CKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRV  1069
             C+P GAAK NR+V V+LY +VKES Q+Y  + E++  LV++F +++  D ++VH +F  +
Sbjct  398   CRPVGAAKTNRVVSVSLYPLVKESVQLYCELTEVMAALVEQFPEMEADDCERVHAVFCGL  457

Query  1068  AKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrep  889
             AKQ DELE  YTW K A + R S+ P+VE   ++KL++M+E +R++   A          
Sbjct  458   AKQLDELEALYTWCKDAYVCRQSDVPEVELITQKKLELMDEFVRDRRAAAA---------  508

Query  888   speveeveepepeaeaeEDMNTIKALPPPPEDFI----EEMAVVEAPTEEKKEQDI----  733
               +  E    E     E+D++  KALP P E       E+ A    P E +    I    
Sbjct  509   --QSPEPPRREASPVVEDDVSATKALPAPEEPVAAAQEEQNAGETVPAEPEAPPLIADGD  566

Query  732   GDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN-GSEDWETALVQTA  556
              D LNL  DA + EEH  QLALALFDG P             +AF+  S DWETALVQ+A
Sbjct  567   ADFLNLKGDAMSGEEHGRQLALALFDGNPAGSAPAP------DAFDPSSTDWETALVQSA  620

Query  555   SHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalp  376
             S L++Q+A+  G    L+LDGMY Q A     A++    +GSA+SVA    G       P
Sbjct  621   SALAHQRAELGGGLSMLVLDGMYSQAAAASTAANAQAF-SGSASSVAMRPPG------AP  673

Query  375   appssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQ  196
                  A   T+ +  DPFAAS++VAPPAYVQMS++E KQ  L EEQ +WQQY K+GM GQ
Sbjct  674   MLALPAPPGTSGASGDPFAASMAVAPPAYVQMSDMETKQHQLVEEQMVWQQYGKNGMSGQ  733

Query  195   VGL  187
               L
Sbjct  734   GAL  736



>ref|XP_009406985.1| PREDICTED: putative clathrin assembly protein At2g25430 [Musa 
acuminata subsp. malaccensis]
Length=642

 Score =   293 bits (750),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 211/520 (41%), Positives = 284/520 (55%), Gaps = 72/520 (14%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR-----------  1429
             +ATRRGTRLLNMSDFRD + SN WD+SAFVRTY+LYLD+++E  +  R+           
Sbjct  109   YATRRGTRLLNMSDFRDEAHSNSWDHSAFVRTYALYLDQRLECMVYERKQGGGNSRSNES  168

Query  1428  ---------------GKHSALASgneegveeedeeeetgntTAIVVTG------TPITEM  1312
                            G H   A GN           + G        G      TP+ +M
Sbjct  169   TTDRWRSPPPNRSDYGDHDPYAHGNYGRSSYSYPPRDGGAGYDERQNGEDKKPPTPLRDM  228

Query  1311  KNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILV  1132
             + E +  R+ H+ Q+LDRFLAC+PTG AK +R++L+ALY +V+ESFQ+Y  I E+L +L+
Sbjct  229   RPERVLGRMHHFQQLLDRFLACRPTGNAKFSRMILIALYPIVRESFQLYADICEILAVLL  288

Query  1131  DRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDim  952
             DRF  +D  D  K  E +   AKQ DEL  FY W K  G++R SEYP+V+   ++ L+ +
Sbjct  289   DRFFDMDYADCVKSFEAYASAAKQIDELCTFYAWCKDTGVARSSEYPEVQRITEKLLETL  348

Query  951   eeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEE---  781
             EE +R+       R  R + P  E       + E E E+DMN+IKALP P  D+ EE   
Sbjct  349   EEFMRD-------RARRPKSPPREAIPAATMDREREPEQDMNSIKALPAP-SDYKEEEPE  400

Query  780   -MAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWE  604
                V   P +++ +Q   DL++L ED  + ++ +N+LALALF G         +    WE
Sbjct  401   PAKVGVEPVKQQPQQQQTDLVDLREDGSSTDDQSNKLALALFQGPVAGSGANGS----WE  456

Query  603   AFN-------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQ  481
             AF                    G  DWE  LV+T S+LS Q+A   G  D L+LDGMY Q
Sbjct  457   AFPSSNGDSGVTSAWQTPAAEPGKADWEIVLVETTSNLSKQQASLGGGLDPLLLDGMYDQ  516

Query  480   GALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVA  301
             G + Q V +   +  GSA+SVA    GR A   L  P    D      G DPF ASLS+ 
Sbjct  517   GVVRQQVNAQ--INGGSASSVALPVPGRGAAPVLALPAP--DGTVQTIGQDPFVASLSIP  572

Query  300   PPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             PP+YVQM+++EKKQ+LL +EQ +WQQY KDGM GQ  L K
Sbjct  573   PPSYVQMADVEKKQQLLVQEQVLWQQYAKDGMQGQSSLAK  612



>gb|KDO58861.1| hypothetical protein CISIN_1g0079601mg, partial [Citrus sinensis]
Length=368

 Score =   284 bits (726),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 194/374 (52%), Positives = 252/374 (67%), Gaps = 20/374 (5%)
 Frame = -1

Query  1233  AAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWD  1054
             +AK NR+V+VALY VVKESFQ+YY I E+LGIL+DRFM+L++PDS KV++IF RV+KQ+D
Sbjct  1     SAKNNRVVIVALYPVVKESFQIYYDITEILGILIDRFMELEVPDSVKVYDIFCRVSKQYD  60

Query  1053  ELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRI---Mrsrepsp  883
             EL+ FY W K  GI+R SEYP+VE    +KL++M++ IR+K  +A  +     +      
Sbjct  61    ELDSFYGWCKTVGIARSSEYPEVERITYKKLELMDDFIRDKSALAQSKKNVDFQLTNEPE  120

Query  882   eveeveepepeaeaeEDMNTIKALPPPPEDF--IEEMAVVEAPTEEKKEQDIGDLLNLGE  709
             + ++  + + E   +EDMN  KALP P E     EE        E K  +   DLLNLGE
Sbjct  121   QEQDDNDKDAETTNQEDMNETKALPAPEESTPAEEEKKEENVKQETKDTEKEADLLNLGE  180

Query  708   DAPTPEEHANQLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKA  532
             D+ T +E A++LALALFD             T WEAF + + DWETALVQ+AS+L++Q A
Sbjct  181   DSATCDEQADKLALALFDSGNAPVDQAGAGRTAWEAFKDETADWETALVQSASNLNHQTA  240

Query  531   QFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADA  352
                G FD L+LDGMY+QGA   AVA +    +GSA+SVA GSAGRPAMLALPAPP     
Sbjct  241   ALGGGFDMLLLDGMYQQGAT--AVAMASAEASGSASSVALGSAGRPAMLALPAPP-----  293

Query  351   NTTASGA----DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLE  184
              TT +GA    DPFAAS +VAPP +VQMS+LEKKQ+LL EEQ MWQQY +DGM GQ+G+ 
Sbjct  294   -TTQAGATLPTDPFAASCAVAPPPFVQMSDLEKKQKLLVEEQLMWQQYARDGMQGQLGIT  352

Query  183   KAQQSSQPHNYYGY  142
             K Q ++  +N  GY
Sbjct  353   KLQPNT--YNMGGY  364



>ref|XP_010324965.1| PREDICTED: putative clathrin assembly protein At2g25430 [Solanum 
lycopersicum]
Length=636

 Score =   291 bits (744),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 211/512 (41%), Positives = 281/512 (55%), Gaps = 67/512 (13%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVEL----RMQNRRGK-----  1423
             +ATRRGTRLLN+SDFRD + SN WD+SAFVRTY+LYLD+++E+    R QN  G      
Sbjct  110   YATRRGTRLLNLSDFRDEAHSNSWDHSAFVRTYALYLDQRLEMMVFERKQNGDGGEIERY  169

Query  1422  -------HSALASgneegveeedeeeetgntTAIVVTG-------------TPITEMKNE  1303
                     S  AS N      E  +E          +G             TP+ +M+ +
Sbjct  170   GSREERWRSPPASNNRGYDYGEFRDEPGYGMRKSRSSGDVRESTVQDQKDVTPLRQMEPQ  229

Query  1302  YLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRF  1123
              ++ ++ H  ++LDRFL+C+PTG AK  R+VLV LY +VKESFQ+Y  I E+L IL+D+F
Sbjct  230   RIFGKMSHLQRLLDRFLSCRPTGLAKNERMVLVTLYPMVKESFQLYADICEVLAILLDKF  289

Query  1122  MKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeei  943
               ++  D  K  + +   +KQ DEL  FY W K  GI+R SEYP+V+    + LD +EE 
Sbjct  290   FDMEYEDCVKAFDAYASASKQIDELVGFYNWCKDIGIARSSEYPEVQRITSKLLDTLEEF  349

Query  942   irekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEA  763
             +         R       SPE +    P P  E+  DMN IKALPPP +         E+
Sbjct  350   V---------RDRSKATKSPERKVEPLPTPSEESPPDMNEIKALPPPEDYTPPPPPKPES  400

Query  762   PTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN----  595
             P      Q+ GDL++L E+  T ++  N+ ALALF G  T + +       WEAF+    
Sbjct  401   PKPAAVVQETGDLVDLREEGVTADDQGNKFALALFAGPVTNNGS-------WEAFSSNGG  453

Query  594   --------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVA  457
                           G  DWE ALV+TASHLS QKA   G  D L+L+GMY QG + Q VA
Sbjct  454   PEVTSAWQNPAAESGKADWELALVETASHLSQQKATMGGGLDPLLLNGMYDQGMVRQHVA  513

Query  456   SSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMS  277
             ++      SA+SVA    G+ +   L  P    D      G DPFAASLSV PPAYVQM+
Sbjct  514   TAQSSGG-SASSVALPGPGKSSTPVLALPAP--DGTVQTVGQDPFAASLSVPPPAYVQMA  570

Query  276   ELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             +LEKKQ+LL +EQ +WQQY ++GM GQ  L K
Sbjct  571   DLEKKQQLLVQEQILWQQYARNGMQGQTSLSK  602



>ref|XP_010068201.1| PREDICTED: putative clathrin assembly protein At1g03050, partial 
[Eucalyptus grandis]
Length=421

 Score =   284 bits (727),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 196/432 (45%), Positives = 264/432 (61%), Gaps = 24/432 (6%)
 Frame = -1

Query  1497  SAFVRTYSLYLDEQVELRMQNRRGKHSALASgneegveeedeeeetgntTAIVVTGTPIT  1318
             SAFVRTY+ YLDEQ++ RM  RR K        E   + +   +            TP+ 
Sbjct  4     SAFVRTYASYLDEQLDYRMLGRRRKRGKCGLDEEGEEDGQGSTKI-----------TPVR  52

Query  1317  EMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGI  1138
             EMK + ++S++QH+ Q+  RFLACKPTG  K +R++ VALY +VKESFQ+YY + E++ I
Sbjct  53    EMKYDLMFSKMQHFQQLFRRFLACKPTGRVKNDRVIFVALYAIVKESFQLYYEMREIMVI  112

Query  1137  LVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLD  958
             L DRF +++I D  K ++IF RV  Q+  LE FY W K  GI+R SEYP++E    +KLD
Sbjct  113   LFDRFTEMEIADCAKAYDIFLRVQMQFYALEDFYAWCKNVGIARTSEYPEIERITHKKLD  172

Query  957   imeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEM  778
             +ME +IR+K+ +A G   R+    P+   V+E      +E +MN++ ALPPPPE  + E 
Sbjct  173   LMERVIRDKVAVAKG--WRAPNAKPKNVIVQETVEAEASEPNMNSVTALPPPPEG-LSES  229

Query  777   AVVEAPTEEKKEQDI---GDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPW  607
             AVVE   EE K++D     DLLNLG++A  P EH +++A  LFDG     P        W
Sbjct  230   AVVE--KEEPKKEDTQQQADLLNLGDNAAAPAEHGDKMAWTLFDG--DALPVGPDPAPKW  285

Query  606   EAF-NGSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLT-TG  433
             EAF N + DWE+ LVQ+AS LSNQK    G  D    +GM + GA      +S      G
Sbjct  286   EAFGNDTADWESPLVQSASSLSNQKTTLAGGLDMWSFNGMNQHGATAAGARTSAAYAGNG  345

Query  432   SATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRL  253
             SA+SV    AG+PAMLALPAPP+      T++ ADPFAASL+VAPP YVQMS+ EKKQR 
Sbjct  346   SASSVTVTPAGQPAMLALPAPPAPV-GGATSNFADPFAASLTVAPPPYVQMSDPEKKQRH  404

Query  252   LWEEQQMWQQYT  217
             L +EQ +  + T
Sbjct  405   LVDEQLLLLKCT  416



>ref|XP_006343526.1| PREDICTED: putative clathrin assembly protein At2g25430-like 
[Solanum tuberosum]
Length=639

 Score =   290 bits (743),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 213/524 (41%), Positives = 284/524 (54%), Gaps = 71/524 (14%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVEL----RMQNRRGK-----  1423
             +ATRRGTRLLN+SDFRD + SN WD+SAFVRTY+LYLD+++E+    R QN  G      
Sbjct  110   YATRRGTRLLNLSDFRDEAHSNSWDHSAFVRTYALYLDQRLEMMVFERKQNGGGGEIERY  169

Query  1422  -------HSALASgneegveeedeeeetgntTAIVVTG-------------TPITEMKNE  1303
                     S  AS N      E  +E          +G             TP+ +M+ E
Sbjct  170   GSREERWRSPPASNNRGYDYGEFGDEPAYGMRKSRSSGDVRESTVQDQKDVTPMRQMEPE  229

Query  1302  YLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRF  1123
              ++ ++ H  ++LDRFL+C+PTG AK  R+VLV LY +VKESFQ+Y  I E+L IL+D+F
Sbjct  230   RIFGKMSHLQRLLDRFLSCRPTGLAKNERMVLVTLYPMVKESFQLYADICEVLAILLDKF  289

Query  1122  MKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeei  943
               ++  D  K  + +   +KQ DEL  FY W K  GI+R SEYP+V+    + LD +EE 
Sbjct  290   FDMEYEDCVKAFDAYASASKQIDELVGFYNWCKDIGIARSSEYPEVQRITSKLLDTLEEF  349

Query  942   irekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEA  763
             +         R       SPE +    P P  E   DMN IKALPPP +         E+
Sbjct  350   V---------RDRAKATKSPERKVEALPAPPEEPAPDMNEIKALPPPEDYTPPPPPEPES  400

Query  762   PTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN----  595
             P      Q+ GDL++L E+  T ++  N+ ALALF G  T + +       WEAF+    
Sbjct  401   PKPAAVVQETGDLMDLREEGVTADDQGNKFALALFAGPGTNNGS-------WEAFSSNGG  453

Query  594   --------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVA  457
                           G  DWE ALV+TASHLS QKA   G  D L+L+GMY QG + Q VA
Sbjct  454   PEVTSAWQNPAAESGKADWELALVETASHLSQQKAAMGGGLDPLLLNGMYDQGMVRQHVA  513

Query  456   SSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMS  277
             ++      SA+SVA    G+ +   L  P    D      G DPFAASL+V PP+YVQM+
Sbjct  514   TAQSSGG-SASSVALPGLGKSSTPVLALPAP--DGTVQTVGLDPFAASLTVPPPSYVQMA  570

Query  276   ELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             +LEKKQ+LL +EQ +WQQY ++GM GQ+ L K         YYG
Sbjct  571   DLEKKQQLLVQEQIVWQQYARNGMQGQMSLSKISSG----GYYG  610



>emb|CDP13525.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   290 bits (743),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 193/507 (38%), Positives = 270/507 (53%), Gaps = 62/507 (12%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             +ATRRGTRLLN+SDFRD + S+ WD+SAFVRT + YLD+++E+ + +++   SA      
Sbjct  110   YATRRGTRLLNLSDFRDEAHSSSWDHSAFVRTCAFYLDQRLEMMVYDKKQSGSAHGEDRY  169

Query  1395  egveeede---------------eeetgntTAIVVTGTPITEMKN---------EYLYSR  1288
                                          + +      P  EMK+         E ++ +
Sbjct  170   RSPPGPSRGYGYDYDYNEFRDEPVYGMRRSRSSGDVREPKEEMKDVTPLREMKPERIFGK  229

Query  1287  IQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDI  1108
             + H  ++LDRFLAC+PTG AK  R+++VALY +VKESF++Y  I E+L IL+D+F  ++ 
Sbjct  230   MGHLQRLLDRFLACRPTGLAKTERMIMVALYPMVKESFKLYADICEVLAILLDKFFDMEY  289

Query  1107  PDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekm  928
              D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    + L+ +EE +R++ 
Sbjct  290   QDCVKAFDAYTSAAKQIDELVGFYNWCKDIGVARSSEYPEVQRITGKLLETLEEFVRDRA  349

Query  927   eMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEK  748
             +          +      E +  E E E   DMN IKAL P PE +         P +  
Sbjct  350   KAT--------KSPERKVEPQPVEKEEEPVPDMNEIKAL-PAPESYTPPPPAEPEPPKPV  400

Query  747   KEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAF----------  598
               +  GDL++L +D  T ++  N+LALALF G     P        WEAF          
Sbjct  401   VPEVAGDLVDLRDDGVTADDQGNKLALALFAG-----PVANNGNGSWEAFPANGQPEVTS  455

Query  597   --------NGSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVL  442
                      G  DWE ALV+TAS+LS QKA   G  D L+L+GMY QG + Q V+SS  L
Sbjct  456   AWQNPAVEGGKADWELALVETASNLSKQKAAMGGGLDPLLLNGMYDQGMVRQQVSSSH-L  514

Query  441   TTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKK  262
             + GSA+SVA  + G+           + D      G DPFAASL + PP YVQM+++EKK
Sbjct  515   SGGSASSVALPAPGK----TPVLALPAPDGTVQTVGQDPFAASLCIPPPPYVQMADMEKK  570

Query  261   QRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             Q LL +EQ +WQQY +DGM GQ  L K
Sbjct  571   QGLLVQEQVVWQQYARDGMQGQASLSK  597



>ref|XP_008337266.1| PREDICTED: putative clathrin assembly protein At2g25430 [Malus 
domestica]
Length=612

 Score =   289 bits (739),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 206/515 (40%), Positives = 282/515 (55%), Gaps = 58/515 (11%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNR--RGKHSA-----  1414
             A+RRG R+LN+S FRD + S  WD++ FVR Y+ YL+E+VE  +  R  RG+  +     
Sbjct  111   ASRRGLRVLNLSGFRDEAHSGSWDHAGFVRLYAXYLEEKVEFEVYERKSRGREGSGGFDQ  170

Query  1413  -------LASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRF  1255
                          E      +              TP+TEM+ E +  R+   +++LDR 
Sbjct  171   ERERANREERREFEYENYXSDRALEREKRRESKDSTPVTEMQPEKVLGRLNDLLRVLDRI  230

Query  1254  LACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFH  1075
             L CKP GAAK +RLV+VALY+VVKESF++Y  I E L +L+D+F +++  D  K  + + 
Sbjct  231   LGCKPAGAAKSSRLVIVALYEVVKESFRLYVEICEALRVLLDKFTEMEYADCLKAFDAYV  290

Query  1074  RVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsr  895
               AK  DEL  FY W K  GI+R SEYP+V+    Q L  +E  ++ K            
Sbjct  291   NAAKMIDELVGFYGWCKDMGIARSSEYPEVQRITDQLLTSLEGFLKGKTSRP--------  342

Query  894   epspeveeveepepeaeaeEDMN-TIKALPPPPEDFIEEMAVVEAPTEEKKEQDIG-DLL  721
               SPE    E    + EA+ED+N  +KALPPP E++       EA  +  + Q +  DL+
Sbjct  343   -KSPERNRDENVRVDEEAKEDVNYEVKALPPP-ENYTAPPXPPEARPKPSQPQPVTEDLV  400

Query  720   NLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAF------------------N  595
             NL ++  T +E  N+ ALALF G PT   T  +    WEAF                  +
Sbjct  401   NLRDEEITADEQGNKFALALFSGQPTSINTNGS----WEAFPSNGEPEVTSAWQTPAAES  456

Query  594   GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVA  415
             G  DWE ALV+TAS+L  QKA   G FD L+L+GMY QGA+ Q V++S  L+ GSA+SVA
Sbjct  457   GRADWELALVETASNLXKQKADLAGGFDSLLLNGMYDQGAVRQHVSTSQ-LSGGSASSVA  515

Query  414   FGSAGRpamlalpappssADANTTASGA-DPFAASLSVAPPAYVQMSELEKKQRLLWEEQ  238
                AG+ A   L  P    D    A G  DPFAASL+V PP+YVQ++++E+KQ LL +EQ
Sbjct  516   MPGAGKAAKQVLALPAP--DGTVHAVGQQDPFAASLTVPPPSYVQIADMERKQHLLSQEQ  573

Query  237   QMWQQYTKDGMHGQVGLEKAQQS-----SQPHNYY  148
              +WQQY +DGM GQ+GL K          QP  YY
Sbjct  574   LLWQQYGRDGMQGQLGLAKISGGPRPMMPQPGGYY  608



>ref|XP_002439828.1| hypothetical protein SORBIDRAFT_09g020870 [Sorghum bicolor]
 gb|EES18258.1| hypothetical protein SORBIDRAFT_09g020870 [Sorghum bicolor]
Length=623

 Score =   286 bits (732),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 213/525 (41%), Positives = 290/525 (55%), Gaps = 65/525 (12%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQ--------------  1438
             FATRRGTR+LNMSDF D SR++ WD+SAFVRTY+ YLD+++E RMQ              
Sbjct  113   FATRRGTRMLNMSDFCDRSRADAWDFSAFVRTYAAYLDDRLECRMQGRQQGGGGGGAAAA  172

Query  1437  ----------------NRRGKHSALASgneegveeedeeeetgntTAIVVTGTPITEMKN  1306
                             NR    +A  +G +E  E + E   +    A+V    P +EM  
Sbjct  173   RGGGRPLYEEMYASPGNRYICDAASFNGRQEDAEADAEAAHSRAAVALVTRDPPTSEMTV  232

Query  1305  EYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDR  1126
             + L  +      +LDRF+AC+P GAAK NR+V V+LY +VKES Q+Y  + E++  L+++
Sbjct  233   DQLLVKANQLHHLLDRFIACRPVGAAKANRVVTVSLYPLVKESVQLYCELTEVMATLIEQ  292

Query  1125  FMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimee  946
             F +++  D ++VH +F  +AKQ +ELE FY W K   + R S+ P+VE   ++KL++M+E
Sbjct  293   FAEMETADCERVHALFCGLAKQLEELENFYAWCKVVCVCRQSDVPEVEVVTQKKLELMDE  352

Query  945   iirekmeMAGG--RIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFI-----  787
              IR++   A    R+        E  E    E E E ++DMN  KALP P E        
Sbjct  353   FIRDRHAAADSQQRLPPPEPEPMESPEPAPVEEEEEDDDDMNATKALPAPEEPPAAEQVE  412

Query  786   -EEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
              E   VV  P EE+      D LNL  DA + EEH  QLALALFDG       K      
Sbjct  413   PEAPLVVADPVEEE-----ADFLNLKADAMSGEEHGQQLALALFDGDIAGSAPKG-----  462

Query  609   WEAFNG-SEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTG  433
                F G S DWET LVQ+AS L+NQ+A+  G    ++LDGMY   A    VAS+    +G
Sbjct  463   -NVFQGTSADWETELVQSASALANQRAELGGGLSMMVLDGMYNHAA----VASNAQTFSG  517

Query  432   SATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRL  253
             SA+SVA    G  A   L  P   A  ++ A GADPFAAS  V PP YVQMS+++ KQ+L
Sbjct  518   SASSVALRPPG--APPMLALPAPPAGGSSAAVGADPFAASALVPPPTYVQMSDMQTKQQL  575

Query  252   LWEEQQMWQQYTKDGMH-GQVGL--EKAQQSSQ-----PHNYYGY  142
             L +EQQMW+QY  +GM+ G + +  ++  Q+ Q      HNY GY
Sbjct  576   LTQEQQMWRQYGNNGMNQGALAMLQQRPNQNQQFLPHTGHNYSGY  620



>ref|XP_007203766.1| hypothetical protein PRUPE_ppa003005mg [Prunus persica]
 gb|EMJ04965.1| hypothetical protein PRUPE_ppa003005mg [Prunus persica]
Length=613

 Score =   283 bits (725),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 201/506 (40%), Positives = 284/506 (56%), Gaps = 51/506 (10%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             +ATRRG R+LN+SDFRD + SN WD++ F+R Y++YLDE+VE  +  R+   +     ++
Sbjct  110   YATRRGMRVLNLSDFRDEAHSNAWDHAGFLRFYAMYLDEKVEFEVYERKSGGTEGGRLDQ  169

Query  1395  egv-----------eeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLA  1249
             E              +  ++           + TPI EM+ E +  R+   +++LDR LA
Sbjct  170   ERDYREERKEFDYGNDVSDQSLEREQKRETKSSTPIREMRPERVLGRLNDLLRVLDRILA  229

Query  1248  CKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRV  1069
             C+P GAAK +RLV+VALYQV+KESF++Y +I E LG+L+DR+ +++  D  K  +++   
Sbjct  230   CRPAGAAKSSRLVIVALYQVLKESFRLYVAICEALGVLLDRYTEMEYADCVKAFDVYVNA  289

Query  1068  AKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrep  889
             AK  DEL  FY W K  GI+R SEYP+V+    + L  +E           G +      
Sbjct  290   AKMIDELVGFYGWCKDTGIARSSEYPEVQRITDKLLSSLE-----------GFLKEKTNR  338

Query  888   speveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGE  709
                +EE  + + E + + +   +KALPPP             P     +    DL+NL +
Sbjct  339   PKSMEEKGQVDCEPKQDMNYEVMKALPPPENYTPPPPPPEAQPKASHPQPVTEDLVNLRD  398

Query  708   DAPTPEEHANQLALALFDGiptidptkttittPWEAF------------------NGSED  583
             D  + +E  N+LALALF G PT   TK +    WEAF                  +G  D
Sbjct  399   DGVSADEQGNKLALALFSGPPTTTNTKGS----WEAFPSDGEPQVTSAWQTPAAESGKTD  454

Query  582   WETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSA  403
             WE ALV+TAS+LS QKA   G FD L+L+GMY QGA+ Q V S+  L++GSA+SVA   A
Sbjct  455   WELALVETASNLSKQKADLAGGFDPLLLNGMYDQGAVRQHV-STSQLSSGSASSVAMPGA  513

Query  402   GRpamlalpappssADANTTASGA-DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQ  226
             G+     L  P    D    A G  DPFAASL+V PP+YVQ++E+E+KQ LL +EQ +WQ
Sbjct  514   GKGVTPLLALPAP--DGTVQAVGQQDPFAASLAVPPPSYVQIAEMERKQYLLSQEQLLWQ  571

Query  225   QYTKDGMHGQVGLEKAQQSSQPHNYY  148
             QY ++GM GQVGL  A+ SS    YY
Sbjct  572   QYGREGMQGQVGL--AKISSGGSGYY  595



>ref|XP_009803425.1| PREDICTED: putative clathrin assembly protein At2g25430 [Nicotiana 
sylvestris]
Length=614

 Score =   283 bits (724),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 204/503 (41%), Positives = 273/503 (54%), Gaps = 46/503 (9%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             +A+RRG R+LNMSDFRD + SN WD+S FVRTY+ YLD+++E  + +R+     +    E
Sbjct  109   YASRRGMRVLNMSDFRDEAHSNSWDHSGFVRTYAFYLDQKLEFTVYDRKLNDVDIKKRFE  168

Query  1395  egveeedeeeetgntTAIVVTG-----TPITEMKNEYLYSRIQHYIQILDRFLACKPTGA  1231
             +G   +  E            G     TP+ EMK E +  R+   +Q+LDRFLAC+PTGA
Sbjct  169   DGYGMDRGERSYSEFDESAGRGEKNGVTPVREMKPERVLERLNQLLQLLDRFLACRPTGA  228

Query  1230  AKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDE  1051
             AK +R+VLVALY +VKESF++Y  I E+L  L+DRF +++  D  K  + +   AK  DE
Sbjct  229   AKNSRMVLVALYSLVKESFKLYADICEVLQFLLDRFAEMEYADCVKAFDAYVNAAKMIDE  288

Query  1050  LEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspevee  871
             L   Y W K  GI+R SE+P+V+    + L  +E  +RE+                    
Sbjct  289   LVGIYNWCKDVGIARSSEFPEVQIITDKLLGTLEGFLRERANRP--------RSPEINRA  340

Query  870   veepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIG-DLLNLGEDAPTP  694
                   E E + DMN IKALPPP             P +    Q +  DL+NL +D  T 
Sbjct  341   ESSLAAEEEKQPDMNEIKALPPPENYIYTPPPSQPGPQQRPDTQRVAEDLVNLKDDGVTA  400

Query  693   EEHANQLALALFDGiptidptkttittPWEAFN-------------------GSEDWETA  571
             +   N++ALALF G              WEAF                    G  DWE A
Sbjct  401   DGEGNKMALALFSGPVANGNDS------WEAFPSDGEAGQVTSAWQTPAAEIGKADWELA  454

Query  570   LVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpa  391
             LV+TAS+LS QKA   G FD L+L+GMY QG + Q V+++ V T GSA+SVA    G  +
Sbjct  455   LVETASNLSKQKADLAGGFDSLLLNGMYDQGTVRQHVSNTQV-TGGSASSVALPGPGNRS  513

Query  390   mlalpappssADANTTASG-ADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTK  214
                L  P    D      G  DPFAASLSV PP+YVQM+ELE+KQ+LL +EQQ+WQQY  
Sbjct  514   KPMLALPAP--DGTIQPVGNQDPFAASLSVPPPSYVQMAELERKQQLLTQEQQLWQQYAS  571

Query  213   DGMHGQVGLEKAQQSSQPHNYYG  145
             +GM GQ+GL K   ++    YYG
Sbjct  572   NGMQGQMGLSKLAGTTS--GYYG  592



>tpg|DAA44659.1| TPA: putative ENTH/ANTH/VHS superfamily protein isoform 1 [Zea 
mays]
 tpg|DAA44660.1| TPA: putative ENTH/ANTH/VHS superfamily protein isoform 2 [Zea 
mays]
Length=541

 Score =   281 bits (718),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 176/415 (42%), Positives = 240/415 (58%), Gaps = 40/415 (10%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ +MK E + +R+ H  Q+LDRFLAC+PTG AK +R+VLVALYQ+V+ESFQ+Y  I E
Sbjct  122   TPVRDMKPEQVLARMHHLQQLLDRFLACRPTGGAKHSRMVLVALYQIVRESFQLYADICE  181

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+DRF  ++  +  K  E +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  182   VLAVLLDRFFDMEYAECVKAFEAYASAAKQIDELCAFYAWCKDTGVARSSEYPEVQRVTD  241

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +                 E E    + E E DMN+IKALP P ED+
Sbjct  242   KLLETLEEFMRDRAKRP----------KSPSPEPEPEPVKEEPEPDMNSIKALPAP-EDY  290

Query  789   IEEMAVVEAPTEEKKE--QDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttit  616
              E          + +   Q  GDL++L ED  + +E  N+LALALF G P    +  +  
Sbjct  291   KEPEPEKVEEEVKPEPPLQPQGDLVDLREDTVSADEQGNRLALALFQGPPAAGGSNGS--  348

Query  615   tPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGM  490
               WEAF                   G  DWE ALV+TAS+LSNQK    G  D L+L+GM
Sbjct  349   --WEAFPSNGGNEVTSAWQNPAAEPGKADWELALVETASNLSNQKPAMSGGMDPLLLNGM  406

Query  489   YRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASL  310
             Y QG + Q V +   +TTGSA+SVA  + G+   +     P   D +    G DPFAASL
Sbjct  407   YDQGVVRQHVGAQ--VTTGSASSVALPAPGQKTQMLALPAP---DGSMQTVGGDPFAASL  461

Query  309   SVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             +V PP+YVQM++LEKKQ+LL +EQ MWQQY +DGM GQ  L +  ++  P   YG
Sbjct  462   AVPPPSYVQMADLEKKQQLLTQEQIMWQQYQRDGMQGQSSLNRLDRAPNPAMPYG  516



>ref|XP_006475889.1| PREDICTED: probable clathrin assembly protein At4g32285-like 
[Citrus sinensis]
 gb|KDO80181.1| hypothetical protein CISIN_1g045671mg [Citrus sinensis]
Length=628

 Score =   283 bits (724),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 202/509 (40%), Positives = 280/509 (55%), Gaps = 53/509 (10%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVEL------------RMQNR  1432
             ++TRRG RLLNMSDFRD + SN WD+  FVR Y++YLDE+VE             +++ R
Sbjct  110   YSTRRGMRLLNMSDFRDEAHSNSWDHGGFVRFYAMYLDEKVEFVVYEKKMRGGEGKVEER  169

Query  1431  RGKHSALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFL  1252
               +         E   +   +             TP+ EM+ E + +R+   ++ILD+ L
Sbjct  170   EDRFRDDFDRGMELRSQSYGDVSESVRREERREATPMREMRPERVLARLNQLLRILDKVL  229

Query  1251  ACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHR  1072
             AC+PTGAAK +RLVLVALY VVK+SF +Y  I E LG+L+D+F +++  D  +  E +  
Sbjct  230   ACRPTGAAKNSRLVLVALYLVVKDSFGLYVDICEALGVLLDKFTEMEYADCVRGFEAYVS  289

Query  1071  VAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsre  892
              AK  DEL  FY W K  GI+R SE+P+V+    + L  ++  +         + M +R 
Sbjct  290   AAKMIDELVGFYGWCKDIGIARSSEFPEVQRITDKLLGTLDGFL---------KEMANRP  340

Query  891   pspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQD--IGDLLN  718
              +PE    E+  P+ E E DMN +KALP P           +     K +      DL+N
Sbjct  341   KNPERIREEKLPPKQEPEPDMNEVKALPAPENSSPPPPPPPKPQQPPKPQPQQVTDDLVN  400

Query  717   LGEDAPTPEEHANQLALALFDGiptidptkttittPWEAF------------------NG  592
             L +DA + +E  N+LALALF G PT           WEAF                  +G
Sbjct  401   LKDDATSADEQGNKLALALFSGPPTNTNGS------WEAFPSNGQPEVTSAWQTPAAESG  454

Query  591   SEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAF  412
               DWE+ALV+TA +LS QKA + G FD L+L+GMY QGA+ Q V+++  L+ GSA+SV  
Sbjct  455   RADWESALVETAGNLSKQKAAYAGGFDSLVLNGMYDQGAVRQHVSTT-QLSGGSASSVTL  513

Query  411   GSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQM  232
                G+ A   L  P       T  +  DPFAASL+V PP+YVQM+E+E+KQ+ L +EQQ+
Sbjct  514   PGPGKSATPVLALPAPDGTVQTVGNN-DPFAASLTVPPPSYVQMAEMERKQQFLVQEQQL  572

Query  231   WQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             WQQY +DGM GQV L K    S    YYG
Sbjct  573   WQQYGRDGMQGQVALAKIAGGS---GYYG  598



>ref|XP_006450877.1| hypothetical protein CICLE_v10007747mg [Citrus clementina]
 gb|ESR64117.1| hypothetical protein CICLE_v10007747mg [Citrus clementina]
Length=628

 Score =   283 bits (724),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 202/509 (40%), Positives = 280/509 (55%), Gaps = 53/509 (10%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVEL------------RMQNR  1432
             ++TRRG RLLNMSDFRD + SN WD+  FVR Y++YLDE+VE             +++ R
Sbjct  110   YSTRRGMRLLNMSDFRDEAHSNSWDHGGFVRFYAMYLDEKVEFVVYEKKMRGGEGKVEER  169

Query  1431  RGKHSALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFL  1252
               +         E   +   +             TP+ EM+ E + +R+   ++ILD+ L
Sbjct  170   EDRFRDDFDRGMELRSQSYGDVSESVRREERREATPMREMRPERVLARLNQLLRILDKVL  229

Query  1251  ACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHR  1072
             AC+PTGAAK +RLVLVALY VVK+SF +Y  I E LG+L+D+F +++  D  +  E +  
Sbjct  230   ACRPTGAAKNSRLVLVALYLVVKDSFGLYVDICEALGVLLDKFTEMEYADCVRGFEAYVS  289

Query  1071  VAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsre  892
              AK  DEL  FY W K  GI+R SE+P+V+    + L  ++  +         + M +R 
Sbjct  290   AAKMIDELVGFYGWCKDIGIARSSEFPEVQRITDKLLGTLDGFL---------KEMANRP  340

Query  891   pspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQD--IGDLLN  718
              +PE    E+  P+ E E DMN +KALP P           +     K +      DL+N
Sbjct  341   KNPERIREEKLPPKQEPEPDMNEVKALPAPENSSPPPPPPPKPQQPPKPQPQQVTDDLVN  400

Query  717   LGEDAPTPEEHANQLALALFDGiptidptkttittPWEAF------------------NG  592
             L +DA + +E  N+LALALF G PT           WEAF                  +G
Sbjct  401   LKDDATSADEQGNKLALALFSGPPTNTNGS------WEAFPSNGQPEVTSAWQTPAAESG  454

Query  591   SEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAF  412
               DWE+ALV+TA +LS QKA + G FD L+L+GMY QGA+ Q V+++  L+ GSA+SV  
Sbjct  455   RADWESALVETAGNLSKQKAAYAGGFDSLVLNGMYDQGAVRQHVSTT-QLSGGSASSVTL  513

Query  411   GSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQM  232
                G+ A   L  P       T  +  DPFAASL+V PP+YVQM+E+E+KQ+ L +EQQ+
Sbjct  514   PGPGKSATPVLALPAPDGTVQTVGNN-DPFAASLTVPPPSYVQMAEMERKQQFLVQEQQL  572

Query  231   WQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             WQQY +DGM GQV L K    S    YYG
Sbjct  573   WQQYGRDGMQGQVALAKIAGGS---GYYG  598



>ref|XP_003526396.1| PREDICTED: putative clathrin assembly protein At2g25430-like 
isoformX1 [Glycine max]
 ref|XP_006581355.1| PREDICTED: putative clathrin assembly protein At2g25430-like 
isoform X2 [Glycine max]
Length=641

 Score =   282 bits (722),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 208/516 (40%), Positives = 284/516 (55%), Gaps = 72/516 (14%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNR------------  1432
             +ATRRGTRLLNMSDFRD + S+ WD+SAFVRTY+LYLD+++EL + +R            
Sbjct  110   YATRRGTRLLNMSDFRDEAHSSSWDHSAFVRTYALYLDQRLELMLFDRKGTVSAANGGGD  169

Query  1431  ---------------------RGKHSALASgneegveeedeeeetgntTAIVVTGTPITE  1315
                                  RG+ +      +     +  E         VV+ TP+ +
Sbjct  170   DRFGGRDNFQSPPYEYGGGEFRGEGAYGNGMRKTRSYGDMSESVGRGEEKRVVSVTPLRD  229

Query  1314  MKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGIL  1135
             M  E ++ ++ H  ++LDRFLAC+PTG AK +R+VL+ALY VVKESFQ+Y  I E+L +L
Sbjct  230   MTPERVFGKMGHLQRLLDRFLACRPTGLAKNSRMVLIALYPVVKESFQLYADICEVLAVL  289

Query  1134  VDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDi  955
             +D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    + L+ 
Sbjct  290   LDKFFDMEYADCVKAFDAYASAAKQIDELVAFYNWCKDTGVARSSEYPEVQKITSKLLET  349

Query  954   meeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMA  775
             +EE +R+       R  R + P  + E     + E E   DMN IKALP           
Sbjct  350   LEEFVRD-------RAKRPKSPERKEEAPPVEKVEEEPAPDMNEIKALP---PPENYTPP  399

Query  774   VVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN  595
                 P  + + Q   DL+NL +DA T ++  N+ ALALF G P  +   +     WEAF 
Sbjct  400   PPPEPEPKPQPQVTEDLVNLRDDAVTADDQGNKFALALFAGAPANNANGS-----WEAFP  454

Query  594   ------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALN  469
                               G  DWE ALV+TAS+LS QKA   G  D L+L GMY QG + 
Sbjct  455   SNGQPEVTSAWQTPAAEPGKADWELALVETASNLSKQKAALGGGLDPLLLTGMYDQGMVR  514

Query  468   QAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAY  289
             Q V+++  L+ GSA+SVA    G+  +LALPAP    D +      DPFAASLSV PP+Y
Sbjct  515   QHVSTTQ-LSGGSASSVALPGPGKTPVLALPAP----DGSVQPVNQDPFAASLSVPPPSY  569

Query  288   VQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             VQM+++EKKQ LL +EQQ+W QY +DGM GQ  L K
Sbjct  570   VQMADMEKKQHLLVQEQQVWHQYARDGMQGQSSLAK  605



>ref|XP_009595075.1| PREDICTED: putative clathrin assembly protein At2g25430 [Nicotiana 
tomentosiformis]
Length=619

 Score =   281 bits (720),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 205/503 (41%), Positives = 275/503 (55%), Gaps = 47/503 (9%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             +A+RRG R+LNMSDFRD + SN WD+S FVRTY+ YLD+++E  + +R+          E
Sbjct  109   YASRRGMRVLNMSDFRDEAHSNSWDHSGFVRTYAFYLDQKLEFTVYDRKLNDVDDKKRFE  168

Query  1395  egveeedeeeetgntTAIVVTG-----TPITEMKNEYLYSRIQHYIQILDRFLACKPTGA  1231
             +G   +  E            G     TP+ EMK E +  R+    Q+LDRFLAC+PTGA
Sbjct  169   DGYGMDRRERSYSEFDESAGRGEKNGVTPVIEMKPERVLERLNQLFQLLDRFLACRPTGA  228

Query  1230  AKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDE  1051
             AK +R+VLVALY +VKESF++Y  I E+L  L+DRF +++  D  K  + +   AK  DE
Sbjct  229   AKNSRMVLVALYSLVKESFKIYADICEVLQFLLDRFAEMEYADCVKAFDAYVNAAKMIDE  288

Query  1050  LEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspevee  871
             L   Y W K  GI+R SE+P+V+    + L  +E  +RE+                    
Sbjct  289   LVGIYNWCKDIGIARSSEFPEVQIITDKLLGTLEGFLRERANRP--------RSPEISRV  340

Query  870   veepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIG-DLLNLGEDAPTP  694
                   E E + DMN IKALPPP E++I        P +    Q +  +L+NL +D  T 
Sbjct  341   ESSLAVEEEKQPDMNEIKALPPP-ENYIYTPPPQPGPQQRPDTQRVTENLVNLKDDGVTA  399

Query  693   EEHANQLALALFDGiptidptkttittPWEAFN-------------------GSEDWETA  571
             +   N++ALALF G              WEAF                    G  DWE A
Sbjct  400   DGEGNKMALALFSGPVANGNGS------WEAFPSDGEAGQVTSAWQTPAAEIGKADWELA  453

Query  570   LVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpa  391
             LV+TAS+LS QKA   G FD L+L+GMY QG + Q V+++ V T GSA+SVA    G  +
Sbjct  454   LVETASNLSKQKADLAGGFDSLLLNGMYDQGTVRQHVSNTQV-TGGSASSVALPGPGNSS  512

Query  390   mlalpappssADANTTASG-ADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTK  214
                L  P    D      G  DPFAASLSV PP+YVQM+ELE+KQ+LL +EQQ+WQQY  
Sbjct  513   KPMLALPAP--DGTVQPVGNQDPFAASLSVPPPSYVQMAELERKQQLLMQEQQLWQQYAS  570

Query  213   DGMHGQVGLEKAQQSSQPHNYYG  145
             +GM GQ+GL K   ++    YYG
Sbjct  571   NGMQGQMGLSKLAGTTS--GYYG  591



>ref|XP_009416237.1| PREDICTED: probable clathrin assembly protein At4g32285 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009416238.1| PREDICTED: probable clathrin assembly protein At4g32285 [Musa 
acuminata subsp. malaccensis]
Length=642

 Score =   281 bits (720),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 179/419 (43%), Positives = 238/419 (57%), Gaps = 39/419 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP  +MK E +  R+    Q+LDRFLAC+PTG AK +R++LVALY +V+ESFQ+Y  I E
Sbjct  223   TPPRDMKPERILGRMHQLHQLLDRFLACRPTGNAKHSRMILVALYPIVRESFQLYADICE  282

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L IL+DRF  +D PD  K  E +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  283   ILAILLDRFFDMDYPDCVKSFEAYASAAKQIDELCSFYAWCKDTGVARSSEYPEVQRITD  342

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R+       R  R + P  E         + E E+DMN+IKALP P  D+
Sbjct  343   KLLETLEEFMRD-------RAKRPKSPPREAVPAPTGAGDEEPEQDMNSIKALPAP-SDY  394

Query  789   IEE----MAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptktt  622
              EE      V   P + + +Q   DL++L +D  + ++ +N+LALALF G          
Sbjct  395   KEEEPEPAKVTVEPVKPQPQQQ-ADLVDLRDDGSSADDQSNKLALALFQGPVAAANGANG  453

Query  621   ittPWEAF-------------------NGSEDWETALVQTASHLSNQKAQFPGNFDELML  499
                 WEAF                    G  DWE  LV+TAS+LSNQKA   G FD L+L
Sbjct  454   S---WEAFPSANGDSGVTSAWQTPAAETGKADWEIVLVETASNLSNQKATLGGGFDPLLL  510

Query  498   DGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFA  319
             +GMY QGA+ Q V +   ++ GS++SVA    GR A   L  P    D      G DPFA
Sbjct  511   NGMYDQGAVKQQVNAQ--MSGGSSSSVALPVPGRGAAPVLALPAP--DGTMQTIGGDPFA  566

Query  318   ASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYGY  142
             ASLS+ PP+YVQM+E+EKKQ+LL +EQ +WQQY KDGM GQ  L K   +  P+    Y
Sbjct  567   ASLSIPPPSYVQMAEIEKKQQLLVQEQVVWQQYAKDGMQGQTSLAKLNNTFMPNPTMPY  625


 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATRRGTRLLNMSDFRD + SN WD+SAFVRTY+LYLD+++E  +  R+
Sbjct  109   YATRRGTRLLNMSDFRDEAHSNSWDHSAFVRTYALYLDQRLECLVYERK  157



>ref|XP_010323295.1| PREDICTED: putative clathrin assembly protein At2g25430 [Solanum 
lycopersicum]
 ref|XP_010323296.1| PREDICTED: putative clathrin assembly protein At2g25430 [Solanum 
lycopersicum]
Length=614

 Score =   280 bits (716),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 194/516 (38%), Positives = 274/516 (53%), Gaps = 70/516 (14%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR-------GKHS  1417
             +A+R+G R+LNMS FRD + SN WD+S FVRTY++YLD+++E     R+       G++ 
Sbjct  107   YASRKGMRVLNMSGFRDEAHSNSWDHSGFVRTYAIYLDQKLEFSTYGRKLNDVDGYGQYR  166

Query  1416  ALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPT  1237
             +  +G +      +E +E+          TP+ EMK E +  R+   +Q+LDRFLAC+PT
Sbjct  167   SEGNGMDRRKRFSNEPDESAGREE-KSGATPVREMKPEKVLERLNQLLQLLDRFLACRPT  225

Query  1236  GAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQW  1057
             GAAK +R+VL  LY +V ESF++Y  I E+L IL+DRF +++  D  K  + +   AK  
Sbjct  226   GAAKNSRMVLATLYSLVNESFKLYADICEVLQILLDRFAEMEYADCVKTFDAYVSAAKMI  285

Query  1056  DELEVFYTWSKAAGISRLSEYPDV-----------ENYPKQKLDimeeiirekmeMAGGR  910
             DEL   Y W K  GI+R SE+P+V           E + +++ +        ++E A   
Sbjct  286   DELVGTYNWCKDVGIARSSEFPEVQVITDKLLGTLEGFLRERANRPRSPEINRVERASAV  345

Query  909   IMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEK--KEQD  736
             I                    E   DMN IKALPPP        A  ++  + +   +Q 
Sbjct  346   I-------------------EENAPDMNEIKALPPPENHTPPPPAPPQSVPQPRPHAQQV  386

Query  735   IGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN-------------  595
               DL+NL +D  T +   N++ALALF G              WEAF              
Sbjct  387   TEDLVNLKDDGVTADGEGNKMALALFSGPVAKGSGS------WEAFPSDGETGQVTSAWQ  440

Query  594   ------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTG  433
                   G  DWE ALV+TAS+LS Q A   G FD L+L+GMY QG + Q V+++ V T G
Sbjct  441   TPAAEIGKADWELALVETASNLSKQTADLAGGFDSLLLNGMYDQGTVRQHVSNTQV-TGG  499

Query  432   SATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRL  253
             SA+SVA    G+ A   L  P          +  DPFAASL+V PP+YVQM+E E+KQ L
Sbjct  500   SASSVALPGVGKTATPMLALPAPDGTVQPVRN-QDPFAASLAVPPPSYVQMAEQERKQHL  558

Query  252   LWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             L +EQQ+WQQY  +GM GQ+GL +   ++    YYG
Sbjct  559   LMQEQQLWQQYASNGMQGQMGLSRLAGATP--GYYG  592



>ref|XP_006358291.1| PREDICTED: putative clathrin assembly protein At2g25430-like 
[Solanum tuberosum]
Length=616

 Score =   279 bits (714),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 198/505 (39%), Positives = 271/505 (54%), Gaps = 48/505 (10%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR-----GKHSAL  1411
             +A+RRG R+LNMS FRD + SN WD+S FVRTY++YLD+++E    +R+     G     
Sbjct  109   YASRRGMRVLNMSGFRDEAHSNSWDHSGFVRTYAIYLDQKLEFSTYDRKLNDGDGYGQYR  168

Query  1410  ASgneegveeedeeeetgntTAIVVTG-TPITEMKNEYLYSRIQHYIQILDRFLACKPTG  1234
             + G+     +    E   +      +G TP  EMK E +  R+   +Q+LDRFLAC+PTG
Sbjct  169   SDGHGMDRRKRFFNEPDESAGREEKSGVTPAREMKPEKVLERLNQLLQLLDRFLACRPTG  228

Query  1233  AAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWD  1054
             AAK +R+VL ALY +VKESF++Y  I E+L  L+DRF +++  D  K  + +   AK  D
Sbjct  229   AAKDSRMVLAALYSLVKESFKLYADICEVLHNLLDRFAEMEYADCVKTFDAYVSAAKMID  288

Query  1053  ELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeve  874
             EL   Y W K  GI+R SE+P+V+    + L  +E  +RE+                   
Sbjct  289   ELVGTYNWCKDVGIARSSEFPEVQVITDKLLGTLEAFLRERANRP--------RSPEINR  340

Query  873   eveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKK--EQDIGDLLNLGEDAP  700
                    + E   DMN IKALPPP        A  +   + +   +Q   DL+NL +D  
Sbjct  341   VESSSAVKEEKTPDMNEIKALPPPENHTPPPPAPPQPVPQPRPHAQQVTEDLVNLKDDGV  400

Query  699   TPEEHANQLALALFDGiptidptkttittPWEAFN-------------------GSEDWE  577
             T +   N++ALALF G              WEAF                    G  DWE
Sbjct  401   TADGEGNKMALALFSGPVAKGNGS------WEAFPSDGETGQVTSAWQTPAAEIGKADWE  454

Query  576   TALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGR  397
              ALV+TAS+LS Q A   G FD L+L+GMY QG + Q V+++ V T GSA+SVA    G+
Sbjct  455   LALVETASNLSKQTADLAGGFDSLLLNGMYDQGTVRQHVSNTQV-TGGSASSVALPGVGK  513

Query  396   pamlalpappssADANTTASG-ADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQY  220
              A   L  P    D      G  DPFAASL+V PP+YVQM+E E+KQ LL +EQQ+WQQY
Sbjct  514   TATPMLALPAP--DGTVQPVGNQDPFAASLAVPPPSYVQMAEQERKQHLLMQEQQLWQQY  571

Query  219   TKDGMHGQVGLEKAQQSSQPHNYYG  145
               +GM GQ+GL +   ++    YYG
Sbjct  572   ASNGMQGQMGLSRLAGATP--GYYG  594



>gb|KDP30263.1| hypothetical protein JCGZ_17045 [Jatropha curcas]
Length=622

 Score =   278 bits (711),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 205/506 (41%), Positives = 287/506 (57%), Gaps = 52/506 (10%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             +A+RRG R+LNMSDFRD + S+ WDY+AFVR Y++YLDE+VE     R  K SA     +
Sbjct  110   YASRRGMRVLNMSDFRDEAHSHSWDYAAFVRFYAMYLDEKVEFGASER--KLSANQRKFD  167

Query  1395  egveeedeeeetgntTAIV----------VTGTPITEMKNEYLYSRIQHYIQILDRFLAC  1246
             EG + +        +   V             TPI EMK E +  ++   +++LDR LAC
Sbjct  168   EGDDFDYRTGRKSRSYGDVNDDSAGREQRKQATPIREMKPEQVLDKLNQLLRMLDRVLAC  227

Query  1245  KPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVA  1066
             +PTG AK NRLVL +LY +VKESF++Y  I E LG+L+DRF +++  D  K  +++   A
Sbjct  228   RPTGMAKNNRLVLTSLYGIVKESFELYIDICEALGVLLDRFTEMEYSDCVKGFDMYVAAA  287

Query  1065  KQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsreps  886
             K  DEL  FY W K  GI+R SE+P V+    Q L  +E  ++E             +  
Sbjct  288   KMIDELVGFYGWCKDIGIARSSEFPAVKKITDQLLGTLEGFLKEMTNRP-------SKNP  340

Query  885   peveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGED  706
               ++E E+   + E E D+N +KALPPP E++           + +  +   DL+NL +D
Sbjct  341   EIIKEEEKVPIKQEPEPDINEVKALPPP-ENYTPPSPPEPE-PKPQPPKATEDLVNLKDD  398

Query  705   APTPEEHANQLALALFDGiptidptkttittPWEAF------------------NGSEDW  580
             A + +E  ++LALALF G   ++         WEAF                  +G  DW
Sbjct  399   AVSADEQGDKLALALFSGPAAVNTNGG-----WEAFPSNGKAEVTSAWQTPAAESGKADW  453

Query  579   ETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAG  400
             E ALV++AS+LS QKA   G  D L+L+GMY QGA+ Q V ++  L+ GSA+SVA    G
Sbjct  454   ELALVESASNLSKQKANLAGGMDSLLLNGMYDQGAVRQHVGTT-QLSGGSASSVALPGQG  512

Query  399   RpamlalpappssADANTTASG-ADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQ  223
             + A   L  P    D      G  DPFAASL+V PP+YVQM+E+E+KQ+LL +EQQ+WQQ
Sbjct  513   KSATPVLALPAP--DGTVQPVGNQDPFAASLAVPPPSYVQMAEIERKQQLLVQEQQLWQQ  570

Query  222   YTKDGMHGQVGLEKAQQSSQPHNYYG  145
             Y +DGM GQ+GL K+  +S    YYG
Sbjct  571   YGRDGMQGQMGLSKSNGAS---GYYG  593



>ref|XP_009363999.1| PREDICTED: putative clathrin assembly protein At2g25430 [Pyrus 
x bretschneideri]
Length=618

 Score =   277 bits (709),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 200/511 (39%), Positives = 279/511 (55%), Gaps = 57/511 (11%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
             A+R G R LN+S FRD + S  WD++ FVR Y++YL+E+VE  +  R+ +    +SG ++
Sbjct  111   ASRTGVRFLNLSAFRDEAHSGSWDHAGFVRFYAMYLEEKVEFEVYERKSRGREGSSGFDQ  170

Query  1392  gveeedeeeetgntTAIVVT--------------GTPITEMKNEYLYSRIQHYIQILDRF  1255
               E  + EE          +               TP+ EM+ E +  R+   +++L+R 
Sbjct  171   ERERANREERREFEYENYQSDQALEREKRRESKDSTPVREMRPERVLVRLNDLLRVLNRI  230

Query  1254  LACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFH  1075
             L C+P GAAK +RLV++ALY+VVKESF++Y  I E LG+++DRF ++D  D  K  + + 
Sbjct  231   LGCRPVGAAKSSRLVIIALYEVVKESFRLYVEICEALGVVLDRFTEMDYADCAKAFDAYV  290

Query  1074  RVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsr  895
               AK  DEL  FY W K  GI+R SE+P+V+    + L  +E  ++ K            
Sbjct  291   NGAKMIDELVGFYGWCKDMGIARSSEFPEVQRITDKLLKSLEGFLKGKTTRP--------  342

Query  894   epspeveeveepepeaeaeEDMN-TIKALPPPPEDFIEEMAVVEAPTEEKKEQDIG-DLL  721
               SPE    E  + + EA++D+N  +KALPPP           E   +  + Q +  DL+
Sbjct  343   -KSPERNREENVQVDEEAKQDVNYEVKALPPPEIYTASPPLPSEVRPKPLQHQPVTEDLV  401

Query  720   NLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAF------------------N  595
             NL +D  T +E  N+ ALALF   PT   T  T    WE F                  +
Sbjct  402   NLRDDGITADEQGNKFALALFSAAPTATNTNGT----WETFPSNGEPEMTSAWQTPAAES  457

Query  594   GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVA  415
             G  DWE ALV+TAS+LS QKA   G FD L+L GMY QGA+   V++S  L+ GSA+SVA
Sbjct  458   GKADWELALVETASNLSKQKADLAGGFDSLLLSGMYDQGAVKHHVSASQ-LSGGSASSVA  516

Query  414   FGSAGRpamlalpappssADANTTASGA-DPFAASLSVAPPAYVQMSELEKKQRLLWEEQ  238
                AG+ A   L  P    D    A G  DPFAASL V PP+YVQM+++E+KQ LL +EQ
Sbjct  517   MPGAGKSATPVLALPAP--DGTVHAVGQQDPFAASLLVPPPSYVQMADMERKQHLLSQEQ  574

Query  237   QMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
              +WQQY +DGM GQ+GL K         YYG
Sbjct  575   LLWQQYGRDGMQGQLGLAKIS-----GGYYG  600



>emb|CDX75232.1| BnaA01g04700D [Brassica napus]
Length=593

 Score =   276 bits (707),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 196/482 (41%), Positives = 281/482 (58%), Gaps = 46/482 (10%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             +ATRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R+GK+ +      
Sbjct  109   YATRRGTRILNMSDFRDEAHSSSWDHSAFVRTYASYLDQRLELALFERKGKNGS------  162

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                       E G     VVT TP+ +M  E ++ ++ H  ++LDRFL+ +PTG AK +R
Sbjct  163   ------SNVNEIGGGGRDVVTVTPLRDMPPEKIFGKMGHLQRLLDRFLSSRPTGLAKSSR  216

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             ++LVA+Y +VKESF++Y  I E+L +L+D+F +++  D  K  + +   AKQ DEL  FY
Sbjct  217   MILVAMYPIVKESFRLYADICEVLAVLLDKFFEMEYTDCVKAFDAYASAAKQIDELIAFY  276

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
              W K  G++R SEYP+V+    + L+ +EE +R++ +              E+E    P 
Sbjct  277   HWCKDTGVARSSEYPEVQRITSKLLETLEEFVRDRAKRG------KSPERKEIEAPPAPA  330

Query  855   peaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQ  676
             PE EAE DMN IKALPPP           +   + ++ Q   DL++L ED  + ++  N+
Sbjct  331   PEEEAEVDMNEIKALPPPENYTPPPPPPPKPEVKPEQPQVTNDLVDLREDGVSVDDQGNK  390

Query  675   LALALFDGiptidptkttittPWEAFN-----------------GSEDWETALVQTASHL  547
              ALALF G         T    WEAF+                 G  DWE ALV+TAS+L
Sbjct  391   FALALFAG-------PATSNGKWEAFSSDNSEVTSAWQNPAAEKGKADWELALVETASNL  443

Query  546   SNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpapp  367
              +QKA   G  D L+L+GMY QGA+ Q V++S  LT GS++SVA     +    +     
Sbjct  444   EHQKAAMGGGLDPLLLNGMYDQGAVRQHVSTSE-LTGGSSSSVALPLPSK--TNSHILAL  500

Query  366   ssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGL  187
              + D        DPFAASL++ PP+YVQM+E++KKQ LL +EQQ+WQQY ++GM GQ  L
Sbjct  501   PAPDGTVQKVNQDPFAASLTIPPPSYVQMAEMDKKQYLLTQEQQLWQQYQQEGMRGQASL  560

Query  186   EK  181
              K
Sbjct  561   AK  562



>gb|KHG28158.1| hypothetical protein F383_15961 [Gossypium arboreum]
Length=633

 Score =   276 bits (707),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 212/515 (41%), Positives = 280/515 (54%), Gaps = 59/515 (11%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRM---------------  1441
             +ATRRG R+LNMSDFRD + SN WD++ FVR Y++YLDE+VE  +               
Sbjct  110   YATRRGMRVLNMSDFRDEAHSNSWDHAGFVRFYAMYLDEKVEFSVFEKKKRDGEDKFAER  169

Query  1440  --QNRR--GKHSALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYI  1273
               +NRR  G+         +       +        +   GTP+ EM+ E +  R+   +
Sbjct  170   DERNRREYGEFRDDYDRETDRRSRSYGDLNDSLRKDVRKEGTPMREMRPERVLGRLHQLL  229

Query  1272  QILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKK  1093
             +ILDR L C+P G AK +RLVLVALYQ++KESF +Y  I E LGIL+DRF +++  D  K
Sbjct  230   RILDRVLGCRPAGMAKDSRLVLVALYQILKESFGLYGEICEALGILLDRFTEMEYVDCVK  289

Query  1092  VHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGG  913
               + +   AK  DEL  FY W K  GI+R SEYP+V+    + L     +     EMA G
Sbjct  290   GFDAYVSAAKMIDELVGFYGWCKDVGIARSSEYPEVQRITDKLL---GTLEGFLKEMANG  346

Query  912   RIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDI  733
             R       SPE    E+P  + E E +MN IKALP P               +    Q  
Sbjct  347   R------KSPERIREEKPPVKEEPETNMNEIKALPAPENYNPPPPPPEPEQPKTVPPQVT  400

Query  732   GDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN--------------  595
              DL+NL +DA + +E  N+LALALF G PT +   +     WEAF               
Sbjct  401   EDLVNLRDDAVSADEQGNKLALALFSGSPTSNANGS-----WEAFPSNGEPEVTSAWQTP  455

Query  594   ----GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSA  427
                 G  DWE ALV++AS+LS QKA   G FD L+L+GMY QGA+ Q V+SS  L+ GSA
Sbjct  456   AAEPGKADWELALVESASNLSKQKAGLAGGFDPLLLNGMYDQGAVRQHVSSS-QLSGGSA  514

Query  426   TSVAFGSAGRpamlalpappssADANTTASGA-DPFAASLSVAPPAYVQMSELEKKQRLL  250
             +SVA    G+ A   L  P    D      G  DPFAASL+V PP+YVQ++++E+KQ+LL
Sbjct  515   SSVAMPGPGKAASQVLALPAP--DGTVQPVGQQDPFAASLTVPPPSYVQIADMEQKQQLL  572

Query  249   WEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
              +EQQ+W QY +DGM GQ  L K   SS    YYG
Sbjct  573   VQEQQLWNQYGRDGMQGQSSLAKITASSV---YYG  604



>ref|XP_008362897.1| PREDICTED: putative clathrin assembly protein At2g25430 [Malus 
domestica]
Length=618

 Score =   276 bits (705),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 199/511 (39%), Positives = 276/511 (54%), Gaps = 57/511 (11%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
             A+R+G R LN+S FRD + S  WD++ FVR Y++YL+E+VE  +  R+ +    +SG ++
Sbjct  111   ASRKGVRFLNLSAFRDEAHSGSWDHAGFVRFYAMYLEEKVEFEVYERKSRGREGSSGFDQ  170

Query  1392  gveeedeeeetgntTAIVVT--------------GTPITEMKNEYLYSRIQHYIQILDRF  1255
               E  + EE          +               TP+ EM+ E +  R+   +++L+R 
Sbjct  171   ERERANREERREFEYENYQSDXALEREKRRESKDSTPVREMRPERVLVRLNDLLRVLNRI  230

Query  1254  LACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFH  1075
             L C+P GAAK +RLV+V LY+VVKESF++Y  I E LG+++DRF ++D  D  K  + + 
Sbjct  231   LGCRPAGAAKSSRLVIVTLYEVVKESFRLYVEICEALGVVLDRFTEMDYADCAKAFDSYV  290

Query  1074  RVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsr  895
               AK  DEL  FY W K  GI+R SE+P+V+    + L  +E  ++ K            
Sbjct  291   NGAKMIDELVGFYGWCKDMGIARSSEFPEVQRITDKLLKSLEGFLKGKTXRP--------  342

Query  894   epspeveeveepepeaeaeEDMN-TIKALPPPPEDFIEEMAVVEAPTEEKKEQDIG-DLL  721
               SPE    E  + + E  +D+N  +KALPPP           E   +  + Q +  DL+
Sbjct  343   -KSPERXREENVQVDEEXXQDVNYEVKALPPPEIYTASPPLPXEVXPKPLQHQPVTEDLV  401

Query  720   NLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAF------------------N  595
             NL +D  T +E  N+ ALALF   PT   T       WE F                  +
Sbjct  402   NLRDDGITADEQGNKXALALFSAAPTATNTNGA----WETFPSNGEPEMTSAWQTPAAES  457

Query  594   GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVA  415
             G  DWE ALV+T S+LS QKA   G FD L+L GMY QGA+   V+SS  L+ GSA+SVA
Sbjct  458   GKADWELALVETXSNLSKQKADLAGGFDSLLLSGMYDQGAVKHHVSSSQ-LSGGSASSVA  516

Query  414   FGSAGRpamlalpappssADANTTASGA-DPFAASLSVAPPAYVQMSELEKKQRLLWEEQ  238
                AG+ AM  L  P    D    A G  DPFAASL V PP+YVQM+++E+KQ LL +EQ
Sbjct  517   MPGAGKSAMPVLALPAP--DGTVHAVGQQDPFAASLLVPPPSYVQMADMERKQHLLSQEQ  574

Query  237   QMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
              +WQQY +DGM GQ+GL K         YYG
Sbjct  575   LLWQQYGRDGMQGQLGLAKIS-----GGYYG  600



>ref|XP_006362623.1| PREDICTED: putative clathrin assembly protein At2g25430-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006362624.1| PREDICTED: putative clathrin assembly protein At2g25430-like 
isoform X2 [Solanum tuberosum]
Length=641

 Score =   276 bits (706),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 206/522 (39%), Positives = 284/522 (54%), Gaps = 66/522 (13%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVEL----RMQN-----RRGK  1423
             +ATRRGTRLLN+ DFRD + ++ WD+SAFVRTY+LYLD+++EL    R QN     R G 
Sbjct  110   YATRRGTRLLNLLDFRDEAHASSWDHSAFVRTYALYLDQRLELMVFERKQNGGEMERYGS  169

Query  1422  ------------------HSALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYL  1297
                               H         G+       +   +       TP+ EMK E +
Sbjct  170   KDEQWRSPQSSNHGYDYDHGDFRDEPGYGMRRSRSSGDVRESIQEKKDVTPLREMKPERI  229

Query  1296  YSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMK  1117
             + ++ H  ++LDRFL+C+PTG AK  R+VLVALY VVKES+++Y  I ++L +L+D+F  
Sbjct  230   FGKMTHLQRLLDRFLSCRPTGLAKNERMVLVALYPVVKESYKIYMDICDVLAVLLDKFFD  289

Query  1116  LDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiir  937
             ++  D  K  + +   AKQ DEL  FY W K  G+SR SEYP+V     + LD +EE +R
Sbjct  290   MEYEDCVKAFDAYSSAAKQIDELVGFYNWCKDIGVSRSSEYPEVSRITSKLLDTLEEFVR  349

Query  936   ekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPT  757
             ++      ++M+S E   E +   + E       DMN IKALPPP +         E P 
Sbjct  350   DR-----AKVMKSPERKVESQPAPQEEEPIP---DMNEIKALPPPEDYTAPPPPEPEPPK  401

Query  756   EEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAF-------  598
              +   Q+  DL++L E+  T ++  N+ ALALF G  T +   +     WEAF       
Sbjct  402   PKPVIQETRDLVDLREEGVTADDQGNKFALALFAGPGTSNANGS-----WEAFPSNGEPE  456

Query  597   -----------NGSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASS  451
                        +G  DWE ALV+TAS+LS QKA   G  D L+L+GMY QG + Q VA++
Sbjct  457   VTSAWQNPAAESGKADWELALVETASNLSKQKAALGGGLDPLLLNGMYDQGVVRQHVATA  516

Query  450   GVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSEL  271
                   SA+SVA    G+ A   L  P    D      G DPFAASLSV PP+YVQM++L
Sbjct  517   QSSGG-SASSVALPGVGKSATPVLALPAP--DGTVQTVGQDPFAASLSVPPPSYVQMADL  573

Query  270   EKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             +KK++LL +EQ +WQQY++DGM GQ  L K         YYG
Sbjct  574   QKKEQLLVQEQMVWQQYSRDGMQGQTSLAKITTG----GYYG  611



>emb|CDX68831.1| BnaC01g06220D [Brassica napus]
Length=591

 Score =   275 bits (702),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 194/484 (40%), Positives = 274/484 (57%), Gaps = 52/484 (11%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             +ATRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R+GK+        
Sbjct  109   YATRRGTRILNMSDFRDEAHSSSWDHSAFVRTYASYLDQRLELALFERKGKNGG------  162

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                               VVT TP+ +M  E ++ ++ H  ++LDRFL+ +PTG AK +R
Sbjct  163   -------GNVNEIGGGRDVVTVTPLRDMPPEKIFGKMGHLQRLLDRFLSSRPTGLAKSSR  215

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             ++LVA+Y +VKESF++Y  I E+L +L+D+F +++  D  K  + +   AKQ DEL  FY
Sbjct  216   MILVAMYPIVKESFRLYADICEVLAVLLDKFFEMEYTDCVKAFDAYASAAKQIDELIAFY  275

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
              W K  G++R SEYP+V+    + L+ +EE +R++ +              E+E    P 
Sbjct  276   HWCKDTGVARSSEYPEVQRITSKLLETLEEFVRDRAKRG------KSPERKEIEAPPPPA  329

Query  855   peaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQD--IGDLLNLGEDAPTPEEHA  682
             PE  AE DMN IKAL   P              E K EQ     DL++L ED  + ++  
Sbjct  330   PEEAAEVDMNEIKAL---PPPENYTPPPPPPKPEAKVEQPQVTNDLVDLREDGVSADDQG  386

Query  681   NQLALALFDGiptidptkttittPWEAFN-----------------GSEDWETALVQTAS  553
             N+ ALALF G         T    WEAF+                 G  DWE ALV+TAS
Sbjct  387   NKFALALFAG-------PVTSNGKWEAFSSDNSEVTSAWQNPAAEQGKADWELALVETAS  439

Query  552   HLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpa  373
             +L +QKA   G  D L+L+GMY QGA+ Q V++S  LT GS++SVA     +    +   
Sbjct  440   NLEHQKAAMGGGLDPLLLNGMYDQGAVRQHVSTSE-LTGGSSSSVALPLPSK--TNSHIL  496

Query  372   ppssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQV  193
                + D        DPFAASL++ PP+YVQM+E++KKQ LL +EQQ+WQQY ++GM GQ 
Sbjct  497   ALPAPDGTVQKVNQDPFAASLTIPPPSYVQMAEMDKKQYLLTQEQQLWQQYQQEGMRGQA  556

Query  192   GLEK  181
              L K
Sbjct  557   SLAK  560



>gb|KHN22116.1| Putative clathrin assembly protein [Glycine soja]
Length=606

 Score =   275 bits (703),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 184/482 (38%), Positives = 263/482 (55%), Gaps = 43/482 (9%)
 Frame = -1

Query  1569  ATRRGT-RLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             +T  GT R+LNMSDFRD + SN WD   FVR YSLYLD +V+     R+     + S   
Sbjct  111   STHLGTSRILNMSDFRDDAHSNSWDQVGFVRVYSLYLDAKVDFVAYRRKLSDGVVESVEF  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                    E E            TP+ EM  E +  R+   +++LD  L C+P+GAAK N 
Sbjct  171   RDEFGSAERERNEV--------TPVREMGAERVLKRLNRLLRMLDCVLGCRPSGAAKNNS  222

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             LVLVALYQVV++SF++Y  + ++LG+L+DRF +++     K  + +   AK  DEL  FY
Sbjct  223   LVLVALYQVVRDSFKLYAEVCDVLGVLLDRFTEMEYEHCVKAFDSYVSAAKMMDELVGFY  282

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
              W K  GI+R SEYPDV+    + L  +E  ++         +    +      EV+   
Sbjct  283   GWCKDTGIARSSEYPDVQRITDKLLGTLEGFLK--------EMSCRPKSPERKLEVKVTV  334

Query  855   peaeaeEDMNTIKAL---------PPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDA  703
              E++ E DMN +KAL         PPPP    +   +  AP  +K+     DL++L ED 
Sbjct  335   NESQPEADMNKVKALPAPETESFTPPPPMSVAQPNKI--APNSQKQ---TSDLVDLREDG  389

Query  702   PTPEEHANQLALALF--DGi--ptidptkttittPWE---AFNGSEDWETALVQTASHLS  544
              + +E  N+L  A    +G         ++ + + WE   A  G  DWE ALV+  S+LS
Sbjct  390   VSADEQGNKLGAATVRTEGSWEAFPSNGESEVKSAWETPAAEAGKADWELALVENTSNLS  449

Query  543   NQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpapps  364
              QKA   G FD L+L+GMY QGA+ Q V+++  L+ GSA+SVA    G+           
Sbjct  450   RQKADLAGGFDPLLLNGMYDQGAVRQHVSTTQ-LSGGSASSVALPGPGK--SATPVLALP  506

Query  363   sADANTTASGA-DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGL  187
             + +    A G  DPFAASL V PP+YVQ++++E+KQ LL +EQQ+WQQY +DGM GQ+GL
Sbjct  507   APNGTVQAVGPQDPFAASLMVPPPSYVQIADMERKQHLLVQEQQLWQQYGRDGMQGQLGL  566

Query  186   EK  181
              +
Sbjct  567   SR  568



>ref|NP_001049708.1| Os03g0275500 [Oryza sativa Japonica Group]
 gb|ABF95253.1| Clathrin assembly protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11622.1| Os03g0275500 [Oryza sativa Japonica Group]
 gb|EAY89446.1| hypothetical protein OsI_10952 [Oryza sativa Indica Group]
 dbj|BAG89428.1| unnamed protein product [Oryza sativa Japonica Group]
Length=651

 Score =   275 bits (704),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 183/403 (45%), Positives = 235/403 (58%), Gaps = 39/403 (10%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ +MK E + +R+ H  Q+LDRFLAC+PTG AK +R+VLVALYQ+V+ESFQ+Y  I E
Sbjct  225   TPVRDMKPERVLARMHHLQQLLDRFLACRPTGGAKHSRMVLVALYQIVRESFQLYADICE  284

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+DRF  ++  +  K  E +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  285   VLAVLLDRFFDMEYAECVKAFEAYASAAKQIDELCAFYGWCKETGVARSSEYPEVQRVTD  344

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +         R    R  SP  E   EP  E E E DMN IKALP P ED+
Sbjct  345   KLLETLEEFM---------RDRAKRPKSPPREPEPEPVKEEEPEPDMNEIKALPAP-EDY  394

Query  789   --IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttit  616
                E   V E    E   Q  GDL++L E+  T +E  N+LALALF G P    +  +  
Sbjct  395   KEPEPEKVEEEVKPEPPPQPQGDLVDLREETVTADEQGNRLALALFQGPPAAGGSNGS--  452

Query  615   tPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGM  490
               WEAF                   G  DWE ALV+TAS+LS QKA   G  D L+L+GM
Sbjct  453   --WEAFPSNGGNEVTSAWQNPAAEPGKADWELALVETASNLSKQKATMTGGMDPLLLNGM  510

Query  489   YRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASL  310
             Y QGA+ Q V  +  +TTGSA+SVA   AG+   +     P   D +    G DPFAASL
Sbjct  511   YDQGAVRQHV--NAQVTTGSASSVALPPAGQKTQVLALPAP---DGSMQNVGGDPFAASL  565

Query  309   SVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             S  PP+YVQM+E+EKKQ+ L +EQ MWQQY +DGM GQ  L K
Sbjct  566   SFPPPSYVQMAEMEKKQQFLTQEQMMWQQYQRDGMQGQSSLAK  608


 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             ATRRGTRLLN+SDFRD + S  WD+SAFVRTY+LYLD+++E  +  R+
Sbjct  111   ATRRGTRLLNLSDFRDEAHSGSWDHSAFVRTYALYLDQRLEFFLHERK  158



>gb|EEE58789.1| hypothetical protein OsJ_10324 [Oryza sativa Japonica Group]
Length=422

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 181/398 (45%), Positives = 231/398 (58%), Gaps = 39/398 (10%)
 Frame = -1

Query  1314  MKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGIL  1135
             MK E + +R+ H  Q+LDRFLAC+PTG AK +R+VLVALYQ+V+ESFQ+Y  I E+L +L
Sbjct  1     MKPERVLARMHHLQQLLDRFLACRPTGGAKHSRMVLVALYQIVRESFQLYADICEVLAVL  60

Query  1134  VDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDi  955
             +DRF  ++  +  K  E +   AKQ DEL  FY W K  G++R SEYP+V+    + L+ 
Sbjct  61    LDRFFDMEYAECVKAFEAYASAAKQIDELCAFYGWCKETGVARSSEYPEVQRVTDKLLET  120

Query  954   meeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF--IEE  781
             +EE +         R    R  SP  E   EP  E E E DMN IKALP P ED+   E 
Sbjct  121   LEEFM---------RDRAKRPKSPPREPEPEPVKEEEPEPDMNEIKALPAP-EDYKEPEP  170

Query  780   MAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEA  601
               V E    E   Q  GDL++L E+  T +E  N+LALALF G P    +  +    WEA
Sbjct  171   EKVEEEVKPEPPPQPQGDLVDLREETVTADEQGNRLALALFQGPPAAGGSNGS----WEA  226

Query  600   FN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGA  475
             F                   G  DWE ALV+TAS+LS QKA   G  D L+L+GMY QGA
Sbjct  227   FPSNGGNEVTSAWQNPAAEPGKADWELALVETASNLSKQKATMTGGMDPLLLNGMYDQGA  286

Query  474   LNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPP  295
             + Q V +   +TTGSA+SVA   AG+   +     P   D +    G DPFAASLS  PP
Sbjct  287   VRQHVNAQ--VTTGSASSVALPPAGQKTQVLALPAP---DGSMQNVGGDPFAASLSFPPP  341

Query  294   AYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             +YVQM+E+EKKQ+ L +EQ MWQQY +DGM GQ  L K
Sbjct  342   SYVQMAEMEKKQQFLTQEQMMWQQYQRDGMQGQSSLAK  379



>ref|XP_004240592.1| PREDICTED: putative clathrin assembly protein At2g25430 [Solanum 
lycopersicum]
Length=641

 Score =   275 bits (702),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 202/522 (39%), Positives = 279/522 (53%), Gaps = 66/522 (13%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVEL----RMQN---------  1435
             +ATRRGTRLLN+SDFRD + ++ WD+SAFVRTY+LYLD+++EL    R QN         
Sbjct  110   YATRRGTRLLNLSDFRDEAHASSWDHSAFVRTYALYLDQRLELMVFERKQNGGQVERYGS  169

Query  1434  -----------RRG---KHSALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYL  1297
                         RG    H         G+       +   +       TP+ EMK E +
Sbjct  170   KDEQWRLPQSSNRGYGYDHGDFRDEPGYGMRRSRSSGDVRESIQEKKDVTPMREMKPERI  229

Query  1296  YSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMK  1117
             + ++ H  ++LDRFL+C+PTG AK  R+VLVALY VVKES+++Y  I ++L +L+D+F  
Sbjct  230   FGKMTHLQRLLDRFLSCRPTGLAKNERMVLVALYPVVKESYKIYTDICDVLAVLLDKFFD  289

Query  1116  LDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiir  937
             ++  D  K  + +   AKQ DEL  FY W K  G+SR SEYP+V     + LD +EE +R
Sbjct  290   MEYEDCVKAFDAYASAAKQIDELVGFYNWCKDIGVSRSSEYPEVSRITSKLLDTLEEFVR  349

Query  936   ekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPT  757
             ++ +          +      + +      E   DMN IKALPPP +        +E P 
Sbjct  350   DRAKA--------MKSPERKVDSQPAPQGEEPTLDMNVIKALPPPEDYTAPPPPELEPPK  401

Query  756   EEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAF-------  598
              +   Q+  DL++L E+  T +   N+ ALALF G  T +   +     WEAF       
Sbjct  402   PKPVIQETRDLVDLREEGVTADAQGNKFALALFAGPGTSNANGS-----WEAFPSNGEPE  456

Query  597   -----------NGSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASS  451
                        +G  DWE ALV+TAS+LS QKA   G  D L+L+GMY QG + Q VA++
Sbjct  457   ITSAWQNPAAESGKADWELALVETASNLSKQKAALGGGLDPLLLNGMYDQGVVRQHVATA  516

Query  450   GVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSEL  271
                   SA+SVA    G+ A   L  P    D      G DPFAASLSV PP+YVQ+++L
Sbjct  517   QSSGG-SASSVALPGVGKSATPVLALPAP--DGTVQTVGQDPFAASLSVPPPSYVQIADL  573

Query  270   EKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             +KK++LL +EQ +WQQY +DGM GQ  L K         YYG
Sbjct  574   QKKEQLLVQEQMVWQQYGRDGMQGQTSLAKITTG----GYYG  611



>emb|CDX76976.1| BnaC04g37710D [Brassica napus]
Length=593

 Score =   271 bits (694),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 197/483 (41%), Positives = 269/483 (56%), Gaps = 46/483 (10%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
             +TRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R+            
Sbjct  110   STRRGTRMLNMSDFRDEAHSSSWDHSAFVRTYAFYLDQRLELALFERKSGGGGGNMNEMG  169

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRL  1213
             G  +E +              TP+ EM  E ++ ++ H  ++LDRFL  +PTG AK +R+
Sbjct  170   GGRDEKKAV------------TPLREMTPERIFGKMGHLQRLLDRFLTLRPTGLAKNSRM  217

Query  1212  VLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYT  1033
             +L+ALY VV+ESF++Y  I E+L +L+D+F  ++  D  K  + +   AKQ DEL  FY 
Sbjct  218   ILIALYPVVRESFKLYADICEVLAVLLDKFFDMEYTDCVKAFDAYASAAKQIDELIAFYN  277

Query  1032  WSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepep  853
             W K  G++R SEYP+V+    + L+ +EE +R++ +    R         E         
Sbjct  278   WCKETGVARSSEYPEVQRITSKLLETLEEFVRDRAK----RGKSPERKEIEAPPPPPVAE  333

Query  852   eaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQL  673
             E EAE DMN IKALPPP           E    +  E    DL+NL ED  T ++  N+ 
Sbjct  334   EEEAEPDMNEIKALPPPENYTPPPQPEPEPEKPQYTE----DLVNLREDGVTGDDQGNKF  389

Query  672   ALALFDGiptidptkttittPWEAFN---------------GSEDWETALVQTASHLSNQ  538
             ALALF G P  +         WEAF                G  DWE ALV+TAS+L  Q
Sbjct  390   ALALFAGPPGSNGK-------WEAFPSDGVTSAWQNPAAEPGKADWELALVETASNLEKQ  442

Query  537   KAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssA  358
              A   G FD L+L+GMY QGA+ Q V++S  LT GSA+SVA    G+     L  P    
Sbjct  443   TAALGGGFDSLLLNGMYDQGAVRQHVSTSQ-LTGGSASSVALPLPGKTNTQVLALPAP--  499

Query  357   DANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKA  178
             D        DPFAASL++ PP+YVQM+E+EKKQ LL +EQQ+WQQY ++GM GQ  L K 
Sbjct  500   DGTVEKVNQDPFAASLTIPPPSYVQMAEMEKKQYLLSQEQQLWQQYQREGMRGQASLAKM  559

Query  177   QQS  169
               +
Sbjct  560   NNT  562



>ref|XP_009346195.1| PREDICTED: LOW QUALITY PROTEIN: putative clathrin assembly protein 
At2g25430 [Pyrus x bretschneideri]
Length=663

 Score =   273 bits (697),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 177/417 (42%), Positives = 238/417 (57%), Gaps = 37/417 (9%)
 Frame = -1

Query  1341  VVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYY  1162
             +V+ TP+ EMK E +++++ H  ++LDRFLA +PTG AK +RLVLVA+Y VVKESFQ+Y 
Sbjct  236   IVSVTPLREMKPERIFAKMGHLQRLLDRFLATRPTGLAKSSRLVLVAVYPVVKESFQLYA  295

Query  1161  SIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVE  982
              I E+L +L+D+F  ++ PD  K  + +   AKQ DEL  FY W K  G++R SEYP+V+
Sbjct  296   DICEVLAVLLDKFFDMEYPDCVKAFDAYASAAKQIDELVGFYGWCKDLGLARSSEYPEVQ  355

Query  981   NYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPP  802
                 + L+ +EE +R+       R   ++ P  +VE       E E + DMN IKALP P
Sbjct  356   RIGSKLLETLEEFVRD-------RSKGTKSPERKVEPAPVAPVEEEPQPDMNEIKALPAP  408

Query  801   PEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptktt  622
              E F            E K++ +GDL++L ++  + +   NQLALALF           +
Sbjct  409   -ESFTPPPPPEVVEKAEVKQEVVGDLVDLRDNGVSADAQGNQLALALF----AGPGGGGS  463

Query  621   ittPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLD  496
                 WEAF                   G  DWE ALV+TAS+LS QK    G  D L+LD
Sbjct  464   ANGSWEAFPSDGQPQVTSAWQTPAAEPGKADWELALVETASNLSRQKQNLGGGMDPLLLD  523

Query  495   GMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAA  316
             GMY QG + Q V S+  LT GSA+SVA    G+ A   L  P    D    A   DPFAA
Sbjct  524   GMYDQGIVRQHV-STAQLTGGSASSVALPGPGKSATQVLALPAP--DGTVQAVNQDPFAA  580

Query  315   SLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             SL+V PP+YVQM++LEKKQ LL +EQQ+W QY K+GM GQ  L+K   +     YYG
Sbjct  581   SLTVPPPSYVQMADLEKKQHLLMQEQQLWNQYAKEGMQGQGSLQKISGT----GYYG  633


 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 1/45 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRM  1441
             +ATRRGTRLLN+SDFRD + S+ WD+SAFVRTY+LYLD+++EL +
Sbjct  110   YATRRGTRLLNLSDFRDEAHSSSWDHSAFVRTYALYLDQRLELML  154



>ref|XP_010920611.1| PREDICTED: probable clathrin assembly protein At4g32285 [Elaeis 
guineensis]
 ref|XP_010920612.1| PREDICTED: probable clathrin assembly protein At4g32285 [Elaeis 
guineensis]
Length=644

 Score =   272 bits (695),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 172/418 (41%), Positives = 237/418 (57%), Gaps = 47/418 (11%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ +MK E +  ++    Q+LDRFLAC+PTGAA+ +R++L++LY +VKESFQ+Y  I +
Sbjct  224   TPLRDMKPERVLGKMHQLQQLLDRFLACRPTGAARHSRMILISLYTIVKESFQLYADICD  283

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+DRF  +D PD  K  E +   AKQ DEL  FY W K  G++R SEYPDV+    
Sbjct  284   ILAVLLDRFFDMDYPDCVKAFEAYKSAAKQIDELCAFYGWCKDTGVARSSEYPDVQRITD  343

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++                   E      + E  +DMN++KALP P  D+
Sbjct  344   KLLETLEEFMRDRARRP----------KSPPREAAPETRDEEPAQDMNSVKALPAP-SDY  392

Query  789   IEEMAVVEAPTEEKK------EQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptk  628
              E+    E   E+        +QD  DLLNL +DA + E+ +++LALALF G        
Sbjct  393   QEQQPEPEPEPEKVVEPPKKLQQDT-DLLNLRDDASSAEDRSSKLALALFSGPGAATGAN  451

Query  627   ttittPWEAFN---------------------GSEDWETALVQTASHLSNQKAQFPGNFD  511
              +    WEAF                      G  DWE ALV+TAS+L+ QKA   G FD
Sbjct  452   GS----WEAFPSNGAPGQGEVTSAWQTPAAEPGKADWELALVETASNLTKQKATLGGGFD  507

Query  510   ELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGA  331
              L+L+GMY QGA+ Q V  +   +TGSA+SVA    G+     L  P    D      G 
Sbjct  508   PLLLNGMYDQGAVKQHV--NAQTSTGSASSVALPGLGQKTTPVLALPAP--DGTVETIGQ  563

Query  330   DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPH  157
             DPFAASLS APP+YVQ++++EKKQ+LL +EQQMWQQY +DGM GQ  L +   S  P+
Sbjct  564   DPFAASLSYAPPSYVQIADIEKKQQLLVQEQQMWQQYGRDGMQGQASLARLNNSYFPN  621


 Score = 68.6 bits (166),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 39/43 (91%), Gaps = 1/43 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVEL  1447
             +ATRRG+RLLNMSDFRD + S+ WD+SAFVRTY+LYLD+++E 
Sbjct  110   YATRRGSRLLNMSDFRDDTHSSSWDHSAFVRTYALYLDQRLEC  152



>ref|XP_009355755.1| PREDICTED: putative clathrin assembly protein At2g25430 [Pyrus 
x bretschneideri]
Length=662

 Score =   272 bits (696),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 177/417 (42%), Positives = 237/417 (57%), Gaps = 37/417 (9%)
 Frame = -1

Query  1341  VVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYY  1162
             +V+ TP+ EMK E ++ ++ H  ++LDRFLA +PTG AK +RLVLVA+Y VVKESFQ+Y 
Sbjct  235   IVSVTPLREMKPERIFVKMGHLQRLLDRFLATRPTGLAKSSRLVLVAVYPVVKESFQLYA  294

Query  1161  SIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVE  982
              I E+L +L+D+F  ++ PD  K  + +   AKQ DEL  FY W K  G++R SEYP+V+
Sbjct  295   DICEVLAVLLDKFFDMEYPDCVKAFDAYASAAKQIDELVGFYGWCKDLGLARSSEYPEVQ  354

Query  981   NYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPP  802
                 + L+ +EE +R+       R   ++ P  +VE       E E + DMN IKALP P
Sbjct  355   RIGSKLLETLEEFVRD-------RSKGTKSPERKVEPAPVAPVEEEPQPDMNEIKALPAP  407

Query  801   PEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptktt  622
              E F            E K++ +GDL++L ++  + +   NQLALALF           +
Sbjct  408   -ESFTPPPPPEVVEKAEVKQEVVGDLVDLRDNGISADAQGNQLALALF----AGPGGGGS  462

Query  621   ittPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLD  496
                 WEAF                   G  DWE ALV+TAS+LS QK    G  D L+LD
Sbjct  463   ANGSWEAFPSDGQPQVTSAWQTPAAEPGKADWELALVETASNLSRQKQNLGGGMDPLLLD  522

Query  495   GMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAA  316
             GMY QG + Q V S+  LT GSA+SVA    G+ A   L  P    D    A   DPFAA
Sbjct  523   GMYDQGIVRQHV-STAQLTGGSASSVALPGPGKSATQVLALPAP--DGTVQAVNQDPFAA  579

Query  315   SLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             SL+V PP+YVQM++LEKKQ LL +EQQ+W QY K+GM GQ  L+K   +     YYG
Sbjct  580   SLTVPPPSYVQMADLEKKQHLLMQEQQLWNQYAKEGMQGQGSLQKISGT----GYYG  632


 Score = 71.6 bits (174),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATRRGTRLLN+SDFRD + S+ WD+SAFVRTY+LYLD+++EL +  R+
Sbjct  110   YATRRGTRLLNLSDFRDEAHSSSWDHSAFVRTYALYLDQRLELMLFERK  158



>emb|CDY35361.1| BnaA04g14860D [Brassica napus]
Length=591

 Score =   270 bits (691),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 193/483 (40%), Positives = 267/483 (55%), Gaps = 48/483 (10%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
             +TRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R+     +      
Sbjct  110   STRRGTRMLNMSDFRDEAHSSSWDHSAFVRTYAFYLDQRLELALFERKSGGGDMNEMGGG  169

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRL  1213
             G +E+                TP+ EM  E ++ ++ H  ++LDRFL  +PTG AK +R+
Sbjct  170   GRDEKKAV-------------TPLPEMTPERIFGKMGHLQRLLDRFLTLRPTGLAKNSRM  216

Query  1212  VLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYT  1033
             +L+ALY VV+ESF++Y  I E+L +L+D+F  ++  D  K  + +   AKQ DEL  FY 
Sbjct  217   ILIALYPVVRESFKLYADICEVLAVLLDKFFDMEYTDCVKAFDAYASAAKQIDELIAFYN  276

Query  1032  WSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepep  853
             W K  G++R SEYP+V+    + L+ +EE +R++ +       +S E          P  
Sbjct  277   WCKETGVARSSEYPEVQRITSKLLETLEEFVRDRAKRG-----KSPERKEIEAPPPPPPV  331

Query  852   eaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQL  673
               E E DMN IKALPPP           E    +  E    DL+NL ED  T ++  N+ 
Sbjct  332   AEEEEPDMNEIKALPPPESYTPPPQPEPEPEKPQYTE----DLVNLREDGVTGDDQGNKF  387

Query  672   ALALFDGiptidptkttittPWEAF---------------NGSEDWETALVQTASHLSNQ  538
             ALALF G              WEAF                G  DWE ALV+TAS+L  Q
Sbjct  388   ALALFAG-------PPGSNGKWEAFPSDGVTSAWQNPAAEPGKADWELALVETASNLEKQ  440

Query  537   KAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssA  358
              A   G FD L+L+GMY QGA+ Q V++S  LT GSA+SVA    G+           + 
Sbjct  441   TAALGGGFDSLLLNGMYDQGAVRQHVSTS-ELTGGSASSVALPLPGK--ANTQILALPAP  497

Query  357   DANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKA  178
             D        DPFAASL++ PP+YVQM+E+EKKQ LL +EQQ+WQQY ++GM GQ  L K 
Sbjct  498   DGTVEKVNQDPFAASLTIPPPSYVQMAEMEKKQYLLSQEQQLWQQYQREGMRGQASLAKM  557

Query  177   QQS  169
               +
Sbjct  558   NNT  560



>ref|XP_009126233.1| PREDICTED: probable clathrin assembly protein At4g32285 [Brassica 
rapa]
Length=627

 Score =   270 bits (691),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 198/504 (39%), Positives = 286/504 (57%), Gaps = 56/504 (11%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             +ATRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R+GK+ + +S   
Sbjct  109   YATRRGTRILNMSDFRDEAHSSSWDHSAFVRTYASYLDQRLELALFERKGKNGSSSSHQS  168

Query  1395  ----------------------egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQ  1282
                                   +      +  E G     VVT TP+ +M  E ++ ++ 
Sbjct  169   NDDFRSPPPQRGYDYENGYGMPKRSRSFGDVNEIGGGGRDVVTVTPLRDMPPEKIFGKMG  228

Query  1281  HYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPD  1102
             H  ++LDRFL+ +PTG AK +R++LVA+Y +VKESF++Y  I E+L +L+D+F +++  D
Sbjct  229   HLQRLLDRFLSSRPTGLAKSSRMILVAMYPIVKESFRLYADICEVLAVLLDKFFEMEYTD  288

Query  1101  SKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeM  922
               K  + +   AKQ DEL  FY W K  G++R SEYP+V+    + L+ +EE +R++ + 
Sbjct  289   CVKAFDAYASAAKQIDELIAFYHWCKDTGVARSSEYPEVQRITSKLLETLEEFVRDRAKR  348

Query  921   AGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKE  742
                          E+E    P PE EAE DMN IKALPPP           +   + ++ 
Sbjct  349   G------KSPERKEIEAPPAPAPEEEAEVDMNEIKALPPPENYTPPPPPPPKPEVKPEQP  402

Query  741   QDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN-----------  595
             Q   DL++L ED  + ++  N+ ALALF G  + +         WEAF+           
Sbjct  403   QVTNDLVDLREDGVSVDDQGNKFALALFAGPASSNGK-------WEAFSSDNSEVTSAWQ  455

Query  594   ------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTG  433
                   G  DWE ALV+TAS+L +QKA   G  D L+L+GMY QGA+ Q V++S  LT G
Sbjct  456   NPAAEQGKADWELALVETASNLEHQKAAMGGGLDPLLLNGMYDQGAVRQHVSTSE-LTGG  514

Query  432   SATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRL  253
             S++SVA     +     L  P    D        DPFAASL++ PP+YVQM+E++KKQ L
Sbjct  515   SSSSVALPLPSKTNSHILALPAP--DGTVQKVNQDPFAASLTIPPPSYVQMAEMDKKQHL  572

Query  252   LWEEQQMWQQYTKDGMHGQVGLEK  181
             L +EQQ+WQQY ++GM GQ  L K
Sbjct  573   LTQEQQLWQQYQQEGMRGQASLAK  596



>ref|XP_011017805.1| PREDICTED: probable clathrin assembly protein At4g32285 isoform 
X2 [Populus euphratica]
Length=619

 Score =   270 bits (690),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 192/508 (38%), Positives = 268/508 (53%), Gaps = 56/508 (11%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHS-------  1417
             FATR G R+LNMSDFRD + SN WD++ FVR Y+++LDE+VE  +  R+ +         
Sbjct  107   FATRNGMRVLNMSDFRDEAHSNSWDHTVFVRFYAMFLDEKVEFSVFERKVREDERKFDEG  166

Query  1416  --ALASgneegveeedeeeetgntTAIV-----VTGTPITEMKNEYLYSRIQHYIQILDR  1258
                   G      E    + + +   +V     +    I EMK E L   +   ++ILDR
Sbjct  167   GDGFGRGENRDEFEYGMPKRSSSYGDLVRREQKMEVAAIREMKPERLLGILDQQLRILDR  226

Query  1257  FLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIF  1078
              LAC+PTGAAK +RLVLVALYQVVKESF +Y  + E L +L+DRF +++     K  +I+
Sbjct  227   VLACRPTGAAKNDRLVLVALYQVVKESFGLYTEVCEALRVLLDRFNEMEYAYCLKGFDIY  286

Query  1077  HRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrs  898
                AK  DEL VFY W K  GI R SE P+V+   +  L             A G  +R 
Sbjct  287   AGAAKIIDELVVFYVWCKDIGIGRSSENPEVQKITENILG------------ALGESLRE  334

Query  897   repspeveeveepepeaeaeED----MNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIG  730
                          E +  A +D    MN +K+LPP  E +           + + +Q   
Sbjct  335   MTNRRTKSSERSIEEKVPANQDQEPGMNEVKSLPP--ESYTPPPPPPSQQPKPQPQQMTE  392

Query  729   DLLNLGEDAPTPEEHANQLALALFDGiptidptkt----------tittPWEAFNGSE--  586
             DL+NL +D  + +E  N+LA+ALF   PT +               +T+ W+   G    
Sbjct  393   DLVNLKDDGISADEQGNELAMALFSEHPTTNANGVWVAFPSPREPEVTSAWQTPAGQSTQ  452

Query  585   -DWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFG  409
              DWE ALV++AS+LS Q+A   G FD L+L+GMY QGA  Q V+++  L  GSA+SV   
Sbjct  453   ADWELALVESASNLSKQRATLGGGFDSLLLNGMYDQGAARQHVSTTQ-LAGGSASSVG--  509

Query  408   SAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMW  229
                  +   + A P+           DPFAASL+V PP+YVQ++E+E+KQ  L  EQ +W
Sbjct  510   ----KSATPVLALPAPDGTIQPVQNQDPFAASLTVPPPSYVQIAEMERKQHFLVNEQLLW  565

Query  228   QQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             Q Y +DGMHGQVGL++   +S    YYG
Sbjct  566   QHYGRDGMHGQVGLDRINGAS---GYYG  590



>ref|XP_003558231.1| PREDICTED: putative clathrin assembly protein At2g25430 [Brachypodium 
distachyon]
Length=644

 Score =   270 bits (690),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 177/403 (44%), Positives = 230/403 (57%), Gaps = 39/403 (10%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ +MK E +  R+ H  Q+LDRFLAC+PTG AK++R+VLVALYQ+V+ESFQ+Y  I E
Sbjct  223   TPVRDMKPERVLGRMHHLQQLLDRFLACRPTGGAKQSRMVLVALYQMVRESFQLYADICE  282

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+DRF  ++  D  K  E +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  283   VLAVLLDRFFDMEYADCVKAFEAYASAAKQIDELCSFYAWCKDTGVARSSEYPEVQRVTD  342

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +         R    R  SP  E   EP  E E E DMN+IKALP P EDF
Sbjct  343   KLLETLEEFM---------RDRAKRPKSPPREPEPEPVKEEEPEPDMNSIKALPAP-EDF  392

Query  789   IEEMAVVEAPTEEKKEQDI--GDLLNLGEDAPTPEEHANQLALALFDGiptidptkttit  616
              E   V      + +      GDL++L ED  + +E  N+LALALF       P      
Sbjct  393   KEPEPVKVEEEVKPEPPPKPQGDLVDLREDTVSADEQGNRLALALF----QGPPAGGGNN  448

Query  615   tPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGM  490
               WEAF                   G  DWE ALV+TAS+LS QKA   G  D L+L+GM
Sbjct  449   GSWEAFPSNGGNEVTSAWQNPAAEPGKADWELALVETASNLSKQKATMTGGMDPLLLNGM  508

Query  489   YRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASL  310
             Y QG + Q V +    TTGS++SVA  + G+   +     P   D +    G DPFAASL
Sbjct  509   YDQGVVRQHVNAQA--TTGSSSSVALPAPGQKTQMLALPAP---DGSMQNVGGDPFAASL  563

Query  309   SVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             + APP+YVQM+E+EKKQ+ L +EQ MWQQY +DGM G   L K
Sbjct  564   TFAPPSYVQMAEMEKKQQFLTQEQMMWQQYQRDGMQGPSSLAK  606


 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             ATRRGTRLLN+SDFRD + S  WD+SAFVRTY+LYLD+++E  +  R+
Sbjct  111   ATRRGTRLLNLSDFRDEAHSGSWDHSAFVRTYALYLDQRLEFLLHERK  158



>ref|XP_010250161.1| PREDICTED: probable clathrin assembly protein At4g32285 [Nelumbo 
nucifera]
Length=655

 Score =   270 bits (690),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 170/405 (42%), Positives = 228/405 (56%), Gaps = 39/405 (10%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ +MK E +  R+    ++LDRFLAC+PTG AK +R+VLVALY VVKESFQ+Y  I E
Sbjct  227   TPLRDMKPERVLGRMHQLQRLLDRFLACRPTGTAKNSRMVLVALYPVVKESFQLYADICE  286

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++ P+  K  E +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  287   ILAVLLDKFFDMEYPECVKSFEAYATAAKQIDELVAFYNWCKDVGVARSSEYPEVQRITD  346

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++                     EE  P  E E+DMN IKALP P E+ 
Sbjct  347   KLLETLEEFMRDRARRP----------KSPERPREEKTPAQEPEQDMNEIKALPAP-ENC  395

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E   + +++Q   DL++L +D  + E+ +N+LALALF                
Sbjct  396   TPAPPPPEPEPKPQQQQVTADLVDLRDDGASAEDQSNRLALALF-----CGGPNGNGNNS  450

Query  609   WEAFN----------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLD  496
             WEAF                       G  DWE ALV+TAS+LS QKA   G FD L+L+
Sbjct  451   WEAFPSDGGASGQPEVTSAWQTPAAEAGKADWELALVETASNLSKQKATLGGGFDPLLLN  510

Query  495   GMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAA  316
             GMY QGA+ Q + ++  LT GSA+SVA    G            + D      G DPFAA
Sbjct  511   GMYDQGAVRQHMRTA-QLTGGSASSVALPMPGPGKSATPVLALPAPDGTVQTVGQDPFAA  569

Query  315   SLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             SLS+ PPAYVQM++LEKKQ LL +EQQ+WQQY ++GM GQV L K
Sbjct  570   SLSIPPPAYVQMADLEKKQHLLTQEQQLWQQYAREGMQGQVSLAK  614


 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATRRGTRLLNMSDFRD + SN WD+SAFVRTY+LYLD+++E  M  R+
Sbjct  109   YATRRGTRLLNMSDFRDEAHSNSWDHSAFVRTYALYLDQRLECMMHERK  157



>ref|XP_008378380.1| PREDICTED: probable clathrin assembly protein At4g32285 [Malus 
domestica]
 ref|XP_008378381.1| PREDICTED: probable clathrin assembly protein At4g32285 [Malus 
domestica]
Length=662

 Score =   269 bits (688),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 171/417 (41%), Positives = 236/417 (57%), Gaps = 38/417 (9%)
 Frame = -1

Query  1341  VVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYY  1162
             +V+ TP+ +MK E +++++ H  ++LDRFLA +PTG AK +RLVLVA+Y +V+ESFQ+Y 
Sbjct  237   IVSVTPLRDMKPERIFAKMGHLQRLLDRFLATRPTGLAKNSRLVLVAVYPLVRESFQLYA  296

Query  1161  SIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVE  982
              I E+L +L+D+F  ++ PD  K  + +   AKQ DEL  FY W K +G++R SEYP+V+
Sbjct  297   DICEVLAVLLDKFFDMEYPDCVKAFDAYVSAAKQIDELVGFYGWCKDSGLARSSEYPEVQ  356

Query  981   NYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPP  802
                 + L+ +EE +R++ +          +      E     P  E + DMN IKALP P
Sbjct  357   RIGSKLLETLEEFVRDRSKAT--------KSPERKVETAPVAPVEEPQPDMNEIKALPAP  408

Query  801   PEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptktt  622
              E F            E K++ +GDL++L ++  + +   NQLALALF           +
Sbjct  409   -ESFTPPPPPEVXAKAEVKQEVVGDLVBLRDNGVSADAQGNQLALALF----AGPGGGGS  463

Query  621   ittPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLD  496
                 WEAF                   G  DWE ALV+TAS+LS QK    G  D L+LD
Sbjct  464   ANGSWEAFPSDGQPQVTSAWQTPAAEPGKADWELALVETASNLSRQKQNLGGGMDPLLLD  523

Query  495   GMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAA  316
             GMY QG + Q V S+  LT GSA+SVA    G+ A   L  P    D    A   DPFAA
Sbjct  524   GMYDQGIVRQHV-STAQLTGGSASSVALPGPGKSATQVLALPAP--DGTVQAVNQDPFAA  580

Query  315   SLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             SL+V PP+YVQM++LEKKQ LL +EQQ+W QY K+GM GQ  L+K   +     YYG
Sbjct  581   SLTVPPPSYVQMADLEKKQHLLTQEQQLWNQYAKEGMQGQGSLQKMSSA----GYYG  633


 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATRRGTRLLN+SDFRD + S+ WD+SAFVRTY+LYLD+++EL +  R+
Sbjct  110   YATRRGTRLLNLSDFRDEAHSSSWDHSAFVRTYALYLDQRLELMLFERK  158



>ref|XP_002324642.2| hypothetical protein POPTR_0018s12830g [Populus trichocarpa]
 gb|EEF03207.2| hypothetical protein POPTR_0018s12830g [Populus trichocarpa]
Length=622

 Score =   268 bits (684),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 193/507 (38%), Positives = 267/507 (53%), Gaps = 62/507 (12%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHS-------  1417
             FATR G R+LNMSDFRD + SN WD++ FVR Y+++LDE+VE  +  R+ +         
Sbjct  107   FATRNGMRVLNMSDFRDEAHSNSWDHTGFVRFYAMFLDEKVEFSVFERKVREDERKFDEG  166

Query  1416  --ALASgneegveeedeeeetgntTAIV-----VTGTPITEMKNEYLYSRIQHYIQILDR  1258
                   G      E    + + +   +V     +    I EMK E L   +   ++ILDR
Sbjct  167   GDGFGRGENRDEFEYGMPKRSSSYGDLVRREQKMEVAAIREMKPERLLGILDQQLRILDR  226

Query  1257  FLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIF  1078
              LAC+PTG AK +RLVLVALYQVVKESF +Y  + E LG+L+DRF +++     K  +I+
Sbjct  227   VLACRPTGIAKNDRLVLVALYQVVKESFGLYTEVCEALGVLLDRFTEMEYAYCLKGFDIY  286

Query  1077  HRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrs  898
                AK  DEL VFY W K  GI R SEYP+V+   +  L             A G  +R 
Sbjct  287   AGAAKIIDELVVFYVWCKDIGIGRSSEYPEVQKITENILG------------ALGESLRE  334

Query  897   repspeveeveepepeaeaeED----MNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIG  730
                          E +  A++D    MN +K+LPPP           + P  + + Q + 
Sbjct  335   MTNRRTKSSERSIEEKVPAKQDQEPGMNEVKSLPPPESYTPPPPPPSQQPQPQPQPQQMT  394

Query  729   -DLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAF---------------  598
              DL+NL +   + +E  N+LALALF G P+ +         W AF               
Sbjct  395   EDLVNLKDGGISADEQGNELALALFSGPPSTNANGA-----WVAFPSPREPEVTSAWQTP  449

Query  597   ---NGSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSA  427
                +   DWE ALV++AS+LS Q+A   G FD L+L+GMY QGA  Q V+++  LT GSA
Sbjct  450   AAQSSQADWELALVESASNLSKQRATLGGGFDSLLLNGMYDQGAARQHVSTTQ-LTGGSA  508

Query  426   TSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLW  247
             +SV        +   + A P+           DPFAASL+V PP+YVQ++E+E+KQ  L 
Sbjct  509   SSVG------KSATPVLALPAPDGTMQPVQNQDPFAASLTVPPPSYVQIAEMERKQHFLV  562

Query  246   EEQQMWQQYTKDGMHGQVGLEKAQQSS  166
              EQQ+WQ Y +DGMHGQVGL +   +S
Sbjct  563   NEQQLWQHYGRDGMHGQVGLARINGAS  589



>ref|XP_009384881.1| PREDICTED: putative clathrin assembly protein At2g25430 [Musa 
acuminata subsp. malaccensis]
Length=612

 Score =   267 bits (683),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 188/498 (38%), Positives = 258/498 (52%), Gaps = 50/498 (10%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVE-LRMQNRRG---KHSALA  1408
             +A RRG RLL MS F D + SN WD+S FVRTY+LYLD ++  +  + +RG   + S L 
Sbjct  109   YANRRGARLLCMSHFCDEAHSNSWDHSTFVRTYALYLDRRLGWMGYETKRGGGNQRSPLP  168

Query  1407  SgneegveeedeeeetgntTAIVVTG--TPITEMKNEYLYSRIQHYIQILDRFLACKPTG  1234
                  G         +         G  TP+  MK E +  R+   + +LD FL C+P G
Sbjct  169   DPYAYGNYVSSSYSSSPGNGNGEYRGRRTPLKGMKPESVLGRMHELLNVLDSFLGCRPRG  228

Query  1233  AAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWD  1054
              A+ +R++LVALY ++ ESFQ+Y  IA++L IL+D F  +D  D  K  E + R AK  D
Sbjct  229   NAQHSRIILVALYPLLSESFQLYADIADVLAILLDGFFDMDYHDCVKSFEAYARAAKLID  288

Query  1053  ELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeve  874
             EL VFY WSK  G++R SEYP+VE    + L+++EE  R +             P   + 
Sbjct  289   ELCVFYAWSKDTGVARSSEYPEVERITDKLLELLEEFTRNRATRT------RSPPRVALP  342

Query  873   eveepepeaeaeEDMNTIKALPPPP---EDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDA  703
                    + E EE MN+IKALP PP   E+  E   V   P E++     GDL++L +D+
Sbjct  343   AAPTETRDEEPEETMNSIKALPAPPDYEEEAPEPAKVAAEPVEQQ-----GDLVDLRDDS  397

Query  702   PTPEEHANQLALALFDGiptidptkttittPWEAF-------------------NGSEDW  580
                    + L LALF      + +  +    WEAF                    G  DW
Sbjct  398   ---AAAVDNLELALFQAPVAANGSDGS----WEAFPSSDGETGVTSAWQNPAAERGKADW  450

Query  579   ETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAG  400
             E  LV+TAS+LS QKA   G F  L+L+GMY QGA+ Q V +    + GSA+S+A     
Sbjct  451   EMMLVETASNLSKQKATLGGGFHPLLLNGMYDQGAVRQHVNAQA--SGGSASSMALPGP-  507

Query  399   RpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQY  220
                         + D      G DPFAASLS+ PP +VQ+++ EKK++LL +EQ MWQQY
Sbjct  508   GRGGAPPVLALPAPDGTVKTIGQDPFAASLSIPPPPFVQIADAEKKRQLLLQEQVMWQQY  567

Query  219   TKDGMHGQVGLEKAQQSS  166
               DGM GQ GL     S+
Sbjct  568   AGDGMQGQAGLANKPNSN  585



>ref|XP_008367716.1| PREDICTED: putative clathrin assembly protein At2g25430 [Malus 
domestica]
Length=662

 Score =   268 bits (684),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 178/420 (42%), Positives = 242/420 (58%), Gaps = 43/420 (10%)
 Frame = -1

Query  1341  VVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYY  1162
             +V+ TP+ +MK E ++ ++ H  ++LDRFLA +PTG AK +RLVLVA+Y VVKESFQ+Y 
Sbjct  235   IVSVTPLRDMKPERIFVKMGHLQRLLDRFLATRPTGLAKNSRLVLVAVYPVVKESFQLYA  294

Query  1161  SIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVE  982
              + E+L +L+D+F  ++ PD  K  + +   AKQ DEL  FY W K  G++R SEYP+V+
Sbjct  295   DVCEVLAVLLDKFFDMEYPDCVKAFDAYASTAKQIDELVGFYGWCKDLGLARSSEYPEVQ  354

Query  981   NYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPP  802
                 + L+ +EE +R+       R   ++ P  +VE       E E + +MN IKALP P
Sbjct  355   RIGSKLLETLEEFVRD-------RSKGTKSPERKVEPAPVAPVEEELQPNMNEIKALPAP  407

Query  801   PEDFIEEM---AVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidpt  631
              E F       AVV+A   E K++ +GDL++L ++  + +   NQLALALF         
Sbjct  408   -ESFTPPPPPEAVVKA---EVKQEVVGDLVDLRDNGVSADAQGNQLALALF----AGPGG  459

Query  630   kttittPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDEL  505
               +    WEAF                   G  DWE ALV+TAS+LS QK    G  D L
Sbjct  460   GGSANGSWEAFPSDGQPQVTSAWQTPAAEPGKADWELALVETASNLSRQKQNLGGGMDPL  519

Query  504   MLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADP  325
             +LDGMY QG + Q V S+  LT GSA+SVA    G+ A   L  P    D    A   DP
Sbjct  520   LLDGMYDQGIVRQHV-SAAQLTGGSASSVALPGPGKSATQVLALPAP--DGTVQAVNEDP  576

Query  324   FAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             FAASL+V PP+YVQM++LEKKQ LL +EQQ+W QY K+GM GQ  L+K   +     YYG
Sbjct  577   FAASLTVPPPSYVQMADLEKKQHLLMQEQQLWNQYAKEGMQGQGSLQKISGT----GYYG  632


 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATRRGT LLN+SDFRD + S+ WD+SAFVRTY+LYLD+++EL +  R+
Sbjct  110   YATRRGTXLLNLSDFRDEAHSSSWDHSAFVRTYALYLDQRLELMLFERK  158



>ref|XP_002324864.1| clathrin assembly family protein [Populus trichocarpa]
 gb|EEF03429.1| clathrin assembly family protein [Populus trichocarpa]
Length=671

 Score =   267 bits (683),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 169/403 (42%), Positives = 226/403 (56%), Gaps = 36/403 (9%)
 Frame = -1

Query  1335  TGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSI  1156
             T TP+ EMK E ++ ++ H  ++LDRFL+C+PTG AK NR++L+ALY VVKESFQ+Y  I
Sbjct  250   TATPLREMKPERIFGKMGHLQRLLDRFLSCRPTGLAKNNRMILIALYPVVKESFQLYADI  309

Query  1155  AEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENY  976
              E+L +L+D+F  ++ PD  K  + +   AKQ DEL  FY W K  G++R SEYP+V+  
Sbjct  310   CEVLAVLLDKFFDMEYPDCVKAFDAYASAAKQIDELIAFYNWCKDTGVARSSEYPEVQRI  369

Query  975   PKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPE  796
               + L+ +EE +R++ +          +     EE      E E   DMN IKALP    
Sbjct  370   TGKLLETLEEFVRDRAKRP--------KSPERKEEAPPVPQEEEPVPDMNEIKALPA--P  419

Query  795   DFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttit  616
             +        E     +K Q   DL+NL +DA T ++  N+LALALF G        +   
Sbjct  420   EDFTPPPPPETEPRPQKPQVTEDLVNLRDDAVTADDQGNRLALALFAGPAANSGNGS---  476

Query  615   tPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGM  490
               WEAF                   G  DWE ALV+TAS+LS QKA   G FD L+L+GM
Sbjct  477   --WEAFQSNGEPQVTSAWQTPAAEAGKADWELALVETASNLSKQKATLGGGFDPLLLNGM  534

Query  489   YRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASL  310
             Y QG + Q V ++  L+ GSA+SVA    G      L  P    D    A   DPFAASL
Sbjct  535   YDQGMVRQHVGTA-QLSGGSASSVALPGPGNGTTPVLALPAP--DGTVQAVNQDPFAASL  591

Query  309   SVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
              V PP+YVQM+++EKKQ+LL +EQ  WQQY +DGM GQ  L K
Sbjct  592   CVPPPSYVQMADMEKKQQLLVQEQVTWQQYARDGMQGQTSLAK  634


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 40/43 (93%), Gaps = 1/43 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVEL  1447
             +ATR+GTRLLNMSDFRD + S+ WD+SAFVRT+++YLD+++EL
Sbjct  110   YATRKGTRLLNMSDFRDEAHSSSWDHSAFVRTFAMYLDQRLEL  152



>emb|CDY11530.1| BnaA09g40960D [Brassica napus]
Length=580

 Score =   265 bits (677),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 193/485 (40%), Positives = 262/485 (54%), Gaps = 57/485 (12%)
 Frame = -1

Query  1563  RRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR-GKHSALASgneeg  1390
             RRGTR+LNMS FRD + S+ WD+SAFVRTY+ YLD+ +EL ++ R  G  + +   +E+ 
Sbjct  114   RRGTRMLNMSHFRDEAHSSSWDHSAFVRTYACYLDQMLELALRTRSYGDVTEMGRRDEKK  173

Query  1389  veeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLV  1210
                                 TP+ EM  E ++ ++ H  ++LDRFL  +PTG AK +R+V
Sbjct  174   ------------------AATPLPEMPPERIFGKMGHLQRLLDRFLNLRPTGLAKNSRMV  215

Query  1209  LVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTW  1030
             L+ALY +V+ESF++Y  I E+L +L+D+F  ++  D  K  + +   AKQ DEL  FY W
Sbjct  216   LIALYPIVRESFKLYADICEVLAVLLDKFFDMEYTDCVKAFDAYASAAKQIDELIAFYDW  275

Query  1029  SKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepe  850
              K  G+ R SEYP+V+    + L+ +EE +R++ +    R         E    E    E
Sbjct  276   CKETGVGRSSEYPEVQRITSKLLETLEEFVRDRAK----RGKSPERKEIEAPPPEPVAQE  331

Query  849   aeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLA  670
              E E DMN IKAL         E     +  E  K     DL+NL ED  T ++  N+ A
Sbjct  332   EELEPDMNEIKAL------PPPESYSPPSEPEPVKPLYTDDLVNLKEDEVTGDDQGNKFA  385

Query  669   LALFDGiptidptkttittPWEAFN---------------GSEDWETALVQTASHLSNQK  535
             LALF G P            WEAF                G  DWE ALV+TAS+L  Q 
Sbjct  386   LALFAGPPGSQ---------WEAFPSDGVTSAWQNPAAEPGKADWELALVETASNLEKQT  436

Query  534   AQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssAD  355
             A   G FD L+L+GMY QG + Q V++S  LT GSA+SVA    G+     L  P    D
Sbjct  437   AALGGGFDSLLLNGMYDQGVVRQHVSTSQ-LTGGSASSVALPLPGKTNTRVLALPAP--D  493

Query  354   ANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQ  175
                     DPFAASL++ PP+YVQM+E+EKKQ LL +EQQ+WQQY ++GM GQ  L K  
Sbjct  494   GTVEKVNQDPFAASLTIPPPSYVQMAEMEKKQYLLSQEQQLWQQYQREGMRGQASLAKMN  553

Query  174   QSSQP  160
                 P
Sbjct  554   MGPVP  558



>gb|KHN08137.1| Putative clathrin assembly protein [Glycine soja]
Length=444

 Score =   261 bits (666),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 171/405 (42%), Positives = 231/405 (57%), Gaps = 36/405 (9%)
 Frame = -1

Query  1341  VVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYY  1162
             VV+ TP+ +M  E ++ ++ H  ++LDRFLAC+PTG AK +R+VL+ALY VVKESFQ+Y 
Sbjct  22    VVSVTPLRDMTPERVFGKMGHLQKLLDRFLACRPTGLAKNSRMVLIALYPVVKESFQLYA  81

Query  1161  SIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVE  982
              I E+L +L+D+F  +D  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+
Sbjct  82    DICEVLAVLLDKFFDMDYADCVKAFDAYSSAAKQIDELVAFYNWCKDTGVARSSEYPEVQ  141

Query  981   NYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPP  802
                 + L+ +EE +R+       R  R + P  + E     + E E   DMN IKALP  
Sbjct  142   RITNKLLETLEEFVRD-------RAKRPKSPERKEEVPPVEKVEEEPAPDMNEIKALP--  192

Query  801   PEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptktt  622
                          P  + + Q   DL+NL +DA T ++  N+LALALF G P  +   + 
Sbjct  193   -PPENYIPPPPPEPEPKPQPQVTEDLVNLRDDAVTADDQGNKLALALFAGAPANNVNGS-  250

Query  621   ittPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLD  496
                 WEAF                   G  DWE ALV+TAS+LS QKA   G FD L+L 
Sbjct  251   ----WEAFPSNGQPEVTSAWQTPAAEPGKADWELALVETASNLSKQKATLGGGFDPLLLT  306

Query  495   GMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAA  316
             GMY QG + Q V+++  L+ GSA+SVA    G+     L  P    D +      DPFAA
Sbjct  307   GMYDQGMVRQHVSTTQ-LSGGSASSVALPGPGKTTTPVLALPAP--DGSVQPVNQDPFAA  363

Query  315   SLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             SLSV PP+YVQM+++EKKQ LL +EQQ+W QY +DGM GQ  L K
Sbjct  364   SLSVPPPSYVQMADMEKKQHLLVQEQQVWHQYARDGMQGQSSLAK  408



>ref|XP_011036564.1| PREDICTED: putative clathrin assembly protein At2g25430 [Populus 
euphratica]
Length=671

 Score =   266 bits (681),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 169/403 (42%), Positives = 227/403 (56%), Gaps = 36/403 (9%)
 Frame = -1

Query  1335  TGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSI  1156
             T TP+ EMK E ++ ++ H  ++LDRFL+C+PTG AK NR++L+ALY VVKESFQ+Y  I
Sbjct  250   TATPLREMKPERIFGKMGHLQRLLDRFLSCRPTGLAKNNRMILIALYPVVKESFQLYADI  309

Query  1155  AEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENY  976
              E+L +L+D+F  ++ PD  K  + +   AKQ DEL  FY W K  G++R SEYP+V+  
Sbjct  310   CEVLAVLLDKFFDMEYPDCVKAFDAYASAAKQIDELIAFYNWCKDTGVARSSEYPEVQRI  369

Query  975   PKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPE  796
               + L+ +EE +R++ +          +     EE      E E   DMN IKALP    
Sbjct  370   TGKLLETLEEFVRDRAKRP--------KSPERKEEAPPVPQEEEPVPDMNEIKALPA--P  419

Query  795   DFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttit  616
             +        E     +K Q   DL+NL +DA T ++  N+LALALF G    +   +   
Sbjct  420   EDFTPPPPPETEPGPQKPQVTEDLVNLRDDAVTADDQGNRLALALFAGPAANNGNGS---  476

Query  615   tPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGM  490
               WEAF                   G  DWE ALV+TAS+LS QKA   G FD L+L+GM
Sbjct  477   --WEAFPSNGEPQVTSAWQTPAAEAGKADWELALVETASNLSKQKATLGGGFDPLLLNGM  534

Query  489   YRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASL  310
             Y QG + Q V ++  L+ GSA+SVA    G      L  P    D    A   DPFAASL
Sbjct  535   YDQGMVRQHVGTA-QLSGGSASSVALPGPGNGTTPVLALPAP--DGTVQAVNQDPFAASL  591

Query  309   SVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
              V PP+YVQM+++EKKQ+LL +EQ  WQQY +DGM GQ  L K
Sbjct  592   CVPPPSYVQMADMEKKQQLLVQEQVTWQQYARDGMQGQASLAK  634


 Score = 65.9 bits (159),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 39/43 (91%), Gaps = 1/43 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVEL  1447
             +ATR+GTRLLNMSDFRD + S+ WD+SAFVRT ++YLD+++EL
Sbjct  110   YATRKGTRLLNMSDFRDEAHSSSWDHSAFVRTLAMYLDQRLEL  152



>gb|KHN07072.1| Putative clathrin assembly protein [Glycine soja]
Length=517

 Score =   261 bits (668),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 198/501 (40%), Positives = 273/501 (54%), Gaps = 68/501 (14%)
 Frame = -1

Query  1539  MSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNR-----------------------  1432
             MSDFRD + S+ WD+SAFVRTY+LYLD+++EL + +R                       
Sbjct  1     MSDFRDEAHSSSWDHSAFVRTYALYLDQRLELMLFDRKGTVSAANGGGDDRGWRQSPPYE  60

Query  1431  ------RGKHSALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQ  1270
                   RG+ +      +     +  E         VV+ TP+ +M  E ++ ++ H  +
Sbjct  61    YGGGEFRGEGAYGNGMRKTRSYGDMSESVGRGEEKRVVSVTPLRDMTPERVFGKMGHLQR  120

Query  1269  ILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKV  1090
             +LDRFLAC+PTG AK +R+VL+ALY VVKESFQ+Y  I E+L +L+D+F  ++  D  K 
Sbjct  121   LLDRFLACRPTGLAKNSRMVLIALYPVVKESFQLYADICEVLAVLLDKFFDMEYADCVKA  180

Query  1089  HEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGR  910
              + +   AKQ DEL  FY W K  G++R SEYP+V+    + L+ +EE +R+       R
Sbjct  181   FDAYASAAKQIDELVAFYNWCKDTGVARSSEYPEVQKITSKLLETLEEFVRD-------R  233

Query  909   IMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIG  730
               R + P  + E     + E E   DMN IKALP               P  + + Q   
Sbjct  234   AKRPKSPERKEEAPPVEKVEEEPAPDMNEIKALP---PPENYTPPPPPEPEPKPQPQVTE  290

Query  729   DLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN---------------  595
             DL+NL +DA T ++  N+ ALALF G P  +   +     WEAF                
Sbjct  291   DLVNLRDDAVTADDQGNKFALALFAGAPANNANGS-----WEAFPSNGQPEVTSAWQTPA  345

Query  594   ---GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSAT  424
                G  DWE ALV+TAS+LS QKA   G  D L+L GMY QG + Q V+++  L+ GSA+
Sbjct  346   AEPGKADWELALVETASNLSKQKAALGGGLDPLLLTGMYDQGMVRQHVSTT-QLSGGSAS  404

Query  423   SVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWE  244
             SVA    G+  +LALPAP    D +      DPFAASLSV PP+YVQM+++EKKQ LL +
Sbjct  405   SVALPGPGKTPVLALPAP----DGSVQPVNQDPFAASLSVPPPSYVQMADMEKKQHLLVQ  460

Query  243   EQQMWQQYTKDGMHGQVGLEK  181
             EQQ+W QY +DGM GQ  L K
Sbjct  461   EQQVWHQYARDGMQGQSSLAK  481



>ref|XP_002285168.1| PREDICTED: putative clathrin assembly protein At2g25430 [Vitis 
vinifera]
Length=652

 Score =   265 bits (677),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 169/401 (42%), Positives = 231/401 (58%), Gaps = 34/401 (8%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EMK E ++ ++ H  ++LDRFLAC+PTG AK NR+VL+ALY VV+ESFQ+Y  I E
Sbjct  232   TPLREMKPERIFGKMGHLQRLLDRFLACRPTGLAKNNRMVLIALYPVVRESFQLYADICE  291

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+DRF +++ PD  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  292   VLAVLLDRFFEMEYPDCVKAFDAYASTAKQIDELVAFYNWCKDTGVARSSEYPEVQRITD  351

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +          +     EE +    E E   DMN IKALPPP    
Sbjct  352   KLLETLEEFVRDRAKGP--------KSPERNEEPQPVAREEEPVPDMNEIKALPPPENYT  403

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E   + ++ Q   DL+NL ++  T ++  N+ ALALF G    +   +     
Sbjct  404   PPPPPPPEPEPKPQQPQVTEDLVNLRDEGVTADDQGNRFALALFAGPGANNTNGS-----  458

Query  609   WEAF------------------NGSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYR  484
             WEAF                   G  DWE ALV+TAS+LS QKA   G FD L+L+GMY 
Sbjct  459   WEAFPSNGQPEVTSAWQTPAAETGKADWELALVETASNLSRQKATLAGGFDPLLLNGMYD  518

Query  483   QGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSV  304
             QG + Q V S+  +T GSA+SVA    G+     L  P    D      G DPFAASLS+
Sbjct  519   QGMVRQHV-STAQMTGGSASSVALPGLGKSTTPVLALPAP--DGTVQTVGQDPFAASLSI  575

Query  303   APPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
              PP+YVQM+++EKKQ+ L +EQQ+WQQY +DGM GQ  L K
Sbjct  576   PPPSYVQMADMEKKQQFLTQEQQLWQQYGRDGMQGQASLAK  616


 Score = 69.3 bits (168),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATRRGTRLLNMSDFRD + SN WD+SAFVRT+++YLD+++E  +  ++
Sbjct  110   YATRRGTRLLNMSDFRDEAHSNSWDHSAFVRTFAMYLDQRLEFILYEKK  158



>emb|CDP10437.1| unnamed protein product [Coffea canephora]
Length=625

 Score =   264 bits (675),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 199/514 (39%), Positives = 281/514 (55%), Gaps = 61/514 (12%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNR------------  1432
             +A+RRG R+LNMSDFRD + SN WD+S FVRTY+ YLD++++  +  R            
Sbjct  110   YASRRGMRVLNMSDFRDEAHSNSWDHSGFVRTYASYLDQKLDFMVYERKLNGGEEKKRYD  169

Query  1431  ------RGKHSALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQ  1270
                   R + S          ++ +E+        +V   TP+ +MK E +  R+   ++
Sbjct  170   DGYGEFRDEPSYGMERRTRSYDDLNEDASGRGEKKVV---TPLRQMKPERILERLNQLLR  226

Query  1269  ILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKV  1090
             +LDRFLACKPTGAAK +R+VLVALY VVKESF++Y    E+LG+++DRF +++  D  K 
Sbjct  227   LLDRFLACKPTGAAKSSRMVLVALYLVVKESFRLYADTCEVLGVVLDRFTEMEYADCVKA  286

Query  1089  HEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGR  910
              + +   AK  DEL   Y WSK  G++R SE+P+V+    + L  +E  +RE+       
Sbjct  287   FDAYVNAAKMIDELVAVYNWSKDIGVARSSEFPEVQRISDKLLGTLEGFLRERANRP---  343

Query  909   IMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIG  730
                  + S +  E      + E    MN IKALPPP               + + +Q  G
Sbjct  344   -----KVSEKSTEESSSAVKEEEVPGMNEIKALPPPENFTPPPPQSQPQ-PKLQTQQVTG  397

Query  729   DLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAF----------------  598
             DL+NL +D  + +E  N+LALALF G P  +   +     WEAF                
Sbjct  398   DLVNLKDDGVSADEQGNKLALALFSGAPAANTNGS-----WEAFPSDGEPEITSAWHTPA  452

Query  597   --NGSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSAT  424
               +G E+WE AL ++AS+LS QKA   G FD L+L+GMY QGA+ Q V  +  L+ GSA+
Sbjct  453   AESGRENWELALAESASNLSKQKADLAGGFDSLLLNGMYDQGAVRQHVNGT-QLSGGSAS  511

Query  423   SVAFGSAGRpamlalpappssADANTTASGA-DPFAASLSVAPPAYVQMSELEKKQRLLW  247
             SVA    G            + D   T  G  DPFAASL V PPAYVQ++++EKKQ+LL 
Sbjct  512   SVAL--PGISQNSTPVLALPAPDGTVTPVGQQDPFAASLYVPPPAYVQIADMEKKQQLLM  569

Query  246   EEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             +EQQ+WQQY  +GM GQ+GL K   ++    YYG
Sbjct  570   QEQQLWQQYASNGMQGQMGLTKIAGTA---GYYG  600



>ref|XP_002308069.2| hypothetical protein POPTR_0006s06580g, partial [Populus trichocarpa]
 gb|EEE91592.2| hypothetical protein POPTR_0006s06580g, partial [Populus trichocarpa]
Length=622

 Score =   263 bits (672),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 195/514 (38%), Positives = 268/514 (52%), Gaps = 58/514 (11%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQ--------------  1438
             +ATRRG R+L+MS FRD +  N WD++ FVR Y++YLDE+VE  +               
Sbjct  107   YATRRGMRVLSMSGFRDEAHPNSWDHTGFVRFYAMYLDEKVEYAVFERKVREDERKFDEG  166

Query  1437  ----NRRGKHSALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQ  1270
                  RR K +    G         +              TPI EMK E L   +   ++
Sbjct  167   DDEFGRRDKRNDYEHGMPRRSRSYGDLNGDMVKREQKKEVTPIREMKPERLLGILGQQLR  226

Query  1269  ILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKV  1090
             ILDR LAC+PTG AK +RLVLVALYQ+ KESF +Y  I E LG+L+DRF +++     K 
Sbjct  227   ILDRVLACRPTGMAKNDRLVLVALYQMAKESFGLYTEICEALGVLLDRFTEMEYAYCLKG  286

Query  1089  HEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGR  910
              +I+   AK  +EL +FY W K  GI R SEYP+V+   +  L  +   ++         
Sbjct  287   FDIYAGAAKIIEELVMFYGWCKDMGIGRSSEYPEVKKITENLLGTLGVFLQ--------E  338

Query  909   IMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIG  730
             +   R  +PE    E    + E E +MN +KALPPP          ++   + ++  +  
Sbjct  339   MTNRRTKNPERSMGENVPAKREQEPEMNEVKALPPPESYTPPPPPELQPKPQPQQVTE--  396

Query  729   DLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN---------------  595
             D +NL +D  + +E  N+L LALF G PT +         W AF+               
Sbjct  397   DFINLKDDGISADEQGNKLDLALFSGPPTTNTNGA-----WVAFSSDIGEPEVTSAWQTP  451

Query  594   ----GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSA  427
                 G  DWE ALV++AS+LS QKA   G FD L+L+GMY QG + Q V S+  LT GSA
Sbjct  452   SAQSGQADWEMALVESASNLSKQKATLGGGFDPLLLNGMYDQGLVRQHV-STWQLTGGSA  510

Query  426   TSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLW  247
             +SVA  S G+ A   L  P          +  DPFAASL+V PP+YVQ++++E K  LL 
Sbjct  511   SSVALPSVGKSATPVLALPAPDETIQPVGN-QDPFAASLAVPPPSYVQIADMEMKHHLLA  569

Query  246   EEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
              EQ++WQ Y +DGMHGQV L K   +S    +YG
Sbjct  570   SEQKLWQHYGRDGMHGQVSLAKINGAS---GFYG  600



>ref|XP_009794065.1| PREDICTED: putative clathrin assembly protein At2g25430 isoform 
X4 [Nicotiana sylvestris]
Length=631

 Score =   262 bits (670),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 197/513 (38%), Positives = 275/513 (54%), Gaps = 67/513 (13%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVEL----RMQN---------  1435
             +ATRRGTRLLN+SDF+D + SN WD+SAFVRTY+LYLD+++EL    R QN         
Sbjct  110   YATRRGTRLLNLSDFKDEAHSNSWDHSAFVRTYALYLDQRLELMVFERKQNGSTGGEIER  169

Query  1434  --------------RRGKHSALASgneegveeedeeeetgntTAIVVTGTPIT---EMKN  1306
                            RG         +E          +G+    +     +T   EMK 
Sbjct  170   YGSREEHFRSPPSSNRGHEYDFGEFRDEPGYGMRRSRSSGDVRESIQENKEVTPLREMKP  229

Query  1305  EYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDR  1126
             E +  ++ H  ++LDRFL+C+PTG AK  R+VLVALY VVKESF+++  I ++L +L+D+
Sbjct  230   ERILGKMTHLQRLLDRFLSCRPTGLAKNERMVLVALYPVVKESFKIHTDICDVLALLLDK  289

Query  1125  FMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimee  946
             F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V     + LD ++E
Sbjct  290   FFDMEFEDCVKAFDAYASAAKQIDELVGFYDWCKDIGVTRSSEYPEVARITSKLLDTLQE  349

Query  945   iirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVE  766
              +R++ +          +      E +    E E   DMN IKAL  PP +        E
Sbjct  350   FVRDRAKAT--------KSPERKVESQSTPQEQEPAPDMNEIKAL--PPPEDYTPPPPPE  399

Query  765   APTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAF----  598
                 +   Q+ GDL++L E+  T ++  N+LALALF G        +     WEAF    
Sbjct  400   PELPKPVVQETGDLVDLREEGVTADDQGNKLALALFAG-----SGTSNANGSWEAFPSNG  454

Query  597   --------------NGSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAV  460
                           +G  DWE ALV+TAS+LS QKA   G  D L+L+GMY QG + Q V
Sbjct  455   ETEVTSAWQNPAAESGKADWELALVETASNLSKQKAALGGGLDPLLLNGMYDQGVVRQHV  514

Query  459   ASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQM  280
             A++   + GSA+SVA    G+           + D      G DPFAASLSV PP+YVQM
Sbjct  515   ATA-QSSGGSASSVALPGLGK--SATPVLALPAPDGTVQTVGQDPFAASLSVPPPSYVQM  571

Query  279   SELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             ++L+KK++LL +EQ +WQQY +DGM GQ+ L K
Sbjct  572   ADLQKKEQLLAQEQMVWQQYARDGMQGQMSLAK  604



>ref|XP_009794064.1| PREDICTED: putative clathrin assembly protein At2g25430 isoform 
X3 [Nicotiana sylvestris]
Length=635

 Score =   263 bits (671),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 197/513 (38%), Positives = 275/513 (54%), Gaps = 67/513 (13%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVEL----RMQN---------  1435
             +ATRRGTRLLN+SDF+D + SN WD+SAFVRTY+LYLD+++EL    R QN         
Sbjct  110   YATRRGTRLLNLSDFKDEAHSNSWDHSAFVRTYALYLDQRLELMVFERKQNGSTGGEIER  169

Query  1434  --------------RRGKHSALASgneegveeedeeeetgntTAIVVTGTPIT---EMKN  1306
                            RG         +E          +G+    +     +T   EMK 
Sbjct  170   YGSREEHFRSPPSSNRGHEYDFGEFRDEPGYGMRRSRSSGDVRESIQENKEVTPLREMKP  229

Query  1305  EYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDR  1126
             E +  ++ H  ++LDRFL+C+PTG AK  R+VLVALY VVKESF+++  I ++L +L+D+
Sbjct  230   ERILGKMTHLQRLLDRFLSCRPTGLAKNERMVLVALYPVVKESFKIHTDICDVLALLLDK  289

Query  1125  FMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimee  946
             F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V     + LD ++E
Sbjct  290   FFDMEFEDCVKAFDAYASAAKQIDELVGFYDWCKDIGVTRSSEYPEVARITSKLLDTLQE  349

Query  945   iirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVE  766
              +R++ +          +      E +    E E   DMN IKAL  PP +        E
Sbjct  350   FVRDRAKAT--------KSPERKVESQSTPQEQEPAPDMNEIKAL--PPPEDYTPPPPPE  399

Query  765   APTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAF----  598
                 +   Q+ GDL++L E+  T ++  N+LALALF G        +     WEAF    
Sbjct  400   PELPKPVVQETGDLVDLREEGVTADDQGNKLALALFAG-----SGTSNANGSWEAFPSNG  454

Query  597   --------------NGSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAV  460
                           +G  DWE ALV+TAS+LS QKA   G  D L+L+GMY QG + Q V
Sbjct  455   ETEVTSAWQNPAAESGKADWELALVETASNLSKQKAALGGGLDPLLLNGMYDQGVVRQHV  514

Query  459   ASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQM  280
             A++   + GSA+SVA    G+           + D      G DPFAASLSV PP+YVQM
Sbjct  515   ATA-QSSGGSASSVALPGLGK--SATPVLALPAPDGTVQTVGQDPFAASLSVPPPSYVQM  571

Query  279   SELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             ++L+KK++LL +EQ +WQQY +DGM GQ+ L K
Sbjct  572   ADLQKKEQLLAQEQMVWQQYARDGMQGQMSLAK  604



>ref|XP_009794063.1| PREDICTED: probable clathrin assembly protein At4g32285 isoform 
X2 [Nicotiana sylvestris]
Length=660

 Score =   263 bits (671),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 197/513 (38%), Positives = 275/513 (54%), Gaps = 67/513 (13%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVEL----RMQN---------  1435
             +ATRRGTRLLN+SDF+D + SN WD+SAFVRTY+LYLD+++EL    R QN         
Sbjct  110   YATRRGTRLLNLSDFKDEAHSNSWDHSAFVRTYALYLDQRLELMVFERKQNGSTGGEIER  169

Query  1434  --------------RRGKHSALASgneegveeedeeeetgntTAIVVTGTPIT---EMKN  1306
                            RG         +E          +G+    +     +T   EMK 
Sbjct  170   YGSREEHFRSPPSSNRGHEYDFGEFRDEPGYGMRRSRSSGDVRESIQENKEVTPLREMKP  229

Query  1305  EYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDR  1126
             E +  ++ H  ++LDRFL+C+PTG AK  R+VLVALY VVKESF+++  I ++L +L+D+
Sbjct  230   ERILGKMTHLQRLLDRFLSCRPTGLAKNERMVLVALYPVVKESFKIHTDICDVLALLLDK  289

Query  1125  FMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimee  946
             F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V     + LD ++E
Sbjct  290   FFDMEFEDCVKAFDAYASAAKQIDELVGFYDWCKDIGVTRSSEYPEVARITSKLLDTLQE  349

Query  945   iirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVE  766
              +R++ +          +      E +    E E   DMN IKAL  PP +        E
Sbjct  350   FVRDRAKAT--------KSPERKVESQSTPQEQEPAPDMNEIKAL--PPPEDYTPPPPPE  399

Query  765   APTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAF----  598
                 +   Q+ GDL++L E+  T ++  N+LALALF G        +     WEAF    
Sbjct  400   PELPKPVVQETGDLVDLREEGVTADDQGNKLALALFAG-----SGTSNANGSWEAFPSNG  454

Query  597   --------------NGSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAV  460
                           +G  DWE ALV+TAS+LS QKA   G  D L+L+GMY QG + Q V
Sbjct  455   ETEVTSAWQNPAAESGKADWELALVETASNLSKQKAALGGGLDPLLLNGMYDQGVVRQHV  514

Query  459   ASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQM  280
             A++   + GSA+SVA    G+           + D      G DPFAASLSV PP+YVQM
Sbjct  515   ATA-QSSGGSASSVALPGLGK--SATPVLALPAPDGTVQTVGQDPFAASLSVPPPSYVQM  571

Query  279   SELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             ++L+KK++LL +EQ +WQQY +DGM GQ+ L K
Sbjct  572   ADLQKKEQLLAQEQMVWQQYARDGMQGQMSLAK  604



>ref|XP_004962023.1| PREDICTED: putative clathrin assembly protein At4g02650-like 
[Setaria italica]
Length=612

 Score =   261 bits (668),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 193/515 (37%), Positives = 274/515 (53%), Gaps = 60/515 (12%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR-----------  1429
             +ATRRGTR+LNM DF D SR++ WD+SA VRTY+ YLD+++E RMQ R            
Sbjct  113   YATRRGTRMLNMFDFCDRSRADAWDFSALVRTYAAYLDDRLEHRMQGRHGGGAAPPRGGR  172

Query  1428  ------------GKHSALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRI  1285
                          +++   + N    ++   + E     A+V    P +EM  + L  + 
Sbjct  173   PLREEMYYASPGNRYTCDLTFNGRQQDDAVADAEADRALALVARDPPTSEMTVDQLLIKA  232

Query  1284  QHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIP  1105
                  +LDRF+AC+P GAAK NR+V V+LY +VKES Q+Y  + E +  L+++F +++  
Sbjct  233   NQLHHLLDRFIACRPVGAAKANRVVAVSLYPLVKESVQLYCELTEAMAALIEQFAEMETA  292

Query  1104  DSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekme  925
             D ++VH +F  +AKQ +EL  FY+W K A + R S+ P+VE   ++KL++M+E       
Sbjct  293   DCERVHALFCGLAKQMEELGAFYSWCKDACVCRQSDVPEVEVVTQKKLELMDEF------  346

Query  924   MAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPP--PEDFIEEMAVVEA-PTE  754
                  I      + + +           EEDMN  KALP P  P   + E   V+A P +
Sbjct  347   -----IRDRHAAASQQDFPPPSPSLVLVEEDMNATKALPAPEEPAAAVPEEDTVQAEPEK  401

Query  753   EKKEQDIGD----LLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFNGSE  586
                  D+ D     LNL  DA   +EH  QLALALFDG P     +       +AF+ S 
Sbjct  402   PLVVADLADEEADFLNLKADAMPADEHGQQLALALFDGNPAGSAPRA------DAFDHSA  455

Query  585   -DWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFG  409
              DWETALVQ+AS L++Q+A+  G  + ++LDGMY     N AVA +   + GSA+SVA  
Sbjct  456   ADWETALVQSASALASQRAELGGGLNMMVLDGMYSHAKANAAVADAQAFS-GSASSVALR  514

Query  408   SAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMW  229
               G P +     P +S  A         FAAS  V PP YVQMS+++ KQ+ L +EQ +W
Sbjct  515   PPGAPMLALPAPPGASGAAAGADP----FAASALVPPPTYVQMSDMQTKQQFLTQEQVVW  570

Query  228   QQYTKDGMHGQVGLEKAQQSSQ------PHNYYGY  142
             QQY K+GM GQ  L   +Q  Q      PH  Y Y
Sbjct  571   QQYGKNGMQGQGALAMLEQRPQQQLQILPHGGYNY  605



>ref|XP_007155030.1| hypothetical protein PHAVU_003G167300g [Phaseolus vulgaris]
 gb|ESW27024.1| hypothetical protein PHAVU_003G167300g [Phaseolus vulgaris]
Length=590

 Score =   260 bits (664),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 195/502 (39%), Positives = 275/502 (55%), Gaps = 68/502 (14%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
             A RRGTR+LNMSDFRD + S+ WD++ FVR Y+LYLDE+VE     R+ +  A +    E
Sbjct  111   AKRRGTRILNMSDFRDEAHSSSWDHAGFVRLYALYLDEKVEFVAYRRKLRGVAESEEFRE  170

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRL  1213
               EEE  +             TP+ EM+ E +  R++H + +LDR L C+P+GAAK NRL
Sbjct  171   EREEESNKRSEV---------TPVREMRAERVLERLKHLLLMLDRVLGCRPSGAAKNNRL  221

Query  1212  VLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYT  1033
             VLVALYQVV++SF++Y  + ++LG+L+DRF +++     K  + +   AK  DEL  FY 
Sbjct  222   VLVALYQVVRDSFKLYVEVCDVLGVLLDRFTEMEYVHCVKAFDSYVGAAKMMDELVGFYG  281

Query  1032  WSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepep  853
             W K  GI+R SEYP+V+    + L  +E  ++E                    +V   E 
Sbjct  282   WCKDMGIARSSEYPEVQRITDKLLGTLEGFLKEMSNRP------KSPERKLEMKVTVKES  335

Query  852   eaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKK-------EQDIGDLLNLGEDAPTP  694
             EAEAE DMN +KALP P     E     EAP    +       +++  DL++L +D  + 
Sbjct  336   EAEAEADMNEVKALPAPES---ESFTPPEAPPSVARPNNVLASQKETSDLVDLRDDGVSA  392

Query  693   EEHANQLALALFDGiptidptkttittPWEAFNGSE------------------DWETAL  568
             +E  N+LALALF G  T+    +     WEAF  +E                  DWE AL
Sbjct  393   DEQGNKLALALFSGPATVRAEGS-----WEAFPSNEEYEGKSAWETAAAEVGKADWELAL  447

Query  567   VQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpam  388
             V+ +S+LS QKA+  G             GA+ Q V+++  ++ GSA+SVA    G+   
Sbjct  448   VENSSNLSKQKAELGG-------------GAVRQHVSTTQ-MSGGSASSVALPGLGKRGT  493

Query  387   lalpappssADANTTASGA-DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKD  211
               L  P    +    A G  DPFAASLSV PP+YVQ++++E+KQ+LL +EQQ+W+QY  D
Sbjct  494   PILALPAP--EGTVEAVGPQDPFAASLSVPPPSYVQIADMERKQQLLVQEQQVWKQYGMD  551

Query  210   GMHGQVGLEKAQQSSQPHNYYG  145
             GM GQVGL +      P   YG
Sbjct  552   GMQGQVGLSRV--GGAPMMPYG  571



>ref|XP_009621781.1| PREDICTED: putative clathrin assembly protein At2g25430 [Nicotiana 
tomentosiformis]
 ref|XP_009621782.1| PREDICTED: putative clathrin assembly protein At2g25430 [Nicotiana 
tomentosiformis]
Length=638

 Score =   261 bits (667),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 205/528 (39%), Positives = 268/528 (51%), Gaps = 80/528 (15%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             +ATRRGTRLLN+SDFRD + SN WD+SAFVRTY+LYLD+++EL +  R+   S       
Sbjct  110   YATRRGTRLLNLSDFRDEAHSNSWDHSAFVRTYALYLDQRLELMVFERKQNGSTGGEIER  169

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYS-------------------------  1291
              G  EE       +       G    E ++E  Y                          
Sbjct  170   YGSREERWRSPPSSNRG---NGYDYGEFRDEPAYGMRKSRSSGDVRESTQERKDVTPLRE  226

Query  1290  ----RIQHYIQILDRFL----ACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGIL  1135
                 RI   +  L R L    +C+PTG AK  R+VLVALY +VKE+FQ+Y  I E+L +L
Sbjct  227   MNPERIFGKMTHLQRLLDRFLSCRPTGLAKNERMVLVALYPMVKENFQLYADICEVLAVL  286

Query  1134  VDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDi  955
             +D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    + LD 
Sbjct  287   LDKFFDMEYQDCVKAFDAYASAAKQIDELVGFYNWCKDIGVARSSEYPEVQRITSKLLDT  346

Query  954   meeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMA  775
             +EE +         R       SPE +    P P  E   DMN IKAL  P  +      
Sbjct  347   LEEFV---------RDRAKATKSPERKVESLPAPPEEPAPDMNEIKAL--PAPEEYTPPP  395

Query  774   VVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN  595
               E    +   Q+ GDL++L E+  T ++  N+ ALALF G         T    WEAF 
Sbjct  396   PPEPEPPKPVVQETGDLVDLREEGVTADDQGNKFALALFAG-------PGTNNGSWEAFP  448

Query  594   GS------------------EDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALN  469
             G+                   DWE ALV+TASHLSNQKA   G  D L+L+GMY QG + 
Sbjct  449   GNGEAQMTSAWQNPAAEIGKADWELALVETASHLSNQKAALGGGLDPLLLNGMYDQGMVR  508

Query  468   QAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAY  289
             Q V S+  L+ GSA+SVA    G+           + D      G DPFAASL+V PP+Y
Sbjct  509   QHV-STAQLSGGSASSVALPGTGK--SATPVLALPAPDGTIQTVGQDPFAASLTVPPPSY  565

Query  288   VQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             VQM++LEKKQ+LL +EQ +WQQY +DGM GQ  L K         YYG
Sbjct  566   VQMADLEKKQQLLVQEQVVWQQYARDGMQGQTSLSKINTG----GYYG  609



>ref|XP_006578140.1| PREDICTED: putative clathrin assembly protein At2g25430-like 
isoform X1 [Glycine max]
 ref|XP_006578141.1| PREDICTED: putative clathrin assembly protein At2g25430-like 
isoform X2 [Glycine max]
Length=652

 Score =   261 bits (667),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 171/405 (42%), Positives = 231/405 (57%), Gaps = 36/405 (9%)
 Frame = -1

Query  1341  VVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYY  1162
             VV+ TP+ +M  E ++ ++ H  ++LDRFLAC+PTG AK +R+VL+ALY VVKESFQ+Y 
Sbjct  230   VVSVTPLRDMTPERVFGKMGHLQKLLDRFLACRPTGLAKNSRMVLIALYPVVKESFQLYA  289

Query  1161  SIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVE  982
              I E+L +L+D+F  +D  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+
Sbjct  290   DICEVLAVLLDKFFDMDYADCVKAFDAYSSAAKQIDELVAFYNWCKDTGVARSSEYPEVQ  349

Query  981   NYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPP  802
                 + L+ +EE +R+       R  R + P  + E     + E E   DMN IKALP  
Sbjct  350   RITNKLLETLEEFVRD-------RAKRPKSPERKEEVPPVEKVEEEPAPDMNEIKALP--  400

Query  801   PEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptktt  622
                          P  + + Q   DL+NL +DA T ++  N+LALALF G P  +   + 
Sbjct  401   -PPENYIPPPPPEPEPKPQPQVTEDLVNLRDDAVTADDQGNKLALALFAGAPANNVNGS-  458

Query  621   ittPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLD  496
                 WEAF                   G  DWE ALV+TAS+LS QKA   G FD L+L 
Sbjct  459   ----WEAFPSNGQPEVTSAWQTPAAEPGKADWELALVETASNLSKQKATLGGGFDPLLLT  514

Query  495   GMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAA  316
             GMY QG + Q V+++  L+ GSA+SVA    G+     L  P    D +      DPFAA
Sbjct  515   GMYDQGMVRQHVSTTQ-LSGGSASSVALPGPGKTTTPVLALPAP--DGSVQPVNQDPFAA  571

Query  315   SLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             SLSV PP+YVQM+++EKKQ LL +EQQ+W QY +DGM GQ  L K
Sbjct  572   SLSVPPPSYVQMADMEKKQHLLVQEQQVWHQYARDGMQGQSSLAK  616


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 44/49 (90%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             FATRRGTRLLNMSDFRD + S+ WD+SAFVRTY++YLD++++L + +R+
Sbjct  110   FATRRGTRLLNMSDFRDEAHSSSWDHSAFVRTYAMYLDQRLDLMLFDRK  158



>ref|XP_009794059.1| PREDICTED: probable clathrin assembly protein At4g32285 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009794060.1| PREDICTED: probable clathrin assembly protein At4g32285 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009794061.1| PREDICTED: probable clathrin assembly protein At4g32285 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009794062.1| PREDICTED: probable clathrin assembly protein At4g32285 isoform 
X1 [Nicotiana sylvestris]
Length=665

 Score =   259 bits (661),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 195/513 (38%), Positives = 274/513 (53%), Gaps = 67/513 (13%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVEL----RMQN---------  1435
             +ATRRGTRLLN+SDF+D + SN WD+SAFVRTY+LYLD+++EL    R QN         
Sbjct  110   YATRRGTRLLNLSDFKDEAHSNSWDHSAFVRTYALYLDQRLELMVFERKQNGSTGGEIER  169

Query  1434  --------------RRGKHSALASgneegveeedeeeetgntTAIVVTGTPITEM---KN  1306
                            RG         +E          +G+    +     +T +   K 
Sbjct  170   YGSREEHFRSPPSSNRGHEYDFGEFRDEPGYGMRRSRSSGDVRESIQENKEVTPLREMKP  229

Query  1305  EYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDR  1126
             E +  ++ H  ++LDRFL+C+PTG AK  R+VLVALY VVKESF+++  I ++L +L+D+
Sbjct  230   ERILGKMTHLQRLLDRFLSCRPTGLAKNERMVLVALYPVVKESFKIHTDICDVLALLLDK  289

Query  1125  FMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimee  946
             F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V     + LD ++E
Sbjct  290   FFDMEFEDCVKAFDAYASAAKQIDELVGFYDWCKDIGVTRSSEYPEVARITSKLLDTLQE  349

Query  945   iirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVE  766
              +R++ +          +      E +    E E   DMN IKAL  PP +        E
Sbjct  350   FVRDRAKAT--------KSPERKVESQSTPQEQEPAPDMNEIKAL--PPPEDYTPPPPPE  399

Query  765   APTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAF----  598
                 +   Q+ GDL++L E+  T ++  N+LALALF G        +     WEAF    
Sbjct  400   PELPKPVVQETGDLVDLREEGVTADDQGNKLALALFAG-----SGTSNANGSWEAFPSNG  454

Query  597   --------------NGSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAV  460
                           +G  DWE ALV+TAS+LS QKA   G  D L+L+GMY QG + Q V
Sbjct  455   ETEVTSAWQNPAAESGKADWELALVETASNLSKQKAALGGGLDPLLLNGMYDQGVVRQHV  514

Query  459   ASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQM  280
             A++   + GSA+SVA    G+           + D      G DPFAASLSV PP+YVQM
Sbjct  515   ATA-QSSGGSASSVALPGLGK--SATPVLALPAPDGTVQTVGQDPFAASLSVPPPSYVQM  571

Query  279   SELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             ++L+KK++LL +EQ +WQQY +DGM GQ+ L K
Sbjct  572   ADLQKKEQLLAQEQMVWQQYARDGMQGQMSLAK  604



>ref|XP_009117225.1| PREDICTED: putative clathrin assembly protein At2g25430 [Brassica 
rapa]
Length=613

 Score =   257 bits (657),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 194/498 (39%), Positives = 264/498 (53%), Gaps = 50/498 (10%)
 Frame = -1

Query  1563  RRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgneegv  1387
             +RGTR+LNMS FRD + S+ WD+SAFVRTY+ YLD+ +EL +  R+   S+    +    
Sbjct  114   KRGTRMLNMSHFRDEAHSSSWDHSAFVRTYACYLDQLLELALFERKSGSSSRGRDDFRSP  173

Query  1386  eeedeeeetgntTAIVVTG--------------TPITEMKNEYLYSRIQHYIQILDRFLA  1249
              +   + E G +      G              TP+ EM  E ++ ++ H  ++LDRFL 
Sbjct  174   PQRSYDYENGVSRRTRSYGDVTEMERRDEKKAATPLPEMPPERIFGKMGHLQRLLDRFLN  233

Query  1248  CKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRV  1069
              +PTG AK +R+VL+ALY +V+ESF++Y  I E+L +L+D+F  ++  +  K  + +   
Sbjct  234   LRPTGLAKNSRMVLIALYPIVRESFKLYADICEVLAVLLDKFFDMECTNCVKAFDAYASA  293

Query  1068  AKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrep  889
             AKQ DEL  FY W K  G+ R SEYP+V+    + L+  EE +R++ +    R       
Sbjct  294   AKQIDELIAFYDWCKETGVGRSSEYPEVQRITSKLLETWEEFVRDRAK----RGKSPERK  349

Query  888   speveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGE  709
               E    E    E E E DMN IKAL         E        E  K     DL+NL E
Sbjct  350   EIEAPPPEPVAQEEEPEPDMNEIKAL------PPPESYTPPPEPEPAKPLYTDDLVNLRE  403

Query  708   DAPTPEEHANQLALALFDGiptidptkttittPWEAFN---------------GSEDWET  574
             D  T ++  N+ ALALF G P  +         WEAF                G  DWE 
Sbjct  404   DEVTGDDQGNKFALALFAGPPGSNGK-------WEAFRSDGVTSAWQNPAAEPGKADWEL  456

Query  573   ALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRp  394
             ALV+TAS+L  Q A   G FD LML+GMY QG + Q V++S  LT GSA+SVA    G+ 
Sbjct  457   ALVETASNLEKQTAALGGGFDTLMLNGMYDQGVVRQHVSTSQ-LTGGSASSVALPLPGKT  515

Query  393   amlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTK  214
                 L  P    D        DPFAASL++ PP+YVQM+E+EKKQ LL +EQQ+WQQY +
Sbjct  516   NTRVLALPAP--DGTVEKVNQDPFAASLTIPPPSYVQMAEMEKKQYLLSQEQQLWQQYQR  573

Query  213   DGMHGQVGLEKAQQSSQP  160
             +GM GQ  L K      P
Sbjct  574   EGMRGQASLAKMNMGPVP  591



>gb|KDP33586.1| hypothetical protein JCGZ_07157 [Jatropha curcas]
Length=671

 Score =   258 bits (658),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 167/401 (42%), Positives = 232/401 (58%), Gaps = 36/401 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EMK E ++ ++ H  ++LDRFL+C+PTG AK +R++L+ALY VV+ESFQ+Y  I E
Sbjct  251   TPLREMKPERIFGKMAHLQRLLDRFLSCRPTGLAKNSRMILIALYPVVRESFQLYADICE  310

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++ PD  K  + +    KQ DEL +FY W K  G++R SEYPDV+    
Sbjct  311   VLAVLLDKFFDMEYPDCVKAFDAYASAGKQIDELIIFYNWCKDTGVARSSEYPDVQKITS  370

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +          +     EE      E E   DMN IKALPPP    
Sbjct  371   KLLETLEEFVRDRAKRP--------KSPERKEEAPPVAQEEEPVPDMNEIKALPPPENYT  422

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E   ++ +  +  DL+NL +D  + ++  N+LALALF G P  +   +     
Sbjct  423   PPPPPEPEPTPQQPQVAE--DLVNLRDDVVSADDQGNRLALALFAGPPANNGNGS-----  475

Query  609   WEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYR  484
             WEAF                   G  DWE ALV++AS+LS QKA   G FD L+L GMY 
Sbjct  476   WEAFPSNGEPQVTSAWQTPAAEPGKADWELALVESASNLSKQKATLGGGFDPLLLSGMYD  535

Query  483   QGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSV  304
             QG + Q V+++  L+ GSA+SVA  + G+ A   L  P    D        DPFAASLS+
Sbjct  536   QGTVRQHVSTT-QLSGGSASSVALPAVGKSATPVLALPAP--DGTVQTVNQDPFAASLSI  592

Query  303   APPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
              PP+YVQMS++EKKQ LL +EQQ+WQQY KDGM GQ  L K
Sbjct  593   PPPSYVQMSDMEKKQHLLVQEQQVWQQYAKDGMQGQASLAK  633


 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 45/50 (90%), Gaps = 1/50 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRG  1426
             +ATRRGTRLLNMSDFRD + S+ WD+SAFVRTY++YLD+++EL + +R+G
Sbjct  110   YATRRGTRLLNMSDFRDEAHSSSWDHSAFVRTYAMYLDQRLELVLFDRKG  159



>ref|XP_008443968.1| PREDICTED: putative clathrin assembly protein At2g25430 isoform 
X2 [Cucumis melo]
Length=492

 Score =   251 bits (641),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 176/493 (36%), Positives = 256/493 (52%), Gaps = 69/493 (14%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             +ATR+GTR+L++S FRD + SN WD+S+F+R Y+LYLDE +E  +  ++ K    +    
Sbjct  42    YATRKGTRVLDLSGFRDEAHSNSWDHSSFLRFYALYLDELIETLVLEKKVKGGDESYYRG  101

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             +                     +    ++ E +   +   I++LDR LAC+P G AK +R
Sbjct  102   KRQ-------------------SSWRSIRPERVVEELNQLIRMLDRVLACRPNGMAKSSR  142

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             LV+ AL  V+KESF++Y  I + LG+L+D+F +++  D  +V ++     K  DEL  FY
Sbjct  143   LVITALNLVIKESFRLYIEICDALGVLLDQFKEMEYADCLRVFDVCANAVKNIDELVEFY  202

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrep----speveev  868
              W K  GI+R SEYP V       L              GG +          +    + 
Sbjct  203   CWCKDVGIARSSEYPGVRMITNNLL-----------ITLGGFLKEMTRRPKDYNEMRTKE  251

Query  867   eepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEE  688
              +P    E+  DMN IKALPPP        +V+++  E        DL+NL ED  + +E
Sbjct  252   MKPVSVKESRYDMNEIKALPPPENCAPVSQSVLQSLKE--------DLVNLREDEVSADE  303

Query  687   HANQLALALFDGiptidptkttittPWEAFN------------------GSEDWETALVQ  562
                +LA+A F G PT +P  +     WE F+                  G  DWE ALV+
Sbjct  304   QGEKLAMAFFSGPPTTNPNGS-----WETFSLNHEPEVSSVWQTRAAEFGKPDWELALVE  358

Query  561   TASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamla  382
             TASHLS Q+    G FD ++L+GMY Q A+ + V    +   GS++SVA    G+ +  +
Sbjct  359   TASHLSKQRPDMGGCFDPMLLNGMYDQEAVRRHVNVEQL--GGSSSSVAVALQGQGSAGS  416

Query  381   lpappssADANTTASGA-DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGM  205
                   + D      G  DPFAASL V PP+YVQ++E+EKKQ+LL +EQ +W+QY +DGM
Sbjct  417   QVLALPAPDGTVELVGQRDPFAASLMVPPPSYVQIAEMEKKQQLLAQEQLLWKQYGRDGM  476

Query  204   HGQVGLEKAQQSS  166
              GQVGLEK    S
Sbjct  477   QGQVGLEKVGNGS  489



>ref|XP_008443967.1| PREDICTED: putative clathrin assembly protein At2g25430 isoform 
X1 [Cucumis melo]
Length=561

 Score =   252 bits (644),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 176/493 (36%), Positives = 256/493 (52%), Gaps = 69/493 (14%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             +ATR+GTR+L++S FRD + SN WD+S+F+R Y+LYLDE +E  +  ++ K    +    
Sbjct  111   YATRKGTRVLDLSGFRDEAHSNSWDHSSFLRFYALYLDELIETLVLEKKVKGGDESYYRG  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             +                     +    ++ E +   +   I++LDR LAC+P G AK +R
Sbjct  171   KRQ-------------------SSWRSIRPERVVEELNQLIRMLDRVLACRPNGMAKSSR  211

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             LV+ AL  V+KESF++Y  I + LG+L+D+F +++  D  +V ++     K  DEL  FY
Sbjct  212   LVITALNLVIKESFRLYIEICDALGVLLDQFKEMEYADCLRVFDVCANAVKNIDELVEFY  271

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrep----speveev  868
              W K  GI+R SEYP V       L              GG +          +    + 
Sbjct  272   CWCKDVGIARSSEYPGVRMITNNLL-----------ITLGGFLKEMTRRPKDYNEMRTKE  320

Query  867   eepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEE  688
              +P    E+  DMN IKALPPP        +V+++  E        DL+NL ED  + +E
Sbjct  321   MKPVSVKESRYDMNEIKALPPPENCAPVSQSVLQSLKE--------DLVNLREDEVSADE  372

Query  687   HANQLALALFDGiptidptkttittPWEAFN------------------GSEDWETALVQ  562
                +LA+A F G PT +P  +     WE F+                  G  DWE ALV+
Sbjct  373   QGEKLAMAFFSGPPTTNPNGS-----WETFSLNHEPEVSSVWQTRAAEFGKPDWELALVE  427

Query  561   TASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamla  382
             TASHLS Q+    G FD ++L+GMY Q A+ + V    +   GS++SVA    G+ +  +
Sbjct  428   TASHLSKQRPDMGGCFDPMLLNGMYDQEAVRRHVNVEQL--GGSSSSVAVALQGQGSAGS  485

Query  381   lpappssADANTTASGA-DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGM  205
                   + D      G  DPFAASL V PP+YVQ++E+EKKQ+LL +EQ +W+QY +DGM
Sbjct  486   QVLALPAPDGTVELVGQRDPFAASLMVPPPSYVQIAEMEKKQQLLAQEQLLWKQYGRDGM  545

Query  204   HGQVGLEKAQQSS  166
              GQVGLEK    S
Sbjct  546   QGQVGLEKVGNGS  558



>ref|XP_011070094.1| PREDICTED: probable clathrin assembly protein At4g32285 [Sesamum 
indicum]
Length=499

 Score =   250 bits (639),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 157/401 (39%), Positives = 225/401 (56%), Gaps = 36/401 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+C+PTG AK  R++LVALY VVKESF++Y  + E
Sbjct  80    TPLREMNPERIFGKMGHLQRLLDRFLSCRPTGLAKNERMILVALYAVVKESFKLYSDVCE  139

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  140   VLAVLLDKFFDMEYQDCVKAFDAYVSAAKQIDELVGFYNWCKDTGVARSSEYPEVQRITS  199

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +          +      E +    E E  +DMN IKALPP   + 
Sbjct  200   KLLETLEEFVRDRSKA--------LKSPERKAESQPVPQEEEQVQDMNEIKALPP--PEN  249

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E    +   Q+ GDL+NL ++  T ++  N+LALALF G    +   +     
Sbjct  250   HTPPPPPEPEPPKPAVQETGDLVNLRDEGVTADDQGNKLALALFAGPAANNGNSS-----  304

Query  609   WEAF------------------NGSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYR  484
             WEAF                   G  DWE ALV++ASHLS Q+A   G  D L+L+GMY 
Sbjct  305   WEAFPSDGGSQVTSAWQNPAAETGKADWELALVESASHLSKQQAAMGGGLDPLLLNGMYD  364

Query  483   QGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSV  304
             QG + Q V+++  LT GSA+SVA    G            + D      G DPFAASL++
Sbjct  365   QGVVRQHVSTT-QLTGGSASSVALPGPG--TSKTPVLALPAPDGTVQTVGQDPFAASLAI  421

Query  303   APPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
              PPAYVQM+++EKKQ  L +EQ +WQQY+++GM GQ  L K
Sbjct  422   PPPAYVQMADMEKKQHFLVQEQMVWQQYSREGMQGQTSLSK  462



>ref|XP_010241546.1| PREDICTED: probable clathrin assembly protein At4g32285 [Nelumbo 
nucifera]
Length=657

 Score =   253 bits (647),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 171/405 (42%), Positives = 229/405 (57%), Gaps = 42/405 (10%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ +MK E +  ++    ++LDRFLAC+PTG AK +R+VLVALY VVKESF+ Y  I E
Sbjct  232   TPLRDMKPERVLGKMNQLQRLLDRFLACRPTGTAKNSRMVLVALYPVVKESFKHYADICE  291

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+DRF  ++ PD  K  E +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  292   ILAVLLDRFFDMEYPDCVKSFEAYASAAKQIDELVAFYNWCKDIGVARSSEYPEVQRITD  351

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++                     EE   E E  +DMN IKALPPP    
Sbjct  352   KLLETLEEFMRDRARRP----------KSPDRPREETPQEEEPAQDMNEIKALPPPENYT  401

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E   + ++  +  DL++L ++  + E+ +N+LALALF G  T +   +     
Sbjct  402   PPPPPEPEPKPQPQQVTE--DLVDLRDNGVSAEDQSNRLALALFSGPATGNTNGS-----  454

Query  609   WEAFN----------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLD  496
             WEAF                       G  DWE ALV+TAS+LS QKA   G FD L+L+
Sbjct  455   WEAFPSNGTAPGEPEVTSAWHTPAAEPGKADWELALVETASNLSKQKATLAGGFDPLLLN  514

Query  495   GMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAA  316
             GMY QGA+ Q   ++  LT GSA+SVA    G+ A   L  P    D      G DPFAA
Sbjct  515   GMYDQGAVRQHT-NTAQLTGGSASSVALPVPGKSATPVLALPAP--DGTVQTVGHDPFAA  571

Query  315   SLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             S+S+ PPAYVQM+++EKKQ LL +EQ MWQQY +DGM GQV L K
Sbjct  572   SVSIPPPAYVQMADIEKKQNLLVQEQHMWQQYARDGMQGQVSLAK  616


 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATR+GTRLLNMSDFRD + SN WD+SAFV+TY+LYLD+Q+E  + +R+
Sbjct  109   YATRKGTRLLNMSDFRDEAHSNSWDHSAFVQTYALYLDQQLEYLVYDRK  157



>gb|AES73629.2| clathrin assembly plant-like protein, putative [Medicago truncatula]
Length=641

 Score =   253 bits (646),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 171/405 (42%), Positives = 232/405 (57%), Gaps = 35/405 (9%)
 Frame = -1

Query  1341  VVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYY  1162
             +VT TP+ +MK E ++ ++ H  ++LDRFLAC+PTG AK NR++L+ALY +VKESFQ+Y 
Sbjct  220   IVTVTPLRDMKPERIFGKMSHLQRLLDRFLACRPTGLAKNNRMILIALYPLVKESFQLYA  279

Query  1161  SIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVE  982
              I E+L +L+D+F  ++ PD  K  + +   AKQ DEL  FY W K +G++R SEYP+V+
Sbjct  280   DICEVLAVLLDKFFDMEYPDCVKAFDAYASAAKQIDELVAFYNWCKESGLARSSEYPEVQ  339

Query  981   NYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPP  802
                 + L+ +EE +R        R  R + P  + E  +    E E   DMN IKALP P
Sbjct  340   RITSKLLETLEEFVR-------DRAKRPKSPERKEEAPKLEVQEEEPVPDMNEIKALPAP  392

Query  801   PEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptktt  622
              E++            E K Q   DL+NL EDA T ++  N+ ALALF       P    
Sbjct  393   -ENYTPPPPPEP--EPEPKPQFTEDLVNLREDAVTADDQGNRFALALF----AGAPANNN  445

Query  621   ittPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLD  496
                 WEAF                   G  DWE ALV+TAS+LS QK    G  D L+L+
Sbjct  446   ANGSWEAFPSNGQPEVTSAWQTPAAEPGKADWELALVETASNLSRQKNALGGGLDPLLLN  505

Query  495   GMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAA  316
             GMY QG + Q V++S  L+ GSA+SVA  + G+     L  P    D +      DPFAA
Sbjct  506   GMYDQGMVRQHVSTSQ-LSGGSASSVALPAPGKTTTPVLALPAP--DGSVQPVNQDPFAA  562

Query  315   SLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             SL++ PP+YVQM+E+EKKQ+LL  EQQ+W QY +DGM GQ  L K
Sbjct  563   SLNIPPPSYVQMAEMEKKQQLLVHEQQLWHQYARDGMQGQSSLNK  607


 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRG  1426
             +A RRGTRLLNMSDFRD + S+ WD+SAFVRTY+LYLD+++EL + +R+ 
Sbjct  110   YAPRRGTRLLNMSDFRDEAHSSSWDHSAFVRTYALYLDQRLELMLFDRKA  159



>ref|XP_011039677.1| PREDICTED: putative clathrin assembly protein At2g25430 [Populus 
euphratica]
Length=657

 Score =   253 bits (645),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 165/401 (41%), Positives = 225/401 (56%), Gaps = 38/401 (9%)
 Frame = -1

Query  1335  TGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSI  1156
             T TP+ EMK E ++ ++ H  ++LDRFL+C+PTG AK NR++L+ALY VVKESF++Y  I
Sbjct  238   TVTPLREMKPERIFGKMGHLQRLLDRFLSCRPTGLAKNNRMILIALYPVVKESFKLYADI  297

Query  1155  AEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENY  976
              E+L +L+D+F  ++ PD  K  + +   AKQ DEL  FY W K  G++R SEYP+V+  
Sbjct  298   CEVLAVLLDKFFDMEYPDCVKAFDAYASAAKQIDELIAFYNWCKDTGVARSSEYPEVQRI  357

Query  975   PKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPE  796
               + L+ +EE +R++ +          +     EE      E E   DMN IKAL     
Sbjct  358   TGKLLETLEEFLRDRSKRP--------KSPERREEAPPVPQEEEPVPDMNEIKAL----P  405

Query  795   DFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttit  616
                      E  T+ ++ Q   DL+NL +DA T ++  N LALALF G P  +   +   
Sbjct  406   PPENYTPPPEPETKPQQPQFAEDLVNLRDDAVTADDQGNTLALALFAGPPANNGNGS---  462

Query  615   tPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGM  490
               WEAF                   G  DWE ALV+TAS+LS QKA   G FD L+L+G 
Sbjct  463   --WEAFPSNGEPQLTSAWQTPAAEPGKADWELALVETASNLSKQKATLGGGFDPLLLNGR  520

Query  489   YRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASL  310
             Y QG + Q V ++  L+ GSA+SVA    G+     L  P    D    A   DPFAASL
Sbjct  521   YDQGMVRQHVGTA-QLSGGSASSVALPGPGKNTTPVLALPAP--DGTVQAVNQDPFAASL  577

Query  309   SVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGL  187
             SV PP+YVQM+++EKKQ LL +EQ  W QY ++GM GQ  L
Sbjct  578   SVPPPSYVQMADMEKKQNLLVQEQVTWHQYAREGMQGQASL  618


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATR+GTRLLNMSDFRD + S+ WD+SAF+RT+++YLD+++EL +  R+
Sbjct  110   YATRKGTRLLNMSDFRDEAHSSSWDHSAFIRTFAMYLDQRLELILFERK  158



>ref|XP_003603378.1| epsin N-terminal homology (ENTH) domain-containing protein [Medicago 
truncatula]
Length=662

 Score =   252 bits (644),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 171/405 (42%), Positives = 232/405 (57%), Gaps = 35/405 (9%)
 Frame = -1

Query  1341  VVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYY  1162
             +VT TP+ +MK E ++ ++ H  ++LDRFLAC+PTG AK NR++L+ALY +VKESFQ+Y 
Sbjct  220   IVTVTPLRDMKPERIFGKMSHLQRLLDRFLACRPTGLAKNNRMILIALYPLVKESFQLYA  279

Query  1161  SIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVE  982
              I E+L +L+D+F  ++ PD  K  + +   AKQ DEL  FY W K +G++R SEYP+V+
Sbjct  280   DICEVLAVLLDKFFDMEYPDCVKAFDAYASAAKQIDELVAFYNWCKESGLARSSEYPEVQ  339

Query  981   NYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPP  802
                 + L+ +EE +R        R  R + P  + E  +    E E   DMN IKALP P
Sbjct  340   RITSKLLETLEEFVR-------DRAKRPKSPERKEEAPKLEVQEEEPVPDMNEIKALPAP  392

Query  801   PEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptktt  622
              E++            E K Q   DL+NL EDA T ++  N+ ALALF       P    
Sbjct  393   -ENYTPPPPPEP--EPEPKPQFTEDLVNLREDAVTADDQGNRFALALF----AGAPANNN  445

Query  621   ittPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLD  496
                 WEAF                   G  DWE ALV+TAS+LS QK    G  D L+L+
Sbjct  446   ANGSWEAFPSNGQPEVTSAWQTPAAEPGKADWELALVETASNLSRQKNALGGGLDPLLLN  505

Query  495   GMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAA  316
             GMY QG + Q V++S  L+ GSA+SVA  + G+     L  P    D +      DPFAA
Sbjct  506   GMYDQGMVRQHVSTSQ-LSGGSASSVALPAPGKTTTPVLALPAP--DGSVQPVNQDPFAA  562

Query  315   SLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             SL++ PP+YVQM+E+EKKQ+LL  EQQ+W QY +DGM GQ  L K
Sbjct  563   SLNIPPPSYVQMAEMEKKQQLLVHEQQLWHQYARDGMQGQSSLNK  607


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRG  1426
             +A RRGTRLLNMSDFRD + S+ WD+SAFVRTY+LYLD+++EL + +R+ 
Sbjct  110   YAPRRGTRLLNMSDFRDEAHSSSWDHSAFVRTYALYLDQRLELMLFDRKA  159



>ref|NP_001174177.1| Os05g0112101 [Oryza sativa Japonica Group]
 gb|AAU44211.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAH01005.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH92905.1| Os05g0112101 [Oryza sativa Japonica Group]
Length=581

 Score =   250 bits (639),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 183/490 (37%), Positives = 249/490 (51%), Gaps = 46/490 (9%)
 Frame = -1

Query  1569  ATRRGTRLLNM-SDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             A RRG  +L + ++FRD + S  WD+SAFVR Y+LYLD +    +       S L +   
Sbjct  109   AGRRGEPMLALLAEFRDEAHSASWDHSAFVRAYALYLDHRARFLI-------SLLPAPRT  161

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                 +E      G+T A V       EM  E L  R     Q+LDR LAC+P+G A+++R
Sbjct  162   VRFADETGSPPRGSTAATV------QEMDTEALLGRALQLRQLLDRVLACRPSGGARQSR  215

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             +VL  LY VVKES Q+   +A +L +L+DRF  +D PD  KV E     AKQ D+L  FY
Sbjct  216   VVLATLYPVVKESTQLCSDVAVVLAVLLDRFFDMDYPDCVKVFEAHVSTAKQTDDLLAFY  275

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
              W     ++R +++ DV     +++D       E+     GR   +   SP   + ++ +
Sbjct  276   GWCDDVRLARPADFADV-----KRIDDKLLETLEQFVRERGR---AGHSSPPPWQQQQQQ  327

Query  855   peaeaeEDMNTIKALPPP------PEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTP  694
                  E DMN IKALP P      P     E    E           GDL++L E     
Sbjct  328   TAQSDELDMNGIKALPAPEHHAAEPSRSAPEKVAPEQMAPPPPPPQTGDLVDLREPV-VE  386

Query  693   EEHANQLALALFDGipti------dptkttittPWE---AFNGSEDWETALVQTASHLSN  541
             +E  N+LALALF G                +T+ W+   A  G  +WE ALV+TAS LS 
Sbjct  387   DEQENKLALALFSGTENGGWVAFPSDDAAEVTSAWQTPAAEAGKAEWELALVETASKLSR  446

Query  540   QKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappss  361
             QKA   G  D L+L GMY QGA+ Q V +     TGSA+SVA          A      +
Sbjct  447   QKASMGGGLDPLLLHGMYDQGAVRQQVGAHEA-ATGSASSVA------APRRAPVLALPA  499

Query  360   ADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
              D     +G DPFAAS+ V PPAYVQM+E+E+KQ+LL +EQQMW QY + GM GQV +++
Sbjct  500   PDGTARTTGGDPFAASMGVPPPAYVQMAEMERKQQLLVQEQQMWAQYRQGGMQGQVAMDR  559

Query  180   AQQSSQPHNY  151
                 + P  Y
Sbjct  560   LAAGAMPVQY  569



>ref|XP_010546565.1| PREDICTED: LOW QUALITY PROTEIN: putative clathrin assembly protein 
At2g25430 [Tarenaya hassleriana]
Length=652

 Score =   252 bits (643),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 166/410 (40%), Positives = 228/410 (56%), Gaps = 37/410 (9%)
 Frame = -1

Query  1335  TGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSI  1156
             + TP+ EM  E ++ ++ H  ++LDRFL+C+PTG AK +R++L+ALY VV+ESF++Y  I
Sbjct  236   SATPLREMMPERIFGKMGHLQRLLDRFLSCRPTGLAKNSRMILIALYPVVRESFRLYADI  295

Query  1155  AEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENY  976
              E+L +L+D+F  ++  DS K  + +   AKQ DEL +FY W K AG++R SEYP+V+  
Sbjct  296   CEVLAVLLDKFFDMEYTDSVKAFDAYASSAKQIDELILFYNWCKDAGVARSSEYPEVQRI  355

Query  975   PKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPE  796
               + L+ +EE +R++ +              E+E    P  E E   DMN IKALP    
Sbjct  356   TGKLLETLEEFVRDRAKR------LKSPERKEIEAPPPPPQEEEPVPDMNEIKALP---P  406

Query  795   DFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttit  616
                          E +K Q   DL+NL +D  + ++  N+LALALF G P  D       
Sbjct  407   PEDYTPPPPVPEPEPQKPQVTDDLVNLRDDNISADDQGNELALALFGGPPGSDGK-----  461

Query  615   tPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGM  490
               WEAFN                  G  DWE ALV+TAS+L  QKA   G FD L+L+GM
Sbjct  462   --WEAFNSHGDNNMTSAWQNPAAEPGKADWELALVETASNLEKQKAALGGGFDPLLLNGM  519

Query  489   YRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASL  310
             Y QG + Q ++++  LT GS +SVA    G+     L  P    D        DPFAASL
Sbjct  520   YDQGMVRQHMSTT-QLTGGSTSSVALPLPGKTNNQVLALPAP--DGTIQKVNEDPFAASL  576

Query  309   SVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQP  160
              + PP+YVQM+E+EKKQRLL +EQQ+W QY  DGM GQ  L K      P
Sbjct  577   VIPPPSYVQMAEMEKKQRLLVQEQQLWNQYQLDGMRGQTSLAKISTGPVP  626


 Score = 63.5 bits (153),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHS  1417
             +ATRRGTR+LN SDFRD + S+ WD+SAFVRTY+ YLD+++ L +  R+   S
Sbjct  109   YATRRGTRMLNFSDFRDEAHSSSWDHSAFVRTYASYLDQRLXLFLFERKSGGS  161



>ref|XP_002309633.1| clathrin assembly family protein [Populus trichocarpa]
 gb|EEE93156.1| clathrin assembly family protein [Populus trichocarpa]
Length=658

 Score =   252 bits (643),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 166/403 (41%), Positives = 228/403 (57%), Gaps = 37/403 (9%)
 Frame = -1

Query  1335  TGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSI  1156
             T TP+ EMK E ++ ++ H  ++LDRFL+C+PTG AK NR++L+ALY VVKESF++Y  I
Sbjct  238   TVTPLKEMKPERIFGKMGHLQRLLDRFLSCRPTGLAKNNRMILIALYPVVKESFKLYADI  297

Query  1155  AEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENY  976
              E+L +L+D+F  ++ PD  K  + +   AKQ DEL   Y W K  G++R SEYP+V+  
Sbjct  298   CEVLAVLLDKFFDMEYPDCVKAFDAYASAAKQIDELIALYNWCKDTGVARSSEYPEVQRI  357

Query  975   PKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPE  796
               + L+ +EE +R++ +          +     EE      E E   DMN IKALP    
Sbjct  358   TGKLLETLEEFLRDRSKRP--------KSPERREEAPPVPQEEEPVPDMNEIKALP---P  406

Query  795   DFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttit  616
                      E   + ++ Q   DL+NL +DA T ++  N+ ALALF G P  +   +   
Sbjct  407   PENYTPPPPEPEPKPQQPQFAEDLVNLRDDAVTADDQGNRFALALFAGPPANNGNGS---  463

Query  615   tPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGM  490
               WEAF                   G  DWE ALV+TAS+LS QKA   G FD L+L+GM
Sbjct  464   --WEAFPSNGEPQLTSAWQTPAAEPGKADWELALVETASNLSKQKATLGGGFDPLLLNGM  521

Query  489   YRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASL  310
             Y QG + Q V ++  L+ GSA+SVA   +G+     L  P    D    A   DPFAASL
Sbjct  522   YDQGMVRQHVGTA-QLSGGSASSVALPGSGKSTTPVLALPAP--DGTVQAVNQDPFAASL  578

Query  309   SVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             SV PP+YVQM+++EKKQ LL +EQ  WQQY ++GM GQ  L K
Sbjct  579   SVPPPSYVQMADMEKKQNLLVQEQVTWQQYAREGMQGQASLVK  621


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATR+GTRLLNMSDFRD + S+ WD+SAF+RT+++YLD+++EL +  R+
Sbjct  110   YATRKGTRLLNMSDFRDEAHSSSWDHSAFIRTFAMYLDQRLELILFERK  158



>ref|XP_006483372.1| PREDICTED: putative clathrin assembly protein At2g25430-like 
[Citrus sinensis]
 gb|KDO61743.1| hypothetical protein CISIN_1g044405mg [Citrus sinensis]
Length=645

 Score =   251 bits (640),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 174/401 (43%), Positives = 235/401 (59%), Gaps = 38/401 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EMK E ++ ++ H  ++LDRFL+C+PTG AK NR+VL+ALY +VKESFQ+Y  I E
Sbjct  229   TPLREMKPERIFGKMGHLQRLLDRFLSCRPTGLAKNNRIVLIALYPMVKESFQIYADICE  288

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G+ R SEYPDV+    
Sbjct  289   VLAVLLDKFFDMEYTDCVKAFDAYTSSAKQIDELIAFYNWCKDTGVMRSSEYPDVQRITS  348

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +                 +  E  P  E  +DMN IKALPPP +  
Sbjct  349   KLLETLEEFVRDRAKRP----------KSPERKEIEAPPVQEPVQDMNEIKALPPPEDHT  398

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E   E +K Q   DL+NL +D  T ++  N+ ALALF+G    +   +     
Sbjct  399   PPPPPEPEPEPEPQKPQVTEDLVNLRDDGITADDQGNKFALALFNGPAANNGNGS-----  453

Query  609   WEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYR  484
             WEAF                   G EDWE ALV+TASHLS+QKA   G  D L+L GMY 
Sbjct  454   WEAFPSNGEPQVTSAWQNPAAEPGKEDWELALVETASHLSHQKAALGGGLDPLLLTGMYE  513

Query  483   QGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSV  304
             QG + Q V+++  L+ GSA+SVA    G+  +LALPAP    D    A   DPFAASLS+
Sbjct  514   QGMVRQHVSTTQ-LSGGSASSVALPGTGKTPVLALPAP----DGTVQAVNQDPFAASLSI  568

Query  303   APPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
              PP+YVQM+E+EKKQ LL  EQQ+WQQY+++GM GQ  L K
Sbjct  569   PPPSYVQMAEMEKKQVLLVHEQQVWQQYSREGMQGQASLAK  609


 Score = 69.7 bits (169),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 40/43 (93%), Gaps = 1/43 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVEL  1447
             +ATRRGTRLLNMSDFRD + S+ WD+SAFVRTY++YLD+++EL
Sbjct  110   YATRRGTRLLNMSDFRDEAHSSSWDHSAFVRTYAMYLDQRLEL  152



>ref|XP_006450421.1| hypothetical protein CICLE_v10007706mg [Citrus clementina]
 gb|ESR63661.1| hypothetical protein CICLE_v10007706mg [Citrus clementina]
Length=645

 Score =   250 bits (639),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 174/401 (43%), Positives = 235/401 (59%), Gaps = 38/401 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EMK E ++ ++ H  ++LDRFL+C+PTG AK NR+VL+ALY +VKESFQ+Y  I E
Sbjct  229   TPLREMKPERIFGKMGHLQRLLDRFLSCRPTGLAKNNRIVLIALYPMVKESFQIYADICE  288

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G+ R SEYPDV+    
Sbjct  289   VLAVLLDKFFDMEYTDCVKAFDAYTSSAKQIDELIAFYNWCKDTGVMRSSEYPDVQRITS  348

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +                 +  E  P  E  +DMN IKALPPP +  
Sbjct  349   KLLETLEEFVRDRAKRP----------KSPERKEIEAPPVQEPVQDMNEIKALPPPEDHT  398

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E   E +K Q   DL+NL +D  T ++  N+ ALALF+G    +   +     
Sbjct  399   PPPPPEPEPEPEPQKPQVTEDLVNLRDDGITADDQGNKFALALFNGPAANNGNGS-----  453

Query  609   WEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYR  484
             WEAF                   G EDWE ALV+TASHLS+QKA   G  D L+L GMY 
Sbjct  454   WEAFPSNGEPQVTSAWQNPAAEPGKEDWELALVETASHLSHQKAALGGGLDPLLLTGMYE  513

Query  483   QGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSV  304
             QG + Q V+++  L+ GSA+SVA    G+  +LALPAP    D    A   DPFAASLS+
Sbjct  514   QGMVRQHVSTTQ-LSGGSASSVALPGTGKTPVLALPAP----DGTVQAVNQDPFAASLSI  568

Query  303   APPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
              PP+YVQM+E+EKKQ LL  EQQ+WQQY+++GM GQ  L K
Sbjct  569   PPPSYVQMAEMEKKQVLLVHEQQVWQQYSREGMQGQSSLAK  609


 Score = 69.7 bits (169),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 40/43 (93%), Gaps = 1/43 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVEL  1447
             +ATRRGTRLLNMSDFRD + S+ WD+SAFVRTY++YLD+++EL
Sbjct  110   YATRRGTRLLNMSDFRDEAHSSSWDHSAFVRTYAMYLDQRLEL  152



>ref|XP_011081548.1| PREDICTED: putative clathrin assembly protein At2g25430 [Sesamum 
indicum]
 ref|XP_011081549.1| PREDICTED: putative clathrin assembly protein At2g25430 [Sesamum 
indicum]
 ref|XP_011081550.1| PREDICTED: putative clathrin assembly protein At2g25430 [Sesamum 
indicum]
 ref|XP_011081552.1| PREDICTED: putative clathrin assembly protein At2g25430 [Sesamum 
indicum]
 ref|XP_011081553.1| PREDICTED: putative clathrin assembly protein At2g25430 [Sesamum 
indicum]
 ref|XP_011081554.1| PREDICTED: putative clathrin assembly protein At2g25430 [Sesamum 
indicum]
Length=643

 Score =   249 bits (636),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 160/401 (40%), Positives = 224/401 (56%), Gaps = 36/401 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+C+PTG AK  R++LVALY ++KESF++Y  + E
Sbjct  224   TPLREMNPERIFGKMGHLQRLLDRFLSCRPTGLAKNERMILVALYAIIKESFKLYADVCE  283

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  284   VLAVLLDKFFDMEYQDCVKAFDAYASAAKQIDELVSFYNWCKDIGVARSSEYPEVQRITS  343

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +          +     EE +    E E   DMN IKALPP   + 
Sbjct  344   KLLETLEEFVRDRAKA--------MKSPERKEETKPAPQEEEPVPDMNEIKALPP--PED  393

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E    +   Q+ GDLL+L ++  T ++  N+LALALF G    +         
Sbjct  394   YNPPPPPEPEPPKLAIQETGDLLDLRDEGVTADDQGNKLALALFAGTVANNGNGL-----  448

Query  609   WEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYR  484
             WEAF                   G  DWE ALV++ASHLS QKA   G  D L+L+GMY 
Sbjct  449   WEAFPSNGEPEVTSAWQNPAAEMGKADWELALVESASHLSKQKATMGGGLDPLLLNGMYD  508

Query  483   QGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSV  304
             QG + Q V S+  L+ GSA+SVA    G  A         + D      G DPFAASLS+
Sbjct  509   QGMVRQHV-STAQLSGGSASSVALPGPG--ASKTPVLALPAPDGTVQTVGQDPFAASLSI  565

Query  303   APPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
              PP YVQM+++EKKQ+LL +EQ +WQQY +DGM GQ  L K
Sbjct  566   PPPPYVQMADMEKKQQLLVQEQIVWQQYARDGMQGQASLAK  606


 Score = 72.4 bits (176),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             ATRRGTRLLN+SDFRD + SN WD+SAFVRTY+LYLD+++EL +  R+
Sbjct  111   ATRRGTRLLNLSDFRDEAHSNSWDHSAFVRTYALYLDQRLELMVYERK  158



>ref|XP_010049908.1| PREDICTED: putative clathrin assembly protein At2g25430 [Eucalyptus 
grandis]
 ref|XP_010049909.1| PREDICTED: putative clathrin assembly protein At2g25430 [Eucalyptus 
grandis]
 ref|XP_010049910.1| PREDICTED: putative clathrin assembly protein At2g25430 [Eucalyptus 
grandis]
 ref|XP_010049912.1| PREDICTED: putative clathrin assembly protein At2g25430 [Eucalyptus 
grandis]
 gb|KCW82732.1| hypothetical protein EUGRSUZ_C04109 [Eucalyptus grandis]
Length=651

 Score =   249 bits (637),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 171/401 (43%), Positives = 228/401 (57%), Gaps = 36/401 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EMK E ++ ++ H  ++LDRFLAC+PTG AK +RL+LVALY VVKESFQVY  I E
Sbjct  238   TPLREMKPERIFGKMGHLQRLLDRFLACRPTGLAKNSRLILVALYPVVKESFQVYADICE  297

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +    KQ DEL  FY W K  G++R SEYP+V+    
Sbjct  298   VLAVLLDKFFDMEYQDCIKAFDAYCSAKKQIDELSAFYDWCKDTGVARSSEYPEVQRITS  357

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +          +     EE+     E E   DMN IKALPPP E++
Sbjct  358   KLLETLEEFVRDRAKRP--------KSPERREELPPVAKEEEPVPDMNEIKALPPP-ENY  408

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                        E  K Q   DL++L +D  T ++  N+ ALALF G P      +     
Sbjct  409   TPAPPPEPK-PEPPKPQVTQDLVDLRDDGVTADDQGNKFALALFAGPPANTGNGS-----  462

Query  609   WEAF------------------NGSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYR  484
             WEAF                  +G EDWE ALV+TAS+LS QKA   G  D L+L+GMY 
Sbjct  463   WEAFPSNGEPEVTSAWQTPAAESGKEDWELALVETASNLSKQKAALGGGLDPLLLNGMYD  522

Query  483   QGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSV  304
             QG + Q V S+  LT GSA+SVA    G+     L  P    D        DPFAASLS+
Sbjct  523   QGMVRQHV-STAQLTGGSASSVALPGLGKSTTPVLALPAP--DGTVQTVNQDPFAASLSI  579

Query  303   APPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
              PP+YVQM+E+EKKQ L+ +EQQ+WQQY  +GM GQ  L K
Sbjct  580   PPPSYVQMAEMEKKQHLVVQEQQLWQQYATEGMRGQATLAK  620


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             ATRRG RLLN+SDFRD + S+ WD+SAFVRTY++YLD+++EL + +R+
Sbjct  111   ATRRGARLLNLSDFRDEAHSSSWDHSAFVRTYAMYLDQKLELILFDRK  158



>gb|EEE63786.1| hypothetical protein OsJ_18609 [Oryza sativa Japonica Group]
Length=556

 Score =   246 bits (629),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 176/482 (37%), Positives = 245/482 (51%), Gaps = 90/482 (19%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHS-------  1417
             +ATRRGTR+LNMSDF D SR++ WD+SAFVRTY+ YLD+++E RMQ + G  +       
Sbjct  113   YATRRGTRMLNMSDFCDHSRTDAWDFSAFVRTYAAYLDDRLEYRMQAKHGGAARPGQPLR  172

Query  1416  ----ALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLA  1249
                 A         +    ++E     A+V   TP +EM  E L ++ Q    +LDRF+A
Sbjct  173   EQLYASPGNRFNYDDFIMRDDEADKAVALVARETPTSEMTLEQLLAKAQQLQHLLDRFIA  232

Query  1248  CKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRV  1069
             C+P GAAK NR+V V+LY +VKES Q+Y  + E++  LV++F +++  D ++VH +F  +
Sbjct  233   CRPVGAAKTNRVVSVSLYPLVKESVQLYCELTEVMAALVEQFPEMEADDCERVHAVFCGL  292

Query  1068  AKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrep  889
             AKQ DELE  YTW K A + R S+ P+VE   ++KL++M+E +R++   A          
Sbjct  293   AKQLDELEALYTWCKDAYVCRQSDVPEVELITQKKLELMDEFVRDRRAAAA---------  343

Query  888   speveeveepepeaeaeEDMNTIKALPPPPEDFI----EEMAVVEAPTEEKKEQDI----  733
               +  E    E     E+D++  KALP P E       E+ A    P E +    I    
Sbjct  344   --QSPEPPRREASPVVEDDVSATKALPAPEEPVAAAQEEQNAGETVPAEPEAPPLIADGD  401

Query  732   GDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTAS  553
              D LNL  DA + EEH  QLALALFDG P       +     +AF+GS            
Sbjct  402   ADFLNLKGDAMSGEEHGRQLALALFDGNPAGQAAAASTAANAQAFSGS------------  449

Query  552   HLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpa  373
                                            ASS  +    A  +A G+           
Sbjct  450   -------------------------------ASSVAMRPPGAPMLAMGAP----------  468

Query  372   ppssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQV  193
                     T+ +  DPFAAS++VAPPAYVQMS++E KQ  L EEQ +WQQY K+GM GQ 
Sbjct  469   ------PGTSGASGDPFAASMAVAPPAYVQMSDMETKQHQLVEEQMVWQQYGKNGMSGQG  522

Query  192   GL  187
              L
Sbjct  523   AL  524



>ref|XP_004501337.1| PREDICTED: putative clathrin assembly protein At2g25430-like 
[Cicer arietinum]
Length=643

 Score =   248 bits (633),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 171/405 (42%), Positives = 235/405 (58%), Gaps = 35/405 (9%)
 Frame = -1

Query  1341  VVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYY  1162
             +VT TP+ +MK E ++ ++ H  ++LDRFLAC+PTG AK +R+VLVALY +V+ESFQ+Y 
Sbjct  220   IVTVTPLRDMKPERIFGKMGHLQRLLDRFLACRPTGLAKNSRMVLVALYPLVRESFQLYA  279

Query  1161  SIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVE  982
              I E+L +L+D+F  ++ PD  K  + +   AKQ DEL  FY W K  GI R SEYP+++
Sbjct  280   DICEVLAVLLDKFFDMEYPDFVKAFDAYASAAKQIDELVAFYNWCKDTGIGRSSEYPEIQ  339

Query  981   NYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPP  802
                 + L+ +EE +R+       R  R + P  + E  +    E E   DMN IKALP P
Sbjct  340   RITSKLLETLEEFVRD-------RAKRPKSPERKEEAPKVEIQEEELVPDMNEIKALPAP  392

Query  801   PEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptktt  622
              E++       E    + + Q   DL+NL EDA T ++  N+ ALALF G P  +   + 
Sbjct  393   -ENY-SPPPPPEPEQPKPQPQFTEDLMNLREDAVTADDQGNRFALALFAGAPANNANGS-  449

Query  621   ittPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLD  496
                 WEAF                   G  DWE ALV+TAS+LS QKA   G  D L+L+
Sbjct  450   ----WEAFPSNGQPEVTSAWQTPAAEPGKADWELALVETASNLSKQKAALGGGLDPLLLN  505

Query  495   GMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAA  316
             GMY QG + Q V++S  L+ GSA+SVA    G+     L  P    D +      DPFAA
Sbjct  506   GMYDQGMVRQHVSTSQ-LSGGSASSVALPGPGKTTTPVLALPAP--DGSVQPVNQDPFAA  562

Query  315   SLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             SL++ PP+YVQM+E+EKKQ+LL  EQQ+W QY ++GM GQ  L K
Sbjct  563   SLNIPPPSYVQMAEMEKKQQLLVHEQQLWHQYAREGMQGQSSLTK  607


 Score = 72.4 bits (176),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 44/49 (90%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATRRGTRLLNMSDFRD + S+ WD+SAFVRTY++YLD+++EL + +R+
Sbjct  110   YATRRGTRLLNMSDFRDEAHSSSWDHSAFVRTYAMYLDQRLELLLFDRK  158



>ref|XP_010048955.1| PREDICTED: putative clathrin assembly protein At2g25430 [Eucalyptus 
grandis]
 ref|XP_010048956.1| PREDICTED: putative clathrin assembly protein At2g25430 [Eucalyptus 
grandis]
 ref|XP_010048957.1| PREDICTED: putative clathrin assembly protein At2g25430 [Eucalyptus 
grandis]
 gb|KCW81386.1| hypothetical protein EUGRSUZ_C02768 [Eucalyptus grandis]
Length=655

 Score =   247 bits (631),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 172/406 (42%), Positives = 229/406 (56%), Gaps = 37/406 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EMK E ++ R+ H  ++LDRFLAC+PTG AK +RL+LVALY VVKESFQ+Y  I E
Sbjct  239   TPLREMKPERIFGRMGHLQRLLDRFLACRPTGLAKNSRLILVALYPVVKESFQLYADICE  298

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  299   VLAVLLDKFFDMEYQDCVKAFDAYASAAKQIDELIAFYNWCKDTGMARSSEYPEVQRITS  358

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +          +     EE+     E E   DMN IKALPPP E++
Sbjct  359   KLLETLEEFVRDRAKRP--------KSPERREELPPVAQEEEPVPDMNEIKALPPP-ENY  409

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                        E  K Q  GDL++L ++  T ++  N+ ALALF G P            
Sbjct  410   TPAPPPEPE-PEPPKPQVTGDLVDLRDEGVTADDQGNKFALALFAGPPANGNGS------  462

Query  609   WEAF------------------NGSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYR  484
             WEAF                   G EDWE ALV+TAS+LS QKA   G  D L+L+GMY 
Sbjct  463   WEAFPSNGGPEVTSAWQNPAAETGKEDWELALVETASNLSKQKAALGGGLDPLLLNGMYD  522

Query  483   QGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSV  304
             QG + Q V S+  L+ GSA+SVA    G+     L  P    D        DPFAASLSV
Sbjct  523   QGMVRQHV-STAQLSGGSASSVALPGLGKSTTPVLALPAP--DGTVQTVNQDPFAASLSV  579

Query  303   APPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSS  166
              PP+YVQM+++E+KQ LL +EQQ+WQQY   GM GQ  L K   +S
Sbjct  580   PPPSYVQMADMEQKQHLLVQEQQVWQQYAVHGMRGQATLAKISGAS  625


 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATRRGTRLLN+SDFRD + S+ WD+SAFVRTY +YLD+++EL + +R+
Sbjct  110   YATRRGTRLLNLSDFRDEAHSSSWDHSAFVRTYGMYLDQRLELILFDRK  158



>ref|XP_009111171.1| PREDICTED: putative clathrin assembly protein At1g03050 isoform 
X2 [Brassica rapa]
Length=527

 Score =   243 bits (621),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 200/464 (43%), Positives = 262/464 (56%), Gaps = 76/464 (16%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FATRRGTRLLNMSDFRD SRSN WDYSAFVRTY+LYLDE+++ RMQ R GK   + S   
Sbjct  112   FATRRGTRLLNMSDFRDVSRSNSWDYSAFVRTYALYLDERLDYRMQTRHGKR-GVYSVGG  170

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
             + VE++ +  E   +TAIVV   PI EMK E          QI  R              
Sbjct  171   DAVEDKKDNPEANLSTAIVVRSQPIAEMKTE----------QIFTRI-------------  207

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
                                  + L  L+DRF+      +                   FY
Sbjct  208   ---------------------QHLQQLLDRFLACRPTGN-------------------FY  227

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
             +W K  GI+R SEYP++E   ++KLD+M+E IR+K  +   +   +   + E ++ E  E
Sbjct  228   SWCKNMGIARSSEYPEIEKITQKKLDLMDEFIRDKSSLEETK-QSNSVEADEEDDDERTE  286

Query  855   peaeaeEDMNTIKALPPPP---EDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEH  685
                E +EDMN IKALP PP   E   EE    E  TEEKKE+++GDL++LG++    E  
Sbjct  287   EVNEEQEDMNAIKALPAPPPKEEKREEEAKEEEVVTEEKKEEEVGDLVDLGDNVVAGEAG  346

Query  684   ANQLALALFDGiptidptkttittPWEAFNG-SEDWETALVQTASHLSNQKAQFPGNFDE  508
              + LALALFDG         +    WEAF+  S DWE ALVQ+A++LS QK +  G FD 
Sbjct  347   GDSLALALFDGPYASGSGSASGPG-WEAFDDDSADWEAALVQSATNLSGQKTELGGGFDM  405

Query  507   LMLDGMYRQGALNQAVASSGVL-TTGSATSVAFGSAGRpamlalpappssADANTTASGA  331
             L+L+GMY+ G +N AV +S     +GSA+S+AFGSAGRPA   L  P  +   N +++G 
Sbjct  406   LLLNGMYQHGTVNAAVQNSTAYGASGSASSMAFGSAGRPAATMLALPAPAT-VNGSSNGP  464

Query  330   ---DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDG  208
                DPFAASL VAPP YVQM+++EKKQR+L EEQ MW QY++ G
Sbjct  465   VTMDPFAASLVVAPPHYVQMNDMEKKQRMLMEEQMMWDQYSRGG  508



>ref|XP_008219684.1| PREDICTED: putative clathrin assembly protein At2g25430 [Prunus 
mume]
Length=629

 Score =   245 bits (625),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 173/413 (42%), Positives = 239/413 (58%), Gaps = 38/413 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ +MK E +++++ H  ++LDRFLA +PTG AK +R+VLVA+Y VV+ESFQ+Y  I E
Sbjct  205   TPLRDMKPEQIFAKMGHLQRLLDRFLATRPTGLAKNSRMVLVAVYPVVRESFQLYGDICE  264

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++ PD  K  + +   AKQ DEL  FY W K +G++R SEYP+V+    
Sbjct  265   VLAVLLDKFFDMEYPDCVKAFDAYASAAKQIDELVGFYAWCKDSGLARSSEYPEVQRIGS  324

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + LD +EE +R++ +          +      E   P P+ E  ++MN IKALP P E++
Sbjct  325   KLLDTLEEFVRDRSKGT--------KSPERRVEPVPPPPQEEEPQNMNEIKALPAP-ENY  375

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                         E K++ + DL++L +D  + +  AN+LALALF G     P   +    
Sbjct  376   TPPPPPEVVDKAEPKQEVVPDLVDLRDDGVSADAQANKLALALFAGPGGSGPANGS----  431

Query  609   WEAF------------------NGSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYR  484
             WEAF                   G  DWE ALV+TAS+LS QK    G  D L+LDGMY 
Sbjct  432   WEAFPSDGQPQVTSAWQTPAAEAGKADWELALVETASNLSRQKQNLGGGLDPLLLDGMYD  491

Query  483   QGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSV  304
             QG + Q V++S  L+ GSA+SVA    G+ A   L  P    D    A   DPFAASL+V
Sbjct  492   QGVVRQHVSTS-QLSGGSASSVALPGPGKSATPVLALPAP--DGTVQAVNQDPFAASLTV  548

Query  303   APPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
              PP+YVQM++LEKKQ LL +EQQ+W QY K+GM GQ  L K    S P  YYG
Sbjct  549   PPPSYVQMADLEKKQHLLVQEQQVWNQYAKEGMQGQGSLAKM---SAP-GYYG  597


 Score = 71.6 bits (174),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATRRGTRLLN+SDFRD + S+ WD+SAFVRTY+LYLD+++EL +  R+
Sbjct  80    YATRRGTRLLNLSDFRDEAHSSSWDHSAFVRTYALYLDQRLELMLFERK  128



>ref|XP_007011846.1| Epsin N-terminal domain-containing protein / clathrin assembly 
protein-related isoform 2 [Theobroma cacao]
 ref|XP_007011847.1| Epsin N-terminal domain-containing protein / clathrin assembly 
protein-related isoform 2 [Theobroma cacao]
 gb|EOY29465.1| Epsin N-terminal domain-containing protein / clathrin assembly 
protein-related isoform 2 [Theobroma cacao]
 gb|EOY29466.1| Epsin N-terminal domain-containing protein / clathrin assembly 
protein-related isoform 2 [Theobroma cacao]
Length=657

 Score =   246 bits (627),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 172/403 (43%), Positives = 232/403 (58%), Gaps = 38/403 (9%)
 Frame = -1

Query  1335  TGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSI  1156
             T TP+ EMK E ++ ++ H  ++LDRFL+C+PTG AK +R++L+ALY VVKESFQ+Y  I
Sbjct  234   TVTPLREMKPERIFGKMGHLQRLLDRFLSCRPTGLAKNSRMILIALYPVVKESFQLYADI  293

Query  1155  AEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENY  976
              E+L +L+DRF  +D PD  K  + +   AKQ DEL  FY W K  G++R SEYP+V+  
Sbjct  294   CEVLAVLLDRFFDMDYPDCVKAFDAYASAAKQIDELIAFYNWCKDTGVARSSEYPEVQRI  353

Query  975   PKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPE  796
               + L+ +EE +         R    R  SPE +E+  P  E E   DMN IKALPPP  
Sbjct  354   TSKLLETLEEFV---------RDRAKRPKSPERKELPPPPKEEEPAPDMNEIKALPPPEN  404

Query  795   DFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttit  616
                            + ++D   L+NL +DA T ++  N+LALALF+G P  +   +   
Sbjct  405   YTPPPPPEPAPVKPPEPQED---LVNLRDDAVTADDQGNKLALALFNGPPANNGNGS---  458

Query  615   tPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGM  490
               WEAF                   G  DWE ALV++AS+LS QKA   G  D L+L+GM
Sbjct  459   --WEAFPSNGQPEVTSAWQTPAAEPGKADWELALVESASNLSRQKAALGGGLDPLLLNGM  516

Query  489   YRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASL  310
             Y QG + Q V S+  L+ GSA+SVA    G+     L  P    D        DPFAASL
Sbjct  517   YDQGMVRQHV-STAQLSGGSASSVALPGPGKSTTPVLALPAP--DGTVQNVNQDPFAASL  573

Query  309   SVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             S+ PP+YVQM+++EKKQ LL +EQQ+WQ+Y +DGM GQ  L K
Sbjct  574   SIPPPSYVQMADMEKKQHLLVQEQQVWQKYARDGMQGQASLAK  616


 Score = 72.0 bits (175),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 44/49 (90%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATRRGTRLLNMSDFRD + S+ WD+SAFVRTY++YLD+++EL + +R+
Sbjct  110   YATRRGTRLLNMSDFRDEAHSSSWDHSAFVRTYAMYLDQRLELMLFDRK  158



>gb|KHG12375.1| hypothetical protein F383_17737 [Gossypium arboreum]
Length=652

 Score =   245 bits (626),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 173/412 (42%), Positives = 230/412 (56%), Gaps = 41/412 (10%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+C+PTG AK  R++L+ALY VVKESFQ+Y  I E
Sbjct  237   TPLREMTPERIFGKMGHLQRLLDRFLSCRPTGLAKNCRMILIALYPVVKESFQLYADICE  296

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++ PD  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  297   VLAVLLDKFFDMEYPDCVKAFDAYASAAKQIDELIAFYNWCKDTGVARSSEYPEVQRITS  356

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +         R    R  SPE +E+  P  E E   DMN IKALP      
Sbjct  357   KLLETLEEFV---------RDRAKRPKSPERKELPPPPKEEEPAPDMNEIKALP---APE  404

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                      P   K  +   DL+NL +D  + ++  N+LALALF+G P  +   +     
Sbjct  405   NYTPPPPPEPEPVKPPEPQEDLVNLRDDTVSADDQGNKLALALFNGPPANNGNGS-----  459

Query  609   WEAFN-----------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQ  481
             WEAF                  G EDWE ALV+TAS+LS QKA   G  D L+L+GMY Q
Sbjct  460   WEAFPSNGPEVTSAWQTPAAEPGKEDWELALVETASNLSRQKAALGGGLDPLLLNGMYDQ  519

Query  480   GALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVA  301
             G + Q V S+  L+ GSA+SVA    G+     L  P    D        DPFAASLSV 
Sbjct  520   GMVRQHV-STAQLSGGSASSVALPGPGKTTTQVLALPAP--DGTVQNVNQDPFAASLSVP  576

Query  300   PPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             PP+YVQM+++EKKQ LL +EQQ+WQQY +DGM GQ  L K         YYG
Sbjct  577   PPSYVQMADMEKKQTLLVQEQQVWQQYARDGMQGQASLAKINNP----GYYG  624


 Score = 71.6 bits (174),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 44/49 (90%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATRRGTRLLNMSDFRD + S+ WD+SAF+RTY++YLD+++EL + +R+
Sbjct  109   YATRRGTRLLNMSDFRDEAHSSSWDHSAFIRTYAMYLDQRLELMLFDRK  157



>ref|XP_002515505.1| clathrin assembly protein, putative [Ricinus communis]
 gb|EEF46954.1| clathrin assembly protein, putative [Ricinus communis]
Length=662

 Score =   246 bits (627),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 176/401 (44%), Positives = 236/401 (59%), Gaps = 34/401 (8%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EMK E ++ ++ H  ++LDRFLAC+PTG AK +R+VL+ALY VVKESFQ+Y  I E
Sbjct  242   TPLREMKVERIFGKMAHLQRLLDRFLACRPTGLAKNSRMVLIALYPVVKESFQLYADICE  301

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++ PD  K  + +   AKQ DEL +FY W K  G+SR SEYPDV+    
Sbjct  302   VLAVLLDKFFDMEYPDCVKAFDAYASAAKQIDELIMFYNWCKDTGVSRSSEYPDVQKITS  361

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R+       R  R + P  +  E      E E   DMN IKALPPP +  
Sbjct  362   KLLETLEEFVRD-------RAKRPKSPERKELEPPPVAQEEEPVPDMNEIKALPPPEDYT  414

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                 A  E   +  + Q  GDL+NL +DA + ++  N+ ALALF G P  +   +     
Sbjct  415   PPPPAEPEP-PKPPQPQVTGDLVNLRDDAVSADDQGNRFALALFAGPPANNGNGS-----  468

Query  609   WEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYR  484
             WEAF                   G  DWE ALV++AS+LS QKA   G  D L+L+GMY 
Sbjct  469   WEAFPSNGDPQVTSAWQTPAAEPGKADWELALVESASNLSKQKAALGGGLDPLLLNGMYD  528

Query  483   QGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSV  304
             QG + Q V S+  L+ GSA+SVA  +AG+ A   L  P    D        DPFAASLS+
Sbjct  529   QGMVRQHV-STAQLSGGSASSVALPAAGKSAAPVLALPAP--DGTVETVNQDPFAASLSI  585

Query  303   APPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
              PP+YVQM+++EKKQ+LL +EQ +WQQY KDGM GQ  L K
Sbjct  586   PPPSYVQMADMEKKQQLLVQEQVVWQQYAKDGMQGQTSLAK  626


 Score = 75.1 bits (183),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGK  1423
             +ATRRGTR+LNMSDFRD + S+ WD+SAFVRTY++YLD+++EL + +R+GK
Sbjct  110   YATRRGTRVLNMSDFRDEAHSSSWDHSAFVRTYAMYLDQRLELILFDRKGK  160



>ref|XP_007011845.1| Epsin N-terminal domain-containing protein / clathrin assembly 
protein-related isoform 1 [Theobroma cacao]
 gb|EOY29464.1| Epsin N-terminal domain-containing protein / clathrin assembly 
protein-related isoform 1 [Theobroma cacao]
Length=673

 Score =   245 bits (626),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 172/403 (43%), Positives = 232/403 (58%), Gaps = 38/403 (9%)
 Frame = -1

Query  1335  TGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSI  1156
             T TP+ EMK E ++ ++ H  ++LDRFL+C+PTG AK +R++L+ALY VVKESFQ+Y  I
Sbjct  234   TVTPLREMKPERIFGKMGHLQRLLDRFLSCRPTGLAKNSRMILIALYPVVKESFQLYADI  293

Query  1155  AEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENY  976
              E+L +L+DRF  +D PD  K  + +   AKQ DEL  FY W K  G++R SEYP+V+  
Sbjct  294   CEVLAVLLDRFFDMDYPDCVKAFDAYASAAKQIDELIAFYNWCKDTGVARSSEYPEVQRI  353

Query  975   PKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPE  796
               + L+ +EE +         R    R  SPE +E+  P  E E   DMN IKALPPP  
Sbjct  354   TSKLLETLEEFV---------RDRAKRPKSPERKELPPPPKEEEPAPDMNEIKALPPPEN  404

Query  795   DFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttit  616
                            + ++D   L+NL +DA T ++  N+LALALF+G P  +   +   
Sbjct  405   YTPPPPPEPAPVKPPEPQED---LVNLRDDAVTADDQGNKLALALFNGPPANNGNGS---  458

Query  615   tPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGM  490
               WEAF                   G  DWE ALV++AS+LS QKA   G  D L+L+GM
Sbjct  459   --WEAFPSNGQPEVTSAWQTPAAEPGKADWELALVESASNLSRQKAALGGGLDPLLLNGM  516

Query  489   YRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASL  310
             Y QG + Q V S+  L+ GSA+SVA    G+     L  P    D        DPFAASL
Sbjct  517   YDQGMVRQHV-STAQLSGGSASSVALPGPGKSTTPVLALPAP--DGTVQNVNQDPFAASL  573

Query  309   SVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             S+ PP+YVQM+++EKKQ LL +EQQ+WQ+Y +DGM GQ  L K
Sbjct  574   SIPPPSYVQMADMEKKQHLLVQEQQVWQKYARDGMQGQASLAK  616


 Score = 72.0 bits (175),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 44/49 (90%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATRRGTRLLNMSDFRD + S+ WD+SAFVRTY++YLD+++EL + +R+
Sbjct  110   YATRRGTRLLNMSDFRDEAHSSSWDHSAFVRTYAMYLDQRLELMLFDRK  158



>emb|CDX76977.1| BnaC04g37720D [Brassica napus]
Length=522

 Score =   242 bits (617),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 192/509 (38%), Positives = 261/509 (51%), Gaps = 67/509 (13%)
 Frame = -1

Query  1548  LLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRM-----------------------  1441
             +LNMS FRD + S+ WD+SAFVRTY+ YLD+ +EL +                       
Sbjct  1     MLNMSHFRDEAHSSSWDHSAFVRTYACYLDQMLELALFERKSGSKERLLESSAKITTSEF  60

Query  1440  --QNRRGKHSALASgneegveeedeeeetgntTAIV--------VTGTPITEMKNEYLYS  1291
                N RG+    +        E      T +   +            TP+ EM  E L+ 
Sbjct  61    NHSNGRGRDDFRSPPQRSYDYENGVSRRTRSYGDVTEMRRRDEKKVATPLPEMPPERLFG  120

Query  1290  RIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLD  1111
             ++ H  ++LDRFL  +PTG AK +R+VL+ LY +V+ESF++Y  I E+L +L+D+F  ++
Sbjct  121   KMGHLQRLLDRFLNLRPTGLAKNSRMVLIVLYPIVRESFRLYADICEVLAVLLDKFFDME  180

Query  1110  IPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirek  931
               D  K  + +   AKQ DEL  FY W K  G+ R SEYP+V+    + L+ +EE +R++
Sbjct  181   YTDCVKAFDAYASAAKQIDELIAFYDWCKETGVGRSSEYPEVQRITSKLLETLEEFVRDR  240

Query  930   meMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEE  751
              +    R         E         E EAE DMN IKALPPP           E    +
Sbjct  241   AK----RGKSPERKEIEAPPPPPVAEEEEAEPDMNEIKALPPPENYTPPPQPEPEPEKPQ  296

Query  750   KKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN--------  595
               E    DL+NL ED  T ++  N+ ALALF G P  +         WEAF         
Sbjct  297   YTE----DLVNLREDGVTGDDQGNKFALALFAGPPGSNGK-------WEAFPSDGVTSAW  345

Query  594   -------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTT  436
                    G  DWE ALV+TAS+L  Q A   G FD L+L+GMY QGA+ Q V++S  LT 
Sbjct  346   QNPAAEPGKADWELALVETASNLEKQTAALGGGFDSLLLNGMYDQGAVRQHVSTS-QLTG  404

Query  435   GSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQR  256
             GSA+SVA    G+     L  P    D        DPFAASL++ PP+YVQM+E+EKKQ 
Sbjct  405   GSASSVALPLPGKTNTQVLALPAP--DGTVEKVNQDPFAASLTIPPPSYVQMAEMEKKQY  462

Query  255   LLWEEQQMWQQYTKDGMHGQVGLEKAQQS  169
             LL +EQQ+WQQY ++GM GQ  L K   +
Sbjct  463   LLSQEQQLWQQYQREGMRGQASLAKMNNT  491



>emb|CBI20038.3| unnamed protein product [Vitis vinifera]
Length=495

 Score =   241 bits (614),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 152/207 (73%), Gaps = 12/207 (6%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD--SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgn  1399
             F+TRRGTR+LNMSDFRD  S+SN WDYSAFVRTY+LYLDE++E RMQ +RGK SA     
Sbjct  111   FSTRRGTRILNMSDFRDHSSQSNSWDYSAFVRTYALYLDERLEFRMQGKRGKRSAFEYEE  170

Query  1398  eegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRN  1219
             +E       +             TP+ +MK   ++SRI H  Q+L+RFLAC+PTG AK N
Sbjct  171   DEEEGGAAAQ----------ARNTPVCDMKTVDIFSRINHLQQLLERFLACRPTGEAKSN  220

Query  1218  RLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVF  1039
             R+VLVALY +VKESFQ+YY I E++GIL++RFM+L++ D  KVHEIF+RV KQ+DEL+ F
Sbjct  221   RVVLVALYPIVKESFQIYYDITEIMGILIERFMELEVQDCVKVHEIFYRVLKQFDELDSF  280

Query  1038  YTWSKAAGISRLSEYPDVENYPKQKLD  958
             YTW ++ GI+R SEYP+VE    +KLD
Sbjct  281   YTWCRSTGIARSSEYPEVEKIALKKLD  307



>ref|XP_009759128.1| PREDICTED: putative clathrin assembly protein At2g25430 [Nicotiana 
sylvestris]
 ref|XP_009759135.1| PREDICTED: putative clathrin assembly protein At2g25430 [Nicotiana 
sylvestris]
Length=638

 Score =   244 bits (622),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 173/413 (42%), Positives = 230/413 (56%), Gaps = 43/413 (10%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+C+PTG AK  R+VLVALY +VKESFQ+Y  I E
Sbjct  222   TPLREMNPEKIFGKMTHLQRLLDRFLSCRPTGLAKNERMVLVALYPMVKESFQLYADICE  281

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  F+ W K  G++R SEYP+V+    
Sbjct  282   VLAVLLDKFFDMEYQDCVKAFDAYSSAAKQIDELVGFFNWCKDIGVARSSEYPEVQRITS  341

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + LD +EE +         R       SPE +    P P  E   DMN IKALP    + 
Sbjct  342   KLLDTLEEFV---------RDRAKATKSPERKVEALPAPPEEPAPDMNEIKALPA--PEE  390

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E    +   Q+ GDL++L E+  T ++  N+ ALALF G  T + +       
Sbjct  391   YTPPPPPEPEPPKPVVQETGDLVDLREEGVTADDQGNKFALALFAGPGTNNGS-------  443

Query  609   WEAFNGS------------------EDWETALVQTASHLSNQKAQFPGNFDELMLDGMYR  484
             WEAF G+                   DWE ALV+TASHLSNQKA   G  D L+L+GMY 
Sbjct  444   WEAFPGNGETQVTSAWQNPAAEIGKADWELALVETASHLSNQKAALGGGLDPLLLNGMYD  503

Query  483   QGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSV  304
             QG + Q V S+  L+ GSA+SVA    G+ A   L  P    D      G DPFAASL+V
Sbjct  504   QGMVRQHV-STAQLSGGSASSVALPGPGKSATPVLALPAP--DGTVQTVGQDPFAASLTV  560

Query  303   APPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
              PP+YVQM++LEKKQ+LL +EQ +WQQY +DGM GQ  L K         YYG
Sbjct  561   PPPSYVQMADLEKKQQLLVQEQVVWQQYARDGMQGQTSLSKINTG----GYYG  609


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATRRGTRLLN+SDFRD + SN WD+SAFVRTY+LYLD+++EL +  R+
Sbjct  110   YATRRGTRLLNLSDFRDEAHSNSWDHSAFVRTYALYLDQRLELMVFERK  158



>ref|XP_010525951.1| PREDICTED: putative clathrin assembly protein At2g25430 [Tarenaya 
hassleriana]
 ref|XP_010525952.1| PREDICTED: putative clathrin assembly protein At2g25430 [Tarenaya 
hassleriana]
Length=648

 Score =   244 bits (622),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 160/411 (39%), Positives = 221/411 (54%), Gaps = 38/411 (9%)
 Frame = -1

Query  1338  VTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYS  1159
              + TP+ EM  E ++ ++ H  ++LDRFL+C+PTG AK +R++L+ALY VV+ESF++Y  
Sbjct  232   TSATPLREMTPERIFGKMGHLQRLLDRFLSCRPTGLAKNSRMILIALYPVVRESFKLYAD  291

Query  1158  IAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVEN  979
             I E+L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+ 
Sbjct  292   ICEVLAVLLDKFFDMEYMDCVKAFDAYASAAKQIDELISFYYWCKDTGVARSSEYPEVQR  351

Query  978   YPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPP  799
                + L+ +EE +R++ +              E+E       E E   DMN IKAL    
Sbjct  352   ITSKLLETLEEFVRDRAKRP------KSPERKEIEAPPPVPQEEEPVPDMNEIKAL----  401

Query  798   EDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptktti  619
                       E     +K Q   DL+NL +D  + ++  N+ ALALF G P  +      
Sbjct  402   PPPESHTPPPEPEPVPQKPQVTDDLVNLRDDDVSADDQGNKFALALFAGPPGSNGK----  457

Query  618   ttPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDG  493
                WE FN                  G  DWE ALV+TAS+L  QKA   G FD L+L+G
Sbjct  458   ---WEGFNSNGDNGVTSAWQNPAAEPGKADWELALVETASNLEKQKAALGGGFDPLLLNG  514

Query  492   MYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAAS  313
             MY QG + Q  +++  LT GSA+SVA    G+     L  P    D        DPFAAS
Sbjct  515   MYDQGMVRQHTSTT-QLTGGSASSVALPLPGKTNSQVLALPAP--DGTVQKVNEDPFAAS  571

Query  312   LSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQP  160
             L+V PP+YVQM+E+EKKQ LL +EQQ+W QY  DGM GQ  L K      P
Sbjct  572   LTVPPPSYVQMAEMEKKQNLLVQEQQLWHQYQHDGMRGQASLAKISTGPVP  622


 Score = 65.5 bits (158),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             + TRRGTR+LN+SDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R+
Sbjct  109   YTTRRGTRMLNLSDFRDEAHSSSWDHSAFVRTYASYLDQRLELVLFERK  157



>ref|XP_007225127.1| hypothetical protein PRUPE_ppa002600mg [Prunus persica]
 gb|EMJ26326.1| hypothetical protein PRUPE_ppa002600mg [Prunus persica]
Length=653

 Score =   243 bits (621),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 173/413 (42%), Positives = 238/413 (58%), Gaps = 38/413 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ +MK E +++++ H  ++LDRFLA +PTG AK +R+VLVA+Y VV+ESFQ+Y  I E
Sbjct  236   TPLRDMKPEQIFAKMGHLQRLLDRFLATRPTGLAKISRMVLVAVYPVVRESFQLYGDICE  295

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++ PD  K  + +   AKQ DEL  FY W K +G++R SEYP+V+    
Sbjct  296   VLAVLLDKFFDMEYPDCVKALDAYASAAKQIDELVGFYAWCKDSGLARSSEYPEVQRIGT  355

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + LD +EE +R++ +          +      E   P P+ E  ++MN IKALP P E++
Sbjct  356   KLLDTLEEFVRDRSKGT--------KSPERKVEPVPPPPQEEEPQNMNEIKALPAP-ENY  406

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                         E K++ + DL++L +D  + +   N+LALALF G     P   +    
Sbjct  407   TPPPPPEVVVKAEPKQEVVPDLVDLRDDGVSADAQGNKLALALFAGPGGSGPANGS----  462

Query  609   WEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYR  484
             WEAF                   G  DWE ALV+TAS+LS QK    G  D L+LDGMY 
Sbjct  463   WEAFPSDGQPQVTSAWQTPAAEPGKADWELALVETASNLSRQKQNLGGGLDPLLLDGMYD  522

Query  483   QGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSV  304
             QG + Q V++S  LT GSA+SVA    G+ A   L  P    D    A   DPFAASL+V
Sbjct  523   QGVVRQHVSTS-QLTGGSASSVALPGPGKSATPVLALPAP--DGTVQAVNQDPFAASLTV  579

Query  303   APPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
              PP+YVQM++LEKKQ LL +EQQ+W QY K+GM GQ  L K    S P  YYG
Sbjct  580   PPPSYVQMADLEKKQHLLVQEQQVWNQYAKEGMQGQGSLAKM---SAP-GYYG  628


 Score = 71.2 bits (173),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATRRGTRLLN+SDFRD + S+ WD+SAFVRTY+LYLD+++EL +  R+
Sbjct  110   YATRRGTRLLNLSDFRDEAHSSSWDHSAFVRTYALYLDQRLELMLFERK  158



>ref|XP_010696359.1| PREDICTED: probable clathrin assembly protein At4g32285 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010696368.1| PREDICTED: probable clathrin assembly protein At4g32285 [Beta 
vulgaris subsp. vulgaris]
Length=644

 Score =   243 bits (620),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 155/399 (39%), Positives = 219/399 (55%), Gaps = 38/399 (10%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ +   E +++++ H  ++LDRFLAC+PTG AK +R++LVALY VV+ESF++Y  I E
Sbjct  225   TPLRDWTPERIFAKMGHLQRLLDRFLACRPTGMAKNSRMILVALYPVVRESFKLYADICE  284

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SE+P+V+    
Sbjct  285   VLAVLLDKFFDMENSDCVKAFDAYASAAKQIDELVAFYNWCKDTGVARSSEFPEVQKITD  344

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++            +   +  E E    E E   DMN IKAL       
Sbjct  345   KLLETLEEFVRDRTRRP--------KSPEKKPEPEPAPKEEEPVPDMNEIKAL----PAP  392

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
              E         E + +Q  GDLL+L E+  T +   N+ ALALF G              
Sbjct  393   EEPTPPPPPAPEPEPKQVTGDLLDLREEGETADSQGNKFALALFAGPAENGNGS------  446

Query  609   WEAFN----------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQG  478
             W+AF+                G  DWE ALV+TAS+L+ Q+    G  D L+L+GMY  G
Sbjct  447   WQAFDSKEGITSAWQNPAAEQGKADWELALVETASNLTKQQTAMGGGLDPLLLNGMYDSG  506

Query  477   ALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAP  298
              + Q V ++ V  +GSA+SVA    G+     L  P    D      G DPFAASL++AP
Sbjct  507   VVRQHVTATHV--SGSASSVALPGPGKTTTPVLALPAP--DGTVQTVGGDPFAASLTIAP  562

Query  297   PAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             PAYVQM+++EKKQ LL +EQ +WQQY   GMHGQ  L K
Sbjct  563   PAYVQMADMEKKQHLLVQEQVVWQQYANSGMHGQATLNK  601


 Score = 72.4 bits (176),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATRRGTRLLNMSDFRD + SN WD+SAFVRT++LYLD+++EL +  R+
Sbjct  107   YATRRGTRLLNMSDFRDEAHSNSWDHSAFVRTFALYLDQRLELMLFERK  155



>ref|XP_004960513.1| PREDICTED: probable clathrin assembly protein At4g32285-like 
[Setaria italica]
Length=614

 Score =   242 bits (617),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 173/481 (36%), Positives = 242/481 (50%), Gaps = 39/481 (8%)
 Frame = -1

Query  1563  RRGTRLLNMS-DFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgneeg  1390
             R G  +L++  DFRD + +  W++SAFVR Y+LYLDE++   +       +   + +   
Sbjct  112   RAGEPVLSLLLDFRDEAHAASWEHSAFVRAYALYLDERLRFLVSLLPPPRAVRFADDYNN  171

Query  1389  veeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLV  1210
                           A V       +M  + L  R +   Q+LDRFLAC+P GAA+ +R+V
Sbjct  172   AVSGASSPPAPAAMAPV------GDMDPDGLLIRARQLRQLLDRFLACRPAGAARTSRVV  225

Query  1209  LVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTW  1030
             L ALY ++ +SFQ+Y   + +L  L+DRF  ++  +  K  E +   AKQ + L  FY W
Sbjct  226   LAALYPLLGDSFQLYDEFSAVLAALLDRFFDMEYAECVKAFETYVGAAKQIETLLAFYAW  285

Query  1029  SKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepe  850
                AG++R S++PDV+    +KL    E        AG        P    +     + E
Sbjct  286   CDDAGVARSSDFPDVKRV-DEKLLETLEQFLRVRGRAGLGSPPPLPPQSVHQSAGRDQDE  344

Query  849   aeaeEDMNTIKALPPPP--EDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQ  676
                  DMN +KALP PP   D  E    V A +   + +   DL++L E A T +E  N+
Sbjct  345   PAEYVDMNGVKALPAPPPVRDSAETTRSVPAKSSADQARQP-DLVDLREPAATADEQENK  403

Query  675   LALALFDGiptidptkttittPWEAF---------------------NGSEDWETALVQT  559
             L LALF       P      + W AF                      G  DWE ALV+T
Sbjct  404   LTLALFSA---PPPATKGADSSWVAFPSESDDAPVAITSAWQTPAAEPGKADWELALVET  460

Query  558   ASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlal  379
             AS+LS Q A   G  D L+L GMY QGA+ + VA+  V  +GSA+SVA  + G     A 
Sbjct  461   ASNLSRQTASLGGGMDPLLLGGMYDQGAVRRQVAAQAV--SGSASSVALPTHGH-GAAAP  517

Query  378   pappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHG  199
                  + D    A G DPFAASL+V PP+YVQM+E+E+KQ+LL +EQQMW QY + GM G
Sbjct  518   VLMLPAPDGTVQAIGGDPFAASLAVPPPSYVQMAEMERKQQLLVQEQQMWAQYRQGGMQG  577

Query  198   Q  196
             Q
Sbjct  578   Q  578



>ref|XP_007137013.1| hypothetical protein PHAVU_009G092600g [Phaseolus vulgaris]
 gb|ESW09007.1| hypothetical protein PHAVU_009G092600g [Phaseolus vulgaris]
Length=651

 Score =   242 bits (618),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 168/405 (41%), Positives = 230/405 (57%), Gaps = 36/405 (9%)
 Frame = -1

Query  1341  VVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYY  1162
             VV+ TP+ +M  E ++ ++ H  ++LDRFLAC+PTG AK +R+VL+ALY VVKESFQ+Y 
Sbjct  229   VVSVTPLRDMTPERVFGKMGHLQRLLDRFLACRPTGLAKNSRMVLIALYPVVKESFQLYA  288

Query  1161  SIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVE  982
              I E+L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+
Sbjct  289   DICEVLAVLLDKFFDMEYADCVKAFDAYASAAKQIDELVTFYNWCKNTGVARSSEYPEVQ  348

Query  981   NYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPP  802
                 + L+ +EE +R+       R  R + P  + E     + E E   DMN IKALP  
Sbjct  349   RITSKLLETLEEFVRD-------RAKRPKSPERKEEAPPVEKVEEEPAPDMNEIKALP--  399

Query  801   PEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptktt  622
                          P  + + Q   DL+NL +DA T ++  N+ ALALF G P  +   + 
Sbjct  400   -PPENYTPPPPPEPEPKPQPQVTEDLVNLRDDAVTADDQGNKFALALFAGAPANNANGS-  457

Query  621   ittPWEAF------------------NGSEDWETALVQTASHLSNQKAQFPGNFDELMLD  496
                 WEAF                   G  DWE ALV+TAS+LS QKA   G  D L+L 
Sbjct  458   ----WEAFPSNGQPEVTSAWQTPAAEQGKADWELALVETASNLSKQKAALGGGLDPLLLT  513

Query  495   GMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAA  316
             GMY QG + Q V+++  L+ GSA+SVA   AG+     L  P    D +      DPFAA
Sbjct  514   GMYDQGMVRQHVSTTQ-LSGGSASSVALPGAGKTTTPVLALPAP--DGSVQPVNQDPFAA  570

Query  315   SLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             SLS+ PP+YVQM+++EKKQ LL +EQQ+W QY +DGM GQ  L K
Sbjct  571   SLSIPPPSYVQMADMEKKQHLLVQEQQVWHQYARDGMQGQTSLTK  615


 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 44/49 (90%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATRRGTRLLN+SDFRD + S+ WD+SAFVRTY++YLD+++EL + +R+
Sbjct  110   YATRRGTRLLNLSDFRDEAHSSSWDHSAFVRTYAMYLDQRLELMLFDRK  158



>ref|XP_010048010.1| PREDICTED: putative clathrin assembly protein At2g25430 [Eucalyptus 
grandis]
 gb|KCW80114.1| hypothetical protein EUGRSUZ_C01441 [Eucalyptus grandis]
Length=598

 Score =   238 bits (607),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 179/499 (36%), Positives = 261/499 (52%), Gaps = 55/499 (11%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgne  1396
             FA+RRG RLLNMS FRD + SN  D+S FVR Y++YL+E+VE  +  +R     + +  +
Sbjct  110   FASRRGMRLLNMSHFRDEAHSNSGDHSGFVRFYAMYLEEKVEFSVFEKRQDGGDVGAEGK  169

Query  1395  egveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNR  1216
                  E + E   +     +    I EM+ E + +R+ H ++ILDR LAC+P GAAK +R
Sbjct  170   YEEGHEFDTERRLSPAKKEIKS--IKEMRPERVSARLYHQLRILDRVLACRPAGAAKTSR  227

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             LVL+ALY V+KESF +Y  I+E L +L +RF +++  +  K    +   AK  DEL   Y
Sbjct  228   LVLMALYLVLKESFGLYGEISEALEVLQERFAQMEYGECLKAFNTYVGAAKLIDELVGHY  287

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
              W + AGI+R+SE+P+V+    + L  +E  ++E  +           P        +P 
Sbjct  288   NWCRDAGIARMSEFPEVQRVTDEILGTLEGQLKETKQNGPNE----NSPERIGGTNIDPL  343

Query  855   peaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQ  676
              E  +E +MN I+ALP P E+ +    +VE P  E + Q + +L++L +D  + +E  ++
Sbjct  344   VEERSEPNMNEIRALPAP-ENHMGVAPLVE-PQPEPQPQHVAELIDLRDDGVSADEQGDK  401

Query  675   LALALFDGiptidptkttittPWEAF--NG----------------SEDWETALVQTASH  550
             LA+ALF G P      +     WEAF  NG                  DWE  LV+TAS+
Sbjct  402   LAVALFVGAPDATANGS-----WEAFAWNGQPEANSAWDTPAADDTKADWELLLVETASN  456

Query  549   LSNQKAQFPGNFDELMLDGMYRQGALNQAVA---SSGVLTTGSATSVAFGSAGRpamlal  379
             L+ QKA   G FD L+ +GMY QGA+ Q ++   SSG  T+  AT V  G A        
Sbjct  457   LAKQKADMAGGFDPLLWNGMYDQGAVRQHMSGDQSSGGSTSSMATQVTPGKA-----ENR  511

Query  378   pappssADANTTASGA-DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMH  202
                  + D      G  D F+ SL    P YVQM+++E+KQ LL +EQQ+WQ +      
Sbjct  512   VLALPAPDGTVQPMGPQDLFSVSLPQPLPPYVQMADVERKQHLLVQEQQVWQGH------  565

Query  201   GQVGLEKAQQSSQPHNYYG  145
                     Q  S P  YYG
Sbjct  566   --------QMGSGPSGYYG  576



>ref|XP_004172314.1| PREDICTED: putative clathrin assembly protein At2g25430-like 
[Cucumis sativus]
Length=653

 Score =   237 bits (604),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 172/412 (42%), Positives = 225/412 (55%), Gaps = 38/412 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+C+PTG AK +R++L ALY +V+ESFQ+Y  I E
Sbjct  234   TPLREMTIERVFGKMGHLQRLLDRFLSCRPTGLAKNSRMILYALYPLVRESFQLYADICE  293

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  294   VLAVLLDKFFDMEYSDCMKAFDAYGSAAKQIDELIAFYNWCKETGVARSSEYPEVQRITS  353

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +         R    R  SPE E       E E   DMN IKALPPP    
Sbjct  354   KLLETLEEFL---------RERGKRPKSPEREPPPPAPEEEEPAPDMNEIKALPPPENYT  404

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                      P  + + Q   DL+NL +DA + ++  N+LALALF G        +     
Sbjct  405   PPPPEPEPQPAPKPQPQVTDDLVNLRDDAVSADDQGNKLALALFAGPAANGANGS-----  459

Query  609   WEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYR  484
             WEAF                   G  DWE ALV+TAS+LS QKA   G  D L+L+GMY 
Sbjct  460   WEAFPSDGQPEVTSAWQTPAAEPGKADWELALVETASNLSRQKAALGGGLDPLLLNGMYD  519

Query  483   QGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSV  304
             QG + Q   S+  L+ GSA+SVA    G      L  P    D    A   DPFAASLSV
Sbjct  520   QGMVRQHT-STAQLSGGSASSVALPGPGNSKTPVLALPAP--DGTVQAVNQDPFAASLSV  576

Query  303   APPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYY  148
              PP+YVQM E+EKKQ LL +EQQ+WQQY +DGM GQ  L K    S P  YY
Sbjct  577   PPPSYVQMVEMEKKQHLLMQEQQLWQQYARDGMQGQSSLTKI---SNPPGYY  625


 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRG  1426
             +ATRRGTRLLNMSDF+D + S+ WD+SAFVRTY+ YLD+++EL +  ++G
Sbjct  110   YATRRGTRLLNMSDFKDEAHSSSWDHSAFVRTYAFYLDQRLELMLFEKKG  159



>ref|XP_004136352.1| PREDICTED: putative clathrin assembly protein At2g25430-like 
[Cucumis sativus]
 gb|KGN60096.1| hypothetical protein Csa_3G877670 [Cucumis sativus]
Length=653

 Score =   237 bits (604),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 172/412 (42%), Positives = 225/412 (55%), Gaps = 38/412 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+C+PTG AK +R++L ALY +V+ESFQ+Y  I E
Sbjct  234   TPLREMTIERVFGKMGHLQRLLDRFLSCRPTGLAKNSRMILYALYPLVRESFQLYADICE  293

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  294   VLAVLLDKFFDMEYSDCMKAFDAYGSAAKQIDELIAFYNWCKETGVARSSEYPEVQRITS  353

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +         R    R  SPE E       E E   DMN IKALPPP    
Sbjct  354   KLLETLEEFL---------RERGKRPKSPEREPPPPAPEEEEPAPDMNEIKALPPPENYT  404

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                      P  + + Q   DL+NL +DA + ++  N+LALALF G        +     
Sbjct  405   PPPPEPEPQPAPKPQPQVTDDLVNLRDDAVSADDQGNKLALALFAGPAANGANGS-----  459

Query  609   WEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYR  484
             WEAF                   G  DWE ALV+TAS+LS QKA   G  D L+L+GMY 
Sbjct  460   WEAFPSDGQPEVTSAWQTPAAEPGKADWELALVETASNLSRQKAALGGGLDPLLLNGMYD  519

Query  483   QGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSV  304
             QG + Q   S+  L+ GSA+SVA    G      L  P    D    A   DPFAASLSV
Sbjct  520   QGMVRQHT-STAQLSGGSASSVALPGPGNSKTPVLALPAP--DGTVQAVNQDPFAASLSV  576

Query  303   APPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYY  148
              PP+YVQM E+EKKQ LL +EQQ+WQQY +DGM GQ  L K    S P  YY
Sbjct  577   PPPSYVQMVEMEKKQHLLMQEQQLWQQYARDGMQGQSSLTKI---SNPPGYY  625


 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRG  1426
             +ATRRGTRLLNMSDF+D + S+ WD+SAFVRTY+ YLD+++EL +  ++G
Sbjct  110   YATRRGTRLLNMSDFKDEAHSSSWDHSAFVRTYAFYLDQRLELMLFEKKG  159



>ref|XP_008466416.1| PREDICTED: putative clathrin assembly protein At2g25430 [Cucumis 
melo]
Length=653

 Score =   236 bits (603),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 172/412 (42%), Positives = 225/412 (55%), Gaps = 38/412 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+C+PTG AK +R++L ALY +V+ESFQ+Y  I E
Sbjct  234   TPLREMTIERVFGKMGHLQRLLDRFLSCRPTGLAKNSRMILYALYPLVRESFQLYADICE  293

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  294   VLAVLLDKFFDMEYSDCMKAFDAYGSAAKQIDELIAFYNWCKDTGVARSSEYPEVQRITS  353

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +         R    R  SPE E       E E   DMN IKALPPP    
Sbjct  354   KLLETLEEFL---------RERGKRPKSPEREPPPPAPEEEEPAPDMNEIKALPPPENYT  404

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                      P  + + Q   DL+NL +DA + ++  N+LALALF G        +     
Sbjct  405   PPPPEPEPQPAPKPQPQVTDDLVNLRDDAVSADDQGNKLALALFAGPAANGANGS-----  459

Query  609   WEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYR  484
             WEAF                   G  DWE ALV+TAS+LS QKA   G  D L+L+GMY 
Sbjct  460   WEAFPSDGQPEVTSAWQTPAAEPGKADWELALVETASNLSRQKAALGGGLDPLLLNGMYD  519

Query  483   QGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSV  304
             QG + Q   S+  L+ GSA+SVA    G      L  P    D    A   DPFAASLSV
Sbjct  520   QGMVRQHT-STAQLSGGSASSVALPGPGNSKTPVLALPAP--DGTVQAVNQDPFAASLSV  576

Query  303   APPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYY  148
              PP+YVQM E+EKKQ LL +EQQ+WQQY +DGM GQ  L K    S P  YY
Sbjct  577   PPPSYVQMVEMEKKQHLLMQEQQLWQQYARDGMQGQSSLNKI---SNPPGYY  625


 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRG  1426
             +ATRRGTRLLNMSDF+D + S+ WD+SAFVRTY+ YLD+++EL +  ++G
Sbjct  110   YATRRGTRLLNMSDFKDEAHSSSWDHSAFVRTYAFYLDQRLELMLFEKKG  159



>gb|KHG13020.1| hypothetical protein F383_20305 [Gossypium arboreum]
Length=651

 Score =   233 bits (595),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 176/415 (42%), Positives = 237/415 (57%), Gaps = 43/415 (10%)
 Frame = -1

Query  1335  TGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSI  1156
             T TP+ EMK E ++ ++ H  ++LDRFL+C+PTG AK +R++L+ALY VVKESFQ+Y  I
Sbjct  234   TVTPLREMKPERIFGKMGHLQRLLDRFLSCRPTGLAKNSRMILIALYPVVKESFQLYADI  293

Query  1155  AEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENY  976
              E+L +L+DRF  ++ PD  K  + +   AKQ DEL  FY W    G++R SEYP+V+  
Sbjct  294   CEVLAVLLDRFFDMEYPDCVKAFDAYASAAKQIDELIAFYNWCNDIGVARSSEYPEVQRI  353

Query  975   PKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPE  796
               + L+ +EE +         R    +  SPE +E+  P  E E E +MN IKALP P  
Sbjct  354   TDKLLETLEEFV---------RDRAKKPTSPERKELPPPPKEEEPEPNMNEIKALPAPEN  404

Query  795   DFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttit  616
                        P +  + Q+  DL+NL +D  T ++  N+ ALALF G    +   +   
Sbjct  405   YAPPPPPSEPEPVKPAEPQE--DLVNLRDDVVTADDQGNKFALALFSGPAANNGNGS---  459

Query  615   tPWEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGM  490
               WEAF                   G  DWE ALV++AS+LS QKA   G  D L+L+GM
Sbjct  460   --WEAFPSNGQPEVTSAWQTPAAEPGKADWELALVESASNLSRQKAALGGGLDPLLLNGM  517

Query  489   YRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASL  310
             Y QG + Q V SSG L+ GSA+SVA    G+  +LALP P    D        DPFAASL
Sbjct  518   YDQGMVRQHV-SSGQLSGGSASSVALPRLGKTLVLALPVP----DGTIQNVNQDPFAASL  572

Query  309   SVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             S+ P +YVQM+++EKKQ LL +EQQ+WQQY+KDGM GQ  L K         YYG
Sbjct  573   SIPPHSYVQMADMEKKQHLLVQEQQVWQQYSKDGMQGQSSLAKINNP----GYYG  623


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 44/49 (90%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATR+GTRLLNMSDFRD + S+ WD+SAFVRTY++YLD+++EL + +R+
Sbjct  110   YATRKGTRLLNMSDFRDEAHSSSWDHSAFVRTYAMYLDQRLELMLFDRK  158



>gb|EMT27768.1| Putative clathrin assembly protein [Aegilops tauschii]
Length=481

 Score =   228 bits (580),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 168/409 (41%), Positives = 222/409 (54%), Gaps = 47/409 (11%)
 Frame = -1

Query  1293  SRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKL  1114
             SR + Y+  L   +       AK++R+VLVALYQ+ +ESFQ+Y  I E+L +L+DRF  +
Sbjct  78    SRTRDYVVALKSLMLVH--RGAKQSRMVLVALYQMARESFQLYADICEVLAVLLDRFFDM  135

Query  1113  DIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiire  934
             +  D  K  E +   AKQ DEL  FY W K  G++R SEYP+V+    + L+ +EE +  
Sbjct  136   EYADCVKAFEAYASAAKQIDELCSFYAWCKDTGVARSSEYPEVQRVTDKLLETLEEFM--  193

Query  933   kmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF--IEEMAVVEAP  760
                    R    R  SP  E   EP  E E E DMN+IKALP P ED+   E   V E  
Sbjct  194   -------RDRAKRPKSPPREPEPEPVKEEEPEPDMNSIKALPAP-EDYKEPEPEKVEEEV  245

Query  759   TEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN-----  595
               E   Q  GDL++L ED  + +E  N+LALALF G P    +  +    WEAF      
Sbjct  246   KPEPPPQPQGDLVDLREDTVSADEQGNRLALALFQGPPAAGGSNGS----WEAFPSNGGN  301

Query  594   -------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVAS  454
                          G  DWE ALV+TAS+LS QKA   G  D L+L+GMY QG + Q V +
Sbjct  302   EVTSAWQNPAAEPGKADWELALVETASNLSKQKAVMTGGMDNLLLNGMYDQGVVRQHVNA  361

Query  453   SGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSE  274
                 T+GS++SVA  + G+   +     P   D +    G DPFAASL+ APP+YVQM+E
Sbjct  362   QA--TSGSSSSVALPAPGQKTQMLALPAP---DGSMQNVGGDPFAASLTFAPPSYVQMAE  416

Query  273   LEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQS------SQPHNYYG  145
             +EKKQ+ L +EQ MWQQY +DGM G   L K  ++      S P   YG
Sbjct  417   MEKKQQFLTQEQMMWQQYQRDGMQGPSSLAKLDRTYNNGFGSNPAMPYG  465



>ref|XP_006405206.1| hypothetical protein EUTSA_v10000078mg [Eutrema salsugineum]
 gb|ESQ46659.1| hypothetical protein EUTSA_v10000078mg [Eutrema salsugineum]
Length=647

 Score =   231 bits (588),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 163/406 (40%), Positives = 224/406 (55%), Gaps = 33/406 (8%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+ +PTG AK +R++L+ALY VV+ESF++Y  I E
Sbjct  239   TPLREMTPERIFGKMGHLQRLLDRFLSLRPTGLAKNSRMILIALYPVVRESFKLYADICE  298

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  299   VLAVLLDKFFDMEYTDCVKAFDAYASAAKQIDELIAFYNWCKETGVARSSEYPEVQRITS  358

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +    R         E      P  E E E DMN IKAL       
Sbjct  359   KLLETLEEFVRDRAK----RSKSPERKEIEAPPPPPPAQEEEPEPDMNEIKAL----PPP  410

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                        E  K+Q   DL+NL ED  T ++  N+ ALALF G P  +         
Sbjct  411   ENYTPPPPPEPEPPKQQVTDDLVNLREDEVTGDDQGNKFALALFAGPPGSNGK-------  463

Query  609   WEAFN---------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGA  475
             WEAF+               G  DWE ALV+TAS+L  Q A   G FD L+L+GMY QG 
Sbjct  464   WEAFSSNGVTSAWQNPAAEPGKADWELALVETASNLEKQTAALGGGFDSLLLNGMYDQGM  523

Query  474   LNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPP  295
             + Q V++S  LT GSA+SVA    G+     L  P    D        DPFAASL++ PP
Sbjct  524   VRQHVSTS-QLTGGSASSVALPLPGKTNNQVLALPAP--DGTVEKVNQDPFAASLTIPPP  580

Query  294   AYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPH  157
             +YVQM+E+EKKQ LL +EQQ+WQQY ++GM GQ  L K      P+
Sbjct  581   SYVQMAEMEKKQYLLSQEQQLWQQYQREGMRGQASLAKMNTGPMPY  626


 Score = 69.3 bits (168),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             ++TRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R+
Sbjct  109   YSTRRGTRMLNMSDFRDEAHSSSWDHSAFVRTYAFYLDQRLELALYERK  157



>ref|XP_002440464.1| hypothetical protein SORBIDRAFT_09g001390 [Sorghum bicolor]
 gb|EES18894.1| hypothetical protein SORBIDRAFT_09g001390 [Sorghum bicolor]
Length=623

 Score =   227 bits (578),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 168/463 (36%), Positives = 237/463 (51%), Gaps = 37/463 (8%)
 Frame = -1

Query  1533  DFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgneegveeedeeeetg  1357
             DFRD + +  WD+S FVR YS YL ++V   +        A A  +          + + 
Sbjct  141   DFRDDAHAASWDHSTFVRAYSTYLLDRVRFLVLLLPAPRFAAADDSRVAGPGPLPPQAS-  199

Query  1356  ntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKES  1177
                          +M  + L  R +H   +LDR LAC+P G A  +R+V   L+ ++++S
Sbjct  200   -----------TADMDTDALLGRARHLRHLLDRVLACRPAGGAGTSRVVRAVLHPLLRDS  248

Query  1176  FQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSE  997
             F+VY  +A +L +L+DRF  +D PD  K  E +   AKQ D L  FY W   AG++R S+
Sbjct  249   FRVYEDVALVLALLLDRFFDMDYPDCVKAFETYVGTAKQIDALRGFYAWCDDAGVARSSD  308

Query  996   YPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIK  817
             +PDV     + L+ ME+ +RE+       +   R  S     V     + +  +DMN IK
Sbjct  309   FPDVRRVDDKLLETMEQFLRERGRAGRASVSPPRPRSARDSAVNARGDDVDHVDDMNGIK  368

Query  816   ALPPPP--EDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALF-----  658
             ALP PP      E    V  PT+E  +Q +  L++L E A T +E  N+LALALF     
Sbjct  369   ALPAPPTRSSGGERARPVVLPTKEAADQSV--LVDLREPAATADEQGNKLALALFSAPPA  426

Query  657   -DGi-----ptidptkttittPWE---AFNGSEDWETALVQTASHLSNQKAQFPGNFDEL  505
              DG       +    +  +T+ W+   A  G  DWE ALV TAS+LS Q A   G  D L
Sbjct  427   TDGDNWVTFASDAAPEPAVTSAWQTPAAEPGKADWELALVDTASNLSKQAASLGGGMDTL  486

Query  504   MLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADP  325
             +L GMY QGA+ Q VA+     + S+     G+A             + D      G DP
Sbjct  487   LLGGMYEQGAVRQQVAAQAASGSASSVLPGHGAAA------PVLMLPAPDGTVQTVGGDP  540

Query  324   FAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQ  196
             FAASL+V PP+YVQM+E+E+KQ+LL +EQQMW QY + GM GQ
Sbjct  541   FAASLAVPPPSYVQMAEMERKQQLLVQEQQMWAQYRQGGMQGQ  583



>ref|NP_567892.1| ENTH/ANTH/VHS superfamily protein [Arabidopsis thaliana]
 ref|NP_001031770.1| ENTH/ANTH/VHS superfamily protein [Arabidopsis thaliana]
 sp|Q8S9J8.2|CAP1_ARATH RecName: Full=Probable clathrin assembly protein At4g32285 [Arabidopsis 
thaliana]
 gb|AAY25417.1| At4g32285 [Arabidopsis thaliana]
 dbj|BAH19907.1| AT4G32285 [Arabidopsis thaliana]
 gb|AEE86033.1| ENTH/ANTH/VHS superfamily protein [Arabidopsis thaliana]
 gb|AEE86034.1| ENTH/ANTH/VHS superfamily protein [Arabidopsis thaliana]
Length=635

 Score =   225 bits (574),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 165/409 (40%), Positives = 235/409 (57%), Gaps = 36/409 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+C+PTG AK +R++L+A+Y VVKESF++Y  I E
Sbjct  224   TPLREMTPERIFGKMGHLQRLLDRFLSCRPTGLAKNSRMILIAMYPVVKESFRLYADICE  283

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  284   VLAVLLDKFFDMEYTDCVKAFDAYASAAKQIDELIAFYHWCKDTGVARSSEYPEVQRITS  343

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ + A            E+E    P P  E   DMN IKALPPP    
Sbjct  344   KLLETLEEFVRDRAKRA------KSPERKEIEAPPAPAPPVEEPVDMNEIKALPPPENHT  397

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E   ++ +  D  DL+NL ED  + ++  N+ ALALF G P  +         
Sbjct  398   PPPPPAPEPKPQQPQVTD--DLVNLREDDVSGDDQGNKFALALFAGPPANNGK-------  448

Query  609   WEAFN----------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQG  478
             WEAF+                G  DWE ALV+TAS+L +QKA   G  D L+L+GMY QG
Sbjct  449   WEAFSSDNNVTSAWQNPAAELGKADWELALVETASNLEHQKAAMGGGLDPLLLNGMYDQG  508

Query  477   ALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAP  298
             A+ Q V++S  LT GS++SVA    G+     L  P    D        DPFAASL++ P
Sbjct  509   AVRQHVSTSE-LTGGSSSSVALPLPGKVNSHILALPAP--DGTVQKVNQDPFAASLTIPP  565

Query  297   PAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQ--QSSQPH  157
             P+YVQM+E++KKQ LL +EQQ+WQQY ++GM GQ  L K    Q++ P+
Sbjct  566   PSYVQMAEMDKKQYLLTQEQQLWQQYQQEGMRGQASLAKMNTAQTAMPY  614


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 40/45 (89%), Gaps = 1/45 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRM  1441
             +ATRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +
Sbjct  109   YATRRGTRILNMSDFRDEAHSSSWDHSAFVRTYASYLDQRLELAL  153



>gb|AAM61646.1| unknown [Arabidopsis thaliana]
Length=653

 Score =   225 bits (574),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 167/410 (41%), Positives = 232/410 (57%), Gaps = 35/410 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+ +PTG AK +R++L+ALY VV+ESF++Y  I E
Sbjct  244   TPLREMTPERIFGKMGHLQRLLDRFLSLRPTGLAKNSRMILIALYPVVRESFKLYADICE  303

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  304   VLAVLLDKFFDMEYSDCVKAFDAYASAAKQIDELIAFYNWCKETGVARSSEYPEVQRITS  363

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +              E+E       E E E DMN IKALPP   + 
Sbjct  364   KLLETLEEFVRDRAKRG------KSPERKEIEAPPPVVEEEEPEPDMNEIKALPP--PEN  415

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E   + +K Q   DL+NL ED  T ++  N+ ALALF G P  +         
Sbjct  416   YTPPPPPEPEPQPEKPQFTEDLVNLREDEVTADDQGNKFALALFAGPPGNNGK-------  468

Query  609   WEAFN---------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGA  475
             WEAF+               G  DWE ALV+TAS+L  Q A   G FD L+L+GMY QG 
Sbjct  469   WEAFSSNGVTSAWQNPAAEPGKADWELALVETASNLEKQTAALGGGFDNLLLNGMYDQGM  528

Query  474   LNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPP  295
             + Q V++S  LT GSA+SVA    G+     L  P    D        DPFAASL++ PP
Sbjct  529   VRQHVSTSQ-LTGGSASSVALPLPGKTNNQVLALPAP--DGTVEKVNQDPFAASLTIPPP  585

Query  294   AYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             +YVQM+E+EKKQ LL +EQQ+WQQY +DGM GQ  L  A+ ++ P   YG
Sbjct  586   SYVQMAEMEKKQYLLSQEQQLWQQYQRDGMRGQASL--AKMNTGPVPTYG  633


 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             ++TRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R+
Sbjct  109   YSTRRGTRMLNMSDFRDEAHSSSWDHSAFVRTYAGYLDQRLELALFERK  157



>gb|AAL77661.1| AT4g32280/F10M6_80 [Arabidopsis thaliana]
Length=635

 Score =   225 bits (573),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 165/409 (40%), Positives = 235/409 (57%), Gaps = 36/409 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+C+PTG AK +R++L+A+Y VVKESF++Y  I E
Sbjct  224   TPLREMTPERIFGKMGHLQRLLDRFLSCRPTGLAKNSRMILIAMYPVVKESFRLYADICE  283

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  284   VLAVLLDKFFDMEYTDCVKAFDAYASAAKQIDELIAFYHWCKDTGVARSSEYPEVQRITS  343

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ + A            E+E    P P  E   DMN IKALPPP    
Sbjct  344   KLLETLEEFVRDRAKRA------KSPERKEIEAPPAPAPPVEEPVDMNEIKALPPPENHT  397

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E   ++ +  D  DL+NL ED  + ++  N+ ALALF G P  +         
Sbjct  398   PPPPPAPEPKPQQPQVTD--DLVNLREDDVSGDDQGNKFALALFAGPPANNGK-------  448

Query  609   WEAFN----------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQG  478
             WEAF+                G  DWE ALV+TAS+L +QKA   G  D L+L+GMY QG
Sbjct  449   WEAFSSDNNVTSAWQNPAVELGKADWELALVETASNLEHQKAAMGGGLDPLLLNGMYDQG  508

Query  477   ALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAP  298
             A+ Q V++S  LT GS++SVA    G+     L  P    D        DPFAASL++ P
Sbjct  509   AVRQHVSTSE-LTGGSSSSVALPLPGKVNSHILALPAP--DGTVQKVNQDPFAASLTIPP  565

Query  297   PAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQ--QSSQPH  157
             P+YVQM+E++KKQ LL +EQQ+WQQY ++GM GQ  L K    Q++ P+
Sbjct  566   PSYVQMAEMDKKQYLLTQEQQLWQQYQQEGMRGQASLAKMNTAQTAMPY  614


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 40/45 (89%), Gaps = 1/45 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRM  1441
             +ATRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +
Sbjct  109   YATRRGTRILNMSDFRDEAHSSSWDHSAFVRTYASYLDQRLELAL  153



>ref|XP_006293772.1| hypothetical protein CARUB_v10022748mg, partial [Capsella rubella]
 gb|EOA26670.1| hypothetical protein CARUB_v10022748mg, partial [Capsella rubella]
Length=707

 Score =   226 bits (575),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 166/410 (40%), Positives = 232/410 (57%), Gaps = 35/410 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+ +PTG AK +R++L+ALY VV+ESF++Y  I E
Sbjct  298   TPLREMTPERIFGKMGHLQRLLDRFLSLRPTGLAKNSRMILIALYPVVRESFKLYADICE  357

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  358   VLAVLLDKFFDMEYTDCVKAFDAYASAAKQIDELIAFYNWCKETGVARSSEYPEVQRITG  417

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +              E+E    P  E E E DMN IKALPP   + 
Sbjct  418   KLLETLEEFVRDRAKRG------KSPERKEIEAPPPPVQEEEPELDMNEIKALPP--PEN  469

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E   + +K Q   DL+NL ED  T ++  N+ ALALF G    +         
Sbjct  470   YTPPPPPEPEPQPQKRQVTEDLVNLREDEVTADDQGNKFALALFAGPAGGNGK-------  522

Query  609   WEAFN---------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGA  475
             WEAF+               G  DWE ALV+TAS+L  Q A   G FD L+L+GMY QG 
Sbjct  523   WEAFSSNGVTSAWQNPAAEPGKADWELALVETASNLERQTAALGGGFDNLLLNGMYDQGM  582

Query  474   LNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPP  295
             + Q V++S  LT GSA+SVA    G+     L  P    D        DPFAASL++ PP
Sbjct  583   VRQHVSTS-QLTGGSASSVALPLPGQTNNQVLALPAP--DGTVEKVNQDPFAASLTIPPP  639

Query  294   AYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             +YVQM+E+EKKQ LL +EQQ+WQQY ++GM GQ  L  A+ ++ P   YG
Sbjct  640   SYVQMAEMEKKQYLLSQEQQLWQQYQREGMRGQASL--AKMNTGPVQPYG  687


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             ++TRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R+
Sbjct  170   YSTRRGTRMLNMSDFRDEAHSSSWDHSAFVRTYAFYLDQRLELALFERK  218



>ref|XP_004291452.1| PREDICTED: putative clathrin assembly protein At2g25430-like 
[Fragaria vesca subsp. vesca]
Length=666

 Score =   225 bits (573),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 159/401 (40%), Positives = 225/401 (56%), Gaps = 33/401 (8%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EMK E ++ ++ H  ++LDRFL+ +PTG AK +RL+LVALY VV+ESFQ+Y  I E
Sbjct  245   TPLREMKPERIFGKMGHLQRLLDRFLSIRPTGLAKNSRLILVALYPVVRESFQLYADICE  304

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+++    
Sbjct  305   VLAVLLDKFFDMEYSDCVKAFDAYASAAKQIDELVAFYGWCKDVGVARSSEYPEIQKIGS  364

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R+       R  R + P  + E       E E + DMN IKALP P E++
Sbjct  365   KLLETLEEFVRD-------RSKRGKSPERKEELPAPVAQEEEPQPDMNEIKALPAP-ENW  416

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                      P  + +     DL++L ++  + +   N +ALALF G      T  +    
Sbjct  417   TPPPPPEPEPQPKPQPVVQEDLVDLRDNGVSADNQGNNMALALFAGPAANGNTNGS----  472

Query  609   WEAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYR  484
             WEAF                   G  DWE ALV+TAS+LS+QKA   G  D L+L+GMY 
Sbjct  473   WEAFPSDGQPQVTSAWQNPAAEPGKADWELALVETASNLSHQKAALGGGLDPLLLNGMYD  532

Query  483   QGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSV  304
             QG + Q V ++  L+ GSA+SVA    G+ A   L  P    D        DPFAASL+V
Sbjct  533   QGIVRQHVGTA-QLSGGSASSVALPGPGKSATPVLALPAP--DGTVMPVNQDPFAASLTV  589

Query  303   APPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
              PP+YVQM+++EKKQ LL +EQ +W QY ++GM G   L K
Sbjct  590   PPPSYVQMADMEKKQHLLVQEQHVWNQYAREGMQGPTSLAK  630


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATR+GTRLLN+SDFRD + S+ WD+SAFVRT+++YLD++++L +  R+
Sbjct  110   YATRKGTRLLNLSDFRDEAHSSSWDHSAFVRTFAMYLDQRLDLMLFERK  158



>ref|XP_006283312.1| hypothetical protein CARUB_v10004350mg [Capsella rubella]
 gb|EOA16210.1| hypothetical protein CARUB_v10004350mg [Capsella rubella]
Length=637

 Score =   224 bits (571),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 164/399 (41%), Positives = 228/399 (57%), Gaps = 34/399 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+C+PTG AK +R++L+A+Y VVKESF++Y  I E
Sbjct  226   TPLREMTPERIFGKMGHLQRLLDRFLSCRPTGLAKNSRMILIAMYPVVKESFRLYADICE  285

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  286   VLAVLLDKFFDMEYTDCVKAFDAYASAAKQIDELIAFYHWCKDTGVARSSEYPEVQRITS  345

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ + A            E+E      P  E E DMN IKALPPP    
Sbjct  346   KLLETLEEFVRDRAKRA------KSPERKEIEAPPPAPPVEEPEVDMNEIKALPPPENHT  399

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E   ++ +  D  DL+NL ED  T ++  N+ ALALF G P  +         
Sbjct  400   PPPPPAPEPKPQQPQVTD--DLVNLREDGVTGDDQGNKFALALFAGPPGNNGK-------  450

Query  609   WEAFN----------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQG  478
             WEAF                 G  DWE ALV+TAS+L NQKA   G  D L+L+GMY QG
Sbjct  451   WEAFPSDNGVTSAWQNPAAELGKADWELALVETASNLENQKAAMGGGLDPLLLNGMYDQG  510

Query  477   ALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAP  298
             A+ Q V++S  LT GS++SVA     +     L  P    D        DPFAASL++ P
Sbjct  511   AVRQHVSTS-ELTGGSSSSVALPLPSKINSHILALPAP--DGTVQKVNQDPFAASLTIPP  567

Query  297   PAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             P+YVQM+E++KKQ LL +EQQ+WQQY ++GM GQ  L K
Sbjct  568   PSYVQMAEMDKKQYLLTQEQQLWQQYQQEGMRGQASLAK  606


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKH  1420
             +ATRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R+GK+
Sbjct  109   YATRRGTRILNMSDFRDEAHSSSWDHSAFVRTYASYLDQRLELALFERKGKN  160



>ref|NP_565595.1| putative clathrin assembly protein [Arabidopsis thaliana]
 sp|Q8LF20.2|CAP2_ARATH RecName: Full=Putative clathrin assembly protein At2g25430 [Arabidopsis 
thaliana]
 gb|AAD20703.1| expressed protein [Arabidopsis thaliana]
 gb|AAM98081.1| At2g25430/F13B15.9 [Arabidopsis thaliana]
 gb|AAP37658.1| At2g25430/F13B15.9 [Arabidopsis thaliana]
 gb|AEC07701.1| putative clathrin assembly protein [Arabidopsis thaliana]
Length=653

 Score =   224 bits (571),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 164/405 (40%), Positives = 226/405 (56%), Gaps = 33/405 (8%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+ +PTG AK +R++L+ALY VV+ESF++Y  I E
Sbjct  244   TPLREMTPERIFGKMGHLQRLLDRFLSLRPTGLAKNSRMILIALYPVVRESFKLYADICE  303

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  304   VLAVLLDKFFDMEYSDCVKAFDAYASAAKQIDELIAFYNWCKETGVARSSEYPEVQRITS  363

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +              E+E       E E E DMN IKALPP   + 
Sbjct  364   KLLETLEEFVRDRAKRG------KSPERKEIEAPPPVVEEEEPEPDMNEIKALPP--PEN  415

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E   + +K Q   DL+NL ED  T ++  N+ ALALF G P  +         
Sbjct  416   YTPPPPPEPEPQPEKPQFTEDLVNLREDEVTADDQGNKFALALFAGPPGNNGK-------  468

Query  609   WEAFN---------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGA  475
             WEAF+               G  DWE ALV+T S+L  Q A   G FD L+L+GMY QG 
Sbjct  469   WEAFSSNGVTSAWQNPAAEPGKADWELALVETTSNLEKQTAALGGGFDNLLLNGMYDQGM  528

Query  474   LNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPP  295
             + Q V++S  LT GSA+SVA    G+     L  P    D        DPFAASL++ PP
Sbjct  529   VRQHVSTS-QLTGGSASSVALPLPGKTNNQVLALPAP--DGTVEKVNQDPFAASLTIPPP  585

Query  294   AYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQP  160
             +YVQM+E+EKKQ LL +EQQ+WQQY +DGM GQ  L K      P
Sbjct  586   SYVQMAEMEKKQYLLSQEQQLWQQYQRDGMRGQASLAKMNTGPVP  630


 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             ++TRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R+
Sbjct  109   YSTRRGTRMLNMSDFRDEAHSSSWDHSAFVRTYAGYLDQRLELALFERK  157



>ref|XP_010432743.1| PREDICTED: probable clathrin assembly protein At4g32285 [Camelina 
sativa]
Length=638

 Score =   223 bits (569),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 162/399 (41%), Positives = 229/399 (57%), Gaps = 34/399 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+C+PTG AK +R++L+A+Y VVKESF++Y  I E
Sbjct  227   TPLREMTPERIFGKMGHLQRLLDRFLSCRPTGLAKNSRMILIAMYPVVKESFRLYADICE  286

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  287   VLAVLLDKFFDMEYTDCVKAFDAYASSAKQIDELIAFYHWCKDTGVARSSEYPEVQRITS  346

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ + A     +S E            P  E   DMN IKALPPP    
Sbjct  347   KLLETLEEFVRDRAKRA-----KSPERKEIEAPPPPAAPVEEPVVDMNEIKALPPPENYT  401

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E   ++ +  +  DL+NL ED  T ++  N+ ALALF G P  +         
Sbjct  402   PPPPPAPEPKPQQPQVTE--DLVNLREDNVTGDDQGNKFALALFAGPPGNNGK-------  452

Query  609   WEAFN----------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQG  478
             WEAF                 G  DWE ALV+TAS+L NQKA   G  D L+L+GMY QG
Sbjct  453   WEAFPSDNGVTSAWQNPAAEIGKADWELALVETASNLENQKAAMGGGLDPLLLNGMYDQG  512

Query  477   ALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAP  298
             A+ Q V++S  LT GS++SVA    G+ + +     P   D        DPFAASL++ P
Sbjct  513   AVRQHVSTS-ELTGGSSSSVALPLPGKNSHILALPAP---DGTVQQVNQDPFAASLTIPP  568

Query  297   PAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             P+YVQM+E++KKQ LL +EQQ+WQQY ++GM GQ  L K
Sbjct  569   PSYVQMAEMDKKQYLLTQEQQLWQQYQQEGMRGQASLAK  607


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 1/47 (2%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNR  1432
             ATRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R
Sbjct  110   ATRRGTRILNMSDFRDEAHSSSWDHSAFVRTYASYLDQRLELALFER  156



>ref|XP_010447412.1| PREDICTED: probable clathrin assembly protein At4g32285 [Camelina 
sativa]
Length=638

 Score =   223 bits (569),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 162/399 (41%), Positives = 229/399 (57%), Gaps = 34/399 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+C+PTG AK +R++L+A+Y VVKESF++Y  I E
Sbjct  227   TPLREMTPERIFGKMGHLQRLLDRFLSCRPTGLAKNSRMILIAMYPVVKESFRLYADICE  286

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  287   VLAVLLDKFFDMEYTDCVKAFDAYASSAKQIDELIAFYHWCKDTGVARSSEYPEVQRITS  346

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ + A     +S E            P  E   DMN IKALPPP    
Sbjct  347   KLLETLEEFVRDRAKRA-----KSPERKEIEAPPPPAAPVEEPVVDMNEIKALPPPENYT  401

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E   ++ +  +  DL+NL ED  T ++  N+ ALALF G P  +         
Sbjct  402   PPPPPAPEPKPQQPQVTE--DLVNLREDNVTGDDQGNKFALALFAGPPGNNGK-------  452

Query  609   WEAFN----------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQG  478
             WEAF                 G  DWE ALV+TAS+L NQKA   G  D L+L+GMY QG
Sbjct  453   WEAFPSDNGVTSAWQNPAAEIGKADWELALVETASNLENQKAAMGGGLDPLLLNGMYDQG  512

Query  477   ALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAP  298
             A+ Q V++S  LT GS++SVA    G+ + +     P   D        DPFAASL++ P
Sbjct  513   AVRQHVSTS-ELTGGSSSSVALPLPGKNSHILALPAP---DGTVQQVNQDPFAASLTIPP  568

Query  297   PAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             P+YVQM+E++KKQ LL +EQQ+WQQY ++GM GQ  L K
Sbjct  569   PSYVQMAEMDKKQYLLTQEQQLWQQYQQEGMRGQASLAK  607


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 1/47 (2%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNR  1432
             ATRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R
Sbjct  110   ATRRGTRILNMSDFRDEAHSSSWDHSAFVRTYASYLDQRLELALFER  156



>gb|ACB59217.1| ENTH [Brassica oleracea]
Length=646

 Score =   223 bits (569),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 165/402 (41%), Positives = 224/402 (56%), Gaps = 33/402 (8%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL  +PTG AK +R++L+ALY VV+ESF++Y  I E
Sbjct  232   TPLPEMTPERIFGKMGHLQRLLDRFLTLRPTGLAKNSRMILIALYPVVRESFKLYADICE  291

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  292   VLAVLLDKFFDMEYTDCVKAFDAYASAAKQIDELIAFYNWCKETGVARSSEYPEVQRITS  351

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +    R         E         E EAE DMN IKALPPP    
Sbjct  352   KLLETLEEFVRDRAK----RGKSPERKEIEAPPPPPVAQEEEAEPDMNEIKALPPPENYT  407

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E    +  E    DL+NL ED  T ++  N+ ALALF G P  +         
Sbjct  408   PPPQPEPEPEKPQYTE----DLVNLREDGVTGDDQGNKFALALFAGPPGSNGK-------  456

Query  609   WEAFN---------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGA  475
             WEAF                G  DWE ALV+TAS+L  Q A   G FD L+L+GMY QGA
Sbjct  457   WEAFPSDGVTSAWQNPAAEPGKADWELALVETASNLEKQTAALGGGFDSLLLNGMYDQGA  516

Query  474   LNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPP  295
             + Q V++S  LT GSA+SVA    G+     L  P    D        DPFAASL++ PP
Sbjct  517   VRQHVSTS-QLTGGSASSVALPLPGKANTQILALPAP--DGTVEKVNQDPFAASLTIPPP  573

Query  294   AYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQS  169
             +YVQM+E+EKKQ LL +EQQ+WQQY ++GM GQ  L K   +
Sbjct  574   SYVQMAEMEKKQYLLSQEQQLWQQYQREGMRGQASLAKMNNT  615


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +TRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R+
Sbjct  110   STRRGTRMLNMSDFRDEAHSSSWDHSAFVRTYAFYLDQRLELALFERK  157



>ref|XP_009140672.1| PREDICTED: putative clathrin assembly protein At2g25430 [Brassica 
rapa]
Length=649

 Score =   223 bits (567),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 163/402 (41%), Positives = 223/402 (55%), Gaps = 33/402 (8%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL  +PTG AK +R++L+ALY VV+ESF++Y  I E
Sbjct  235   TPLPEMTPERIFGKMGHLQRLLDRFLTLRPTGLAKNSRMILIALYPVVRESFKLYADICE  294

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  295   VLAVLLDKFFDMEYTDCVKAFDAYASAAKQIDELIAFYNWCKETGVARSSEYPEVQRITS  354

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +    R         E      P    E E DMN IKALPPP    
Sbjct  355   KLLETLEEFVRDRAK----RGKSPERKEIEAPPPPPPPVAEEEEPDMNEIKALPPPESYT  410

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E    +  E    DL+NL ED  T ++  N+ ALALF G P  +         
Sbjct  411   PPPQPEPEPEKPQYTE----DLVNLREDGVTGDDQGNKFALALFAGPPGSNGK-------  459

Query  609   WEAFN---------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGA  475
             WEAF                G  DWE ALV+TAS+L  Q A   G FD L+L+GMY QGA
Sbjct  460   WEAFPSDGVTSAWQNPAAEPGKADWELALVETASNLEKQTAALGGGFDSLLLNGMYDQGA  519

Query  474   LNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPP  295
             + Q V+++  LT GSA+SVA    G+     L  P    D        DPFAASL++ PP
Sbjct  520   VRQHVSTT-QLTGGSASSVALPLPGKANTQILALPAP--DGTVEKVNQDPFAASLTIPPP  576

Query  294   AYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQS  169
             +YVQM+E+EKKQ LL +EQQ+WQQY ++GM GQ  L K   +
Sbjct  577   SYVQMAEMEKKQYLLSQEQQLWQQYQREGMRGQASLAKMNNT  618


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +TRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R+
Sbjct  110   STRRGTRMLNMSDFRDEAHSSSWDHSAFVRTYAFYLDQRLELALFERK  157



>emb|CAA16962.1| putative protein [Arabidopsis thaliana]
 emb|CAB79946.1| putative protein [Arabidopsis thaliana]
Length=842

 Score =   225 bits (573),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 165/409 (40%), Positives = 235/409 (57%), Gaps = 36/409 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+C+PTG AK +R++L+A+Y VVKESF++Y  I E
Sbjct  431   TPLREMTPERIFGKMGHLQRLLDRFLSCRPTGLAKNSRMILIAMYPVVKESFRLYADICE  490

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  491   VLAVLLDKFFDMEYTDCVKAFDAYASAAKQIDELIAFYHWCKDTGVARSSEYPEVQRITS  550

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ + A            E+E    P P  E   DMN IKALPPP    
Sbjct  551   KLLETLEEFVRDRAKRA------KSPERKEIEAPPAPAPPVEEPVDMNEIKALPPPENHT  604

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E   ++ +  D  DL+NL ED  + ++  N+ ALALF G P  +         
Sbjct  605   PPPPPAPEPKPQQPQVTD--DLVNLREDDVSGDDQGNKFALALFAGPPANNGK-------  655

Query  609   WEAFN----------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQG  478
             WEAF+                G  DWE ALV+TAS+L +QKA   G  D L+L+GMY QG
Sbjct  656   WEAFSSDNNVTSAWQNPAAELGKADWELALVETASNLEHQKAAMGGGLDPLLLNGMYDQG  715

Query  477   ALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAP  298
             A+ Q V++S  LT GS++SVA    G+     L  P    D        DPFAASL++ P
Sbjct  716   AVRQHVSTSE-LTGGSSSSVALPLPGKVNSHILALPAP--DGTVQKVNQDPFAASLTIPP  772

Query  297   PAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQ--QSSQPH  157
             P+YVQM+E++KKQ LL +EQQ+WQQY ++GM GQ  L K    Q++ P+
Sbjct  773   PSYVQMAEMDKKQYLLTQEQQLWQQYQQEGMRGQASLAKMNTAQTAMPY  821


 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 40/45 (89%), Gaps = 1/45 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRM  1441
             +ATRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +
Sbjct  316   YATRRGTRILNMSDFRDEAHSSSWDHSAFVRTYASYLDQRLELAL  360



>ref|XP_002878853.1| hypothetical protein ARALYDRAFT_481396 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55112.1| hypothetical protein ARALYDRAFT_481396 [Arabidopsis lyrata subsp. 
lyrata]
Length=648

 Score =   222 bits (566),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 164/405 (40%), Positives = 229/405 (57%), Gaps = 33/405 (8%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+ +PTG AK +R++L+ALY VV+ESF++Y  I E
Sbjct  239   TPLREMTPERIFGKMGHLQRLLDRFLSLRPTGLAKNSRMILIALYPVVRESFKLYADICE  298

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  299   VLAVLLDKFFDMEYTDCVKAFDAYASAAKQIDELIAFYNWCKETGVARSSEYPEVQRITS  358

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +              E+E    P  E E E DMN IKALPPP    
Sbjct  359   KLLETLEEFVRDRAKRG------KSPERKEIEAPPPPVQEEEPEPDMNEIKALPPPENYT  412

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E   ++ +  +  DL+NL ED  T ++  N+ ALALF G P+ +         
Sbjct  413   PPPPPEPEPQPQKPQFTE--DLVNLREDEVTADDQGNKFALALFAGPPSNNGK-------  463

Query  609   WEAFN---------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGA  475
             WEAF+               G  DWE ALV+TAS+L  Q A   G FD L+L+GMY QG 
Sbjct  464   WEAFSSNGVTSAWQNPAAEPGKADWELALVETASNLEKQTAALGGGFDNLLLNGMYDQGM  523

Query  474   LNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPP  295
             + Q V++S  LT GSA+SVA    G+     L  P    D        DPFAASL++ PP
Sbjct  524   VRQHVSTS-QLTGGSASSVALPLPGKTNNQVLALPAP--DGTVEKVNQDPFAASLTIPPP  580

Query  294   AYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQP  160
             +YVQM+E+EKKQ LL +EQQ+WQQY ++GM GQ  L K      P
Sbjct  581   SYVQMAEMEKKQYLLSQEQQLWQQYQREGMRGQASLAKMNTGPVP  625


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             ++TRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R+
Sbjct  107   YSTRRGTRMLNMSDFRDEAHSSSWDHSAFVRTYAGYLDQRLELALFERK  155



>ref|XP_010417312.1| PREDICTED: putative clathrin assembly protein At2g25430 [Camelina 
sativa]
Length=651

 Score =   222 bits (566),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 166/410 (40%), Positives = 233/410 (57%), Gaps = 34/410 (8%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+ +PTG AK +R++L+ALY VV+ESF++Y  I E
Sbjct  241   TPLREMTPERIFGKMGHLQRLLDRFLSLRPTGLAKNSRMILIALYPVVRESFKLYADICE  300

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DE+  FY W K  G++R SEYP+V+    
Sbjct  301   VLAVLLDKFFDMEYTDCVKAFDAYASAAKQIDEVIAFYNWCKETGVARSSEYPEVQRITG  360

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +       +S E     +    P  E E E DMN IKALPP   + 
Sbjct  361   KLLETLEEFVRDRAKRG-----KSPERKEIDQAPPPPVQEEEPEPDMNEIKALPP--PEN  413

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E     +K Q   DL+NL ED  T ++  N+ ALALF G P  +         
Sbjct  414   YTPPPPPEPEPLPQKPQFTEDLVNLREDEVTADDQGNKFALALFAGPPGNNGK-------  466

Query  609   WEAFN---------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGA  475
             WEAF+               G  DWE ALV+TAS+L  Q A   G FD L+L+GMY QG 
Sbjct  467   WEAFSSNGVTSAWQNPAAESGKADWELALVETASNLEKQTAALGGGFDNLLLNGMYDQGM  526

Query  474   LNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPP  295
             + Q V++S  LT GSA+SVA    G+     L  P    D        DPFAASL++ PP
Sbjct  527   VRQHVSTS-QLTGGSASSVALPLPGKTNTQVLALPAP--DGTVEKVNQDPFAASLTIPPP  583

Query  294   AYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPHNYYG  145
             +YVQM+E+EKKQ LL +EQQ+WQQY ++GM GQ  L  A+ ++ P   YG
Sbjct  584   SYVQMAEMEKKQYLLNQEQQLWQQYQREGMRGQASL--AKMNNGPVQAYG  631


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             ++TRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R+
Sbjct  109   YSTRRGTRMLNMSDFRDEAHSSSWDHSAFVRTYAGYLDQRLELALFERK  157



>ref|XP_008443969.1| PREDICTED: putative clathrin assembly protein At2g25430 isoform 
X3 [Cucumis melo]
Length=442

 Score =   217 bits (553),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 150/406 (37%), Positives = 213/406 (52%), Gaps = 49/406 (12%)
 Frame = -1

Query  1314  MKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGIL  1135
             ++ E +   +   I++LDR LAC+P G AK +RLV+ AL  V+KESF++Y  I + LG+L
Sbjct  60    IRPERVVEELNQLIRMLDRVLACRPNGMAKSSRLVITALNLVIKESFRLYIEICDALGVL  119

Query  1134  VDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDi  955
             +D+F +++  D  +V ++     K  DEL  FY W K  GI+R SEYP V       L  
Sbjct  120   LDQFKEMEYADCLRVFDVCANAVKNIDELVEFYCWCKDVGIARSSEYPGVRMITNNLL--  177

Query  954   meeiirekmeMAGGRIMrsrep----speveeveepepeaeaeEDMNTIKALPPPPEDFI  787
                         GG +          +    +  +P    E+  DMN IKALPPP     
Sbjct  178   ---------ITLGGFLKEMTRRPKDYNEMRTKEMKPVSVKESRYDMNEIKALPPPENCAP  228

Query  786   EEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPW  607
                +V+++  E        DL+NL ED  + +E   +LA+A F G PT +P  +     W
Sbjct  229   VSQSVLQSLKE--------DLVNLREDEVSADEQGEKLAMAFFSGPPTTNPNGS-----W  275

Query  606   EAFN------------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQ  481
             E F+                  G  DWE ALV+TASHLS Q+    G FD ++L+GMY Q
Sbjct  276   ETFSLNHEPEVSSVWQTRAAEFGKPDWELALVETASHLSKQRPDMGGCFDPMLLNGMYDQ  335

Query  480   GALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGA-DPFAASLSV  304
              A+ + V    +   GS++SVA    G+ +  +      + D      G  DPFAASL V
Sbjct  336   EAVRRHVNVEQL--GGSSSSVAVALQGQGSAGSQVLALPAPDGTVELVGQRDPFAASLMV  393

Query  303   APPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSS  166
              PP+YVQ++E+EKKQ+LL +EQ +W+QY +DGM GQVGLEK    S
Sbjct  394   PPPSYVQIAEMEKKQQLLAQEQLLWKQYGRDGMQGQVGLEKVGNGS  439



>ref|XP_010472542.1| PREDICTED: putative clathrin assembly protein At2g25430 [Camelina 
sativa]
Length=652

 Score =   221 bits (564),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 161/405 (40%), Positives = 224/405 (55%), Gaps = 34/405 (8%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+ +PTG AK +R++L+ALY VV+ESF++Y  I E
Sbjct  244   TPLREMTPERIFGKMGHLQRLLDRFLSLRPTGLAKNSRMILIALYPVVRESFKLYADICE  303

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DE+  FY W K  G++R SEYP+V+    
Sbjct  304   VLAVLLDKFFDMEYTDCVKAFDAYASAAKQIDEVIAFYNWCKETGVARSSEYPEVQRITG  363

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +              E+E    P  E E E DMN IKALP      
Sbjct  364   KLLETLEEFVRDRAKRG------MSPERKEIEAPPPPVQEEEPEPDMNEIKALP---PPE  414

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                      P    ++    DL+NL ED  T ++  N+ ALALF G P  +         
Sbjct  415   NYTPPPPPEPEPLPQKPQFEDLVNLREDEVTADDQGNKFALALFAGPPGNNGK-------  467

Query  609   WEAFN---------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGA  475
             WEAF+               G  DWE ALV+TAS+L  Q A   G FD L+L+GMY QG 
Sbjct  468   WEAFSSNGVTSAWQNPAAEPGKADWELALVETASNLEKQTAALGGGFDNLLLNGMYDQGM  527

Query  474   LNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPP  295
             + Q V++S  LT GSA+SVA    G+     L  P    D        DPFAASL++ PP
Sbjct  528   VRQHVSTS-QLTGGSASSVALPLPGKTNTQVLALPAP--DGTVEKVNQDPFAASLTIPPP  584

Query  294   AYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQP  160
             +YVQM+E+EKKQ LL +EQQ+WQQY ++GM GQ  L K      P
Sbjct  585   SYVQMAEMEKKQYLLNQEQQLWQQYQREGMRGQASLAKMNNGPVP  629


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             ++TRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R+
Sbjct  109   YSTRRGTRMLNMSDFRDEAHSSSWDHSAFVRTYAGYLDQRLELALFERK  157



>ref|XP_002869286.1| hypothetical protein ARALYDRAFT_328503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45545.1| hypothetical protein ARALYDRAFT_328503 [Arabidopsis lyrata subsp. 
lyrata]
Length=845

 Score =   223 bits (569),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 165/409 (40%), Positives = 234/409 (57%), Gaps = 36/409 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+C+PTG AK +R++L+A+Y VVKESF++Y  I E
Sbjct  434   TPLREMTPERIFGKMGHLQRLLDRFLSCRPTGLAKNSRMILIAMYPVVKESFRLYADICE  493

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  494   VLAVLLDKFFDMEYTDCVKAFDAYASAAKQIDELIAFYHWCKDTGVARSSEYPEVQRITS  553

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ + A            E+E    P P  E    MN IKALPPP    
Sbjct  554   KLLETLEEFVRDRAKRA------KSPERKEIEAPPAPAPPVEEPVGMNEIKALPPPENHT  607

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E   ++ +  D  DL+NL ED  T ++  N+ ALALF G P  +         
Sbjct  608   PPPPPAPEPKPQQPQVTD--DLVNLREDDVTGDDQGNKFALALFAGPPASNGK-------  658

Query  609   WEAFN----------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQG  478
             WEAF+                G  DWE ALV+TAS+L +QKA   G  D L+L+GMY QG
Sbjct  659   WEAFSSDNGVTSAWQNPAAELGKADWELALVETASNLEHQKAAMGGGLDPLLLNGMYDQG  718

Query  477   ALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAP  298
             A+ Q V++S  LT GS++SVA    G+     L  P    D        DPFAASL++ P
Sbjct  719   AVRQHVSTSE-LTGGSSSSVALPLPGKINSHILALPAP--DGTVQKVNQDPFAASLTIPP  775

Query  297   PAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQ--QSSQPH  157
             P+YVQM+E++KKQ LL +EQQ+WQQY ++GM GQ  L K    Q++ P+
Sbjct  776   PSYVQMAEMDKKQYLLTQEQQLWQQYQQEGMRGQASLAKMNTAQTAMPY  824


 Score = 68.6 bits (166),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             +ATRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R+
Sbjct  317   YATRRGTRILNMSDFRDEAHSSSWDHSAFVRTYASYLDQRLELALFERK  365



>ref|XP_001766329.1| predicted protein [Physcomitrella patens]
 gb|EDQ68961.1| predicted protein [Physcomitrella patens]
Length=642

 Score =   220 bits (561),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 171/514 (33%), Positives = 247/514 (48%), Gaps = 69/514 (13%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKH---------  1420
             A+RRG R++N+SDF+D + SN WDYS+FVRTY L+LDE+++  +Q   GK+         
Sbjct  112   ASRRGRRIVNLSDFKDETHSNAWDYSSFVRTYGLFLDERLDCSLQ-VSGKNKSRSGRGRG  170

Query  1419  --------SALASgneegveeedeeeetgntTAIVVTGT-----------PITEMKNEYL  1297
                     S + S      +       + ++ A  +  T           PI EM  + L
Sbjct  171   RGRSSYSKSPVRSSYRGSPDGRSRYAGSPDSRAYSIATTNDTRQEESDNVPIKEMSVKQL  230

Query  1296  YSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMK  1117
               ++    ++++R L C+P GAAK NRLV  ALY ++KESFQ+Y  I +   +L++ F  
Sbjct  231   LGKLPAMQRLMERVLGCRPAGAAKTNRLVQHALYPIIKESFQLYRDICDGYAVLLEGFFD  290

Query  1116  LDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQK---LDimee  946
             ++  D  K +E F + AKQ DEL   Y      G+ R SEY +V   PK++   L+    
Sbjct  291   MEQKDRVKAYETFIKSAKQADELHDLYKMCMHYGVGRSSEYIEVSPVPKEQLNSLEEYMR  350

Query  945   iirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDFIE-EMAVV  769
                     +    +   +        E       A E           P   +E E A  
Sbjct  351   SNVPSQTRSKSPEVAPLQLEYRAPSPERSPEPERAPEPEPAPPPKETAPAAVVEPETAPA  410

Query  768   EAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFN--  595
              APT     Q +GDLLN+ +   + E+H+++LALALF        + +T T+ WE FN  
Sbjct  411   PAPT-----QSVGDLLNMDQATISTEDHSDKLALALF--------STSTTTSTWETFNSD  457

Query  594   --------------GSEDWETALVQTASHLSNQKAQFP--GNFDELMLDGMYRQGALNQA  463
                           G   WE ALV++ASHLS      P  G FD L+LD MY QG + Q 
Sbjct  458   DQKNSQQTFNSSESGKAGWELALVESASHLSKPPPDRPLAGGFDNLLLDSMYNQGEVLQK  517

Query  462   VASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQ  283
              A +   +  +++ V    A     L  P   + +  N    G DPFAAS  V PPAYVQ
Sbjct  518   QAIASAPSGSASSVVLTNRASAFLALPAPPGTTPSSVN----GEDPFAASAVVPPPAYVQ  573

Query  282   MSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             MS+L  KQ+LL +EQ MWQ+Y  +GM G+   +K
Sbjct  574   MSDLNTKQQLLSQEQIMWQRYQMEGMRGEATFQK  607



>ref|XP_010429535.1| PREDICTED: putative clathrin assembly protein At2g25430 [Camelina 
sativa]
Length=639

 Score =   220 bits (561),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 163/405 (40%), Positives = 228/405 (56%), Gaps = 32/405 (8%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+ +PTG AK +R++L+ALY VV+ESF++Y  I E
Sbjct  229   TPLREMTPERIFGKMGHLQRLLDRFLSLRPTGLAKNSRMILIALYPVVRESFKLYADICE  288

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DE+  FY W K  G++R SEYP+V+    
Sbjct  289   VLAVLLDKFFDMEYTDCVKAFDAYASAAKQIDEVIAFYNWCKETGVARSSEYPEVQRITG  348

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +       +S E          P  E E E DMN IKALPPP    
Sbjct  349   KLLETLEEFVRDRAKRG-----KSPERKEIEAPPPPPVQEEEPEPDMNEIKALPPPENYT  403

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E   ++ +  +  DL+NL ED  T ++  N+ ALALF G P  +         
Sbjct  404   PPPPPEPEPQPQKPQFTE--DLVNLREDEVTADDQGNKFALALFAGPPGNNGK-------  454

Query  609   WEAFN---------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGA  475
             WEAF+               G  DWE ALV+TAS+L  Q A   G FD L+L+GMY QG 
Sbjct  455   WEAFSSNGVTSAWQNPAAEPGKADWELALVETASNLEKQTAALGGGFDNLLLNGMYDQGM  514

Query  474   LNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPP  295
             + Q V++S  LT GSA+SVA    G+     L  P    D        DPFAASL++ PP
Sbjct  515   VRQHVSTS-QLTGGSASSVALPLPGKTNTQVLALPAP--DGTVEKVNQDPFAASLTIPPP  571

Query  294   AYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQP  160
             +YVQM+E+EKKQ LL +EQQ+WQQY ++GM GQ  L K      P
Sbjct  572   SYVQMAEMEKKQYLLNQEQQLWQQYQREGMRGQASLAKMNNGPVP  616


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 1/49 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR  1429
             ++TRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R+
Sbjct  109   YSTRRGTRMLNMSDFRDEAHSSSWDHSAFVRTYAGYLDQRLELALFERK  157



>ref|XP_010437928.1| PREDICTED: probable clathrin assembly protein At4g32285 [Camelina 
sativa]
Length=638

 Score =   219 bits (559),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 160/399 (40%), Positives = 227/399 (57%), Gaps = 34/399 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+C+PTG AK +R++L+A+Y VVKESF++Y  I E
Sbjct  227   TPLREMTPERIFGKMGHLQRLLDRFLSCRPTGLAKNSRMILIAMYPVVKESFRLYADICE  286

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  287   VLAVLLDKFFDMEYTDCVKAFDAYASSAKQIDELIAFYHWCKDTGVARSSEYPEVQRITS  346

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +       +S E            P  E   DMN IKALPP   + 
Sbjct  347   KLLETLEEFVRDRAKRG-----KSPERKEIEAPPPAAAPVEEPAVDMNEIKALPP--PEN  399

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                        + ++ Q + DL+NL ED  T +E  N+ ALALF G P  +         
Sbjct  400   YTPPPPPAPEPKPQQPQVMEDLVNLREDNVTGDEQGNKFALALFAGPPGNNGK-------  452

Query  609   WEAFN----------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQG  478
             WEAF                 G  DWE ALV+TAS+L NQKA   G  D L+L+ MY QG
Sbjct  453   WEAFPSDNGVTSAWQNPAAEIGKADWELALVETASNLENQKAAMGGGLDPLLLNLMYDQG  512

Query  477   ALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAP  298
             A+ Q V++S  LT GS++SVA    G+ + +     P   D        DPFAASL++ P
Sbjct  513   AVRQHVSTSE-LTGGSSSSVALPLPGKNSHILALPAP---DGTVQQVNQDPFAASLTIPP  568

Query  297   PAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             P+YVQM+E++KKQ LL +EQQ+WQQY ++GM GQ  L K
Sbjct  569   PSYVQMAEMDKKQYLLTQEQQLWQQYQQEGMRGQASLAK  607


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 1/47 (2%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNR  1432
             ATRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R
Sbjct  110   ATRRGTRILNMSDFRDEAHSSSWDHSAFVRTYASYLDQRLELALFER  156



>gb|KFK29836.1| hypothetical protein AALP_AA7G185200 [Arabis alpina]
Length=635

 Score =   218 bits (555),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 160/399 (40%), Positives = 226/399 (57%), Gaps = 35/399 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+ +PTG AK +R++L+A+Y +VKESF++Y  I E
Sbjct  225   TPLREMTPERIFGKMGHLQRLLDRFLSSRPTGLAKSSRMILIAMYPIVKESFRLYADICE  284

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  285   VLAVLLDKFFDMEYTDCVKAFDAYASAAKQIDELIAFYHWCKDTGVARSSEYPEVQRITS  344

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R+       R  R++ P  +  E     P  E   DMN IKALPPP    
Sbjct  345   KLLETLEEFVRD-------RAKRAKSPERKEIEAPPAPPVEEPAVDMNEIKALPPPENYT  397

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E   ++ +  D  DL+NL ED  T ++  N+ ALALF G  + +         
Sbjct  398   PPPPPKPEPKPQQPQVTD--DLVNLREDNVTGDDQGNKFALALFAGPASSNGK-------  448

Query  609   WEAFN----------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQG  478
             WEAF                 G  DWE ALV+TAS+L NQKA   G  D L+L+GMY QG
Sbjct  449   WEAFPSDNGVTSAWQNPAAELGKADWELALVETASNLENQKAAMGGGLDPLLLNGMYDQG  508

Query  477   ALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAP  298
              + Q V++S  LT GS++SVA     +     L  P    D        DPFAASL++ P
Sbjct  509   VVRQHVSTS-ELTGGSSSSVALPLPSKTNSHILALPAP--DGTVQKVNQDPFAASLTIPP  565

Query  297   PAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             P+YVQM+E++KKQ LL +EQQ+WQQY ++GM GQ  L K
Sbjct  566   PSYVQMAEMDKKQYLLTQEQQLWQQYQQEGMRGQSSLAK  604


 Score = 74.7 bits (182),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALAS  1405
             +ATRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R+GK+   +S
Sbjct  109   YATRRGTRILNMSDFRDEAHSSSWDHSAFVRTYASYLDQRLELALYERKGKNGGSSS  165



>ref|XP_004970790.1| PREDICTED: putative clathrin assembly protein At1g03050-like 
[Setaria italica]
Length=577

 Score =   214 bits (544),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 166/477 (35%), Positives = 239/477 (50%), Gaps = 47/477 (10%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD---SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASg  1402
              ATRRG R+L+MS FRD   +RS  WD++AFV  Y++YLD++++ RMQ R G  ++  + 
Sbjct  114   LATRRGRRVLDMSRFRDRGRARSRDWDFAAFVHAYAVYLDDRLKRRMQGRPGGVASPRNW  173

Query  1401  neegvee----edeeeetgntTAIVVTGTPIT--EMKNEYLYSRIQHYIQILDRFLACKP  1240
             + +         D   E      +V    P    E   E L ++ Q    IL RF+ C+P
Sbjct  174   SIDDGSLFFHDTDGRNEVHEAWELVPGENPAAAIEASTEDLIAKAQQLKHILGRFIDCRP  233

Query  1239  TGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQ  1060
             TG A+ NR+V  ALY++V ES   Y  + E++ +L+ RF +LD P   +VH IF  +AK 
Sbjct  234   TGKARTNRVVTAALYRLVTESAAAYCELTEVMVVLMGRFAELDTPACVRVHSIFTSLAKL  293

Query  1059  WDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspe  880
              DE++ FY W KA  + R S+ P+V+   ++ LD+               +         
Sbjct  294   VDEVDDFYAWCKATAVCRPSDVPEVQRVRQKNLDL---------------MYEFIRDRKA  338

Query  879   veeveepepeaeaeEDMNTIKAL--PPPPEDFI----EEMAVVEAPTEEKK-----EQDI  733
                     P     E  + ++A+  P P E  +    E  A   AP E        +  +
Sbjct  339   SASRRSRSPSYTPLEKYDVVRAIDEPAPREQQVTAREENNAGKAAPAEPAGSLVVVDDKM  398

Query  732   GDLLNLGEDA--PTPEEHANQLALALFDGiptidptkttittPWEAFNG-SEDWETALVQ  562
              D LNL ED   P+ EEH   L LALFDG P     +      W AF+  SEDWETALVQ
Sbjct  399   ADFLNLDEDTSPPSGEEHGRDLTLALFDGNPAEAAPE------WVAFDDPSEDWETALVQ  452

Query  561   TASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVL-TTGSATSVAFGSAGRpaml  385
             +    + ++A+  G FD   L+GMY   A   A  ++  L   GSA+SVA    G   + 
Sbjct  453   STRWPATRRAELGGGFDTAALNGMYSHAAAANATVTNARLFAAGSASSVAMQPLGGTVLA  512

Query  384   alpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTK  214
               P   ++  A    +    FAASL+V PP YVQM++L+ +QRLL +EQ  WQQY +
Sbjct  513   LPPPSGANTTAAAARADP--FAASLAVPPPTYVQMTDLQARQRLLVQEQNAWQQYER  567



>ref|XP_007148441.1| hypothetical protein PHAVU_006G209000g [Phaseolus vulgaris]
 gb|ESW20435.1| hypothetical protein PHAVU_006G209000g [Phaseolus vulgaris]
Length=617

 Score =   214 bits (545),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 153/217 (71%), Gaps = 12/217 (6%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALA----  1408
             F+TRRGTRLLNMSDFRD S+S  WD+SAFVRT +LYLDE++E +MQ+RRGK S  +    
Sbjct  112   FSTRRGTRLLNMSDFRDNSKSGSWDFSAFVRTCALYLDERLEYKMQSRRGKRSMYSFDEE  171

Query  1407  -------SgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLA  1249
                        E   E + ++ET     +    TP+  MK E ++S++QH   +L+RFLA
Sbjct  172   EEREREREREREREREREIDKETEKERDMAGRSTPVHNMKLEQIFSKMQHLHLLLERFLA  231

Query  1248  CKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRV  1069
             C+PTGAAK +R+V+VALY +VKESFQ+YY I+E+L +L+DRF  +++ +  KV++IF RV
Sbjct  232   CRPTGAAKNHRIVIVALYPIVKESFQIYYDISEILSVLIDRFPDMEVQECVKVYDIFCRV  291

Query  1068  AKQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLD  958
              KQ+DEL+ FY WS+  GI+R SEYP++E    +KL+
Sbjct  292   GKQFDELDPFYGWSRNIGIARSSEYPEIERITLKKLE  328


 Score =   169 bits (427),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 135/187 (72%), Gaps = 2/187 (1%)
 Frame = -1

Query  741  QDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQ  562
            Q  GDLLNLG+D  T E   ++LALALFDG   +    +T   PW AF+   DWETALVQ
Sbjct  408  QTEGDLLNLGDDTMTNEAQGDKLALALFDGEAAVAAASSTQALPWHAFDEEADWETALVQ  467

Query  561  TASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamla  382
            + ++LSNQK  + G FD L+LDGMY+   +N+A+  +G   +GS++SVA GSAGRP+MLA
Sbjct  468  STTNLSNQKPTYGGGFDTLLLDGMYKHAEMNKAMEGAGYGGSGSSSSVALGSAGRPSMLA  527

Query  381  lpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMH  202
            LPAPP+S       S +DPFAASL+VAPP+YVQMSE+EKKQR L EEQ MWQQY KDGM 
Sbjct  528  LPAPPTS--GGPGDSNSDPFAASLAVAPPSYVQMSEMEKKQRFLLEEQMMWQQYGKDGMQ  585

Query  201  GQVGLEK  181
            GQ  L+K
Sbjct  586  GQTALDK  592



>ref|XP_006654911.1| PREDICTED: probable clathrin assembly protein At4g32285-like 
[Oryza brachyantha]
Length=492

 Score =   211 bits (538),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 160/490 (33%), Positives = 215/490 (44%), Gaps = 129/490 (26%)
 Frame = -1

Query  1536  SDFRD-SRSNFWDYSAFVRTYSLYLDEQVE-----------LRMQNRRGKHSALASgnee  1393
             +DFRD + S  WD+SAFVR Y+ YLD +             +R  + RG     AS    
Sbjct  67    ADFRDEAHSASWDHSAFVRAYADYLDHRARFLISLLPAPRTVRFADERGSSPTPASS---  123

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRL  1213
                                    + +M  E L  R     Q+LDRFLAC+P+G A+ +R+
Sbjct  124   -----------------------VHDMDTEALLGRALQLRQLLDRFLACRPSGGARSSRV  160

Query  1212  VLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYT  1033
             VL  LY VVKES Q+   +A +L +L+DRF  +D PD  KV E     AKQ DEL  FY 
Sbjct  161   VLATLYAVVKESTQLCSDVAVVLAVLLDRFFDMDYPDCVKVFEAHVSTAKQTDELLAFYA  220

Query  1032  WSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepep  853
             W     ++R +++ DV     +++D       E+     GR       S      ++P  
Sbjct  221   WCDDVRLARPADFADV-----KRIDDKLLETLEQFVRERGR----AGQSSPPPWQQQPAR  271

Query  852   eaeaeEDMNTIKALPPPPEDFIE---EMAVVEAPTEEKKEQDI-----GDLLNLGEDAPT  697
               +   DMN IKALP P     E     A   AP  ++  + +     GDL++L E  P 
Sbjct  272   SDDPYPDMNGIKALPAPEHHAAEPSRSAAEKVAPVAKRSPEQVAPPQTGDLVDLRE--PV  329

Query  696   PEEHANQLALALFDGiptidptkttittPWEAF------------------NGSEDWETA  571
              ++  N+LALALF G              W AF                   G  DWE A
Sbjct  330   GDDQENKLALALFSG-------PPVADGGWVAFPSDDAPEVTSAWQTPAVEPGKADWELA  382

Query  570   LVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpa  391
             LV+TAS+LS QKA   G  D L+L G                                  
Sbjct  383   LVETASNLSRQKASMGGGLDPLLLHG----------------------------------  408

Query  390   mlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKD  211
                               G DPFAASL+V PPAYVQM+E+E+KQ+LL +EQQMW  Y + 
Sbjct  409   -------------TVHTVGGDPFAASLAVPPPAYVQMAEMERKQQLLVQEQQMWAHYRQG  455

Query  210   GMHGQVGLEK  181
             GM GQV +++
Sbjct  456   GMQGQVAMDR  465



>ref|XP_002960679.1| hypothetical protein SELMODRAFT_437722 [Selaginella moellendorffii]
 gb|EFJ38218.1| hypothetical protein SELMODRAFT_437722 [Selaginella moellendorffii]
Length=601

 Score =   209 bits (531),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 171/505 (34%), Positives = 250/505 (50%), Gaps = 59/505 (12%)
 Frame = -1

Query  1563  RRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVEL----------RMQNRRGKHS  1417
             R G R+L +S F D SRSN WDY+AFVRTY+LYLDE+++           R +       
Sbjct  110   RMGRRMLMLSAFTDESRSNGWDYTAFVRTYALYLDERLDCHVFSPGQAPKRERGGYDGGG  169

Query  1416  ALASgneegveeedeeeetgntTAIVVTGTPIT-EMKNEYLYSRIQHYIQILDRFLACKP  1240
                         +  ++    +     TG   T +MK + L  ++    +I++R LAC+P
Sbjct  170   YRNEEYRYSDSRDYYDDRRRESPPRQTTGQLKTKDMKPDMLLEKLPVMQRIMERMLACRP  229

Query  1239  TGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQ  1060
              GAA+ +RL  + LY ++KESFQ+Y  I + + +L++ F  ++  +S K  +I+ + AKQ
Sbjct  230   AGAARYHRLTQICLYMIIKESFQLYGEIRDGITVLLEAFFDMEYQESTKAFDIYAKSAKQ  289

Query  1059  WDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspe  880
              +EL+ FY   K  G+ R S+YP +    +  LD +E+ +RE+   +G R    R  SPE
Sbjct  290   SEELDSFYNVCKHIGVGRSSDYPTIVKVAQDHLDTLEDSLRERSR-SGSR--AQRPKSPE  346

Query  879   veeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAP  700
                  + E     + D N IKALP PP +        +   ++       DLLNL  D  
Sbjct  347   PSPPPKAEESEPEDIDYNGIKALPAPPVEPPAPEPEPQVEEKD------ADLLNL--DKS  398

Query  699   TPEEHANQLALALFDGiptidptkttittPWEAF-----------------NGSEDWETA  571
             T     ++LALALF           +    WE F                 NG   WE A
Sbjct  399   TMVAEGDRLALALFS-------DAPSANGKWEPFGSSTPQANGGSAASYSENGKAGWELA  451

Query  570   LVQTASHLSNQ-KAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRp  394
             LV  AS+L+        GNFD+L+LD MY QG++ Q   SS  +  GSA+SVA       
Sbjct  452   LVTEASNLAKTPTTSLAGNFDQLLLDSMYEQGSVAQKAVSS--MPAGSASSVAIPG----  505

Query  393   amlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTK  214
                  P    +  A +     DPF ASL V PP +VQM+++++KQRLL +EQQ+W QY +
Sbjct  506   ----KPTNYLALPAPSGTVDEDPFTASLGVPPPPFVQMADMQQKQRLLTQEQQLWNQYQQ  561

Query  213   DGMHGQVGLEKAQQSSQP-HNYYGY  142
             +GM GQ G      +  P + YY Y
Sbjct  562   NGMQGQYGYTSYYGNGHPQYGYYSY  586



>ref|XP_002983358.1| hypothetical protein SELMODRAFT_234210 [Selaginella moellendorffii]
 gb|EFJ15700.1| hypothetical protein SELMODRAFT_234210 [Selaginella moellendorffii]
Length=586

 Score =   208 bits (529),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 168/488 (34%), Positives = 252/488 (52%), Gaps = 40/488 (8%)
 Frame = -1

Query  1563  RRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVEL----------RMQNRRGKHS  1417
             R G R+L +S F D SRSN WDY+AFVRTY+LYLDE+++           R +       
Sbjct  110   RMGRRMLMLSAFTDESRSNGWDYTAFVRTYALYLDERLDCHVFSPGQAPKRERGGYDGGG  169

Query  1416  ALASgneegveeedeeeetgntTAIVVTGTPIT-EMKNEYLYSRIQHYIQILDRFLACKP  1240
                         +  ++    +     TG   T +MK + L  ++    +I++R LAC+P
Sbjct  170   YRNEEYRYSDSRDYYDDRRRESPPRQTTGQLKTKDMKPDMLLEKLPVMQRIMERMLACRP  229

Query  1239  TGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQ  1060
              GAA+ +RL  + LY ++KESFQ+Y  I + + +L++ F  ++  +S K  +I+ + AKQ
Sbjct  230   AGAARYHRLTQICLYMIIKESFQLYGEIRDGITVLLEAFFDMEYQESTKAFDIYAKSAKQ  289

Query  1059  WDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspe  880
              +EL+ FY   K  G+ R S+YP +    +  LD +E+ +RE+   +G R    R  SPE
Sbjct  290   SEELDSFYNVCKHIGVGRSSDYPTIVKVAQDHLDTLEDSLRERSR-SGSR--AQRPKSPE  346

Query  879   veeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAP  700
                  + E     + D N IKALP PP +        +   ++       DLLNL  D  
Sbjct  347   PSPPPKAEESEPEDIDYNGIKALPAPPVEPPAPEPEPQVEEKD------ADLLNL--DKS  398

Query  699   TPEEHANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQ-KAQFP  523
             T     ++LALALF   P+ +    + +      NG   WE ALV  AS+L+        
Sbjct  399   TMVAEGDRLALALFSDAPSANGNAASYSE-----NGKAGWELALVTEASNLAKTPTTSLA  453

Query  522   GNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTT  343
             GNFD+L+LD MY QG++ Q   SS  +  GSA+SVA            P    +  A + 
Sbjct  454   GNFDQLLLDSMYEQGSVAQKAVSS--MPAGSASSVAIPG--------KPTNYLALPAPSG  503

Query  342   ASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQ  163
                 DPF+ASL V PP +VQM+++++KQRLL +EQQ+W QY ++GM GQ G      +  
Sbjct  504   TVDEDPFSASLGVPPPPFVQMADMQQKQRLLTQEQQLWNQYQQNGMQGQYGYTSYYGNGH  563

Query  162   P-HNYYGY  142
             P + +Y Y
Sbjct  564   PQYGHYSY  571



>ref|NP_001168422.1| putative ENTH/ANTH/VHS superfamily protein [Zea mays]
 gb|ACN28161.1| unknown [Zea mays]
 gb|AFW74952.1| putative ENTH/ANTH/VHS superfamily protein [Zea mays]
Length=597

 Score =   207 bits (526),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 165/462 (36%), Positives = 234/462 (51%), Gaps = 42/462 (9%)
 Frame = -1

Query  1533  DFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgneegveeedeeeetg  1357
             DFRD +    WD+SAFVR Y+ YL ++V   +                 +        + 
Sbjct  132   DFRDDAHPGSWDHSAFVRAYATYLLDRVRFLV-----------------LLLPAPPRFSD  174

Query  1356  ntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKES  1177
                A      P  +M  E L  R +H   +LDR LAC+P GAA  +R+V  AL+ ++++S
Sbjct  175   GRVAPGPPQAPADDMDAEALLGRARHLRHLLDRLLACRPAGAAGASRVVRAALHPMLRDS  234

Query  1176  FQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSE  997
             F+VY  +A +L +L+DRF  +D  D  K  E +   AKQ D L  FY W + AGI+R S+
Sbjct  235   FRVYEDVALLLALLLDRFFDMDYSDCVKAFETYVGTAKQIDALRAFYAWCEDAGIARSSD  294

Query  996   YPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIK  817
             +PDV+    + L+ ME+ +RE+                  +     + +    + MN+IK
Sbjct  295   FPDVKRVDDKLLETMEQFLRERGRAGRAWASPPAPSRLAHQPDANAQGDDGHVDGMNSIK  354

Query  816   ALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGipti-  640
              LP P    I        P EE  + D   L++L E A T +E  N+LALALF   P   
Sbjct  355   VLPAPSTRSIGAEPATPRPAEEASQSD---LVDLRETAATADEEGNKLALALFSAPPATN  411

Query  639   -----------dptkttittPWE---AFNGSEDWETALVQTASHLSNQKAQFPGNFDELM  502
                           +  +T+ W    A   + DWE ALV+TAS+LS Q A   G  D L+
Sbjct  412   GSWVTFPSGPDAAPEPAVTSAWHTPAAEPRNADWELALVETASNLSKQAASLGGGMDTLL  471

Query  501   LDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPF  322
             L GMY  GA+ + VA+      GSA+S+A     + A + +   P  + A   A G DPF
Sbjct  472   LGGMYDHGAVRRQVAA-----PGSASSMALLPGHQVAPVLMLLGPDGSTARQVAGG-DPF  525

Query  321   AASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQ  196
             AASL+V PP+YVQM+E+E+KQ+LL +EQQMW QY   GM GQ
Sbjct  526   AASLAVPPPSYVQMAEMERKQQLLVQEQQMWAQYRHGGMQGQ  567



>ref|XP_006412495.1| hypothetical protein EUTSA_v10024663mg [Eutrema salsugineum]
 gb|ESQ53948.1| hypothetical protein EUTSA_v10024663mg [Eutrema salsugineum]
Length=637

 Score =   207 bits (528),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 155/399 (39%), Positives = 227/399 (57%), Gaps = 34/399 (9%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EM  E ++ ++ H  ++LDRFL+ +PTG AK +R++L+A+Y +VKESF++Y  I E
Sbjct  226   TPLREMAPEMIFGKMGHLQRLLDRFLSSRPTGLAKSSRMILIAMYPIVKESFRLYADICE  285

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F +++  D  K  + +   AKQ DEL  FY W K  G++R SEYP+V+    
Sbjct  286   VLAVLLDKFFEMEYKDCVKAFDAYASAAKQIDELIAFYHWCKDTGVARSSEYPEVQRITS  345

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +              E+E    P    E   DMN IKALPPP  + 
Sbjct  346   KLLETLEEFVRDRAKRP------KSPERKEIEAPPPPPQVEEPAVDMNEIKALPPPENNT  399

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                    E   ++ +  D  DL+NL +D  T ++  N+ ALALF G  + +         
Sbjct  400   PPPPPKPEPKPQQPQVTD--DLVNLRDDGVTADDQGNKFALALFAGPASSNGK-------  450

Query  609   WEAFN----------------GSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQG  478
             WEAF+                G  DWE ALV+TAS+L NQK+   G  D L+L+GMY QG
Sbjct  451   WEAFSSDNGVTSAWQNPAAEPGKADWELALVETASNLENQKSAMGGGLDPLLLNGMYDQG  510

Query  477   ALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAP  298
             A+ Q V++S +    S++SVA    G+     L  P    D        DPFAASL++ P
Sbjct  511   AVRQHVSTSELSGG-SSSSVALPLPGKTNSQILALPAP--DGTVQKVNQDPFAASLTIPP  567

Query  297   PAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEK  181
             P+YVQM+E++KKQ LL +EQQ+WQQY ++GM GQ  L K
Sbjct  568   PSYVQMAEMDKKQYLLTQEQQLWQQYQQEGMRGQASLAK  606


 Score = 72.4 bits (176),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 45/52 (87%), Gaps = 1/52 (2%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKH  1420
             +ATRRGTR+LNMSDFRD + S+ WD+SAFVRTY+ YLD+++EL +  R+G++
Sbjct  109   YATRRGTRILNMSDFRDEAHSSSWDHSAFVRTYASYLDQRLELALFERKGRN  160



>gb|EYU34984.1| hypothetical protein MIMGU_mgv1a003921mg [Erythranthe guttata]
Length=555

 Score =   205 bits (522),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 169/484 (35%), Positives = 249/484 (51%), Gaps = 51/484 (11%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDS--RSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgn  1399
             FA+ +GTR+LNMSDFRD    +N ++ + F+ +++ YLD+++E+ + + + K   L +GN
Sbjct  111   FASWKGTRVLNMSDFRDEAHNTNLFEQTGFLVSFASYLDQKLEIIVYDLK-KSRVLGNGN  169

Query  1398  eegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRN  1219
              +  +E+ E+ +      I V               R+   +Q+LDRFLAC+P GAA+  
Sbjct  170   NDDDKEKGEKNKYDELGFIRVV-------------ERLNLQLQLLDRFLACRPRGAARNT  216

Query  1218  RLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVF  1039
             R+VLVAL  +VKESF VY  + ++L    D F +L      +  + + + AK  D L  F
Sbjct  217   RMVLVALQVLVKESFAVYSDVTDVLEHFQDCFHELKYVYCVRAFDAYVKAAKIMDGLIGF  276

Query  1038  YTWSKAAGI--SRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeve  865
             Y+W K   +  +  S++P V+    + L  +E +++EK                  E  E
Sbjct  277   YSWCKDLELVFATPSDFPKVQKISDEILRALEMVLKEKKTT----------EKSPNETRE  326

Query  864   epepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIG-DLLNLGEDAPTPEE  688
             E   E   +  +N IKALPPP E+F         P   + +Q I  +L+NL +      +
Sbjct  327   EETKEETVQNAINEIKALPPP-ENF--------NPQPHQNQQLITENLVNLVD---FDNQ  374

Query  687   HANQLALALFDGiptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQFPGNFDE  508
               + LALALF        T        E  NG  DWE  LV ++S+LS QKA   G FD 
Sbjct  375   EGDNLALALFSTNGDAKATSAWQNPAVE--NGRSDWELVLVDSSSNLSIQKADLAGGFDS  432

Query  507   LMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGA-  331
             LML+GMY  G   +  AS+G    GSA+SVA        M        + D      G  
Sbjct  433   LMLNGMYDHGTQVRQHASNG----GSASSVALPGINGAMMNNKVLALPAPDGTVKPVGQQ  488

Query  330   DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQ---SSQP  160
             DPFAASLSV PP+YVQ++++E+KQ LL +EQ  WQQY+ +GM G +G  K      +S P
Sbjct  489   DPFAASLSVPPPSYVQIADMERKQVLLAQEQHRWQQYSTNGMQGPMGFAKIASYYDTSMP  548

Query  159   HNYY  148
             + YY
Sbjct  549   YGYY  552



>ref|XP_008666278.1| PREDICTED: LOW QUALITY PROTEIN: putative clathrin assembly protein 
At2g25430 [Zea mays]
Length=452

 Score =   201 bits (512),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 146/379 (39%), Positives = 198/379 (52%), Gaps = 77/379 (20%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
              TRRGTRLLN+SDF D + S  WD+SAFVRTY+LYLD+++E  +  R             
Sbjct  111   GTRRGTRLLNLSDFWDEAHSGSWDHSAFVRTYALYLDQRLEFFLHER-------------  157

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQ-ILDRFLACKPTGAAKRNR  1216
                                        K  +L   +  ++Q +LDRFLAC+PTG AK++R
Sbjct  158   ---------------------------KQGFLDRFLADHLQXLLDRFLACRPTGGAKQSR  190

Query  1215  LVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFY  1036
             LVLVALYQ+V+ESFQ+Y  I E+L +L+DRF  ++  +  K  E +   AKQ DEL  FY
Sbjct  191   LVLVALYQIVRESFQLYSDICEVLAVLLDRFFDMEYAECVKAFEAYASAAKQIDELSAFY  250

Query  1035  TWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepe  856
              W K +G++R SEYP+V++   + L+ +E+ +R++ +                 E E   
Sbjct  251   AWCKDSGVARSSEYPEVQHVTDKLLETLEKFMRDRAKRP----------KSPPREPEPEP  300

Query  855   peaeaeEDMNTIKALPPPPEDFI--EEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHA  682
              + E E DMN+IKAL P PED+   E M V E    E   Q  GDL++L E   + +E  
Sbjct  301   VKEEPEPDMNSIKAL-PAPEDYKEPEPMKVEEEVKPEPPPQPQGDLVDLREHTVSADEQG  359

Query  681   NQLALALFDGiptidptkttittPWEAF------------------NGSEDWETALVQTA  556
             N+LALALF G     P  +     WEAF                   G  DWE ALV+TA
Sbjct  360   NRLALALFQG----PPAASGNNGSWEAFPSNGGNEVTSAWQNPAAEPGKADWELALVETA  415

Query  555   SHLSNQKAQFPGNFDELML  499
             S+LS QK    G  D L+L
Sbjct  416   SNLSMQKPAMSGGMDPLLL  434



>ref|XP_002458865.1| hypothetical protein SORBIDRAFT_03g041725 [Sorghum bicolor]
 gb|EES03985.1| hypothetical protein SORBIDRAFT_03g041725 [Sorghum bicolor]
Length=562

 Score =   203 bits (516),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 176/472 (37%), Positives = 248/472 (53%), Gaps = 50/472 (11%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD---SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASg  1402
              ATRRG R+L++  FRD   +RS  WDY+AFVR Y+ YLD++++ RMQ R     A + G
Sbjct  106   LATRRGRRMLDVPRFRDRERARSRDWDYAAFVRAYAAYLDDRLKQRMQARGAGAGAASPG  165

Query  1401  neegveeedeeeetgntT-AIVVTG-TPITE-MKNEYLYSRIQHYIQILDRFLACKPTGA  1231
                   + D           +V  G  P+TE    E + ++ Q    +L RF+ C+PTG 
Sbjct  166   KWHVDGDTDRTTYEVPEAWELVPPGERPLTEATTTEDVIAKAQQLKHLLGRFIECRPTGK  225

Query  1230  AKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDE  1051
             A+ N +V  ALY++VKES  +Y  + E++ +LVDRF +L  P   +VH IF  +AK  DE
Sbjct  226   ARMNPVVTAALYRLVKESAAMYCELTEVMVVLVDRFAELGTPACVRVHSIFTSLAKMVDE  285

Query  1050  LEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAG--GRIMrsrepspev  877
             L+ FY+W KA  + R S+ P+++   ++ LD+M+E IR++   A   GR           
Sbjct  286   LDDFYSWCKATDVCRPSDVPEIQRVRQKNLDLMDEFIRDRHVSASQWGR-----------  334

Query  876   eeveepepeaeaeEDMNTIKALPPPPEDFI-----EEMAVVEAPTEEKK-----EQDIGD  727
                           + N +KA+ P P++       E  A   AP E        +    D
Sbjct  335   --------SPPTPVEKNDVKAIEPEPKEHQVVAREENNAGKAAPAELASSLVVVDDKTAD  386

Query  726   LLNLGEDA--PTPEEHANQLALALFDGiptidptkttittPWEAFNGSE-DWETALVQTA  556
              LNL EDA  P+ EEH   L LALFDG              W AF+ SE DWETALVQ+ 
Sbjct  387   FLNLDEDASPPSGEEHGRNLTLALFDG------NSAEAAPKWVAFDDSEADWETALVQST  440

Query  555   SH-LSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlal  379
             S   +  + +  G F+  +LD M      N AV ++     GSA+SVA    G   +LAL
Sbjct  441   SMPAAAHRWELGGGFNTTVLD-MCNHATAN-AVETNARAFAGSASSVATQPLG-ATVLAL  497

Query  378   pappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQ  223
             P PP ++ A   A+ ADPFAASL+V PP  VQM++L+ + RLL +EQ  W Q
Sbjct  498   PPPPGASTAAAAAARADPFAASLAVPPPICVQMTDLQTRHRLLMQEQNAWHQ  549



>tpg|DAA46805.1| TPA: putative ENTH/ANTH/VHS superfamily protein [Zea mays]
Length=541

 Score =   199 bits (506),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 145/389 (37%), Positives = 197/389 (51%), Gaps = 87/389 (22%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
              TRRGTRLLN+SDF D + S  WD+SAFVRTY+LYLD+++E                   
Sbjct  111   GTRRGTRLLNLSDFWDEAHSGSWDHSAFVRTYALYLDQRLEF------------------  152

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRL  1213
                                           +L+ R Q +   LDRFLAC+PTG AK++RL
Sbjct  153   ------------------------------FLHERKQGF---LDRFLACRPTGGAKQSRL  179

Query  1212  VLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYT  1033
             VLVALYQ+V+ESFQ+Y  I E+L +L+DRF  ++  +  K  E +   AKQ DEL  FY 
Sbjct  180   VLVALYQIVRESFQLYSDICEVLAVLLDRFFDMEYAECVKAFEAYASAAKQIDELSAFYA  239

Query  1032  WSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepep  853
             W K +G++R SEYP+V++   + L+ +E+ +R++ +                 E E    
Sbjct  240   WCKDSGVARSSEYPEVQHVTDKLLETLEKFMRDRAKRP----------KSPPREPEPEPV  289

Query  852   eaeaeEDMNTIKALPPPPEDF--IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHAN  679
             + E E DMN+IKAL P PED+   E M V E    E   Q  GDL++L E   + +E  N
Sbjct  290   KEEPEPDMNSIKAL-PAPEDYKEPEPMKVEEEVKPEPPPQPQGDLVDLREHTVSADEQGN  348

Query  678   QLALALFDGiptidptkttittPWEAF------------------NGSEDWETALVQTAS  553
             +LALALF G     P  +     WEAF                   G  DWE ALV+TAS
Sbjct  349   RLALALFQG----PPAASGNNGSWEAFPSNGGNEVTSAWQNPAAEPGKADWELALVETAS  404

Query  552   HLSNQKAQFPGNFDELMLDGMYRQGALNQ  466
             +LS QK    G  +  + D  ++Q    Q
Sbjct  405   NLSMQKPAMSGALEHFLFDPQHKQHDFGQ  433



>ref|NP_001044997.1| Os01g0881100 [Oryza sativa Japonica Group]
 dbj|BAC06233.1| clathrin assembly protein-like [Oryza sativa Japonica Group]
 dbj|BAF06911.1| Os01g0881100 [Oryza sativa Japonica Group]
 gb|EAZ14379.1| hypothetical protein OsJ_04299 [Oryza sativa Japonica Group]
 dbj|BAG98915.1| unnamed protein product [Oryza sativa Japonica Group]
Length=521

 Score =   187 bits (474),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 152/472 (32%), Positives = 212/472 (45%), Gaps = 88/472 (19%)
 Frame = -1

Query  1572  FATRRGTRLLNMSD---FRDSRSN-FWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALAS  1405
              ATRRG R+L++S     R SRS   WD+  FVR Y+ YLD++++ RM+ R        S
Sbjct  113   LATRRGRRMLDVSHRFPHRSSRSRATWDFHGFVRAYAAYLDDRLKHRMKGRVASQGKWCS  172

Query  1404  gneegveeedeeeetgntTAIVVTGTPITE-------MKNEYLYSRIQHYIQILDRFLAC  1246
                     +  +       A+      +            E L S+ QH   IL RF+ C
Sbjct  173   DGRRDGFPDITDGSYEVGEAVAEVWALVPRDTPATGTTTTEELVSKAQHLKHILQRFIGC  232

Query  1245  KPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVA  1066
             +PTG A+ N++V  AL+++VKES  +Y  + E++ +L DRF +L+ P   +VH IF  +A
Sbjct  233   RPTGKARTNKVVAAALHRLVKESAVMYRELTEVMAMLADRFAELETPCCVRVHSIFTSIA  292

Query  1065  KQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsreps  886
             K +DEL+ FY+W ++A I R SE P+VE   ++KLD+M+E IR        R   S    
Sbjct  293   KLFDELDEFYSWCRSATICRPSEIPEVERVAQKKLDLMDEFIR-------DRQPASSRWW  345

Query  885   peveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGED  706
                           A    N+ KA P  P      + V         +  + D LNLGE+
Sbjct  346   RCTPPAPSSPLAPIASNGDNSSKASPAEPAPAGALVVV---------DDHMADFLNLGEE  396

Query  705   APTP---EEHANQLALALFDGiptidptkttittPWEAFNG--SEDWETALVQTASHLSN  541
             + TP   EE    L L+LF           T    WE F+    +DWETALVQ+AS  + 
Sbjct  397   S-TPLSTEEQDRDLTLSLFGD------DPATPAPKWETFDDDQCDDWETALVQSASKFA-  448

Query  540   QKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappss  361
                                               T SAT +A                  
Sbjct  449   ---------------------------------ATQSATVLALPPP--------------  461

Query  360   ADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGM  205
                 T    ADPFAASL+V PP YVQM +++ +QRLL  EQ MWQQ+    M
Sbjct  462   -PGATGGEVADPFAASLAVPPPTYVQMMDMQARQRLLANEQMMWQQFETQQM  512



>gb|EAY76714.1| hypothetical protein OsI_04669 [Oryza sativa Indica Group]
Length=521

 Score =   186 bits (473),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 152/472 (32%), Positives = 211/472 (45%), Gaps = 88/472 (19%)
 Frame = -1

Query  1572  FATRRGTRLLNMSD---FRDSRSN-FWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALAS  1405
              ATRRG R+L++S     R SRS   WD+  FVR Y+ YLD++++ RM+ R        S
Sbjct  113   LATRRGRRMLDVSHRFPHRSSRSRATWDFHGFVRAYAAYLDDRLKHRMKGRVASQGKWCS  172

Query  1404  gneegveeedeeeetgntTAIVVTGTPITE-------MKNEYLYSRIQHYIQILDRFLAC  1246
                     +  +       A+      +            E L S+ QH   IL RF+ C
Sbjct  173   DGRRDGFPDITDGSYEVGEAVAEVWALVPRDTPATGTTTTEELVSKAQHLKHILQRFIGC  232

Query  1245  KPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVA  1066
             +PTG A+ N++V  AL+++VKES  +Y  + E++ +L DRF +L+ P   +VH IF  +A
Sbjct  233   RPTGKARTNKVVAAALHRLVKESAVMYRELTEVMAMLADRFAELETPGCVRVHSIFTSIA  292

Query  1065  KQWDELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsreps  886
             K +DEL+ FY+W ++A I R SE P+VE   ++KLD+M+E IR        R   S    
Sbjct  293   KLFDELDEFYSWCRSATICRPSEIPEVERVAQKKLDLMDEFIR-------DRQPASSRWW  345

Query  885   peveeveepepeaeaeEDMNTIKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGED  706
                           A    N  KA P  P      + V         +  + D LNLGE+
Sbjct  346   RCTPPAPSSPLAPIASNGDNGSKASPAEPAPAGALVVV---------DDHMADFLNLGEE  396

Query  705   APTP---EEHANQLALALFDGiptidptkttittPWEAFNG--SEDWETALVQTASHLSN  541
             + TP   EE    L L+LF           T    WE F+    +DWETALVQ+AS  + 
Sbjct  397   S-TPLSTEEQDRDLTLSLFGD------DPATPAPKWETFDDDQCDDWETALVQSASKFA-  448

Query  540   QKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappss  361
                                               T SAT +A                  
Sbjct  449   ---------------------------------ATQSATVLALPPP--------------  461

Query  360   ADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGM  205
                 T    ADPFAASL+V PP YVQM +++ +QRLL  EQ MWQQ+    M
Sbjct  462   -PGATGGEVADPFAASLAVPPPTYVQMMDMQARQRLLANEQMMWQQFETQQM  512



>ref|XP_008657000.1| PREDICTED: putative clathrin assembly protein At1g03050 [Zea 
mays]
 gb|AFW84382.1| putative ENTH/ANTH/VHS superfamily protein [Zea mays]
Length=555

 Score =   187 bits (474),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 155/479 (32%), Positives = 224/479 (47%), Gaps = 76/479 (16%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDSRSNF-----WDYSAFVRTYSLYLDEQVELRMQNRRGKHSALA  1408
              ATRRG R+L++S FRD   +      W ++AFV  Y+ YLD++++ RMQ R    ++  
Sbjct  113   LATRRGRRMLDLSRFRDRDRDRARCRDWCFAAFVHAYATYLDDRLKHRMQARGACGASPG  172

Query  1407  SgneegveeedeeeetgntTAIVVTGTPITEMKNEY---LYSRIQHYIQILDRFLACKPT  1237
               + +G  +    E       +V  G   +  +      +  + Q    +L RF+ C+PT
Sbjct  173   KWHVDGDPDAMACEVAEAAWELVPRGRSASATETAAAEDVVGKAQQLKHLLGRFIQCRPT  232

Query  1236  GAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQW  1057
             G A+ N +V  ALY++VKES  +Y  + E++ +L+DRF  L  P   +VH IF  +AK  
Sbjct  233   GKARTNPVVTAALYRLVKESAAMYCELTEVMVVLLDRFADLGTPACVRVHSIFTSLAKLV  292

Query  1056  DELEVFYTWSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAG--GRIMrsrepsp  883
             DEL+ FY+W KA  + R S+ P+++   +  LD+M+E IR++   A   GR         
Sbjct  293   DELDDFYSWCKATDVCRPSDIPEIQRVKQTNLDLMDEFIRDRQASASPWGR---------  343

Query  882   eveeveepepeaeaeEDMNTIKALPPPPED-----FIEEMAVVEAPTEEKKE--------  742
                               N ++   P P+        E  A   AP E            
Sbjct  344   ----------SPPTPIKKNDVRGTEPTPKQQQGVAPKENSAGKAAPAEPATSPVVVDVVH  393

Query  741   -QDIGDLLNLGEDA-PTP--EEHANQLALALFDGiptidptkttittPWEAFNGSE-DWE  577
                  D LNLGEDA P+   EEH   L LALF+G              W AF+ SE DWE
Sbjct  394   DDKTADFLNLGEDASPSSGEEEHGMNLTLALFEG------NSAEAAPKWVAFDDSEADWE  447

Query  576   TALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSATSVAFGSAGR  397
             TALVQ+    S Q+++  G F              N    +S    TGSA+S+A    G 
Sbjct  448   TALVQST---STQRSELGGGF--------------NTTTVTSTRAFTGSASSMATQPLG-  489

Query  396   pamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQY  220
                              + + ADPFAASL+V PP  VQM++L+ +QRLL +EQ  W QY
Sbjct  490   -----ATVLALPPPLGASTARADPFAASLAVPPPICVQMTDLQTRQRLLMQEQNSWHQY  543



>ref|XP_006646535.1| PREDICTED: putative clathrin assembly protein At1g03050-like 
[Oryza brachyantha]
Length=454

 Score =   179 bits (454),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 141/448 (31%), Positives = 202/448 (45%), Gaps = 68/448 (15%)
 Frame = -1

Query  1518  RSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALA--------Sgneegveeedeeee  1363
             RS   D+ AFVR Y+ YLD++++ RM+ R G  ++           G  E     +  E 
Sbjct  50    RSRARDFYAFVRAYAAYLDDRLKHRMKGRGGTVASHGRWCLEGRRDGFPETGGRYEVGEV  109

Query  1362  tgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVK  1183
               +  A+V    P TE   E L ++ QH   ILDRF+AC+PTG A+ N++V  AL+++VK
Sbjct  110   VPDVWAVVPREPPATETTAEELIAKAQHLKHILDRFIACRPTGKARTNQVVTAALHRLVK  169

Query  1182  ESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRL  1003
             ES  +Y  +  ++ +L+DRF  L+ P   +VH IF  VA   DEL+ FY+W + A I   
Sbjct  170   ESAAMYSELTGVMSVLIDRFAMLETPACVRVHSIFTSVATLLDELDDFYSWCRFAAICPS  229

Query  1002  SEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNT  823
             SE PDVE+  ++KLD        +   A         P         P     +   ++ 
Sbjct  230   SEIPDVEHVAQKKLD--LMDKFIRDRQAAPAPSSPHAPIATAPAPSSPHAPIASNGGIDA  287

Query  822   IKALPPPPEDFIEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTP---EEHANQLALALFDG  652
              K LP P     E    +        +  + D L+L E+  TP   EE     A +LF G
Sbjct  288   TKPLPAPEVKGAEPAGALVV-----VDDHMADFLHLDEET-TPLSAEEQERNPARSLFGG  341

Query  651   iptidptkttittPWEAFNG--SEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQG  478
                           WEAF+   S+DWETA VQ+AS  + Q+                   
Sbjct  342   -------DPLTPAKWEAFDDDPSDDWETARVQSASRFATQQL------------------  376

Query  477   ALNQAVASSGVLTTGSATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAP  298
                 A+      TT  A     G+                   T +   DPFAASL+V P
Sbjct  377   ---SAMQPPHCATTVLALPPPPGA-------------------TASQATDPFAASLAVPP  414

Query  297   PAYVQMSELEKKQRLLWEEQQMWQQYTK  214
             P YVQM +++ +QRLL  EQ MWQQ+ +
Sbjct  415   PTYVQMMDMQARQRLLANEQMMWQQFER  442



>ref|XP_003568997.1| PREDICTED: probable clathrin assembly protein At4g32285 [Brachypodium 
distachyon]
Length=581

 Score =   180 bits (456),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 153/476 (32%), Positives = 227/476 (48%), Gaps = 62/476 (13%)
 Frame = -1

Query  1536  SDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgneegveeedeeeet  1360
             ++FRD +    WD++AFVR  +LYLD++    +        +L            +   +
Sbjct  106   AEFRDEAHPASWDHTAFVRALALYLDDRARFLL--------SLLPPPRTVRFASLDGPSS  157

Query  1359  gntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKE  1180
                 A  +   P  EM    L +R      +++R LAC+P GAA+R+R+VL AL+ VVK+
Sbjct  158   SPAPAADMAARPAHEMDAAALLARAGQLRHLIERCLACRPAGAARRSRVVLAALWPVVKD  217

Query  1179  SFQVYYSIAEMLGILVDRFMKL-DIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRL  1003
             S  +Y  +A +L  L+DRF  + D  D  +  E     A+  D L   Y W   AG++R 
Sbjct  218   SAALYADMAAVLAALLDRFFDMEDYEDCAEAFEAHVSAARLADGLLALYAWCDHAGVARS  277

Query  1002  S--EYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDM  829
             S  E+P+V+    + L+ +E+++RE+ +    +                       E D+
Sbjct  278   SDLEFPEVKRVDDKFLETLEQLLRERGQAEAAQT--------PSPPPANAHVMDGIERDV  329

Query  828   NTIKALPPPPEDF----IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALAL  661
             N I+ALP P E +     +  A   AP  +++ Q+ G+L++L E A   EE  N++ALAL
Sbjct  330   NGIRALPAP-EHYKLAPTKAAAAAVAPMGDEQIQEQGELVDLRESA---EEQGNKMALAL  385

Query  660   FDG----------------iptidptkttittPWEAFNGSEDWETALVQTASHLSNQKAQ  529
             F G                    D       + W+       WE ALV+TAS LS +   
Sbjct  386   FSGDPPAPETKNGGWVAFPSEDDDDAAAITASAWQTPAAEPGWELALVETASTLSTRGTA  445

Query  528   FPGN-FDELMLDGMYRQGAL---NQAVASSGVLTTGSATSVAFGSAGRpamlalpappss  361
              PG   D L+L GMY  GA     Q  A+SG     SA+SV    AG           + 
Sbjct  446   APGGGMDALLLQGMYDHGAAVRQQQQHAASG-----SASSVVLPGAG---------FLAL  491

Query  360   ADANTTASGADPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQV  193
                     G DPFAASL+V PPAYVQM+E+E+K+ LL +EQ+MW QY + GM G+ 
Sbjct  492   PGPGVHGGGGDPFAASLAVPPPAYVQMAEMERKRELLAQEQRMWAQYRQGGMQGRT  547



>gb|EPS72901.1| hypothetical protein M569_01858, partial [Genlisea aurea]
Length=361

 Score =   174 bits (440),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 128/207 (62%), Gaps = 14/207 (7%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRDS--RSNFWDYSAFVRTYSLYLDEQVELRMQNR-RGKHSALASg  1402
             F TR+ T  LN+S FRDS  R + WD+SAFVRTY++YLDE VE RMQ R R +H      
Sbjct  108   FETRKRTCFLNVSGFRDSSFRRHAWDFSAFVRTYAMYLDEDVEFRMQGRKRTRHWDEEED  167

Query  1401  neegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKR  1222
              E+                I    TP+ E+ NE ++    H  Q++ +FLACKPTGAAK 
Sbjct  168   EEDEKGSR-----------IWTRTTPVREISNELVFFMAHHVKQLIQKFLACKPTGAAKH  216

Query  1221  NRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEV  1042
             + +V  ALY++V ES +++  + E++ +L +RFM+L++PD  +V+EIF  V+  +DEL+ 
Sbjct  217   DEIVGAALYRIVIESIRLHDGMNEIIEVLTERFMELEVPDMARVYEIFCSVSVLYDELDA  276

Query  1041  FYTWSKAAGISRLSEYPDVENYPKQKL  961
             FY W K A I   SEYP+VE  P +KL
Sbjct  277   FYEWCKNAAIGSTSEYPEVEKIPHKKL  303



>ref|XP_010051791.1| PREDICTED: putative clathrin assembly protein At2g25430 [Eucalyptus 
grandis]
Length=351

 Score =   169 bits (427),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 135/384 (35%), Positives = 192/384 (50%), Gaps = 69/384 (18%)
 Frame = -1

Query  1329  TPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAE  1150
             TP+ EMK E ++ ++ H  ++L+RFLAC+PTG AK +RL+LVALY VVKESFQVY  I E
Sbjct  27    TPLREMKPERIFGKMGHLQRLLERFLACRPTGLAKNSRLILVALYPVVKESFQVYADICE  86

Query  1149  MLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYTWSKAAGISRLSEYPDVENYPK  970
             +L +L+D+F  ++  D  K  +     AKQ DEL  FY W K  G++R  EYP+V+ +  
Sbjct  87    VLAVLLDKFYDMEYQDCVKAFDANASAAKQIDELIAFYNWCKDTGVARSLEYPEVQRFTS  146

Query  969   QKLDimeeiirekmeMAGGRIMrsrepspeveeveepepeaeaeEDMNTIKALPPPPEDF  790
             + L+ +EE +R++ +          +     EE+     E E   DM  +KAL PPPE++
Sbjct  147   KLLETLEEFVRDRAKRP--------KSPERREELLPVAKEEEPVPDMKEMKAL-PPPENY  197

Query  789   IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHANQLALALFDGiptidptkttittP  610
                        E  K Q   DL++L +D  T ++  N+ ALALF G     P   T    
Sbjct  198   TPTPPPEPK-PEPPKPQVTEDLVDLRDDGVTADDQGNKFALALFVG-----PPANTGNGS  251

Query  609   WEAFNGSEDWE-TALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTG  433
             WEAF  + + E T+  QT +  S ++              M RQ        S+  LT G
Sbjct  252   WEAFPSNGEPEVTSAWQTPAAESGKEE-------------MVRQH------VSTAQLTGG  292

Query  432   SATSVAFGSAGRpamlalpappssADANTTASGADPFAASLSVAPPAYVQMSELEKKQRL  253
             SA+SVA    G+                             S  P     M+E+EKKQ L
Sbjct  293   SASSVALPGLGK-----------------------------STTP-----MAEMEKKQHL  318

Query  252   LWEEQQMWQQYTKDGMHGQVGLEK  181
             + +EQQ+WQQY  +G+ GQ  L K
Sbjct  319   VVQEQQLWQQYAMEGLQGQATLGK  342



>gb|AFW86798.1| putative ENTH/ANTH/VHS superfamily protein [Zea mays]
Length=570

 Score =   172 bits (437),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 128/338 (38%), Positives = 176/338 (52%), Gaps = 71/338 (21%)
 Frame = -1

Query  1569  ATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRRGKHSALASgnee  1393
              TRRGTRLLN+SDFRD + S  WD+SAFVRTY+LYLD+++E  +Q R+            
Sbjct  172   GTRRGTRLLNLSDFRDEAHSGSWDHSAFVRTYALYLDQRLEFFLQERK------------  219

Query  1392  gveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILDRFLACKPTGAAKRNRL  1213
                                                 Q ++   DRFLAC+PTG AK++R+
Sbjct  220   ------------------------------------QGFL---DRFLACRPTGGAKQSRM  240

Query  1212  VLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEIFHRVAKQWDELEVFYT  1033
             VLVALYQ+V+ESFQ+Y  I E+L +L+DRF  ++  +  K  E +   AKQ DEL  FY 
Sbjct  241   VLVALYQIVRESFQLYSDICEVLAVLLDRFFDMEYAECVKAFEAYASAAKQIDELSAFYA  300

Query  1032  WSKAAGISRLSEYPDVENYPKQKLDimeeiirekmeMAGGRIMrsrepspeveeveepep  853
             W K  G++R SEY +V+    + L+ +E+ +          + R++ P     E E    
Sbjct  301   WCKDTGVARSSEYLEVQRVTDKLLETLEKFM----------MDRAKRPKSPPREPEPEPV  350

Query  852   eaeaeEDMNTIKALPPPPEDF--IEEMAVVEAPTEEKKEQDIGDLLNLGEDAPTPEEHAN  679
             + E E DMN+IKAL P PED+   E + V E    E   Q  GDL++L E   + +E  N
Sbjct  351   KEEPEPDMNSIKAL-PAPEDYKEPEPVKVEEEVKPEPPPQPQGDLVDLREHTVSADEQGN  409

Query  678   QLALALFDGiptidptkttittPWEAF--NGSEDWETA  571
             +LALALF G     P        WEAF  NG  +  +A
Sbjct  410   RLALALFQG----PPAAGGNNGSWEAFPSNGGNEVTSA  443



>ref|XP_006655342.1| PREDICTED: putative clathrin assembly protein At1g03050-like 
[Oryza brachyantha]
Length=438

 Score =   168 bits (425),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 129/207 (62%), Gaps = 18/207 (9%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQN------RRGK--H  1420
             +ATRRGTR+LNMSDF D SR++ WD+SAFVRTY+ YLD+++E RM        RRG+  H
Sbjct  113   YATRRGTRMLNMSDFCDRSRTDAWDFSAFVRTYAAYLDDRLEYRMHAKHGDAARRGRPLH  172

Query  1419  SALASgn---------eegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQI  1267
               L +               E++    ET    A+V   TP +EM  E L ++ Q    +
Sbjct  173   EQLYASPGNRFSYEDFCAREEDKATNAETDKAVALVARETPTSEMTLEQLLAKAQQLQHL  232

Query  1266  LDRFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVH  1087
             LDRF+AC+P GAAK NR+V V+LY +VKES Q+Y  + E++  LV++F +++  D ++VH
Sbjct  233   LDRFIACRPVGAAKTNRVVSVSLYPLVKESVQLYCELTEVMAALVEQFSEMETDDCERVH  292

Query  1086  EIFHRVAKQWDELEVFYTWSKAAGISR  1006
              +F  +AKQ DELE  YTW K A + R
Sbjct  293   AVFCGLAKQLDELEALYTWCKDAHVCR  319


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 49/83 (59%), Gaps = 12/83 (14%)
 Frame = -1

Query  354  ANTTASGA-DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKA  178
            +   ASG  DPFAAS++V PP YVQMS+++ KQ  L EE+ +WQQY K+GM GQ  L   
Sbjct  352  SGAAASGVVDPFAASMAVPPPTYVQMSDMQTKQHQLVEEKMVWQQYGKNGMRGQGALAML  411

Query  177  QQSSQP-----------HNYYGY  142
            +Q   P           +NY GY
Sbjct  412  EQQRPPQLEQMLLPNGGYNYAGY  434



>ref|XP_002285283.1| PREDICTED: putative clathrin assembly protein At2g25430 [Vitis 
vinifera]
Length=633

 Score =   171 bits (432),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 122/212 (58%), Gaps = 16/212 (8%)
 Frame = -1

Query  1572  FATRRGTRLLNMSDFRD-SRSNFWDYSAFVRTYSLYLDEQVELRMQNRR-----------  1429
             +ATRRG RLLNMSDFRD + SN WDYS FVRTY LYLDE++E  +  ++           
Sbjct  110   YATRRGARLLNMSDFRDEAHSNSWDYSGFVRTYGLYLDEKLEFMVYEKKLSPGGDDDRRR  169

Query  1428  ----GKHSALASgneegveeedeeeetgntTAIVVTGTPITEMKNEYLYSRIQHYIQILD  1261
                 G +                +            GTP+ +MK E +  ++   ++I+D
Sbjct  170   RDEYGDYRDEPMYGMPRRSRSYGDLNESAVREQKDVGTPVKDMKTERVLGKLNGLMRIVD  229

Query  1260  RFLACKPTGAAKRNRLVLVALYQVVKESFQVYYSIAEMLGILVDRFMKLDIPDSKKVHEI  1081
             RFLAC+PTG AK +R+VLVALYQ+VKESF +Y  I+E L +L DRF +++  D  KV + 
Sbjct  230   RFLACRPTGVAKNSRMVLVALYQIVKESFGLYADISEALAVLQDRFFEMEYADCVKVFDA  289

Query  1080  FHRVAKQWDELEVFYTWSKAAGISRLSEYPDV  985
                 AK  DEL  FY W +  G++R SEYP+V
Sbjct  290   HVGAAKLIDELVGFYNWCRDTGVARSSEYPEV  321


 Score =   153 bits (386),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 124/202 (61%), Gaps = 27/202 (13%)
 Frame = -1

Query  729  DLLNLGEDAPTPEEHANQLALALFDGiptidptkttittPWEAF----------------  598
            DL+NL +DA + ++  N+LALALF G PT +   +     WEAF                
Sbjct  400  DLVNLRDDAVSADDQGNKLALALFSGPPTSNNNGS-----WEAFPSNGGPEVTSAWQTPA  454

Query  597  --NGSEDWETALVQTASHLSNQKAQFPGNFDELMLDGMYRQGALNQAVASSGVLTTGSAT  424
              +G  DWE ALV+TAS+LS QK    G FD L+L+GMY QGA+ Q V S+  LT GSA+
Sbjct  455  AESGKADWELALVETASNLSKQKNAMAGGFDPLLLNGMYDQGAVRQHV-STAQLTGGSAS  513

Query  423  SVAFGSAGRpamlalpappssADANTTASG-ADPFAASLSVAPPAYVQMSELEKKQRLLW  247
            SVA    G+ A   L  P    D    A G  DPFAASL+V PP+YVQ++++EKKQ LL 
Sbjct  514  SVALPGQGKNATPVLALPAP--DGTVQAVGHQDPFAASLAVPPPSYVQIADMEKKQHLLV  571

Query  246  EEQQMWQQYTKDGMHGQVGLEK  181
            +EQQ+WQQY ++GM GQVGL K
Sbjct  572  QEQQVWQQYGREGMQGQVGLAK  593



>emb|CDY37444.1| BnaC08g45820D [Brassica napus]
Length=281

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 116/243 (48%), Positives = 154/243 (63%), Gaps = 19/243 (8%)
 Frame = -1

Query  834  DMNTIKALPPPPEDFIEEMAVVEAPTE------EKKEQDIGDLLNLGEDAPTPEEHA--N  679
            DMN IKALP PP    EE    E   E      E K++++GDLL+L  D  + E  A  +
Sbjct  40   DMNAIKALPAPPPKEDEEEKTEEEAEEPVIIEEENKKEEVGDLLDL-VDISSGEAGAAGD  98

Query  678  QLALALFDGiptidptkttittPWEAF-NGSEDWETALVQTASHLSNQKAQFPGNFDELM  502
             LALALFDG         +    WEAF +   DWETALVQ+A++LS QK +  G FD L+
Sbjct  99   NLALALFDGPYASGSGSESGPG-WEAFKDDGADWETALVQSATNLSGQKTELGGGFDMLL  157

Query  501  LDGMYRQGALNQAVASSGVL-TTGSATSVAFGSAGRpamlalpappssADANTTASGA--  331
            L+GMY+ G +N AV +S    T+GSA+S+AFGSAGRPA   L  P  +  AN +++G   
Sbjct  158  LNGMYQHGTVNAAVQTSTAYGTSGSASSMAFGSAGRPAATVLALPAPAT-ANGSSNGPVV  216

Query  330  --DPFAASLSVAPPAYVQMSELEKKQRLLWEEQQMWQQYTKDGMHGQVGLEKAQQSSQPH  157
              DPFAASL VAPPAYVQM+E+EKKQR+L EEQ MW+Q++++G  G + + + Q  +QP+
Sbjct  217  PMDPFAASLVVAPPAYVQMNEMEKKQRMLMEEQIMWEQFSREGRQGHMNIRQNQ--NQPN  274

Query  156  NYY  148
              Y
Sbjct  275  YSY  277



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4377449940080