BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18449_g1_i1 len=2266 path=[1:0-660 @662@!:661-1398 4597:1399-1402
1400:1403-2265]

Length=2266
                                                                      Score     E

ref|XP_009588204.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    638   0.0      
ref|XP_006350541.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    636   0.0      
ref|XP_004234968.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    629   0.0      
ref|XP_011075988.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    622   0.0      
gb|EYU25233.1|  hypothetical protein MIMGU_mgv1a003646mg                617   0.0      
gb|EYU19646.1|  hypothetical protein MIMGU_mgv1a003999mg                615   0.0      
ref|XP_010520973.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    578   0.0      
ref|XP_011024833.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    591   0.0      
ref|XP_011024834.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    590   0.0      
ref|XP_002318424.2|  hypothetical protein POPTR_0012s02260g             585   0.0      Populus trichocarpa [western balsam poplar]
gb|KFK26956.1|  hypothetical protein AALP_AA8G315200                    584   0.0      
ref|XP_002272792.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    610   0.0      Vitis vinifera
ref|XP_006441089.1|  hypothetical protein CICLE_v10019480mg             608   0.0      
emb|CBI23009.3|  unnamed protein product                                607   0.0      
ref|XP_006441090.1|  hypothetical protein CICLE_v10019480mg             604   0.0      
ref|XP_008234752.1|  PREDICTED: mitochondrial clpX-like chaperone...    605   0.0      
ref|XP_003526717.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    602   0.0      
ref|XP_008380808.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    604   0.0      
ref|XP_008376716.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    603   0.0      
gb|KDO54245.1|  hypothetical protein CISIN_1g005637mg                   607   0.0      
ref|XP_002321405.2|  hypothetical protein POPTR_0015s01520g             602   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002516670.1|  ATP-dependent clp protease ATP-binding subun...    602   0.0      Ricinus communis
ref|XP_009368656.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    602   0.0      
ref|XP_009357301.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    602   0.0      
gb|KDO54243.1|  hypothetical protein CISIN_1g005637mg                   605   0.0      
ref|XP_008380812.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    601   0.0      
gb|KDP25897.1|  hypothetical protein JCGZ_23723                         601   0.0      
gb|KDO54242.1|  hypothetical protein CISIN_1g005637mg                   604   0.0      
ref|XP_009352023.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    600   0.0      
gb|KDO54244.1|  hypothetical protein CISIN_1g005637mg                   604   0.0      
ref|XP_009119879.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    586   0.0      
ref|XP_007218873.1|  hypothetical protein PRUPE_ppa003261mg             599   0.0      
gb|KHN19496.1|  ATP-dependent Clp protease ATP-binding subunit ClpX     594   0.0      
ref|XP_009352024.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    597   0.0      
ref|XP_003523365.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    594   0.0      
ref|XP_009349952.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    596   0.0      
ref|XP_004502651.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    572   0.0      
ref|XP_004307989.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    595   0.0      
emb|CDY14385.1|  BnaA10g06700D                                          579   0.0      
ref|XP_008466826.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    594   0.0      
ref|XP_006401716.1|  hypothetical protein EUTSA_v10013106mg             593   0.0      
ref|XP_011044638.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    593   0.0      
ref|XP_007039051.1|  CLP protease regulatory subunit X isoform 1        593   0.0      
gb|EPS62752.1|  hypothetical protein M569_12037                         584   0.0      
ref|XP_008466827.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    590   0.0      
ref|XP_002864237.1|  hypothetical protein ARALYDRAFT_918413             589   0.0      
ref|XP_004146223.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    588   0.0      
emb|CDY35643.1|  BnaC09g29650D                                          580   0.0      
ref|NP_568792.1|  CLP protease regulatory subunit X                     587   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007136523.1|  hypothetical protein PHAVU_009G052400g             581   0.0      
gb|AAB88706.1|  CLP protease regulatory subunit CLPX                    583   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482726.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    583   0.0      
ref|XP_010267611.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    583   0.0      
ref|XP_006280226.1|  hypothetical protein CARUB_v10026143mg             582   0.0      
ref|XP_010442896.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    582   0.0      
ref|XP_009132481.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    570   0.0      
ref|XP_004502652.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    572   0.0      
ref|XP_010445728.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    578   0.0      
ref|XP_010671440.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    574   0.0      
emb|CDY54345.1|  BnaC03g14910D                                          572   0.0      
ref|XP_006647394.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    565   0.0      
ref|XP_004164772.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    572   0.0      
ref|XP_010555729.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    572   0.0      
ref|XP_006836922.1|  hypothetical protein AMTR_s00099p00142540          574   0.0      
ref|XP_010035267.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    568   0.0      
ref|XP_011044639.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    565   0.0      
ref|XP_002452300.1|  hypothetical protein SORBIDRAFT_04g023280          562   0.0      Sorghum bicolor [broomcorn]
gb|AES72507.2|  ATP-dependent Clp protease regulatory subunit ClpX      542   0.0      
ref|XP_010915955.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    556   0.0      
dbj|BAH01586.1|  unnamed protein product                                559   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_003575174.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    559   0.0      
ref|XP_008676716.1|  PREDICTED: uncharacterized protein LOC100272...    545   0.0      
gb|EYU25234.1|  hypothetical protein MIMGU_mgv1a003646mg                550   0.0      
ref|XP_004952735.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    555   0.0      
dbj|BAJ98835.1|  predicted protein                                      554   0.0      
emb|CAN75136.1|  hypothetical protein VITISV_040753                     551   0.0      Vitis vinifera
gb|AFW71882.1|  hypothetical protein ZEAMMB73_870207                    553   0.0      
gb|EEE57209.1|  hypothetical protein OsJ_07170                          550   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010252309.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    553   0.0      
ref|XP_008681399.1|  PREDICTED: uncharacterized protein LOC100272...    553   0.0      
ref|XP_003556404.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    547   0.0      
gb|AFW71881.1|  hypothetical protein ZEAMMB73_870207                    551   0.0      
emb|CDP05061.1|  unnamed protein product                                538   0.0      
ref|NP_001140773.1|  uncharacterized protein LOC100272848               539   0.0      Zea mays [maize]
ref|XP_008681398.1|  PREDICTED: uncharacterized protein LOC100272...    551   0.0      
emb|CBI16961.3|  unnamed protein product                                547   0.0      
ref|XP_010930370.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    550   0.0      
ref|XP_008783202.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    538   0.0      
ref|XP_002519956.1|  ATP-dependent clp protease ATP-binding subun...    549   0.0      Ricinus communis
gb|KHN05027.1|  ATP-dependent Clp protease ATP-binding subunit ClpX     541   0.0      
emb|CBI29632.3|  unnamed protein product                                541   0.0      
gb|KCW46559.1|  hypothetical protein EUGRSUZ_K00383                     542   0.0      
ref|XP_007143921.1|  hypothetical protein PHAVU_007G113600g             540   0.0      
ref|XP_010665487.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    546   0.0      
ref|XP_004241855.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    545   0.0      
ref|XP_010657908.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    542   1e-180   
dbj|BAD15818.1|  putative ATP-dependent Clp protease ATP-binding ...    543   3e-180   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010063745.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    545   4e-180   
ref|XP_007019731.1|  ATP-dependent clp protease ATP-binding subun...    542   1e-179   
ref|XP_010442897.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    538   1e-179   
ref|XP_009366893.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    543   1e-179   
ref|XP_006647186.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    533   1e-179   
ref|XP_009379893.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    541   3e-179   
ref|XP_006376103.1|  hypothetical protein POPTR_0013s09570g             542   4e-179   
ref|XP_011009777.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    540   4e-178   
ref|XP_010445732.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    534   5e-178   
ref|XP_001773526.1|  predicted protein                                  528   8e-178   
ref|XP_009420156.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    536   1e-177   
gb|KGN52598.1|  hypothetical protein Csa_5G646720                       535   2e-177   
ref|XP_006599644.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    537   4e-177   
ref|XP_010912710.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    523   5e-177   
ref|XP_010908120.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    535   6e-177   
emb|CAN64542.1|  hypothetical protein VITISV_013764                     537   6e-177   Vitis vinifera
ref|XP_006587384.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    536   1e-176   
ref|XP_008808963.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    532   6e-176   
ref|XP_004141515.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    533   7e-176   
ref|XP_010677229.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    530   1e-175   
ref|XP_006303712.1|  hypothetical protein CARUB_v10011824mg             531   1e-175   
ref|XP_002893761.1|  hypothetical protein ARALYDRAFT_473508             531   2e-175   
ref|XP_010677227.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    531   2e-175   
gb|KFK45073.1|  hypothetical protein AALP_AA1G339900                    531   2e-175   
gb|KDP37794.1|  hypothetical protein JCGZ_06696                         533   2e-175   
ref|XP_009616314.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    531   4e-175   
ref|XP_008459496.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    530   4e-175   
ref|XP_009781367.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    531   5e-175   
gb|KHN27868.1|  ATP-dependent Clp protease ATP-binding subunit ClpX     528   6e-175   
ref|XP_010499875.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    530   8e-175   
ref|NP_564423.3|  ATP-dependent Clp protease                            529   9e-175   Arabidopsis thaliana [mouse-ear cress]
gb|AAG51286.1|AC027035_9  CLP protease regulatory subunit CLPX, p...    529   9e-175   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010682114.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    530   1e-174   
ref|XP_010461163.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    529   1e-174   
emb|CDX86004.1|  BnaC06g21300D                                          527   1e-174   
gb|AAG51217.1|AC051630_14  CLP protease regulatory subunit CLPX, ...    529   1e-174   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114799.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    528   2e-174   
ref|XP_008788320.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    528   2e-174   
emb|CDX93769.1|  BnaA09g23690D                                          528   2e-174   
ref|XP_009404286.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    529   2e-174   
ref|XP_008781975.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    528   3e-174   
ref|XP_006356538.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    528   5e-174   
gb|EEE56773.1|  hypothetical protein OsJ_06335                          520   8e-174   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006587386.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    529   8e-174   
ref|XP_010478756.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    526   9e-174   
ref|XP_007019730.1|  ATP-dependent clp protease ATP-binding subun...    528   1e-173   
ref|XP_008788322.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    526   1e-173   
gb|KHN24432.1|  ATP-dependent Clp protease ATP-binding subunit ClpX     526   1e-173   
ref|XP_010266546.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    514   2e-173   
gb|ACR33872.1|  unknown                                                 514   2e-173   Zea mays [maize]
ref|XP_008388035.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    528   2e-173   
ref|XP_007039052.1|  CLP protease regulatory subunit X isoform 2        520   2e-173   
ref|XP_010529709.1|  PREDICTED: mitochondrial clpX-like chaperone...    525   4e-173   
ref|XP_006441855.1|  hypothetical protein CICLE_v10019167mg             525   6e-173   
ref|XP_001768014.1|  predicted protein                                  516   6e-173   
ref|XP_004952279.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    520   1e-172   
ref|XP_001774045.1|  predicted protein                                  513   1e-172   
ref|XP_006415098.1|  hypothetical protein EUTSA_v10007003mg             524   1e-172   
gb|AFW62663.1|  hypothetical protein ZEAMMB73_067276                    510   2e-172   
ref|XP_002527823.1|  ATP-dependent clp protease ATP-binding subun...    521   3e-172   Ricinus communis
ref|XP_009421144.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    523   3e-172   
ref|XP_010234150.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    518   3e-172   
ref|XP_006478287.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    522   5e-172   
gb|KDP40893.1|  hypothetical protein JCGZ_24892                         519   1e-171   
ref|XP_008232534.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    521   4e-171   
ref|XP_006349274.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    519   4e-171   
ref|XP_007152420.1|  hypothetical protein PHAVU_004G128700g             520   9e-171   
gb|AFW70872.1|  ATP-dependent Clp protease ATP-binding subunit clpX     514   2e-170   
gb|EYU22682.1|  hypothetical protein MIMGU_mgv1a002117mg                519   3e-170   
dbj|BAD21479.1|  putative ATP-dependent Clp protease ATP-binding ...    513   6e-170   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006645143.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    511   6e-170   
ref|NP_001147507.1|  ATP-dependent Clp protease ATP-binding subun...    513   7e-170   Zea mays [maize]
gb|KHG18905.1|  clpX                                                    513   8e-170   
ref|XP_009762784.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    515   1e-169   
gb|KCW46560.1|  hypothetical protein EUGRSUZ_K00383                     511   2e-169   
ref|XP_004230411.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    514   2e-169   
ref|XP_009421145.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    514   5e-169   
ref|XP_009613098.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    513   1e-168   
ref|XP_004952278.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    513   1e-168   
ref|NP_001045031.1|  Os01g0886600                                       506   3e-168   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ93977.1|  predicted protein                                      509   1e-167   
ref|XP_003564797.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    508   2e-167   
gb|EEC71918.1|  hypothetical protein OsI_04712                          508   6e-167   Oryza sativa Indica Group [Indian rice]
gb|EEE55774.1|  hypothetical protein OsJ_04339                          505   1e-166   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011095003.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    509   2e-166   
ref|XP_004970835.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    506   3e-166   
ref|XP_007023127.1|  ATP-dependent Clp protease isoform 2               502   6e-166   
ref|XP_004300022.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    503   1e-165   
ref|XP_004970834.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    504   3e-165   
ref|XP_002458882.1|  hypothetical protein SORBIDRAFT_03g042120          501   2e-164   Sorghum bicolor [broomcorn]
gb|AFW84351.1|  hypothetical protein ZEAMMB73_159465                    501   3e-164   
gb|KDO42064.1|  hypothetical protein CISIN_1g038067mg                   496   5e-164   
ref|XP_007023128.1|  ATP-dependent Clp protease isoform 3               496   7e-164   
ref|XP_006470836.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    498   9e-164   
ref|XP_008218637.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    498   1e-163   
ref|XP_006431435.1|  hypothetical protein CICLE_v10003616mg             497   3e-163   
ref|XP_009355384.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    495   2e-162   
gb|KHG05917.1|  ATP-dependent Clp protease ATP-binding subunit ClpX     492   8e-162   
ref|XP_010065233.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    493   8e-162   
ref|XP_003619596.1|  ATP-dependent Clp protease ATP-binding subun...    485   1e-161   
ref|XP_010112073.1|  ATP-dependent Clp protease ATP-binding subun...    494   3e-161   
gb|KCW62577.1|  hypothetical protein EUGRSUZ_G00073                     490   7e-161   
ref|XP_007023126.1|  ATP-dependent Clp protease ATP-binding subun...    489   2e-160   
gb|AES75813.2|  ATP-dependent Clp protease regulatory subunit ClpX      490   1e-159   
ref|XP_007222159.1|  hypothetical protein PRUPE_ppa007724mg             477   5e-159   
ref|XP_008643592.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    483   5e-159   
gb|EMS53220.1|  ATP-dependent Clp protease ATP-binding subunit ClpX     478   1e-158   
ref|XP_011028416.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    483   5e-158   
ref|XP_011028415.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    483   5e-158   
ref|XP_004142810.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    483   2e-157   
ref|XP_008460586.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    482   4e-157   
ref|XP_004512653.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    485   5e-157   
ref|XP_010908125.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    482   1e-156   
ref|XP_011087617.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    481   2e-156   
ref|XP_003619595.1|  ATP-dependent Clp protease ATP-binding subun...    482   2e-156   
ref|XP_002864018.1|  hypothetical protein ARALYDRAFT_495043             479   3e-156   
gb|KHG18903.1|  clpX                                                    510   1e-155   
ref|XP_010499878.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    478   3e-155   
ref|XP_011028418.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    467   4e-155   
ref|XP_010461164.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    477   7e-155   
ref|XP_006385093.1|  hypothetical protein POPTR_0004s23830g             475   1e-154   
ref|XP_010912711.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    464   2e-154   
ref|XP_010478757.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    476   2e-154   
gb|KDO54247.1|  hypothetical protein CISIN_1g005637mg                   473   5e-154   
ref|XP_003602256.1|  LCR                                                463   6e-154   
gb|KDO54246.1|  hypothetical protein CISIN_1g005637mg                   471   3e-153   
ref|XP_006279597.1|  hypothetical protein CARUB_v10026110mg             471   3e-153   
ref|XP_006412459.1|  hypothetical protein EUTSA_v10024710mg             471   4e-153   
emb|CDP11543.1|  unnamed protein product                                460   1e-152   
gb|KHG18904.1|  clpX                                                    501   1e-152   
dbj|BAA98151.1|  CLP protease regulatory subunit CLPX-like              469   3e-152   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482282.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    469   4e-152   
gb|KFK32966.1|  hypothetical protein AALP_AA6G312500                    467   4e-152   
ref|XP_009119914.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    467   8e-152   
ref|NP_568714.4|  ATP-dependent Clp protease                            468   1e-151   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010441212.1|  PREDICTED: mitochondrial clpX-like chaperone...    467   3e-151   
emb|CDY14359.1|  BnaA10g06960D                                          465   6e-151   
ref|XP_009119913.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    464   1e-150   
ref|XP_010442456.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    465   1e-150   
ref|XP_010267612.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    456   3e-149   
ref|XP_010442455.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    460   7e-149   
gb|KCW71001.1|  hypothetical protein EUGRSUZ_F04107                     460   1e-148   
emb|CDY20236.1|  BnaC09g30030D                                          459   2e-148   
ref|XP_010442457.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    457   1e-147   
ref|XP_010521411.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    454   2e-146   
ref|XP_010521410.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    454   3e-146   
ref|XP_010099789.1|  ATP-dependent Clp protease ATP-binding subun...    442   8e-145   
gb|EMT28446.1|  ATP-dependent Clp protease ATP-binding subunit clpX     449   1e-144   
ref|XP_010677235.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    445   9e-144   
ref|XP_010912712.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    431   5e-142   
gb|EYU35038.1|  hypothetical protein MIMGU_mgv1a019263mg                438   4e-141   
emb|CAN80513.1|  hypothetical protein VITISV_026067                     433   4e-140   Vitis vinifera
gb|KDO54248.1|  hypothetical protein CISIN_1g005637mg                   431   6e-138   
gb|KHG08239.1|  ATP-dependent Clp protease ATP-binding subunit ClpX     431   1e-137   
ref|XP_010451689.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    416   2e-136   
emb|CDO97670.1|  unnamed protein product                                416   2e-135   
ref|XP_004961402.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    419   2e-134   
ref|XP_008460588.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    419   5e-133   
ref|XP_008647507.1|  PREDICTED: hypothetical protein isoform X2         414   1e-132   
ref|XP_010231123.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    414   2e-132   
ref|XP_008647506.1|  PREDICTED: hypothetical protein isoform X1         409   7e-131   
ref|XP_006655521.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    406   4e-130   
ref|NP_001056145.1|  Os05g0533900                                       399   4e-128   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009781368.1|  PREDICTED: uncharacterized protein LOC104230...    406   7e-128   
ref|XP_008460589.1|  PREDICTED: mitochondrial clpX-like chaperone...    402   3e-127   
gb|EEC79584.1|  hypothetical protein OsI_20758                          400   6e-127   Oryza sativa Indica Group [Indian rice]
ref|XP_002440133.1|  hypothetical protein SORBIDRAFT_09g026620          401   8e-127   Sorghum bicolor [broomcorn]
gb|EEE64480.1|  hypothetical protein OsJ_19330                          399   1e-126   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005704295.1|  ATP-dependent Clp protease ATP-binding subun...    396   3e-125   
ref|XP_010231124.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    394   3e-125   
ref|XP_008460587.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    399   6e-125   
dbj|BAJ91098.1|  predicted protein                                      393   2e-124   
gb|KDO42937.1|  hypothetical protein CISIN_1g0057621mg                  385   4e-122   
ref|XP_009774630.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    371   1e-119   
ref|XP_004166887.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    373   2e-119   
ref|WP_038311711.1|  Clp protease ATP-binding protein                   375   2e-118   
gb|ETM40261.1|  ATP-dependent Clp protease, ATP-binding subunit ClpX    384   2e-118   
ref|XP_008909880.1|  ATP-dependent Clp protease, ATP-binding subu...    384   2e-118   
gb|ETI40278.1|  ATP-dependent Clp protease, ATP-binding subunit ClpX    383   4e-118   
ref|XP_002907124.1|  ATP-dependent Clp protease ATP-binding subun...    383   4e-118   
ref|WP_011580509.1|  ATP-dependent protease                             374   5e-118   
ref|WP_007670142.1|  ATP-dependent protease                             374   5e-118   
ref|XP_009520055.1|  hypothetical protein PHYSODRAFT_554819             383   7e-118   
ref|XP_005718669.1|  unnamed protein product                            378   8e-118   
ref|WP_012974526.1|  ATP-dependent protease                             373   9e-118   
ref|XP_005539106.1|  probable ATP-dependent Clp protease regulato...    383   1e-117   
ref|WP_029008556.1|  Clp protease ATP-binding protein                   373   1e-117   
ref|WP_006274255.1|  ATP-dependent protease                             371   2e-117   
ref|WP_036992337.1|  Clp protease ATP-binding protein                   373   2e-117   
ref|WP_018632248.1|  ATP-dependent protease                             372   2e-117   
ref|WP_014248122.1|  ATP-dependent protease                             372   2e-117   
ref|WP_023453567.1|  ATP-dependent protease                             372   2e-117   
ref|XP_002895917.1|  ATP-dependent Clp protease ATP-binding subun...    381   3e-117   
ref|WP_035672995.1|  Clp protease ATP-binding protein                   372   3e-117   
ref|WP_029012938.1|  Clp protease ATP-binding protein                   372   4e-117   
ref|WP_014240114.1|  ATP-dependent protease                             371   5e-117   
ref|WP_027832427.1|  Clp protease ATP-binding protein                   372   5e-117   
ref|WP_038036780.1|  Clp protease ATP-binding protein                   371   5e-117   
ref|XP_005648593.1|  ClpX, ATPase regulatory subunit                    376   5e-117   
ref|WP_016654951.1|  ATP-dependent Clp protease ATP-binding subun...    372   5e-117   
ref|WP_029040034.1|  Clp protease ATP-binding protein                   371   6e-117   
ref|WP_011785317.1|  MULTISPECIES: ATP-dependent protease               371   6e-117   
ref|WP_028034631.1|  Clp protease ATP-binding protein                   371   6e-117   
ref|WP_028794910.1|  Clp protease ATP-binding protein                   371   7e-117   
ref|WP_006786779.1|  ATP-dependent protease                             371   7e-117   
ref|WP_038528404.1|  Clp protease ATP-binding protein                   371   8e-117   
ref|WP_012135995.1|  ATP-dependent protease ATP-binding subunit ClpX    370   1e-116   
ref|WP_004753835.1|  ATP-dependent Clp protease ATP-binding subun...    370   1e-116   
ref|WP_023457651.1|  ATP-dependent protease                             370   1e-116   
ref|WP_004581873.1|  ATP-dependent protease ATP-binding subunit ClpX    370   2e-116   
ref|WP_007154039.1|  MULTISPECIES: ATP-dependent protease               370   2e-116   
ref|WP_004903267.1|  ATP-dependent Clp protease ATP-binding subun...    370   2e-116   
ref|WP_008938687.1|  ATP-dependent protease ATP-binding subunit ClpX    370   2e-116   
ref|WP_037447244.1|  Clp protease ATP-binding protein                   369   3e-116   
ref|WP_018308322.1|  ATP-dependent protease                             369   3e-116   
ref|WP_034765012.1|  Clp protease ATP-binding protein                   369   4e-116   
ref|WP_008434772.1|  ATP-dependent protease                             369   4e-116   
ref|WP_022513926.1|  aTP-dependent Clp protease ATP-binding subun...    369   4e-116   
ref|WP_019185803.1|  ATP-dependent protease                             369   4e-116   
ref|WP_029653901.1|  Clp protease ATP-binding protein                   369   5e-116   
ref|WP_027492330.1|  Clp protease ATP-binding protein                   369   5e-116   
ref|WP_007511234.1|  MULTISPECIES: ATP-dependent protease               369   5e-116   
ref|WP_022988049.1|  ATP-dependent protease                             369   5e-116   
ref|WP_029032747.1|  Clp protease ATP-binding protein                   369   5e-116   
ref|WP_035602252.1|  Clp protease ATP-binding protein                   368   6e-116   
emb|CEA06429.1|  ATP-dependent protease ATP-binding subunit ClpX        369   6e-116   
ref|WP_027299899.1|  Clp protease ATP-binding protein                   368   7e-116   
ref|WP_009586396.1|  ATP-dependent Clp protease, ATP-binding subu...    369   7e-116   
ref|WP_005981784.1|  ATP-dependent protease                             368   7e-116   
ref|WP_004154600.1|  MULTISPECIES: ATP-dependent protease               369   8e-116   
ref|WP_014646099.1|  ATP-dependent protease                             369   8e-116   
ref|WP_028735990.1|  Clp protease ATP-binding protein                   368   8e-116   
ref|WP_032129320.1|  Clp protease ATP-binding protein                   368   8e-116   
ref|WP_004830171.1|  ATP-dependent Clp protease ATP-binding subun...    369   9e-116   
ref|WP_009450130.1|  ATP-dependent protease                             368   9e-116   
ref|WP_020812295.1|  ATP-dependent protease                             367   9e-116   
emb|CEI52147.1|  ATP-dependent Clp protease ATP-binding subunit ClpX    369   9e-116   
ref|WP_005033739.1|  ATP-dependent protease                             369   9e-116   
ref|WP_019018385.1|  ATP-dependent protease                             368   9e-116   
ref|WP_004146319.1|  ATP-dependent protease                             368   1e-115   
ref|WP_023449473.1|  ATP-dependent protease                             368   1e-115   
ref|WP_035593428.1|  Clp protease ATP-binding protein                   368   1e-115   
ref|WP_006727556.1|  ATP-dependent protease                             368   1e-115   
ref|WP_013971882.1|  MULTISPECIES: ATP-dependent protease               368   1e-115   
ref|WP_035685950.1|  hypothetical protein                               366   1e-115   
ref|WP_012566445.1|  ATP-dependent protease                             367   1e-115   
ref|WP_038613042.1|  Clp protease ATP-binding protein                   368   1e-115   
ref|WP_007352521.1|  ATP-dependent protease                             368   1e-115   
ref|WP_031383763.1|  Clp protease ATP-binding protein                   367   1e-115   
ref|WP_016855020.1|  ATP-dependent protease                             367   2e-115   
ref|WP_028945302.1|  Clp protease ATP-binding protein                   367   2e-115   
ref|WP_020812293.1|  ATP-dependent protease                             366   2e-115   
ref|WP_004943716.1|  ATP-dependent Clp protease ATP-binding subun...    368   2e-115   
ref|WP_010224368.1|  MULTISPECIES: ATP-dependent protease               367   2e-115   
ref|WP_035025578.1|  MULTISPECIES: Clp protease ATP-binding protein     367   2e-115   
ref|WP_027289109.1|  Clp protease ATP-binding protein                   367   2e-115   
ref|WP_024270647.1|  ATP-dependent Clp protease ATP-binding subun...    367   2e-115   
ref|WP_004932846.1|  ATP-dependent Clp protease ATP-binding subun...    368   2e-115   
ref|WP_004920068.1|  MULTISPECIES: ATP-dependent protease               368   2e-115   
ref|WP_025878143.1|  MULTISPECIES: Clp protease ATP-binding protein     367   2e-115   
gb|ESW40373.1|  ATP-dependent protease                                  368   2e-115   
ref|WP_010483890.1|  ATP-dependent protease [                           367   2e-115   
emb|CCF18978.1|  ATP-dependent Clp protease ATP-binding subunit clpX    367   2e-115   
ref|WP_029416147.1|  Clp protease ATP-binding protein                   367   2e-115   
ref|WP_035217682.1|  Clp protease ATP-binding protein                   367   2e-115   
ref|WP_023463898.1|  ATP-dependent protease                             367   2e-115   
ref|WP_011975067.1|  MULTISPECIES: ATP-dependent protease               367   2e-115   
ref|WP_017907830.1|  MULTISPECIES: ATP-dependent protease               367   2e-115   
ref|WP_024847792.1|  Clp protease ATP-binding protein                   367   2e-115   
ref|WP_017356990.1|  ATP-dependent protease                             367   2e-115   
ref|WP_014130673.1|  ATP-dependent protease                             367   2e-115   
ref|WP_016541515.1|  ATP-dependent Clp protease ATP-binding subun...    367   2e-115   
ref|WP_004660446.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    367   2e-115   
ref|WP_037063391.1|  Clp protease ATP-binding protein                   367   2e-115   
ref|WP_028000055.1|  Clp protease ATP-binding protein                   367   2e-115   
ref|WP_003521528.1|  MULTISPECIES: ATP-dependent protease               367   2e-115   
ref|WP_027508522.1|  Clp protease ATP-binding protein                   367   2e-115   
ref|WP_003531807.1|  MULTISPECIES: ATP-dependent protease               367   3e-115   
ref|WP_019659527.1|  ATP-dependent protease                             367   3e-115   
ref|WP_011036185.1|  ATP-dependent protease                             367   3e-115   
ref|WP_013332103.1|  ATP-dependent protease                             367   3e-115   
ref|WP_002690404.1|  ATP-dependent protease                             367   3e-115   
ref|WP_019302717.1|  ATP-dependent protease                             367   3e-115   
ref|WP_024314733.1|  Clp protease ATP-binding protein                   367   3e-115   
ref|WP_017461159.1|  ATP-dependent protease                             367   3e-115   
ref|WP_005156181.1|  ATP-dependent Clp protease ATP-binding subun...    367   3e-115   
ref|WP_015915639.1|  ATP-dependent protease                             367   3e-115   
ref|WP_039441240.1|  Clp protease ATP-binding protein                   367   3e-115   
ref|WP_004804224.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    367   3e-115   
ref|WP_018679598.1|  ATP-dependent protease                             367   3e-115   
ref|WP_005238662.1|  MULTISPECIES: ATP-dependent protease               367   3e-115   
ref|WP_009400267.1|  ATP-dependent protease ATP-binding subunit ClpX    367   3e-115   
ref|WP_005297007.1|  ATP-dependent Clp protease ATP-binding subun...    367   3e-115   
ref|WP_005185075.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    367   3e-115   
ref|WP_028694417.1|  Clp protease ATP-binding protein                   367   3e-115   
ref|WP_007792128.1|  MULTISPECIES: ATP-dependent protease               367   3e-115   
ref|WP_005147000.1|  ATP-dependent Clp protease ATP-binding subun...    367   3e-115   
ref|WP_035262755.1|  Clp protease ATP-binding protein                   366   3e-115   
ref|WP_005318092.1|  ATP-dependent Clp protease ATP-binding subun...    367   4e-115   
ref|WP_029219277.1|  Clp protease ATP-binding protein                   367   4e-115   
ref|WP_008215386.1|  ATP-dependent protease                             367   4e-115   
ref|WP_038412860.1|  Clp protease ATP-binding protein                   367   4e-115   
ref|WP_003496489.1|  MULTISPECIES: ATP-dependent protease               367   4e-115   
ref|WP_038618941.1|  Clp protease ATP-binding protein                   367   4e-115   
ref|WP_003547337.1|  ATP-dependent protease                             367   4e-115   
ref|WP_005276204.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    367   4e-115   
ref|WP_004657821.1|  ATP-dependent Clp protease ATP-binding subun...    367   4e-115   
ref|WP_006451747.1|  MULTISPECIES: ATP-dependent protease               367   4e-115   
gb|EYT19637.1|  ATP-dependent Clp protease, ATP-binding subunit ClpX    365   4e-115   
gb|AHF83440.1|  ATP-dependent protease                                  366   4e-115   
ref|WP_027708971.1|  Clp protease ATP-binding protein                   366   4e-115   
ref|WP_005051946.1|  ATP-dependent Clp protease ATP-binding subun...    367   4e-115   
ref|WP_008943650.1|  ATP-dependent protease                             366   5e-115   
gb|AHK44002.1|  ATP-dependent Clp protease ATP-binding subunit ClpX     366   5e-115   
ref|WP_022714809.1|  ATP-dependent protease                             366   5e-115   
ref|WP_012522367.1|  ATP-dependent protease                             366   5e-115   
ref|WP_007531755.1|  ATP-dependent protease                             366   5e-115   
ref|WP_025899029.1|  Clp protease ATP-binding protein                   366   5e-115   
ref|WP_034854111.1|  Clp protease ATP-binding protein                   366   5e-115   
ref|WP_026612528.1|  MULTISPECIES: Clp protease ATP-binding protein     366   5e-115   
ref|WP_003512644.1|  MULTISPECIES: ATP-dependent protease               366   5e-115   
ref|WP_017963839.1|  MULTISPECIES: ATP-dependent protease               366   5e-115   
ref|WP_021999104.1|  aTP-dependent Clp protease ATP-binding subun...    366   5e-115   
ref|WP_015462926.1|  ATP-dependent protease ATP-binding subunit ClpX    366   5e-115   
ref|WP_004813200.1|  ATP-dependent Clp protease ATP-binding subun...    367   5e-115   
ref|WP_034803621.1|  Clp protease ATP-binding protein                   366   5e-115   
ref|WP_006312723.1|  MULTISPECIES: ATP-dependent protease               366   5e-115   
ref|WP_019995339.1|  ATP-dependent protease                             366   5e-115   
ref|WP_038690151.1|  Clp protease ATP-binding protein                   366   6e-115   
ref|WP_011396059.1|  ATP-dependent protease                             366   6e-115   
ref|WP_019336555.1|  ATP-dependent protease                             366   6e-115   
ref|WP_025426570.1|  Clp protease ATP-binding protein                   366   6e-115   
gb|KGI77599.1|  Clp protease ATP-binding protein                        366   6e-115   
ref|WP_007567156.1|  ATP-dependent protease                             366   6e-115   
ref|WP_011257881.1|  ATP-dependent protease                             366   6e-115   
ref|WP_004640927.1|  ATP-dependent protease                             366   6e-115   
ref|WP_005220905.1|  MULTISPECIES: ATP-dependent protease               366   6e-115   
ref|WP_018900222.1|  ATP-dependent protease                             366   6e-115   
ref|WP_018239383.1|  MULTISPECIES: ATP-dependent protease               366   6e-115   
ref|WP_017395714.1|  ATP-dependent protease                             366   6e-115   
ref|WP_004726534.1|  ATP-dependent Clp protease ATP-binding subun...    366   6e-115   
ref|WP_008941235.1|  MULTISPECIES: ATP-dependent protease               366   6e-115   
ref|WP_020021810.1|  ATP-dependent protease                             366   6e-115   
ref|WP_034609735.1|  Clp protease ClpX                                  366   7e-115   
ref|WP_003483788.1|  MULTISPECIES: ATP-dependent protease               366   7e-115   
ref|WP_004818903.1|  ATP-dependent Clp protease ATP-binding subun...    366   7e-115   
ref|WP_019465588.1|  ATP-dependent protease                             366   7e-115   
ref|WP_015471792.1|  ATP-dependent protease Clp, ATPase subunit         366   7e-115   
ref|WP_009683826.1|  MULTISPECIES: ATP-dependent protease               366   7e-115   
ref|WP_037414089.1|  Clp protease ATP-binding protein                   366   7e-115   
ref|WP_039007396.1|  Clp protease ATP-binding protein                   366   7e-115   
dbj|GAB27783.1|  Clp protease ATP-binding subunit ClpX                  364   7e-115   
ref|WP_005007363.1|  ATP-dependent Clp protease ATP-binding subun...    366   7e-115   
ref|WP_003600394.1|  ATP-dependent protease                             366   7e-115   
ref|WP_018325989.1|  ATP-dependent protease                             366   7e-115   
ref|WP_012271563.1|  ATP-dependent protease                             366   7e-115   
gb|AIQ93601.1|  ATP-dependent Clp protease, ATP-binding subunit ClpX    366   7e-115   
ref|WP_003250242.1|  MULTISPECIES: ATP-dependent protease               366   7e-115   
ref|WP_036128469.1|  Clp protease ATP-binding protein                   366   8e-115   
gb|AHD13813.1|  ATP-dependent protease                                  366   8e-115   
ref|WP_024308002.1|  Clp protease ATP-binding protein                   366   8e-115   
ref|WP_037000808.1|  Clp protease ATP-binding protein                   366   8e-115   
ref|WP_023536000.1|  MULTISPECIES: ATP-dependent Clp protease, AT...    366   8e-115   
ref|WP_023379635.1|  MULTISPECIES: ATP-dependent protease ATP-bin...    366   8e-115   
ref|WP_002806031.1|  ATP-dependent protease ATP-binding subunit ClpX    366   8e-115   
ref|WP_004781987.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    366   8e-115   
ref|WP_010341122.1|  ATP-dependent protease                             366   9e-115   
ref|WP_013715329.1|  ATP-dependent protease                             365   9e-115   
ref|WP_028480881.1|  Clp protease ATP-binding protein                   365   9e-115   
ref|XP_003087188.1|  hypothetical protein CRE_23295                     366   9e-115   
emb|CCD99774.1|  ATP-dependent Clp protease ATP-binding subunit clpX    364   9e-115   
ref|WP_012044595.1|  ATP-dependent protease                             365   9e-115   
ref|WP_011496925.1|  ATP-dependent protease                             365   1e-114   
ref|WP_039631581.1|  ATP-dependent protease                             365   1e-114   
ref|WP_011588494.1|  MULTISPECIES: ATP-dependent protease               365   1e-114   
ref|WP_013480180.1|  ATP-dependent protease                             365   1e-114   
ref|WP_026782897.1|  Clp protease ATP-binding protein                   365   1e-114   
ref|WP_004680013.1|  MULTISPECIES: ATP-dependent protease               365   1e-114   
ref|WP_028634543.1|  Clp protease ATP-binding protein                   365   1e-114   
ref|WP_017676722.1|  MULTISPECIES: ATP-dependent protease               365   1e-114   
ref|WP_035893379.1|  hypothetical protein                               365   1e-114   
ref|WP_014871719.1|  ATP-dependent protease                             365   1e-114   
gb|AAX14030.1|  ATP-binding subunit heat shock protein ClpX             365   1e-114   
ref|WP_038460550.1|  Clp protease ATP-binding protein                   365   1e-114   
ref|WP_016394423.1|  MULTISPECIES: ATP-dependent protease ATP-bin...    365   1e-114   
ref|WP_026471035.1|  Clp protease ClpX                                  366   1e-114   
ref|WP_035265272.1|  Clp protease ClpX                                  365   1e-114   
ref|WP_010115287.1|  ATP-dependent protease                             365   1e-114   
ref|WP_007819824.1|  MULTISPECIES: ATP-dependent protease               365   1e-114   
ref|WP_018973195.1|  ATP-dependent protease                             365   1e-114   
ref|WP_035583383.1|  Clp protease ATP-binding protein                   365   1e-114   
ref|WP_012112164.1|  ATP-dependent protease                             365   1e-114   
ref|WP_010953271.1|  ATP-dependent protease                             366   1e-114   
ref|WP_005920420.1|  ATP-dependent protease ATP-binding subunit ClpX    365   1e-114   
ref|WP_026791295.1|  Clp protease ATP-binding protein                   365   1e-114   
ref|WP_037121850.1|  Clp protease ATP-binding protein                   365   1e-114   
ref|WP_022725067.1|  ATP-dependent protease                             365   1e-114   
ref|WP_016553599.1|  MULTISPECIES: ATP-dependent protease ATP-bin...    365   1e-114   
ref|WP_039603710.1|  Clp protease ATP-binding protein                   365   1e-114   
ref|WP_009462942.1|  ATP-dependent protease                             365   1e-114   
ref|WP_025860055.1|  Clp protease ATP-binding protein                   365   2e-114   
ref|WP_013907484.1|  ATP-dependent protease                             365   2e-114   
ref|WP_004855034.1|  ATP-dependent Clp protease ATP-binding subun...    365   2e-114   



>ref|XP_009588204.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Nicotiana tomentosiformis]
Length=572

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/422 (81%), Positives = 371/422 (88%), Gaps = 5/422 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDS-DKVEGT  1360
             F  P++  KGL    + ++  K+  S+ +Y    R    +   S + P  NDS +K +G 
Sbjct  154   FPTPKQLCKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDS---SHKWPAGNDSSEKADGA  210

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             E+E+VELEKSNIL+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  211   ENESVELEKSNILLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  270

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP
Sbjct  271   KLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  330

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTGGVT
Sbjct  331   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTGGVT  390

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             SA VTSSLLE VESSDLISYGLIPEFVGRFPILV+L+ALTENQLVQVLTEPKNALGKQYK
Sbjct  391   SAAVTSSLLEIVESSDLISYGLIPEFVGRFPILVNLSALTENQLVQVLTEPKNALGKQYK  450

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             KMFQMN VKLHFTEDALR IA+KAI+KNTGARGLRSILESILMDAMYEIPDVR+GD+VID
Sbjct  451   KMFQMNGVKLHFTEDALRLIAKKAISKNTGARGLRSILESILMDAMYEIPDVRTGDDVID  510

Query  459   avivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIV  280
             AV+VD+E+VG EGRGCGAKILYGKGA D + S N  K+ +  +EGS+ D E E++LPSIV
Sbjct  511   AVVVDEESVGAEGRGCGAKILYGKGAFDRHFSQNRPKDSETNLEGSDGDHETEQELPSIV  570

Query  279   AL  274
             AL
Sbjct  571   AL  572


 Score =   181 bits (459),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 139/199 (70%), Gaps = 12/199 (6%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRI-KSKNYFTNSR--HSFS  1805
             MAAA RSK     AS   +H RYFI+N    GR  N    +R  K  N   NS   H+ S
Sbjct  1     MAAAFRSK---HRASMAITHFRYFIINDFHTGRFPNFHLCTRTSKWDNLLANSSAPHNSS  57

Query  1804  LFKPVSVRGEF-VDRGYDNSRNLSSCGKIDISSSY---GDPPEVWQPPG-DGIVVRPGVK  1640
             LFKPVS  GEF   + Y N +N  +  KI +SSS    GDPPE+WQPPG +GIVVRPGVK
Sbjct  58    LFKPVSFLGEFKSSQNYSNRKNNKNKRKISMSSSSNYGGDPPEIWQPPGGEGIVVRPGVK  117

Query  1639  FVQV-GEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKV  1463
             FVQ      GP  GSGGGFGSG+KDG WGGSNLG +FPTPK++CKGLDKFVIGQERAKKV
Sbjct  118   FVQAGEGEGGPGPGSGGGFGSGSKDGSWGGSNLGSHFPTPKQLCKGLDKFVIGQERAKKV  177

Query  1462  LSVAVYNHYKRIYNDSAQK  1406
             LSVAVYNHYKRIYNDS+ K
Sbjct  178   LSVAVYNHYKRIYNDSSHK  196



>ref|XP_006350541.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Solanum tuberosum]
Length=571

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/422 (80%), Positives = 370/422 (88%), Gaps = 5/422 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDS-DKVEGT  1360
             F  P++  KGL    + ++  K+  S+ +Y    R    +   S + P  NDS +K +G 
Sbjct  153   FPTPKQLCKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDS---SHKWPAGNDSSEKTDGI  209

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             E+E+VELEKSNIL+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  210   ENESVELEKSNILLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  269

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP
Sbjct  270   KLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  329

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT
Sbjct  330   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  389

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             SA VTSSLLETVESSDLISYGLIPEFVGRFPILVSL+ALTE+QLVQVLTEPKNALGKQYK
Sbjct  390   SAAVTSSLLETVESSDLISYGLIPEFVGRFPILVSLSALTEDQLVQVLTEPKNALGKQYK  449

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             KMFQMN VKLHF EDALR IARKA++KNTGARGLRSILE+ILMDAMYEIPDVR+GD+VID
Sbjct  450   KMFQMNGVKLHFVEDALRLIARKALSKNTGARGLRSILENILMDAMYEIPDVRTGDDVID  509

Query  459   avivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIV  280
             AV+VD+E+VG EGRGCG KILYGKGA D +   N  K+ +  +EGS+ D E E++LPSIV
Sbjct  510   AVVVDEESVGTEGRGCGGKILYGKGAFDQHFPQNRSKDSESNMEGSDGDHEAEQELPSIV  569

Query  279   AL  274
             AL
Sbjct  570   AL  571


 Score =   232 bits (591),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 151/195 (77%), Gaps = 5/195 (3%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAA LRSKS R TAS   +H RYFI+N   AG L N    +R K  N  +NS HS SLFK
Sbjct  1     MAAVLRSKSSRHTASMAIAHFRYFIINDFHAGHLPNFHLCNRTKWDNLVSNSGHSSSLFK  60

Query  1795  PVSVRGEFVDRGYDNSRNLSSCG-----KIDISSSYGDPPEVWQPPGDGIVVRPGVKFVQ  1631
              VS R EFVDR YDN +N  +       KI +SS+YG+PPE+WQPPG+GIVVRPGVKFVQ
Sbjct  61    SVSFRSEFVDRCYDNLKNSQNSSRKSKEKISMSSNYGEPPEIWQPPGEGIVVRPGVKFVQ  120

Query  1630  VGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVA  1451
             VGE +GP SGSGGGFGSG+KDG WGGSNLG  FPTPK++CKGLDKFVIGQERAKKVLSVA
Sbjct  121   VGEGEGPGSGSGGGFGSGSKDGSWGGSNLGTQFPTPKQLCKGLDKFVIGQERAKKVLSVA  180

Query  1450  VYNHYKRIYNDSAQK  1406
             VYNHYKRIYNDS+ K
Sbjct  181   VYNHYKRIYNDSSHK  195



>ref|XP_004234968.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Solanum lycopersicum]
Length=570

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/422 (79%), Positives = 368/422 (87%), Gaps = 5/422 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDS-DKVEGT  1360
             F  P++  +GL    + ++  K+  S+ +Y    R    +   S + P  NDS +K +G 
Sbjct  152   FPTPKQLCRGLDKFVIGQERAKKVLSVAVYNHYKRIYNDS---SHKWPAGNDSSEKTDGV  208

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             E+E+VELEKSNIL+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  209   ENESVELEKSNILLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  268

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP
Sbjct  269   KLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  328

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT
Sbjct  329   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  388

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             SA VTSSLLETVESSDLISYGLIPEFVGRFPILVSL+ALTE+QLVQVLTEPKNALGKQYK
Sbjct  389   SAAVTSSLLETVESSDLISYGLIPEFVGRFPILVSLSALTEDQLVQVLTEPKNALGKQYK  448

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             KMFQMN VKLHF E ALR +ARKAI+KNTGARGLRSILE+ILMDAMYEIPDVR+GD+VID
Sbjct  449   KMFQMNGVKLHFVEAALRLVARKAISKNTGARGLRSILENILMDAMYEIPDVRTGDDVID  508

Query  459   avivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIV  280
             AV+VD+E+VG EGRGCG KILYGKGA D +   N  K+ +  +E S+ D E E++LPSIV
Sbjct  509   AVVVDEESVGTEGRGCGGKILYGKGAFDRHFPQNRSKDSEANMEASDGDHEAEQELPSIV  568

Query  279   AL  274
             AL
Sbjct  569   AL  570


 Score =   241 bits (615),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 153/194 (79%), Gaps = 4/194 (2%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAA LRSKS R TAS   +H RYFI+N    G L N    SR K  N  +NS HS SLFK
Sbjct  1     MAAVLRSKSSRRTASMAITHFRYFIINDFHTGHLPNFHLCSRTKWDNLVSNSGHSSSLFK  60

Query  1795  PVSVRGEFVDRGYDNSRNLS--SCGKIDISSSYGDPPEVWQPPGDGIVVRPGVKFVQVGE  1622
             PVS RGEFVDR YDN +N S  S  KI++SS+YG+PPE+WQPPG+GIVVRPGVKFVQVGE
Sbjct  61    PVSFRGEFVDRCYDNLKNSSRKSKEKINMSSNYGEPPEIWQPPGEGIVVRPGVKFVQVGE  120

Query  1621  --VDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAV  1448
               V G  SGSGGGFGSG+KDG WGGSNLG  FPTPK++C+GLDKFVIGQERAKKVLSVAV
Sbjct  121   GEVPGSGSGSGGGFGSGSKDGSWGGSNLGTQFPTPKQLCRGLDKFVIGQERAKKVLSVAV  180

Query  1447  YNHYKRIYNDSAQK  1406
             YNHYKRIYNDS+ K
Sbjct  181   YNHYKRIYNDSSHK  194



>ref|XP_011075988.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Sesamum indicum]
Length=573

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/421 (78%), Positives = 364/421 (86%), Gaps = 4/421 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  +GL    + ++  K+  S+ +Y    R  + +   S R     + DK EG E
Sbjct  156   FPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKRIYSDS---SQRPAGSTNGDKTEGKE  212

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
             +E VELEKSNIL+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  213   YENVELEKSNILLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  272

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL VADYNV AAQQGI+YIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  273   LLMVADYNVAAAQQGIIYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPE  332

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERR DSSIGFGAP+R NMRTGGVTS
Sbjct  333   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRHDSSIGFGAPIRANMRTGGVTS  392

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A VTSSLLETVESSDLI+YGLIPEFVGRFP+LV+L+AL+E QLVQVLTEPKNALGKQYKK
Sbjct  393   AAVTSSLLETVESSDLIAYGLIPEFVGRFPVLVNLSALSEEQLVQVLTEPKNALGKQYKK  452

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN VKLHFTEDALR IA+KAITKNTGARGLRS+LE+ILMDAMYEIPDVR+GD++IDA
Sbjct  453   MFQMNGVKLHFTEDALRLIAKKAITKNTGARGLRSMLENILMDAMYEIPDVRTGDDIIDA  512

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
             VIVD E+VG  GRG  AKILYGKGALD Y S ++ K+P+   EGSEA+ EVE DLPSI A
Sbjct  513   VIVDKESVGSGGRGSRAKILYGKGALDRYFSQHKLKDPETSSEGSEAEAEVEHDLPSIAA  572

Query  276   L  274
             L
Sbjct  573   L  573


 Score =   239 bits (611),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 154/198 (78%), Gaps = 8/198 (4%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGW-----NSRIKSKNYFTNSRHS  1811
             MAAALRSKS RETAS   S  RYFI NHM AGR+ +  W     NS   + ++ ++S  +
Sbjct  1     MAAALRSKSSRETASVAVSQFRYFIQNHMHAGRVNHFQWSSGFDNSYQNNSSFLSSSPFN  60

Query  1810  FSLFKPVSVRGEFVDRGYDNSRNLSSCGKIDISSSYGDPPEVWQPPG---DGIVVRPGVK  1640
             F+ FKP+S+RGE++D G +  +   +  KI+  SS GDPPEVWQPPG   DGIVVRPGVK
Sbjct  61    FTPFKPLSLRGEYIDNGKNYPKFSRNKRKIENFSSQGDPPEVWQPPGAGGDGIVVRPGVK  120

Query  1639  FVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVL  1460
             F+QV + DG ++GSGGGFG G KDGCWGGSNLGPNFPTPKEIC+GLDKFVIGQERAKKVL
Sbjct  121   FIQVTDGDGSNAGSGGGFGPGQKDGCWGGSNLGPNFPTPKEICRGLDKFVIGQERAKKVL  180

Query  1459  SVAVYNHYKRIYNDSAQK  1406
             SVAVYNHYKRIY+DS+Q+
Sbjct  181   SVAVYNHYKRIYSDSSQR  198



>gb|EYU25233.1| hypothetical protein MIMGU_mgv1a003646mg [Erythranthe guttata]
Length=572

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/422 (78%), Positives = 362/422 (86%), Gaps = 8/422 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  S+ +Y    R      + SD +    D  K EG +
Sbjct  157   FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKR------IYSDSSQRPADGGKTEGAD  210

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              E VELEKSNIL+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  211   DENVELEKSNILLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  270

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVADYNV AAQQGI+YIDEVDKITKKAES+NISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  271   LLTVADYNVVAAQQGIIYIDEVDKITKKAESMNISRDVSGEGVQQALLKMLEGTVVNVPE  330

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERR DSSIGFGAPVR NMR GGVTS
Sbjct  331   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRHDSSIGFGAPVRANMRMGGVTS  390

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A VTSSLLETVESSDLI+YGLIPEFVGRFP+LV+L+ALTE QLVQVLTEPKNALGKQY+K
Sbjct  391   AAVTSSLLETVESSDLIAYGLIPEFVGRFPVLVNLSALTEEQLVQVLTEPKNALGKQYRK  450

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN VKLHFTEDALR IARKAITKNTGARGLRS+LE++LMDAMYEIPD R+GD++IDA
Sbjct  451   MFQMNGVKLHFTEDALRLIARKAITKNTGARGLRSMLENVLMDAMYEIPDERTGDDIIDA  510

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPK-KIVEGSEADIEVERDLPSIV  280
             VIVD ++VG EGRGCGAKILYGKGALD Y S N+  + +    EGSE + EVE++ PSIV
Sbjct  511   VIVDKDSVGSEGRGCGAKILYGKGALDRYFSQNKANDSQVSSSEGSEVENEVEQEFPSIV  570

Query  279   AL  274
             AL
Sbjct  571   AL  572


 Score =   213 bits (541),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 147/199 (74%), Gaps = 9/199 (5%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRH------  1814
             MAA LRSKS R+  S   S  RYFI NH+ AGR+ +  W+S   + +Y +NS        
Sbjct  1     MAAVLRSKSSRDRTSVAISQFRYFIQNHLHAGRVNHFQWSSGFDNSSYRSNSSFISNPPF  60

Query  1813  SFSLFKPVSVRGEFVDRGYDNSRNLSSCGKIDISSSYGDPPEVWQPPG---DGIVVRPGV  1643
             + + FKP S RG+++D G +      +   I+ SSS GDPPEVWQPPG   DGI+VRPGV
Sbjct  61    NMTPFKPPSPRGDYIDSGKNFPNFFRNKRIIENSSSQGDPPEVWQPPGGGGDGIMVRPGV  120

Query  1642  KFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKV  1463
             KF+ VGE DG +SGSGGGFGSG KDG WGGSNLGP+FPTPKEICKGLDKFVIGQERAKKV
Sbjct  121   KFIHVGEGDGSNSGSGGGFGSGQKDGSWGGSNLGPDFPTPKEICKGLDKFVIGQERAKKV  180

Query  1462  LSVAVYNHYKRIYNDSAQK  1406
             LSVAVYNHYKRIY+DS+Q+
Sbjct  181   LSVAVYNHYKRIYSDSSQR  199



>gb|EYU19646.1| hypothetical protein MIMGU_mgv1a003999mg [Erythranthe guttata]
Length=550

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/422 (77%), Positives = 362/422 (86%), Gaps = 5/422 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  +GL    + ++  K+  S+ +Y    R  + +L    R    +D+DK EG +
Sbjct  132   FPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKRIHSDSL---QRTAGSSDNDKAEGKD  188

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              E VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  189   DEDVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  248

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL VADYNV AAQQGI+YIDEVDKI KKAES+NISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  249   LLMVADYNVAAAQQGIIYIDEVDKIIKKAESVNISRDVSGEGVQQALLKMLEGTVVNVPE  308

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILF+CGGAF DLEKTISERR DSSIGFGAPVR NMR GG+TS
Sbjct  309   KGARKHPRGDNIQIDTKDILFLCGGAFNDLEKTISERRHDSSIGFGAPVRANMRNGGLTS  368

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A VTSSLLETVESSDLI+YGLIPEFVGRFP+LV+L ALTENQLVQVLTEPKNALGKQY+K
Sbjct  369   AAVTSSLLETVESSDLIAYGLIPEFVGRFPVLVNLLALTENQLVQVLTEPKNALGKQYRK  428

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN VKLHFTED+LR IA+K +TKNTGARGLRS+LE++LMDAMYEIPDVR GD+VIDA
Sbjct  429   MFQMNGVKLHFTEDSLRLIAQKTLTKNTGARGLRSMLENLLMDAMYEIPDVREGDDVIDA  488

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGS-EADIEVERDLPSIV  280
             V+VD E+VG +GRGCGAKILYGKGALD Y S +E K+ KK  EGS E + EVE +LP IV
Sbjct  489   VVVDTESVGSDGRGCGAKILYGKGALDRYFSQHEFKDSKKTAEGSCEGEAEVEHELPCIV  548

Query  279   AL  274
             AL
Sbjct  549   AL  550


 Score =   158 bits (400),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 121/196 (62%), Gaps = 28/196 (14%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQ--AGRLGNLGWNSRIKSKNYFTNSRHSF--  1808
             MAAALRSKS R+TASA  SH R+FI N  +  +GR+ +   +S    ++Y +N R     
Sbjct  1     MAAALRSKSSRDTASAAVSHFRHFIQNQTRTHSGRVNHYHQSSGF-DRSYHSNFRFHLNP  59

Query  1807  -SLFKPVSVRGEFVDRGYDNSRNLSSCGKI-DISSSYGDPPEVWQPPGDGIVVRPGVKFV  1634
              S  K +S+ G ++D G ++ +      KI + SS  GDPP +WQPPG+      GV  +
Sbjct  60    PSNSKLISLHGNYIDGGNNSQKFFGHKRKIRNFSSQGGDPPSLWQPPGE-----EGVADI  114

Query  1633  QVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSV  1454
               G                 KD  WGGSNLG +FPTPKEIC+GLDKFVIGQERAKKVLSV
Sbjct  115   GPG----------------PKDAYWGGSNLGMDFPTPKEICRGLDKFVIGQERAKKVLSV  158

Query  1453  AVYNHYKRIYNDSAQK  1406
             AVYNHYKRI++DS Q+
Sbjct  159   AVYNHYKRIHSDSLQR  174



>ref|XP_010520973.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Tarenaya hassleriana]
Length=576

 Score =   578 bits (1491),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 300/360 (83%), Positives = 331/360 (92%), Gaps = 1/360 (0%)
 Frame = -2

Query  1353  EAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKL  1174
             E VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKL
Sbjct  214   ELVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKL  273

Query  1173  LTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEK  994
             LTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEK
Sbjct  274   LTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEK  333

Query  993   GARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSA  814
             GARKHPRGDNIQ+DTKDILFICGGAF+D+EKTISERR DSSIGFGAPVR NMR GGVT+A
Sbjct  334   GARKHPRGDNIQMDTKDILFICGGAFVDIEKTISERRHDSSIGFGAPVRANMRAGGVTNA  393

Query  813   VVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKM  634
              V S+L+ETVESSDLI+YGLIPEFVGRFP+LVSL+ALTENQLVQVLTEPKNALGKQYKK+
Sbjct  394   TVASTLMETVESSDLIAYGLIPEFVGRFPVLVSLSALTENQLVQVLTEPKNALGKQYKKL  453

Query  633   FQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidav  454
             F MN VKLHFT+ AL  +ARKAI+KN GARGLR++LESILMD+MYEIPDV++GD+VIDAV
Sbjct  454   FDMNGVKLHFTKGALSLVARKAISKNIGARGLRALLESILMDSMYEIPDVKAGDDVIDAV  513

Query  453   ivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
             +VD+EAV  EG RG GAKIL G+GALD YLS  + K+  ++ EGSE + EVE +LPS++A
Sbjct  514   VVDEEAVESEGRRGNGAKILRGEGALDRYLSKTKSKDSSEMKEGSEGETEVEIELPSVIA  573


 Score =   181 bits (458),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 133/204 (65%), Gaps = 19/204 (9%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAA RS + RETAS T S  RYFI N +  GR  +   N R K  +   N+    + +K
Sbjct  1     MAAAFRSNTSRETASLTLSQFRYFIFNRVHTGRTTSSQCNHRSKCDDPLPNA----TFYK  56

Query  1795  PVSVRGEFVDRG---YDNSRN--------LSSCGKIDISSSYGDPPEVWQPPGDGIVVR-  1652
             P+ + G+ V++G    D+ R          ++CGK  I SS GDPP+VWQPPGDGI VR 
Sbjct  57    PIFLGGQVVEKGTSFVDHRRENRNPSKSFATNCGKSAIFSSNGDPPDVWQPPGDGITVRV  116

Query  1651  --PGVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQE  1478
                 V   + G   G SSGSG G GS +K+  WGGSNLGPNFPTPKEICKGLD FVIGQE
Sbjct  117   NGSAVNLGRGGGGGGASSGSGNGVGSNSKE-SWGGSNLGPNFPTPKEICKGLDNFVIGQE  175

Query  1477  RAKKVLSVAVYNHYKRIYNDSAQK  1406
             RAKKVLSVAVYNHYKRIY +S+QK
Sbjct  176   RAKKVLSVAVYNHYKRIYYESSQK  199



>ref|XP_011024833.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Populus euphratica]
Length=581

 Score =   591 bits (1524),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 304/368 (83%), Positives = 333/368 (90%), Gaps = 0/368 (0%)
 Frame = -2

Query  1380  SDKVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGE  1201
             ++K E  + E VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGE
Sbjct  212   NEKAETMDEEEVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGE  271

Query  1200  DVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLE  1021
             DVESILYKLLT AD+NV AAQQGI+YIDEVDKITKKAES+NISRDVSGEGVQQALLKMLE
Sbjct  272   DVESILYKLLTAADHNVAAAQQGIIYIDEVDKITKKAESVNISRDVSGEGVQQALLKMLE  331

Query  1020  GTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTN  841
             GT+VNVP+K ARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR N
Sbjct  332   GTVVNVPDKEARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRAN  391

Query  840   MRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKN  661
             MRTGGVTSA +TSSLLET ESSDL+SYGLIPEFVGRFPILVSL+ALTE+QLVQVLTEPKN
Sbjct  392   MRTGGVTSAALTSSLLETAESSDLVSYGLIPEFVGRFPILVSLSALTEDQLVQVLTEPKN  451

Query  660   ALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVR  481
             ALGKQY+K+FQMN VKLH T+ ALRSIARKAITKNTGAR LRSILE+ILMD+MYEIPDVR
Sbjct  452   ALGKQYRKLFQMNGVKLHVTDHALRSIARKAITKNTGARALRSILENILMDSMYEIPDVR  511

Query  480   SGdnvidavivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVE  301
              G ++ID V+VD+EA+G E  G  AKILYG+GALD YLS N+ K  +  VEGS+ + EVE
Sbjct  512   RGADIIDTVVVDEEAIGPEECGARAKILYGRGALDRYLSKNKLKSSEATVEGSDGEPEVE  571

Query  300   RDLPSIVA  277
              +LP IVA
Sbjct  572   SELPKIVA  579


 Score =   164 bits (416),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 128/210 (61%), Gaps = 37/210 (18%)
 Frame = -1

Query  1969  AALRSKSCRETASATASHLRYFILNHMQAG-RLGNLGWNSRI-KSKNYFTNSRHSFSLFK  1796
             AA+R K  +ETAS      RYF+ N+M  G RL +    S+  K  ++F N+ H FS FK
Sbjct  4     AAVRGKPTKETAS----QFRYFMFNYMHVGSRLSSAHCASKTTKWDDHFANTPHHFSSFK  59

Query  1795  PVSVRGEFVDRGYDNSRNLSSCG------------KIDIS----SSYGDPPEVWQPPGDG  1664
             PVS+ GEFV++G     N+ S G            K+  +    S YGDPPEV +PPGDG
Sbjct  60    PVSLCGEFVEKGTQLLENMRSSGNSSKDFDRNWNQKVRYNGGDGSGYGDPPEVREPPGDG  119

Query  1663  I----VVRPGVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDK  1496
             +    V   GV F +VG             GSG+KDG WGGSNLG +FPTPK+ICK LDK
Sbjct  120   VAKLRVTDGGVNF-KVG----------SRGGSGSKDGSWGGSNLGSSFPTPKDICKALDK  168

Query  1495  FVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             FVIGQ+RAKKVLSVAVYNHYKRIY  S +K
Sbjct  169   FVIGQQRAKKVLSVAVYNHYKRIYVQSVKK  198



>ref|XP_011024834.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Populus euphratica]
Length=575

 Score =   590 bits (1520),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 304/368 (83%), Positives = 333/368 (90%), Gaps = 0/368 (0%)
 Frame = -2

Query  1380  SDKVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGE  1201
             ++K E  + E VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGE
Sbjct  206   NEKAETMDEEEVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGE  265

Query  1200  DVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLE  1021
             DVESILYKLLT AD+NV AAQQGI+YIDEVDKITKKAES+NISRDVSGEGVQQALLKMLE
Sbjct  266   DVESILYKLLTAADHNVAAAQQGIIYIDEVDKITKKAESVNISRDVSGEGVQQALLKMLE  325

Query  1020  GTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTN  841
             GT+VNVP+K ARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR N
Sbjct  326   GTVVNVPDKEARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRAN  385

Query  840   MRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKN  661
             MRTGGVTSA +TSSLLET ESSDL+SYGLIPEFVGRFPILVSL+ALTE+QLVQVLTEPKN
Sbjct  386   MRTGGVTSAALTSSLLETAESSDLVSYGLIPEFVGRFPILVSLSALTEDQLVQVLTEPKN  445

Query  660   ALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVR  481
             ALGKQY+K+FQMN VKLH T+ ALRSIARKAITKNTGAR LRSILE+ILMD+MYEIPDVR
Sbjct  446   ALGKQYRKLFQMNGVKLHVTDHALRSIARKAITKNTGARALRSILENILMDSMYEIPDVR  505

Query  480   SGdnvidavivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVE  301
              G ++ID V+VD+EA+G E  G  AKILYG+GALD YLS N+ K  +  VEGS+ + EVE
Sbjct  506   RGADIIDTVVVDEEAIGPEECGARAKILYGRGALDRYLSKNKLKSSEATVEGSDGEPEVE  565

Query  300   RDLPSIVA  277
              +LP IVA
Sbjct  566   SELPKIVA  573


 Score =   164 bits (416),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 128/210 (61%), Gaps = 37/210 (18%)
 Frame = -1

Query  1969  AALRSKSCRETASATASHLRYFILNHMQAG-RLGNLGWNSRI-KSKNYFTNSRHSFSLFK  1796
             AA+R K  +ETAS      RYF+ N+M  G RL +    S+  K  ++F N+ H FS FK
Sbjct  4     AAVRGKPTKETAS----QFRYFMFNYMHVGSRLSSAHCASKTTKWDDHFANTPHHFSSFK  59

Query  1795  PVSVRGEFVDRGYDNSRNLSSCG------------KIDIS----SSYGDPPEVWQPPGDG  1664
             PVS+ GEFV++G     N+ S G            K+  +    S YGDPPEV +PPGDG
Sbjct  60    PVSLCGEFVEKGTQLLENMRSSGNSSKDFDRNWNQKVRYNGGDGSGYGDPPEVREPPGDG  119

Query  1663  I----VVRPGVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDK  1496
             +    V   GV F +VG             GSG+KDG WGGSNLG +FPTPK+ICK LDK
Sbjct  120   VAKLRVTDGGVNF-KVG----------SRGGSGSKDGSWGGSNLGSSFPTPKDICKALDK  168

Query  1495  FVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             FVIGQ+RAKKVLSVAVYNHYKRIY  S +K
Sbjct  169   FVIGQQRAKKVLSVAVYNHYKRIYVQSVKK  198



>ref|XP_002318424.2| hypothetical protein POPTR_0012s02260g [Populus trichocarpa]
 gb|EEE96644.2| hypothetical protein POPTR_0012s02260g [Populus trichocarpa]
Length=597

 Score =   585 bits (1509),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 302/368 (82%), Positives = 333/368 (90%), Gaps = 0/368 (0%)
 Frame = -2

Query  1380  SDKVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGE  1201
             ++K E  + E VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQA YVGE
Sbjct  228   NEKAETMDEEEVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQARYVGE  287

Query  1200  DVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLE  1021
             DVES+LYKLLT ADYNV AAQQGI+YIDEVDKITKKAES+NISRDVSGEGVQQALLKMLE
Sbjct  288   DVESMLYKLLTAADYNVAAAQQGIIYIDEVDKITKKAESVNISRDVSGEGVQQALLKMLE  347

Query  1020  GTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTN  841
             GT+VNVP+K ARKHPRGDNIQI+TKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR N
Sbjct  348   GTVVNVPDKEARKHPRGDNIQINTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRAN  407

Query  840   MRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKN  661
             MRTGGVTSA +TSSLLET ESSDL+SYGLIPEFVGRFPILVSL+ALTE+QLVQVLTEPKN
Sbjct  408   MRTGGVTSAAMTSSLLETAESSDLVSYGLIPEFVGRFPILVSLSALTEDQLVQVLTEPKN  467

Query  660   ALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVR  481
             ALGKQY+K+FQMN VKLH TE ALRSIA KAITKNTGAR LRSILE+ILMD+MYEIPDV+
Sbjct  468   ALGKQYRKLFQMNGVKLHVTEHALRSIAIKAITKNTGARALRSILENILMDSMYEIPDVK  527

Query  480   SGdnvidavivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVE  301
              G ++IDAV+VD+EA+G + RG GAKILYG+GALD YLS N+ K  +  VEGS+ + EVE
Sbjct  528   RGADIIDAVVVDEEAIGPKQRGAGAKILYGRGALDHYLSKNKLKSSEATVEGSDGEPEVE  587

Query  300   RDLPSIVA  277
              +L  IVA
Sbjct  588   SELRKIVA  595


 Score =   167 bits (424),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 128/210 (61%), Gaps = 37/210 (18%)
 Frame = -1

Query  1969  AALRSKSCRETASATASHLRYFILNHMQAG-RLGNLGWNSRI-KSKNYFTNSRHSFSLFK  1796
             AA+R K  +ETAS      RYF+ N+M  G RL +    S+  K  ++F N+ H F+ FK
Sbjct  4     AAVRGKPTKETAS----QFRYFMFNYMHVGSRLSSAHCASKTTKWDDHFANTPHHFTSFK  59

Query  1795  PVSVRGEFVDRGYDNSRNLSSCG------------KIDISSS----YGDPPEVWQPPGDG  1664
             PVS+ GEFV++G     N+ S G            K+  +S     YGDPPEVW+PPGDG
Sbjct  60    PVSLCGEFVEKGTQLLENMRSSGNSSKDFDRNWSQKVRYNSGDGSGYGDPPEVWEPPGDG  119

Query  1663  I----VVRPGVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDK  1496
             +    V   GV F +VG  DG            +KDG WGGS LG +FPTPK+ICK LDK
Sbjct  120   VAKLKVTDGGVNF-KVGSRDGSG----------SKDGSWGGSKLGSSFPTPKDICKALDK  168

Query  1495  FVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             FVIGQ+RAKKVLSVAVYNHYKRI+ +S +K
Sbjct  169   FVIGQQRAKKVLSVAVYNHYKRIHLESVKK  198



>gb|KFK26956.1| hypothetical protein AALP_AA8G315200 [Arabis alpina]
Length=578

 Score =   584 bits (1506),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 303/371 (82%), Positives = 337/371 (91%), Gaps = 2/371 (1%)
 Frame = -2

Query  1383  DSDKVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVG  1204
             DS   +  + + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVG
Sbjct  206   DSTAAKPADDDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVG  265

Query  1203  EDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKML  1024
             EDVESILYKLLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKML
Sbjct  266   EDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKML  325

Query  1023  EGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRT  844
             EGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERR DSSIGFGAPVR 
Sbjct  326   EGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRHDSSIGFGAPVRA  385

Query  843   NMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPK  664
             NMR GGVT+A V S+L+ETVESSDLI+YGLIPEFVGRFP+LVSL+ALTENQL+QVLTEPK
Sbjct  386   NMRAGGVTNAAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLSALTENQLMQVLTEPK  445

Query  663   NALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDV  484
             NALGKQYKKM+QMN+VKLHFTE AL+ IARKAITKNTGARGLR++LESILMD+MYEIPD 
Sbjct  446   NALGKQYKKMYQMNSVKLHFTESALQLIARKAITKNTGARGLRALLESILMDSMYEIPDE  505

Query  483   RSGdnvidavivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKE-PKKIVEGSEADI  310
              +G+++I+AV+VD+EAV  EG RG GAKIL GKGAL  YLS  + K+ P+   EGS+ +I
Sbjct  506   STGNDMIEAVVVDEEAVEGEGRRGLGAKILRGKGALGRYLSETKSKDSPQVAKEGSDGEI  565

Query  309   EVERDLPSIVA  277
             EVE ++PS+VA
Sbjct  566   EVEAEIPSVVA  576


 Score =   168 bits (426),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 127/200 (64%), Gaps = 15/200 (8%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAALRS + RETAS T SH RYFI N +   R      N R KS +      +  +L +
Sbjct  1     MAAALRSNTSRETASLTLSHFRYFISNRIHTARTSTPHCNHRAKSDD----PSNKTALLR  56

Query  1795  P-----VSVRGEF--VDRGY--DNSRNLSSCGKIDISSSYGDPPEVWQPPGDGIVVR-PG  1646
             P     V  RGE    ++GY  D  + ++  G   + SS GDPP++WQPPGDG+ +R  G
Sbjct  57    PMGTSFVDYRGERRNSNKGYATDCVQKVNGVGS-SLLSSQGDPPDLWQPPGDGVSIRLNG  115

Query  1645  VKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKK  1466
                +      G S GSG G  S +K+  WGGSNLG NFPTPKEIC+GL+KFVIGQERAKK
Sbjct  116   STVILGRGGGGSSPGSGNGTESNSKEDSWGGSNLGTNFPTPKEICEGLNKFVIGQERAKK  175

Query  1465  VLSVAVYNHYKRIYNDSAQK  1406
             VLSVAVYNHYKRIY +S+QK
Sbjct  176   VLSVAVYNHYKRIYYESSQK  195



>ref|XP_002272792.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Vitis vinifera]
 ref|XP_010662855.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Vitis vinifera]
Length=583

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/421 (77%), Positives = 364/421 (86%), Gaps = 4/421 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  +GL    + ++  K+  S+ +Y    R    +L K     E    DK E T+
Sbjct  163   FPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKRIYHQSLQKWP--AEDTSDDKAEATD  220

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
             +++VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  221   NDSVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  280

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL VADYNV AAQQGIVYIDEVDKITKKAESLN+SRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  281   LLMVADYNVAAAQQGIVYIDEVDKITKKAESLNLSRDVSGEGVQQALLKMLEGTVVNVPE  340

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTGG T 
Sbjct  341   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTGGPTD  400

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A V SSLLETVESSDLISYGLIPEFVGRFPILVSL+ALTENQLV+VLTEPKNALGKQYKK
Sbjct  401   AAVASSLLETVESSDLISYGLIPEFVGRFPILVSLSALTENQLVEVLTEPKNALGKQYKK  460

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN VKLHFT++ALR I+RKA++KNTGARGLRSILE+ILM+AMYEIPDVR+G+++IDA
Sbjct  461   MFQMNGVKLHFTKNALRLISRKAMSKNTGARGLRSILENILMNAMYEIPDVRTGNDIIDA  520

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEG-SEADIEVERDLPSIV  280
             V+VDDEAVG +G G GAKILYGKGALDCYLS ++ KE +  +EG S+ + E E ++PSIV
Sbjct  521   VVVDDEAVGSDGHGFGAKILYGKGALDCYLSQHKLKETETPMEGSSDGEAEAEAEIPSIV  580

Query  279   A  277
             A
Sbjct  581   A  581


 Score =   196 bits (498),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 141/208 (68%), Gaps = 21/208 (10%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSR--HSFSL  1802
             MAAALRSKS RETA  T S  RYFILNHM AGRL N   + +    + FT+S   + F+ 
Sbjct  1     MAAALRSKSSRETALLTFSQFRYFILNHMHAGRLPNSYISHKPNCDHCFTHSHTPYHFTS  60

Query  1801  FKPVSVRGEFVDRG---YDNSRNLSSCG----------KIDISSSYGDPPEVWQPPGDGI  1661
             FKPVS+RGE VD+G   +DN R  S  G          +  I +S+GDPPEVW   GDGI
Sbjct  61    FKPVSLRGELVDKGLEFFDNQR-FSKVGFSTNESKKLSRDTILNSFGDPPEVWS--GDGI  117

Query  1660  VVR---PGVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFV  1490
             VVR    G   V+ G   G + G+G GFGS +KD  WGGSNLG NFPTPKEIC+GLDKFV
Sbjct  118   VVRQGGSGSNLVRGGGGAGANGGAGSGFGSNSKDESWGGSNLGHNFPTPKEICRGLDKFV  177

Query  1489  IGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             IGQERAKKVLSVAVYNHYKRIY+ S QK
Sbjct  178   IGQERAKKVLSVAVYNHYKRIYHQSLQK  205



>ref|XP_006441089.1| hypothetical protein CICLE_v10019480mg [Citrus clementina]
 ref|XP_006493316.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X2 [Citrus sinensis]
 gb|ESR54329.1| hypothetical protein CICLE_v10019480mg [Citrus clementina]
Length=573

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/420 (76%), Positives = 366/420 (87%), Gaps = 3/420 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  S+ +Y   +R    +  K  R+  ++ S   +G +
Sbjct  154   FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNESSQK--RSAGESSSCTTDGVD  211

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  212   DDTVELEKSNILLMGPTGSGKTLLAKTLARYVNVPFVIADATTLTQAGYVGEDVESILYK  271

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTV+DYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  272   LLTVSDYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPE  331

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERRQDSSIGFGAPVR NMR GGVT 
Sbjct  332   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRQDSSIGFGAPVRANMRAGGVTD  391

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             AVVTSSL+ETVESSDLI+YGLIPEFVGRFP+LVSL ALTENQLVQVLTEPKNALGKQY+K
Sbjct  392   AVVTSSLMETVESSDLIAYGLIPEFVGRFPVLVSLLALTENQLVQVLTEPKNALGKQYRK  451

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN VKLHFTE+ALR IA+KAI+KNTGARGLRS+LE+ILMDAMYEIPDVR+GD VIDA
Sbjct  452   MFQMNGVKLHFTENALRLIAKKAISKNTGARGLRSLLENILMDAMYEIPDVRAGDEVIDA  511

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
             V+VD+EAVG E RGCGAKILYGKGALD YL+ +++K+ +  V G++ + E+E ++PSIVA
Sbjct  512   VVVDEEAVGSEDRGCGAKILYGKGALDRYLAQHKRKDLETNVAGADGEPEMETEIPSIVA  571


 Score =   181 bits (460),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 133/196 (68%), Gaps = 17/196 (9%)
 Frame = -1

Query  1963  LRSK-SCRETASATASHLRYFILNHMQAGRLGNLGWNS-RIKSKNYFTNSRHSFSLFKPV  1790
             LRSK +   T S T S  RY +L++M AGR+ +    + R K  ++  N+ + F+ F+PV
Sbjct  8     LRSKPATVGTTSLTVSQFRYLMLSYMHAGRVASSSRCAHRSKWDDHVINTPYHFTSFRPV  67

Query  1789  SVRGEFVDRGYDNSRNLSSCGKIDISSS-----YGDPPEVWQPPGDGIVVR---PGVKFV  1634
             S+RGE V++G     + + C K+   SS     YGDPPEVWQPPGDGI VR    G   V
Sbjct  68    SLRGELVEKGSQLCTDNAKCQKLTGGSSSITSSYGDPPEVWQPPGDGIAVRVNGQGPNLV  127

Query  1633  QVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSV  1454
             +         GSG GFGSG+KDGCWGGSNLG  FPTPKEICKGLDKFVIGQERAKKVLSV
Sbjct  128   R-------GGGSGSGFGSGSKDGCWGGSNLGNKFPTPKEICKGLDKFVIGQERAKKVLSV  180

Query  1453  AVYNHYKRIYNDSAQK  1406
             AVYNHY RIYN+S+QK
Sbjct  181   AVYNHYMRIYNESSQK  196



>emb|CBI23009.3| unnamed protein product [Vitis vinifera]
Length=583

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/421 (77%), Positives = 363/421 (86%), Gaps = 4/421 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  +GL    + ++  K+  S+ +Y    R    +L K     E    DK E T+
Sbjct  163   FPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKRIYHQSLQKWP--AEDTSDDKAEATD  220

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
             +++VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQA YVGEDVESILYK
Sbjct  221   NDSVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQARYVGEDVESILYK  280

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL VADYNV AAQQGIVYIDEVDKITKKAESLN+SRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  281   LLMVADYNVAAAQQGIVYIDEVDKITKKAESLNLSRDVSGEGVQQALLKMLEGTVVNVPE  340

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTGG T 
Sbjct  341   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTGGPTD  400

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A V SSLLETVESSDLISYGLIPEFVGRFPILVSL+ALTENQLV+VLTEPKNALGKQYKK
Sbjct  401   AAVASSLLETVESSDLISYGLIPEFVGRFPILVSLSALTENQLVEVLTEPKNALGKQYKK  460

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN VKLHFT++ALR I+RKA++KNTGARGLRSILE+ILM+AMYEIPDVR+G+++IDA
Sbjct  461   MFQMNGVKLHFTKNALRLISRKAMSKNTGARGLRSILENILMNAMYEIPDVRTGNDIIDA  520

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEG-SEADIEVERDLPSIV  280
             V+VDDEAVG +G G GAKILYGKGALDCYLS ++ KE +  +EG S+ + E E ++PSIV
Sbjct  521   VVVDDEAVGSDGHGFGAKILYGKGALDCYLSQHKLKETETPMEGSSDGEAEAEAEIPSIV  580

Query  279   A  277
             A
Sbjct  581   A  581


 Score =   196 bits (498),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 141/208 (68%), Gaps = 21/208 (10%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSR--HSFSL  1802
             MAAALRSKS RETA  T S  RYFILNHM AGRL N   + +    + FT+S   + F+ 
Sbjct  1     MAAALRSKSSRETALLTFSQFRYFILNHMHAGRLPNSYISHKPNCDHCFTHSHTPYHFTS  60

Query  1801  FKPVSVRGEFVDRG---YDNSRNLSSCG----------KIDISSSYGDPPEVWQPPGDGI  1661
             FKPVS+RGE VD+G   +DN R  S  G          +  I +S+GDPPEVW   GDGI
Sbjct  61    FKPVSLRGELVDKGLEFFDNQR-FSKVGFSTNESKKLSRDTILNSFGDPPEVWS--GDGI  117

Query  1660  VVR---PGVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFV  1490
             VVR    G   V+ G   G + G+G GFGS +KD  WGGSNLG NFPTPKEIC+GLDKFV
Sbjct  118   VVRQGGSGSNLVRGGGGAGANGGAGSGFGSNSKDESWGGSNLGHNFPTPKEICRGLDKFV  177

Query  1489  IGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             IGQERAKKVLSVAVYNHYKRIY+ S QK
Sbjct  178   IGQERAKKVLSVAVYNHYKRIYHQSLQK  205



>ref|XP_006441090.1| hypothetical protein CICLE_v10019480mg [Citrus clementina]
 ref|XP_006493315.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X1 [Citrus sinensis]
 gb|ESR54330.1| hypothetical protein CICLE_v10019480mg [Citrus clementina]
Length=575

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/422 (76%), Positives = 366/422 (87%), Gaps = 5/422 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  S+ +Y   +R    +  K  R+  ++ S   +G +
Sbjct  154   FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNESSQK--RSAGESSSCTTDGVD  211

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  212   DDTVELEKSNILLMGPTGSGKTLLAKTLARYVNVPFVIADATTLTQAGYVGEDVESILYK  271

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTV+DYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  272   LLTVSDYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPE  331

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERRQDSSIGFGAPVR NMR GGVT 
Sbjct  332   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRQDSSIGFGAPVRANMRAGGVTD  391

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             AVVTSSL+ETVESSDLI+YGLIPEFVGRFP+LVSL ALTENQLVQVLTEPKNALGKQY+K
Sbjct  392   AVVTSSLMETVESSDLIAYGLIPEFVGRFPVLVSLLALTENQLVQVLTEPKNALGKQYRK  451

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN VKLHFTE+ALR IA+KAI+KNTGARGLRS+LE+ILMDAMYEIPDVR+GD VIDA
Sbjct  452   MFQMNGVKLHFTENALRLIAKKAISKNTGARGLRSLLENILMDAMYEIPDVRAGDEVIDA  511

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQK--EPKKIVEGSEADIEVERDLPSI  283
             V+VD+EAVG E RGCGAKILYGKGALD YL+ +++K  E +  V G++ + E+E ++PSI
Sbjct  512   VVVDEEAVGSEDRGCGAKILYGKGALDRYLAQHKRKDLELQTNVAGADGEPEMETEIPSI  571

Query  282   VA  277
             VA
Sbjct  572   VA  573


 Score =   182 bits (461),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 133/196 (68%), Gaps = 17/196 (9%)
 Frame = -1

Query  1963  LRSK-SCRETASATASHLRYFILNHMQAGRLGNLGWNS-RIKSKNYFTNSRHSFSLFKPV  1790
             LRSK +   T S T S  RY +L++M AGR+ +    + R K  ++  N+ + F+ F+PV
Sbjct  8     LRSKPATVGTTSLTVSQFRYLMLSYMHAGRVASSSRCAHRSKWDDHVINTPYHFTSFRPV  67

Query  1789  SVRGEFVDRGYDNSRNLSSCGKIDISSS-----YGDPPEVWQPPGDGIVVR---PGVKFV  1634
             S+RGE V++G     + + C K+   SS     YGDPPEVWQPPGDGI VR    G   V
Sbjct  68    SLRGELVEKGSQLCTDNAKCQKLTGGSSSITSSYGDPPEVWQPPGDGIAVRVNGQGPNLV  127

Query  1633  QVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSV  1454
             +         GSG GFGSG+KDGCWGGSNLG  FPTPKEICKGLDKFVIGQERAKKVLSV
Sbjct  128   R-------GGGSGSGFGSGSKDGCWGGSNLGNKFPTPKEICKGLDKFVIGQERAKKVLSV  180

Query  1453  AVYNHYKRIYNDSAQK  1406
             AVYNHY RIYN+S+QK
Sbjct  181   AVYNHYMRIYNESSQK  196



>ref|XP_008234752.1| PREDICTED: mitochondrial clpX-like chaperone MCX1 [Prunus mume]
Length=588

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/422 (78%), Positives = 361/422 (86%), Gaps = 5/422 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + +++ K+  S+ +Y    R    +L K       N   KV+  +
Sbjct  167   FPTPKEICKGLDKFVIGQEQAKKVLSVAVYNHYKRIYHESLQKWSAGDSGNS--KVDAMD  224

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  225   DDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  284

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  285   LLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  344

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRG+NIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTGGVT 
Sbjct  345   KGARKHPRGENIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTGGVTD  404

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A VTSSLLETVESSDLI YGLIPEFVGRFPILVSL+ALTENQLVQVLTEPKNALGKQYKK
Sbjct  405   AAVTSSLLETVESSDLIRYGLIPEFVGRFPILVSLSALTENQLVQVLTEPKNALGKQYKK  464

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MF+MN VKLHFTE ALR IARKAI+KNTGARGLR+ILE+ILMDAMYEIPDVR+GD++IDA
Sbjct  465   MFRMNGVKLHFTESALRLIARKAISKNTGARGLRAILENILMDAMYEIPDVRAGDDIIDA  524

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPK-KIVEG-SEADIEVERDLPSI  283
             V++D+EAVG E +G GAKILYGKGALD YLS N+ KE +    EG S+ + EVE +L S+
Sbjct  525   VVIDEEAVGSEAQGSGAKILYGKGALDHYLSRNKAKEVETATTEGSSDGEPEVETELSSV  584

Query  282   VA  277
             VA
Sbjct  585   VA  586


 Score =   189 bits (481),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 139/211 (66%), Gaps = 23/211 (11%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAALRSK  R+T S+T S  RYF+ N+M AGR+ N  +  RIK+++ F N+ + F+ FK
Sbjct  1     MAAALRSKPSRDTVSSTVSQFRYFVFNYMHAGRVVNSHYAHRIKNEDLFMNTPYHFTSFK  60

Query  1795  PVSVRGEFVDRG---YD----------NS-----RNLSSCGKIDISSSYGDPPEVWQPPG  1670
             PV++ G FV++G   +D          NS     R L S     + SS GDPPEVW   G
Sbjct  61    PVALGGNFVEKGSQIFDRPRVAQKTSKNSDRNWGRKLCSSRCNSVLSSQGDPPEVWS--G  118

Query  1669  DGIVVR--PGVKFVQVGEVDgpssgsgggf-gsGAKDGCWGGSNLGPNFPTPKEICKGLD  1499
             DGIVVR  P    V+ G   G  S   GG   S +KD CWGGS+LG NFPTPKEICKGLD
Sbjct  119   DGIVVRAGPSSNLVRGGGGGGGPSPGSGGGFESNSKDECWGGSSLGNNFPTPKEICKGLD  178

Query  1498  KFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             KFVIGQE+AKKVLSVAVYNHYKRIY++S QK
Sbjct  179   KFVIGQEQAKKVLSVAVYNHYKRIYHESLQK  209



>ref|XP_003526717.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Glycine max]
Length=524

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/420 (77%), Positives = 360/420 (86%), Gaps = 3/420 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  S+ +Y    R    T L      + ++S KV+  +
Sbjct  105   FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIFNETSLPKWPAGDSDNSVKVDAAD  164

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADAT+LTQAGYVGEDVESILYK
Sbjct  165   DDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATSLTQAGYVGEDVESILYK  224

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL VADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  225   LLMVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPE  284

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTK+ILFICGGAF+DLEKTISERR DSSIGFGAP+R NMRTG VT 
Sbjct  285   KGARKHPRGDNIQIDTKNILFICGGAFVDLEKTISERRHDSSIGFGAPIRANMRTGKVTE  344

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A V SSLLETVESSDLI+YGLIPEFVGRFPILVSL+ALTENQL+QVL+EPKNALGKQYKK
Sbjct  345   AAVASSLLETVESSDLIAYGLIPEFVGRFPILVSLSALTENQLIQVLSEPKNALGKQYKK  404

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN VKLHFTE+ALRSIARKAI+KNTGARGLRSILE++L+DAMYEIPD+R+ D+VIDA
Sbjct  405   MFQMNGVKLHFTENALRSIARKAISKNTGARGLRSILENVLVDAMYEIPDIRTDDDVIDA  464

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
             V+VD+EAVG EGRG GAKILYGKGALD YLS  EQK   + +E S AD E + +LPSIVA
Sbjct  465   VVVDEEAVGGEGRGRGAKILYGKGALDQYLS--EQKNDSETMEASAADNEADTELPSIVA  522


 Score =   135 bits (340),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 105/188 (56%), Gaps = 48/188 (26%)
 Frame = -1

Query  1966  ALRSKSC---RETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             A RSK C   +ETAS   +H R+ + N+ +AG       +SR   +  F           
Sbjct  3     AFRSKPCCSYKETASLALAHFRHLVFNYARAG-------SSRCPPRAGFG----------  45

Query  1795  PVSVRGEFVDRGYDNSRNLSSCGKIDISSSYGDPPEVWQPPGDGIVVRPGVKFVQVGEVD  1616
                     V RGY             + +S GDPPEVW   G GIVVRPG    +V    
Sbjct  46    --------VRRGYI------------VVASLGDPPEVWS--GGGIVVRPGNSNFEVA---  80

Query  1615  gpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHY  1436
                 G G      +K+GCWGGSNLG +FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHY
Sbjct  81    ---GGGGAPNSGDSKEGCWGGSNLGNSFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHY  137

Query  1435  KRIYNDSA  1412
             KRI+N+++
Sbjct  138   KRIFNETS  145



>ref|XP_008380808.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Malus domestica]
Length=588

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/422 (76%), Positives = 363/422 (86%), Gaps = 5/422 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  +GL +  + +++ K+  S+ +Y    R    +L K       N   KV+  +
Sbjct  167   FPTPKEICQGLDTFVIGQEKAKKVLSVAVYNHYKRIYHESLQKWSTGDSSNG--KVDAMD  224

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  225   DDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  284

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  285   LLTVADYNVTAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPE  344

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRG+NIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTGGVT 
Sbjct  345   KGARKHPRGENIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTGGVTD  404

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A VTSSLLE VESSDLI YGLIPEFVGRFPILVSL+ALTENQLV+VLTEPKNALGKQYKK
Sbjct  405   AAVTSSLLEIVESSDLIRYGLIPEFVGRFPILVSLSALTENQLVEVLTEPKNALGKQYKK  464

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MF+MN VKLHFTE ALR IARKAI+KNTGARGLR+ILE+ILMDAMYEIP+VR+GD++IDA
Sbjct  465   MFRMNGVKLHFTESALRLIARKAISKNTGARGLRAILENILMDAMYEIPEVRTGDDIIDA  524

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKI--VEGSEADIEVERDLPSI  283
             V++D+EAVG +G+GCGAKILYGKGALD Y S N+ K+ ++I   EGS+ + E E +L S+
Sbjct  525   VVIDEEAVGLDGKGCGAKILYGKGALDRYHSQNKAKDAEQIATTEGSDGEPEAETELSSV  584

Query  282   VA  277
             VA
Sbjct  585   VA  586


 Score =   181 bits (459),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 132/211 (63%), Gaps = 23/211 (11%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAALRSK  R+TAS+  S  RYF+ N+M AGR+ +     R KS + F N+ + F+ FK
Sbjct  1     MAAALRSKPSRDTASSAVSQFRYFVFNYMHAGRVASSHHAHRTKSDDLFMNTPYHFTSFK  60

Query  1795  PVSVRGEFVDRGYD-------------NS-----RNLSSCGKIDISSSYGDPPEVWQPPG  1670
             PV   G FV++G               NS     R LSS     + SS GDPPEVW   G
Sbjct  61    PVLPGGNFVEKGSQIFNHPRASQRVSKNSDKNWGRKLSSSRCNTVVSSQGDPPEVWS--G  118

Query  1669  DGIVVR--PGVKFVQVGEVDgpssgsgggf-gsGAKDGCWGGSNLGPNFPTPKEICKGLD  1499
             DGIVVR  PG   V+ G   G  S   GG   S +KD  WGGSNLG NFPTPKEIC+GLD
Sbjct  119   DGIVVRTAPGSNLVRXGXGGGGPSPGSGGGFDSNSKDENWGGSNLGNNFPTPKEICQGLD  178

Query  1498  KFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              FVIGQE+AKKVLSVAVYNHYKRIY++S QK
Sbjct  179   TFVIGQEKAKKVLSVAVYNHYKRIYHESLQK  209



>ref|XP_008376716.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Malus domestica]
Length=587

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/421 (77%), Positives = 361/421 (86%), Gaps = 4/421 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  +GL    + +++ K+  S+ +Y    R    +L K       N   KV+  +
Sbjct  167   FPTPKEICQGLDKFVIGQEKAKKVLSVAVYNHYKRIYHESLQKWSAGDSSNG--KVDAMD  224

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  225   DDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  284

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  285   LLTVADYNVTAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPE  344

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRG+NIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTGGVT 
Sbjct  345   KGARKHPRGENIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTGGVTD  404

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A VTSSLLE VESSDLI YGLIPEFVGRFPILVSL+ALTENQLV+VLTEPKNALGKQYKK
Sbjct  405   AAVTSSLLEIVESSDLIRYGLIPEFVGRFPILVSLSALTENQLVEVLTEPKNALGKQYKK  464

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MF+MN VKLHFTE ALR IARKAI+KNTGARGLR+ILE+ILMDAMYEIPDVR+GD++IDA
Sbjct  465   MFRMNGVKLHFTESALRLIARKAISKNTGARGLRAILENILMDAMYEIPDVRTGDDIIDA  524

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIV-EGSEADIEVERDLPSIV  280
             V++D+EAVG +G+GCGAKILYGKGALD YLS N+ K+ +    EGS+ + E E +L S+V
Sbjct  525   VVIDEEAVGLDGKGCGAKILYGKGALDHYLSQNKPKDVEIAAKEGSDGEPEAETELSSVV  584

Query  279   A  277
             A
Sbjct  585   A  585


 Score =   187 bits (475),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 137/211 (65%), Gaps = 23/211 (11%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAALRSK  R+TAS+ AS  RYF+ N+M +GR+ +  +  R KS + F N+ + F+ FK
Sbjct  1     MAAALRSKPSRDTASSAASQFRYFVFNYMHSGRVASSHYAHRTKSDDLFMNTPYHFTSFK  60

Query  1795  PVSVRGEFVDRG---YDN---------------SRNLSSCGKIDISSSYGDPPEVWQPPG  1670
             PV + G FV++G   +D+                R LSS     + SS GDPPEVW   G
Sbjct  61    PVLLGGNFVEKGSQIFDHPRASRRASKNSDKNWGRKLSSSRCNGVMSSQGDPPEVWS--G  118

Query  1669  DGIVVR--PGVKFVQVGEVDgpssgsgggf-gsGAKDGCWGGSNLGPNFPTPKEICKGLD  1499
             DGIVVR  PG   V+ G   G  +   GG   S +KD  WGGSNLG NFPTPKEIC+GLD
Sbjct  119   DGIVVRAAPGSNLVRGGGGGGGPNPGSGGGFDSNSKDENWGGSNLGRNFPTPKEICQGLD  178

Query  1498  KFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             KFVIGQE+AKKVLSVAVYNHYKRIY++S QK
Sbjct  179   KFVIGQEKAKKVLSVAVYNHYKRIYHESLQK  209



>gb|KDO54245.1| hypothetical protein CISIN_1g005637mg [Citrus sinensis]
Length=684

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/420 (76%), Positives = 366/420 (87%), Gaps = 3/420 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  S+ +Y   +R    +  K  R+  ++ S   +G +
Sbjct  265   FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNESSQK--RSAGESSSCTTDGVD  322

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  323   DDTVELEKSNILLMGPTGSGKTLLAKTLARYVNVPFVIADATTLTQAGYVGEDVESILYK  382

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTV+DYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  383   LLTVSDYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPE  442

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERRQDSSIGFGAPVR NMR GGVT 
Sbjct  443   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRQDSSIGFGAPVRANMRAGGVTD  502

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             AVVTSSL+ETVESSDLI+YGLIPEFVGRFP+LVSL ALTENQLVQVLTEPKNALGKQY+K
Sbjct  503   AVVTSSLMETVESSDLIAYGLIPEFVGRFPVLVSLLALTENQLVQVLTEPKNALGKQYRK  562

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN VKLHFTE+ALR IA+KAI+KNTGARGLRS+LE+ILMDAMYEIPDVR+GD VIDA
Sbjct  563   MFQMNGVKLHFTENALRLIAKKAISKNTGARGLRSLLENILMDAMYEIPDVRAGDEVIDA  622

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
             V+VD+EAVG E RGCGAKILYGKGALD YL+ +++K+ +  V G++ + E+E ++PSIVA
Sbjct  623   VVVDEEAVGSEDRGCGAKILYGKGALDRYLAQHKRKDLETNVAGADGEPEMETEIPSIVA  682


 Score =   180 bits (457),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 128/187 (68%), Gaps = 16/187 (9%)
 Frame = -1

Query  1939  TASATASHLRYFILNHMQAGRLGNLGWNS-RIKSKNYFTNSRHSFSLFKPVSVRGEFVDR  1763
             T S T S  RY +L++M AGR+ +    + R K  ++  N+ + F+ F+PVS+RGE V++
Sbjct  128   TTSLTVSQFRYLMLSYMHAGRVASSSRCAHRSKWDDHVINTPYHFTSFRPVSLRGELVEK  187

Query  1762  GYDNSRNLSSCGKIDISSS-----YGDPPEVWQPPGDGIVVR---PGVKFVQVGEVDgps  1607
             G     + + C K+   SS     YGDPPEVWQPPGDGI VR    G   V+        
Sbjct  188   GSQLCTDNAKCQKLTGGSSSITSSYGDPPEVWQPPGDGIAVRVNGQGPNLVR-------G  240

Query  1606  sgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRI  1427
              GSG GFGSG+KDGCWGGSNLG  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHY RI
Sbjct  241   GGSGSGFGSGSKDGCWGGSNLGNKFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRI  300

Query  1426  YNDSAQK  1406
             YN+S+QK
Sbjct  301   YNESSQK  307



>ref|XP_002321405.2| hypothetical protein POPTR_0015s01520g [Populus trichocarpa]
 gb|EEF05532.2| hypothetical protein POPTR_0015s01520g [Populus trichocarpa]
Length=572

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/423 (76%), Positives = 357/423 (84%), Gaps = 9/423 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIR---ESTMTLLKSDRNPEKNDSDKVE  1366
             F  P++  K L +  + ++  K+  S+ +Y    R   ES      +D   EK+D     
Sbjct  153   FPTPKEICKALDNFVIGQRRAKKVLSVAVYNHYKRIYLESVKKWSNTDSGNEKSDI----  208

Query  1365  GTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESI  1186
               + + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQA YVGEDVESI
Sbjct  209   -MDDDGVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQARYVGEDVESI  267

Query  1185  LYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVN  1006
             LYKLLT ADYNV AAQQGI+YIDE+DKITKKAES+NISRDVSGEGVQQALLKMLEGTIVN
Sbjct  268   LYKLLTAADYNVAAAQQGIIYIDEIDKITKKAESVNISRDVSGEGVQQALLKMLEGTIVN  327

Query  1005  VPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGG  826
             VPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTGG
Sbjct  328   VPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTGG  387

Query  825   VTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQ  646
             VTS  VTSSLLET ESSDL+SYGLIPEFVGRFPILVSL ALTE+QLVQVLTEPKNALGKQ
Sbjct  388   VTSTAVTSSLLETAESSDLVSYGLIPEFVGRFPILVSLAALTEDQLVQVLTEPKNALGKQ  447

Query  645   YKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnv  466
             YKK+FQMN+VKLH TE+ALRSIARKAITKNTGAR LRSILE+ILMD+MYEIPDVR+GD++
Sbjct  448   YKKLFQMNDVKLHVTENALRSIARKAITKNTGARALRSILENILMDSMYEIPDVRTGDDI  507

Query  465   idavivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPS  286
             IDAV+VD+ A+G E R  GAKILYG+GALD YLS  + K  KK  EGS+ + EVE +LPS
Sbjct  508   IDAVVVDEVAIGSEERSVGAKILYGRGALDHYLSKEKLKCSKKTTEGSDGEPEVESELPS  567

Query  285   IVA  277
             IVA
Sbjct  568   IVA  570


 Score =   158 bits (400),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 126/210 (60%), Gaps = 40/210 (19%)
 Frame = -1

Query  1969  AALRSKSCRETASATASHLRYFILNHMQAG-RLGNLGWNSRIKSKN-YFTNSRHSFSLFK  1796
             AA+R K  +     TAS  RYF+ N+M  G RL +    ++I +++ +F N+ + F+ FK
Sbjct  4     AAVRCKPTK----VTASQFRYFMFNYMHVGSRLSSSHCANKIATRDDHFANTPYHFTSFK  59

Query  1795  PVSVRGEFV-----------------DRGYDNSRNLSSCGKIDISSSYGDPPEVWQPPGD  1667
             PVS+RGEFV                 DR +  + + +S G     S+YGDPPEVWQPPGD
Sbjct  60    PVSLRGEFVEKSTQLLENMRSSSSSSDRNWRETVSSNSGG----GSNYGDPPEVWQPPGD  115

Query  1666  GIV---VRPGVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDK  1496
             G+    V  G    +V              GSG+KDG WGGSNLG +FPTPKEICK LD 
Sbjct  116   GVAKMRVSDGGGDFKV----------WSRGGSGSKDGYWGGSNLGSSFPTPKEICKALDN  165

Query  1495  FVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             FVIGQ RAKKVLSVAVYNHYKRIY +S +K
Sbjct  166   FVIGQRRAKKVLSVAVYNHYKRIYLESVKK  195



>ref|XP_002516670.1| ATP-dependent clp protease ATP-binding subunit clpx, putative 
[Ricinus communis]
 gb|EEF45689.1| ATP-dependent clp protease ATP-binding subunit clpx, putative 
[Ricinus communis]
Length=565

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/420 (76%), Positives = 358/420 (85%), Gaps = 3/420 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  +GL    + +   K+  S+ +Y    R    ++ K       N+  K E  +
Sbjct  146   FPTPKEICRGLDKFVIGQDRAKKVLSVAVYNHYKRIYHDSIQKWSAGDSGNN--KAEAMD  203

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  204   EDGVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  263

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL  ADYNV AAQQGIVYIDEVDKITKKAES+NISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  264   LLMAADYNVAAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQALLKMLEGTVVNVPE  323

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMR G VTS
Sbjct  324   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRMGSVTS  383

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A VTSSLLETVES DLISYGLIPEFVGRFP+LVSL+ALTENQLVQVLTEPKNALGKQYKK
Sbjct  384   AAVTSSLLETVESGDLISYGLIPEFVGRFPVLVSLSALTENQLVQVLTEPKNALGKQYKK  443

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN V+LHFTE+ALR IA+KAITKNTGARGLR+ILE+ILMDAMYEIPDV++G+++IDA
Sbjct  444   MFQMNGVRLHFTENALRLIAKKAITKNTGARGLRAILENILMDAMYEIPDVKTGEDIIDA  503

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
             V+VD+EAVG EG G G +ILYGKGALD YL+ N+ K+ ++ V+GS+ D EVE +L SIVA
Sbjct  504   VVVDEEAVGTEGCGTGGRILYGKGALDRYLAENKLKDSERTVDGSDGDPEVETELSSIVA  563


 Score =   189 bits (481),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 134/201 (67%), Gaps = 24/201 (12%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNS------RIKSKNYFTNSRH  1814
             MAA  R+K  +ETA       RYFI N+M AG  G +   S      R K  ++F+N+ +
Sbjct  1     MAAVFRAKPSKETA---FYQFRYFIFNYMHAG--GAIMSTSTSYCTHRNKWDDHFSNTPY  55

Query  1813  SFSLFKPVSVRGEFVDRG---YDNSRNLSSCGKIDIS--SSYGDPPEVWQPPGDGIVVRP  1649
              F+ FKPVS+RGEF+++G    DN RN S   K      S+YGDPPEVWQPPGDGI    
Sbjct  56    HFTSFKPVSLRGEFIEKGNQLLDNKRNWSEKLKNSSGGGSNYGDPPEVWQPPGDGIAT--  113

Query  1648  GVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAK  1469
                 V+V EV        GG GS +KDGCWGGS+LG NFPTPKEIC+GLDKFVIGQ+RAK
Sbjct  114   ----VRVSEV--RGGEGRGGPGSNSKDGCWGGSDLGNNFPTPKEICRGLDKFVIGQDRAK  167

Query  1468  KVLSVAVYNHYKRIYNDSAQK  1406
             KVLSVAVYNHYKRIY+DS QK
Sbjct  168   KVLSVAVYNHYKRIYHDSIQK  188



>ref|XP_009368656.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Pyrus x bretschneideri]
Length=587

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/421 (76%), Positives = 360/421 (86%), Gaps = 4/421 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  +GL    + + + K+  S+ +Y    R    +L K       N   KV+  +
Sbjct  167   FPTPKEICQGLDKFVIGQDKAKKVLSVAVYNHYKRIYHESLQKWSAGDSSNG--KVDAMD  224

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  225   DDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  284

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  285   LLTVADYNVTAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPE  344

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRG+NIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTGGVT 
Sbjct  345   KGARKHPRGENIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTGGVTD  404

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A VTSSLLE VESSDLI YGLIPEFVGRFPILVSL+ALTENQLV+VLTEPKNALGKQYKK
Sbjct  405   AAVTSSLLEIVESSDLIRYGLIPEFVGRFPILVSLSALTENQLVEVLTEPKNALGKQYKK  464

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MF+MN VKLHFTE ALR IARKAI+KNTGARGLR+ILE+ILMDAMYEIPDVR+GD++IDA
Sbjct  465   MFRMNGVKLHFTESALRLIARKAISKNTGARGLRAILENILMDAMYEIPDVRTGDDIIDA  524

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIV-EGSEADIEVERDLPSIV  280
             V++D+EAVG +G+GCGAKILYGKGALD +LS N+ K+ +    EGS+ + E E +L S+V
Sbjct  525   VVIDEEAVGLDGKGCGAKILYGKGALDHFLSQNKPKDVETAAKEGSDGEPEAETELSSVV  584

Query  279   A  277
             A
Sbjct  585   A  585


 Score =   180 bits (456),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 133/211 (63%), Gaps = 23/211 (11%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAALRSK  R+ AS+  S  RYF+ N+M AGR+ +  +  R K+ + F N+ + F+ FK
Sbjct  1     MAAALRSKPSRDAASSAVSQFRYFVFNYMHAGRVASSHYAHRTKNDDLFMNTPYHFTSFK  60

Query  1795  PVSVRGEFVDRG---YDN---------------SRNLSSCGKIDISSSYGDPPEVWQPPG  1670
             PV + G FV++G   +D+                R LSS     + SS GDPPEVW   G
Sbjct  61    PVLLGGNFVEKGSQIFDHPRASQRASKNSDKNWGRKLSSSRCNGVMSSQGDPPEVWS--G  118

Query  1669  DGIVVR--PGVKFVQVGEVDgpssgsgggf-gsGAKDGCWGGSNLGPNFPTPKEICKGLD  1499
             DGIVVR  PG   V+ G      S   GG   S +KD  WGGS LG NFPTPKEIC+GLD
Sbjct  119   DGIVVRAAPGSNLVRGGGGGSGPSPGSGGGFDSNSKDENWGGSKLGKNFPTPKEICQGLD  178

Query  1498  KFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             KFVIGQ++AKKVLSVAVYNHYKRIY++S QK
Sbjct  179   KFVIGQDKAKKVLSVAVYNHYKRIYHESLQK  209



>ref|XP_009357301.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Pyrus x bretschneideri]
Length=587

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/421 (76%), Positives = 360/421 (86%), Gaps = 4/421 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  +GL    + + + K+  S+ +Y    R    +L K       N   KV+  +
Sbjct  167   FPTPKEICQGLDKFVIGQDKAKKVLSVAVYNHYKRIYHESLQKWSAGDSSNG--KVDAMD  224

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  225   DDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  284

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  285   LLTVADYNVTAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPE  344

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRG+NIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTGGVT 
Sbjct  345   KGARKHPRGENIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTGGVTD  404

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A VTSSLLE VESSDLI YGLIPEFVGRFPILVSL+ALTENQLV+VLTEPKNALGKQYKK
Sbjct  405   AAVTSSLLEIVESSDLIRYGLIPEFVGRFPILVSLSALTENQLVEVLTEPKNALGKQYKK  464

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MF+MN VKLHFTE ALR IARKAI+KNTGARGLR+ILE+ILMDAM+EIPDVR+GD++IDA
Sbjct  465   MFRMNGVKLHFTESALRLIARKAISKNTGARGLRAILENILMDAMFEIPDVRTGDDIIDA  524

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIV-EGSEADIEVERDLPSIV  280
             V++D+EAVG +G+GCGAKILYGKGALD YLS N+ K+ +    EGS+ + E E +L S+V
Sbjct  525   VVIDEEAVGLDGKGCGAKILYGKGALDHYLSQNKPKDVETAAKEGSDGEPEAETELSSVV  584

Query  279   A  277
             A
Sbjct  585   A  585


 Score =   180 bits (456),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 133/211 (63%), Gaps = 23/211 (11%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAALRSK  R+ AS+  S  RYF+ N+M AGR+ +  +  R K+ + F N+ + F+ FK
Sbjct  1     MAAALRSKPSRDAASSAVSQFRYFVFNYMHAGRVASSHYAHRTKNDDLFMNTPYHFTSFK  60

Query  1795  PVSVRGEFVDRG---YDN---------------SRNLSSCGKIDISSSYGDPPEVWQPPG  1670
             PV + G FV++G   +D+                R LSS     + SS GDPPEVW   G
Sbjct  61    PVLLGGNFVEKGSQIFDHPRASQRASKNSDKNWGRKLSSSRCNGVMSSQGDPPEVWS--G  118

Query  1669  DGIVVR--PGVKFVQVGEVDgpssgsgggf-gsGAKDGCWGGSNLGPNFPTPKEICKGLD  1499
             DGIVVR  PG   V+ G      S   GG   S +KD  WGGS LG NFPTPKEIC+GLD
Sbjct  119   DGIVVRAAPGSNLVRGGGGGSGPSPGSGGGFDSNSKDENWGGSKLGKNFPTPKEICQGLD  178

Query  1498  KFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             KFVIGQ++AKKVLSVAVYNHYKRIY++S QK
Sbjct  179   KFVIGQDKAKKVLSVAVYNHYKRIYHESLQK  209



>gb|KDO54243.1| hypothetical protein CISIN_1g005637mg [Citrus sinensis]
Length=684

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/420 (76%), Positives = 366/420 (87%), Gaps = 3/420 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  S+ +Y   +R    +  K  R+  ++ S   +G +
Sbjct  265   FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNESSQK--RSAGESSSCTTDGVD  322

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  323   DDTVELEKSNILLMGPTGSGKTLLAKTLARYVNVPFVIADATTLTQAGYVGEDVESILYK  382

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTV+DYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  383   LLTVSDYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPE  442

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERRQDSSIGFGAPVR NMR GGVT 
Sbjct  443   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRQDSSIGFGAPVRANMRAGGVTD  502

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             AVVTSSL+ETV+SSDLI+YGLIPEFVGRFP+LVSL ALTENQLVQVLTEPKNALGKQY+K
Sbjct  503   AVVTSSLMETVKSSDLIAYGLIPEFVGRFPVLVSLLALTENQLVQVLTEPKNALGKQYRK  562

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN VKLHFTE+ALR IA+KAI+KNTGARGLRS+LE+ILMDAMYEIPDVR+GD VIDA
Sbjct  563   MFQMNGVKLHFTENALRLIAKKAISKNTGARGLRSLLENILMDAMYEIPDVRAGDEVIDA  622

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
             V+VD+EAVG E RGCGAKILYGKGALD YL+ +++K+ +  V G++ + E+E ++PSIVA
Sbjct  623   VVVDEEAVGSEDRGCGAKILYGKGALDRYLAQHKRKDLETNVAGADGEPEMETEIPSIVA  682


 Score =   180 bits (457),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 128/187 (68%), Gaps = 16/187 (9%)
 Frame = -1

Query  1939  TASATASHLRYFILNHMQAGRLGNLGWNS-RIKSKNYFTNSRHSFSLFKPVSVRGEFVDR  1763
             T S T S  RY +L++M AGR+ +    + R K  ++  N+ + F+ F+PVS+RGE V++
Sbjct  128   TTSLTVSQFRYLMLSYMHAGRVASSSRCAHRSKWDDHVINTPYHFTSFRPVSLRGELVEK  187

Query  1762  GYDNSRNLSSCGKIDISSS-----YGDPPEVWQPPGDGIVVR---PGVKFVQVGEVDgps  1607
             G     + + C K+   SS     YGDPPEVWQPPGDGI VR    G   V+        
Sbjct  188   GSQLCTDNAKCQKLTGGSSSITSSYGDPPEVWQPPGDGIAVRVNGQGPNLVR-------G  240

Query  1606  sgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRI  1427
              GSG GFGSG+KDGCWGGSNLG  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHY RI
Sbjct  241   GGSGSGFGSGSKDGCWGGSNLGNKFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRI  300

Query  1426  YNDSAQK  1406
             YN+S+QK
Sbjct  301   YNESSQK  307



>ref|XP_008380812.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Malus domestica]
Length=587

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/421 (76%), Positives = 361/421 (86%), Gaps = 4/421 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  +GL +  + +++ K+  S+ +Y    R    +L K       N   KV+  +
Sbjct  167   FPTPKEICQGLDTFVIGQEKAKKVLSVAVYNHYKRIYHESLQKWSTGDSSNG--KVDAMD  224

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  225   DDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  284

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  285   LLTVADYNVTAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPE  344

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRG+NIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTGGVT 
Sbjct  345   KGARKHPRGENIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTGGVTD  404

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A VTSSLLE VESSDLI YGLIPEFVGRFPILVSL+ALTENQLV+VLTEPKNALGKQYKK
Sbjct  405   AAVTSSLLEIVESSDLIRYGLIPEFVGRFPILVSLSALTENQLVEVLTEPKNALGKQYKK  464

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MF+MN VKLHFTE ALR IARKAI+KNTGARGLR+ILE+ILMDAMYEIP+VR+GD++IDA
Sbjct  465   MFRMNGVKLHFTESALRLIARKAISKNTGARGLRAILENILMDAMYEIPEVRTGDDIIDA  524

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPK-KIVEGSEADIEVERDLPSIV  280
             V++D+EAVG +G+GCGAKILYGKGALD Y S N+ K+ +    EGS+ + E E +L S+V
Sbjct  525   VVIDEEAVGLDGKGCGAKILYGKGALDRYHSQNKAKDAEIATTEGSDGEPEAETELSSVV  584

Query  279   A  277
             A
Sbjct  585   A  585


 Score =   181 bits (459),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 132/211 (63%), Gaps = 23/211 (11%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAALRSK  R+TAS+  S  RYF+ N+M AGR+ +     R KS + F N+ + F+ FK
Sbjct  1     MAAALRSKPSRDTASSAVSQFRYFVFNYMHAGRVASSHHAHRTKSDDLFMNTPYHFTSFK  60

Query  1795  PVSVRGEFVDRGYD-------------NS-----RNLSSCGKIDISSSYGDPPEVWQPPG  1670
             PV   G FV++G               NS     R LSS     + SS GDPPEVW   G
Sbjct  61    PVLPGGNFVEKGSQIFNHPRASQRVSKNSDKNWGRKLSSSRCNTVVSSQGDPPEVWS--G  118

Query  1669  DGIVVR--PGVKFVQVGEVDgpssgsgggf-gsGAKDGCWGGSNLGPNFPTPKEICKGLD  1499
             DGIVVR  PG   V+ G   G  S   GG   S +KD  WGGSNLG NFPTPKEIC+GLD
Sbjct  119   DGIVVRTAPGSNLVRXGXGGGGPSPGSGGGFDSNSKDENWGGSNLGNNFPTPKEICQGLD  178

Query  1498  KFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              FVIGQE+AKKVLSVAVYNHYKRIY++S QK
Sbjct  179   TFVIGQEKAKKVLSVAVYNHYKRIYHESLQK  209



>gb|KDP25897.1| hypothetical protein JCGZ_23723 [Jatropha curcas]
Length=580

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/422 (76%), Positives = 360/422 (85%), Gaps = 3/422 (1%)
 Frame = -2

Query  1539  QIFRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEG  1363
             Q F  P++  KGL    + ++  K+  S+ +Y    R    ++ K     +  DS K E 
Sbjct  159   QNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYHDSIQKWSAG-DSGDS-KAEA  216

Query  1362  TEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESIL  1183
                + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESIL
Sbjct  217   MNDDGVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESIL  276

Query  1182  YKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNV  1003
             YKLL  ADYNV AAQQGIVYIDEVDKITKKAES+N+SRDVSGEGVQQALLKMLEGT+VNV
Sbjct  277   YKLLLSADYNVAAAQQGIVYIDEVDKITKKAESVNVSRDVSGEGVQQALLKMLEGTVVNV  336

Query  1002  PEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGV  823
             PEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTG V
Sbjct  337   PEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTGSV  396

Query  822   TSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQY  643
             TSA VTSSLLET ESSDLISYGLIPEFVGRFP+LVSL+ALTENQLVQVLTEPKNALGKQY
Sbjct  397   TSAAVTSSLLETAESSDLISYGLIPEFVGRFPVLVSLSALTENQLVQVLTEPKNALGKQY  456

Query  642   KKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvi  463
             KKMFQ+N VKLHFTE+ALR IA+KAITKNTGARGLR+ILE+ILMD+MYEIPDVR+G++++
Sbjct  457   KKMFQLNGVKLHFTENALRLIAKKAITKNTGARGLRAILENILMDSMYEIPDVRTGEDIL  516

Query  462   davivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSI  283
             DAV+VD+EAVG EGRG GAKILYGKGA D YLS ++ K+ +  ++G + + EVE +L SI
Sbjct  517   DAVVVDEEAVGTEGRGTGAKILYGKGAFDRYLSKHKLKDTETSLDGCDGEPEVETELSSI  576

Query  282   VA  277
             VA
Sbjct  577   VA  578


 Score =   189 bits (479),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 130/206 (63%), Gaps = 19/206 (9%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAA LRSK  +E AS T S  RYF+ N +  G + +       K  ++ +N+ + FS  K
Sbjct  1     MAAVLRSKPAKEAASFTTSQFRYFLFNCVHTGSMSSSYSTHWDKWDDHSSNTPYHFSSLK  60

Query  1795  PVSVRGEFVDRG---YDN--SRNLSS-----------CGKIDISSSYGDPPEVWQPPGDG  1664
             PVS+RGEFVD+G    DN  SR  SS               +  S+YGDPPEVWQPPGDG
Sbjct  61    PVSLRGEFVDKGTQFLDNRKSRRYSSKDFGGNWNQRSNCSSNNGSNYGDPPEVWQPPGDG  120

Query  1663  IVVRPGVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIG  1484
             I     ++  + G       G   G GS +KD CWGGSNLG NFPTPKEICKGLDKFVIG
Sbjct  121   ITT---IRVSESGANVVRGGGGRNGSGSNSKDECWGGSNLGQNFPTPKEICKGLDKFVIG  177

Query  1483  QERAKKVLSVAVYNHYKRIYNDSAQK  1406
             QERAKKVLSVAVYNHYKRIY+DS QK
Sbjct  178   QERAKKVLSVAVYNHYKRIYHDSIQK  203



>gb|KDO54242.1| hypothetical protein CISIN_1g005637mg [Citrus sinensis]
Length=684

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/420 (76%), Positives = 365/420 (87%), Gaps = 3/420 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  S+ +Y   +R    +  K  R+  ++ S   +G +
Sbjct  265   FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNESSQK--RSAGESSSCTTDGVD  322

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQA YVGEDVESILYK
Sbjct  323   DDTVELEKSNILLMGPTGSGKTLLAKTLARYVNVPFVIADATTLTQARYVGEDVESILYK  382

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTV+DYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  383   LLTVSDYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPE  442

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERRQDSSIGFGAPVR NMR GGVT 
Sbjct  443   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRQDSSIGFGAPVRANMRAGGVTD  502

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             AVVTSSL+ETVESSDLI+YGLIPEFVGRFP+LVSL ALTENQLVQVLTEPKNALGKQY+K
Sbjct  503   AVVTSSLMETVESSDLIAYGLIPEFVGRFPVLVSLLALTENQLVQVLTEPKNALGKQYRK  562

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN VKLHFTE+ALR IA+KAI+KNTGARGLRS+LE+ILMDAMYEIPDVR+GD VIDA
Sbjct  563   MFQMNGVKLHFTENALRLIAKKAISKNTGARGLRSLLENILMDAMYEIPDVRAGDEVIDA  622

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
             V+VD+EAVG E RGCGAKILYGKGALD YL+ +++K+ +  V G++ + E+E ++PSIVA
Sbjct  623   VVVDEEAVGSEDRGCGAKILYGKGALDRYLAQHKRKDLETNVAGADGEPEMETEIPSIVA  682


 Score =   180 bits (457),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 128/187 (68%), Gaps = 16/187 (9%)
 Frame = -1

Query  1939  TASATASHLRYFILNHMQAGRLGNLGWNS-RIKSKNYFTNSRHSFSLFKPVSVRGEFVDR  1763
             T S T S  RY +L++M AGR+ +    + R K  ++  N+ + F+ F+PVS+RGE V++
Sbjct  128   TTSLTVSQFRYLMLSYMHAGRVASSSRCAHRSKWDDHVINTPYHFTSFRPVSLRGELVEK  187

Query  1762  GYDNSRNLSSCGKIDISSS-----YGDPPEVWQPPGDGIVVR---PGVKFVQVGEVDgps  1607
             G     + + C K+   SS     YGDPPEVWQPPGDGI VR    G   V+        
Sbjct  188   GSQLCTDNAKCQKLTGGSSSITSSYGDPPEVWQPPGDGIAVRVNGQGPNLVR-------G  240

Query  1606  sgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRI  1427
              GSG GFGSG+KDGCWGGSNLG  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHY RI
Sbjct  241   GGSGSGFGSGSKDGCWGGSNLGNKFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRI  300

Query  1426  YNDSAQK  1406
             YN+S+QK
Sbjct  301   YNESSQK  307



>ref|XP_009352023.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Pyrus x bretschneideri]
Length=588

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/422 (76%), Positives = 362/422 (86%), Gaps = 5/422 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  +GL    + +++ K+  S+ +Y    R    +L K       N   KV+ T+
Sbjct  167   FPTPKEICQGLDKFVIGQEKAKKVLSVAVYNHYKRIYHESLQKWSTGDSSNG--KVDATD  224

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  225   DDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  284

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  285   LLTVADYNVTAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPE  344

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRG+NIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTGGVT 
Sbjct  345   KGARKHPRGENIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTGGVTD  404

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A VTSSLLE VESSDLI YGLIPEFVGRFPILVSL+ALTENQLV+VLTEPKNALGKQYKK
Sbjct  405   AAVTSSLLEIVESSDLIRYGLIPEFVGRFPILVSLSALTENQLVEVLTEPKNALGKQYKK  464

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MF+MN VKLHFTE ALR IA +AI+KNTGARGLR+ILE+ILMDAMYEIP+VR+GD++IDA
Sbjct  465   MFRMNGVKLHFTESALRLIATRAISKNTGARGLRAILENILMDAMYEIPEVRTGDDIIDA  524

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIV--EGSEADIEVERDLPSI  283
             V++D+EAVG +G+GCGAKILYGKGALD Y S N+ K+ ++I   EG++ + E E +L S+
Sbjct  525   VVIDEEAVGLDGKGCGAKILYGKGALDRYHSQNKAKDAEQIATPEGTDGEPEAETELSSV  584

Query  282   VA  277
             VA
Sbjct  585   VA  586


 Score =   184 bits (466),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 135/211 (64%), Gaps = 23/211 (11%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAALRSK  R+TAS+  S  RYF+LN+M A R+ +  +  R KS++ F N+ + F+ F 
Sbjct  1     MAAALRSKPSRDTASSAVSQFRYFVLNYMHASRVASSHYAHRTKSEDLFMNTPYHFTSFN  60

Query  1795  PVSVRGEFVDRGYD-------------NS-----RNLSSCGKIDISSSYGDPPEVWQPPG  1670
             PV + G+FV +G               NS     R LSS     + SS GDPPEVW   G
Sbjct  61    PVLLGGKFVGKGSQIFNHPRASQRVSKNSDKNWGRKLSSSRCNTVVSSQGDPPEVWS--G  118

Query  1669  DGIVVR--PGVKFVQVGEVDgpssgsgggf-gsGAKDGCWGGSNLGPNFPTPKEICKGLD  1499
             DGIVVR  PG   V+ G   G  S   GG   S +KD  WGGSNLG NFPTPKEIC+GLD
Sbjct  119   DGIVVRTAPGSNLVRGGGGGGGPSPGSGGGFDSNSKDDNWGGSNLGNNFPTPKEICQGLD  178

Query  1498  KFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             KFVIGQE+AKKVLSVAVYNHYKRIY++S QK
Sbjct  179   KFVIGQEKAKKVLSVAVYNHYKRIYHESLQK  209



>gb|KDO54244.1| hypothetical protein CISIN_1g005637mg [Citrus sinensis]
Length=686

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/422 (76%), Positives = 366/422 (87%), Gaps = 5/422 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  S+ +Y   +R    +  K  R+  ++ S   +G +
Sbjct  265   FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNESSQK--RSAGESSSCTTDGVD  322

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  323   DDTVELEKSNILLMGPTGSGKTLLAKTLARYVNVPFVIADATTLTQAGYVGEDVESILYK  382

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTV+DYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  383   LLTVSDYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPE  442

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERRQDSSIGFGAPVR NMR GGVT 
Sbjct  443   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRQDSSIGFGAPVRANMRAGGVTD  502

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             AVVTSSL+ETVESSDLI+YGLIPEFVGRFP+LVSL ALTENQLVQVLTEPKNALGKQY+K
Sbjct  503   AVVTSSLMETVESSDLIAYGLIPEFVGRFPVLVSLLALTENQLVQVLTEPKNALGKQYRK  562

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN VKLHFTE+ALR IA+KAI+KNTGARGLRS+LE+ILMDAMYEIPDVR+GD VIDA
Sbjct  563   MFQMNGVKLHFTENALRLIAKKAISKNTGARGLRSLLENILMDAMYEIPDVRAGDEVIDA  622

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQK--EPKKIVEGSEADIEVERDLPSI  283
             V+VD+EAVG E RGCGAKILYGKGALD YL+ +++K  E +  V G++ + E+E ++PSI
Sbjct  623   VVVDEEAVGSEDRGCGAKILYGKGALDRYLAQHKRKDLELQTNVAGADGEPEMETEIPSI  682

Query  282   VA  277
             VA
Sbjct  683   VA  684


 Score =   180 bits (457),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 128/187 (68%), Gaps = 16/187 (9%)
 Frame = -1

Query  1939  TASATASHLRYFILNHMQAGRLGNLGWNS-RIKSKNYFTNSRHSFSLFKPVSVRGEFVDR  1763
             T S T S  RY +L++M AGR+ +    + R K  ++  N+ + F+ F+PVS+RGE V++
Sbjct  128   TTSLTVSQFRYLMLSYMHAGRVASSSRCAHRSKWDDHVINTPYHFTSFRPVSLRGELVEK  187

Query  1762  GYDNSRNLSSCGKIDISSS-----YGDPPEVWQPPGDGIVVR---PGVKFVQVGEVDgps  1607
             G     + + C K+   SS     YGDPPEVWQPPGDGI VR    G   V+        
Sbjct  188   GSQLCTDNAKCQKLTGGSSSITSSYGDPPEVWQPPGDGIAVRVNGQGPNLVR-------G  240

Query  1606  sgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRI  1427
              GSG GFGSG+KDGCWGGSNLG  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHY RI
Sbjct  241   GGSGSGFGSGSKDGCWGGSNLGNKFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRI  300

Query  1426  YNDSAQK  1406
             YN+S+QK
Sbjct  301   YNESSQK  307



>ref|XP_009119879.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Brassica rapa]
Length=551

 Score =   586 bits (1510),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 305/380 (80%), Positives = 339/380 (89%), Gaps = 8/380 (2%)
 Frame = -2

Query  1392  EKNDSDKVEGT-----EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATT  1228
             +K  + + EGT     + + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATT
Sbjct  170   QKRSTGETEGTAAKPADDDLVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATT  229

Query  1227  LTQAGYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGV  1048
             LTQAGYVGEDVESILYKLLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGV
Sbjct  230   LTQAGYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGV  289

Query  1047  QQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSI  868
             QQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERR DSSI
Sbjct  290   QQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRHDSSI  349

Query  867   GFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQL  688
             GFGAPVR NMR GGVT+A V S+L+ETVESSDLI+YGLIPEFVGRFP+LVSL+ALTENQL
Sbjct  350   GFGAPVRANMRAGGVTNAAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLSALTENQL  409

Query  687   VQVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMD  508
             ++VLTEPKNALGKQYKKM+QMN+VKLHFTE ALR IARKAITKNTGARGLR++LESILMD
Sbjct  410   MEVLTEPKNALGKQYKKMYQMNSVKLHFTETALRLIARKAITKNTGARGLRALLESILMD  469

Query  507   AMYEIPDVRSGdnvidavivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKE--PKK  337
             +MYEIPD  +G ++I+AV+VD+EAV  EG RG GAKIL GKGAL  YLS   + +  P+ 
Sbjct  470   SMYEIPDEGTGKDMIEAVVVDEEAVEGEGRRGSGAKILRGKGALSLYLSETTKSKDSPRT  529

Query  336   IVEGSEADIEVERDLPSIVA  277
               EGSE +IEVE ++PS+VA
Sbjct  530   TKEGSEGEIEVEAEIPSVVA  549


 Score =   153 bits (386),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 115/194 (59%), Gaps = 27/194 (14%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAALRS + RETAS T SH RYF  N + A                   N R+  +  K
Sbjct  1     MAAALRSNTSRETASLTLSHFRYFFFNRLHAA--------------TPHCNHRNKIASVK  46

Query  1795  PVSVRGEFVDRGYDNSRNLSSCG-KIDISSSYGDPPEVWQPPGDGIVVRP---GVKFVQV  1628
             P+  R          S ++   G K    SS GDPP++WQPP DG+ +R        +  
Sbjct  47    PMGAR---------RSSSMGYAGVKSATLSSQGDPPDLWQPPRDGLSLRADGSSGVHLGR  97

Query  1627  GEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAV  1448
             G   G S G+G G GS +K+  WGGSNLG +FPTPKEICKGLDKFVIGQERAKKVLSVAV
Sbjct  98    GGGGGSSPGAGNGTGSNSKEDSWGGSNLGSSFPTPKEICKGLDKFVIGQERAKKVLSVAV  157

Query  1447  YNHYKRIYNDSAQK  1406
             YNHYKRIY +S+QK
Sbjct  158   YNHYKRIYYESSQK  171



>ref|XP_007218873.1| hypothetical protein PRUPE_ppa003261mg [Prunus persica]
 gb|EMJ20072.1| hypothetical protein PRUPE_ppa003261mg [Prunus persica]
Length=588

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/422 (77%), Positives = 359/422 (85%), Gaps = 5/422 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + +++ K+  S+ +Y    R    +L K       N   KV+  +
Sbjct  167   FPTPKEICKGLDKFVIGQEQAKKVLSVAVYNHYKRIYHESLQKWSAGDSGNS--KVDAMD  224

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ  YVGEDVESILYK
Sbjct  225   DDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQERYVGEDVESILYK  284

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  285   LLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  344

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRG+NIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTGGVT 
Sbjct  345   KGARKHPRGENIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTGGVTD  404

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A VTSSLLETVESSDLI YGLIPEFVGRFPILVSL+ALTENQLVQVLTEPKNALGKQYKK
Sbjct  405   AAVTSSLLETVESSDLIRYGLIPEFVGRFPILVSLSALTENQLVQVLTEPKNALGKQYKK  464

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MF+MN VKLHFTE ALR IARKAI+KNTGARGLR+ILE+ILMDAMYEIPDVR+GD++IDA
Sbjct  465   MFRMNGVKLHFTESALRLIARKAISKNTGARGLRAILENILMDAMYEIPDVRAGDDIIDA  524

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPK-KIVEG-SEADIEVERDLPSI  283
             V++D+EAVG E +G GAKILYGKGALD YLS N+ KE +    EG S+ + EVE +L S+
Sbjct  525   VVIDEEAVGSEAQGSGAKILYGKGALDHYLSQNKAKEVETATTEGSSDGEPEVETELSSV  584

Query  282   VA  277
             VA
Sbjct  585   VA  586


 Score =   186 bits (473),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 137/211 (65%), Gaps = 23/211 (11%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAALRSK  R+T S+T S  RYF+ N++ AGR+ N  +  R K+++ F N+ + F+ FK
Sbjct  1     MAAALRSKPSRDTVSSTVSQFRYFVFNYLHAGRVVNSHYAHRTKNEDLFMNTPYHFTSFK  60

Query  1795  PVSVRGEFVDRG---YD----------NS-----RNLSSCGKIDISSSYGDPPEVWQPPG  1670
             PV++ G FV++G   +D          NS     R L S     + SS GDPPEVW   G
Sbjct  61    PVALGGNFVEKGSQIFDRPRVAQKTSKNSDRNWGRKLCSSRCNSVLSSQGDPPEVWS--G  118

Query  1669  DGIVVR--PGVKFVQVGEVDgpssgsgggf-gsGAKDGCWGGSNLGPNFPTPKEICKGLD  1499
             DGIVVR  P    V+     G  S   GG   S +KD CWGGS+LG NFPTPKEICKGLD
Sbjct  119   DGIVVRAGPSSNLVRGSGGGGGPSPGSGGGFESNSKDECWGGSSLGNNFPTPKEICKGLD  178

Query  1498  KFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             KFVIGQE+AKKVLSVAVYNHYKRIY++S QK
Sbjct  179   KFVIGQEQAKKVLSVAVYNHYKRIYHESLQK  209



>gb|KHN19496.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Glycine 
soja]
Length=497

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/459 (71%), Positives = 368/459 (80%), Gaps = 13/459 (3%)
 Frame = -2

Query  1626  AKWMVRARALVVGSGQGLKMGAGEAPIWV-----QIFRPPRKFAKGLISL*LVRKEPKRS  1462
             A + VR    V G G     G  +   W        F  P++  KGL    + ++  K+ 
Sbjct  41    AGFGVRRGFDVAGGGAAPNSGDSKEGCWGGSNLGNSFPTPKEICKGLDKFVIGQERAKKV  100

Query  1461  -SL*LYiiiIRESTMTLLKSDRNP---EKNDSDKVEGTEHEAVELEKSNILVMGPTGSGK  1294
              S+ +Y    R    T   S + P     N++ K +  + + VELEKSNIL+MGPTGSGK
Sbjct  101   LSVAVYNHYKRIFNET--SSSKWPAGDSDNNNVKTDAVDDDRVELEKSNILLMGPTGSGK  158

Query  1293  TLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLTVADYNVQAAQQGIVYIDE  1114
             TLLAKTLAR VNVPFVIADAT+LTQA YVGEDVESILYKLL VADYNV AAQQGIVYIDE
Sbjct  159   TLLAKTLARFVNVPFVIADATSLTQASYVGEDVESILYKLLMVADYNVAAAQQGIVYIDE  218

Query  1113  VDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILF  934
             VDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPEKGARKHPRGDNIQIDTK+ILF
Sbjct  219   VDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPEKGARKHPRGDNIQIDTKNILF  278

Query  933   ICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGL  754
             ICGGAF+DLEKTISE R DSSIGFGAP+R NMRTG VT A V SSLL+TVESSDL++YGL
Sbjct  279   ICGGAFVDLEKTISESRHDSSIGFGAPIRANMRTGKVTEAAVASSLLQTVESSDLVAYGL  338

Query  753   IPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIAR  574
             IPEFVGRFPILVSL+ALTENQL+QVLTEPKNALGKQYKKMFQMN VKLHFTE+ALRSIAR
Sbjct  339   IPEFVGRFPILVSLSALTENQLIQVLTEPKNALGKQYKKMFQMNGVKLHFTENALRSIAR  398

Query  573   KAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidavivddeaVGHEGRGCGAKILY  394
             KAI+KNTGARGLRSILE++L+DAMYEIPD+R+GD+VIDAV+VD+EAVG EGRG GAKILY
Sbjct  399   KAISKNTGARGLRSILENVLVDAMYEIPDIRTGDDVIDAVVVDEEAVGGEGRGRGAKILY  458

Query  393   GKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
             GK ALD YLS  EQK   + +E S AD E + +LPSIVA
Sbjct  459   GKDALDRYLS--EQKNDSETMEASAADNEADTELPSIVA  495



>ref|XP_009352024.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Pyrus x bretschneideri]
Length=587

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/421 (76%), Positives = 360/421 (86%), Gaps = 4/421 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  +GL    + +++ K+  S+ +Y    R    +L K       N   KV+ T+
Sbjct  167   FPTPKEICQGLDKFVIGQEKAKKVLSVAVYNHYKRIYHESLQKWSTGDSSNG--KVDATD  224

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  225   DDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  284

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  285   LLTVADYNVTAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPE  344

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRG+NIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTGGVT 
Sbjct  345   KGARKHPRGENIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTGGVTD  404

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A VTSSLLE VESSDLI YGLIPEFVGRFPILVSL+ALTENQLV+VLTEPKNALGKQYKK
Sbjct  405   AAVTSSLLEIVESSDLIRYGLIPEFVGRFPILVSLSALTENQLVEVLTEPKNALGKQYKK  464

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MF+MN VKLHFTE ALR IA +AI+KNTGARGLR+ILE+ILMDAMYEIP+VR+GD++IDA
Sbjct  465   MFRMNGVKLHFTESALRLIATRAISKNTGARGLRAILENILMDAMYEIPEVRTGDDIIDA  524

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPK-KIVEGSEADIEVERDLPSIV  280
             V++D+EAVG +G+GCGAKILYGKGALD Y S N+ K+ +    EG++ + E E +L S+V
Sbjct  525   VVIDEEAVGLDGKGCGAKILYGKGALDRYHSQNKAKDAEIATPEGTDGEPEAETELSSVV  584

Query  279   A  277
             A
Sbjct  585   A  585


 Score =   184 bits (466),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 135/211 (64%), Gaps = 23/211 (11%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAALRSK  R+TAS+  S  RYF+LN+M A R+ +  +  R KS++ F N+ + F+ F 
Sbjct  1     MAAALRSKPSRDTASSAVSQFRYFVLNYMHASRVASSHYAHRTKSEDLFMNTPYHFTSFN  60

Query  1795  PVSVRGEFVDRGYD-------------NS-----RNLSSCGKIDISSSYGDPPEVWQPPG  1670
             PV + G+FV +G               NS     R LSS     + SS GDPPEVW   G
Sbjct  61    PVLLGGKFVGKGSQIFNHPRASQRVSKNSDKNWGRKLSSSRCNTVVSSQGDPPEVWS--G  118

Query  1669  DGIVVR--PGVKFVQVGEVDgpssgsgggf-gsGAKDGCWGGSNLGPNFPTPKEICKGLD  1499
             DGIVVR  PG   V+ G   G  S   GG   S +KD  WGGSNLG NFPTPKEIC+GLD
Sbjct  119   DGIVVRTAPGSNLVRGGGGGGGPSPGSGGGFDSNSKDDNWGGSNLGNNFPTPKEICQGLD  178

Query  1498  KFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             KFVIGQE+AKKVLSVAVYNHYKRIY++S QK
Sbjct  179   KFVIGQEKAKKVLSVAVYNHYKRIYHESLQK  209



>ref|XP_003523365.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Glycine max]
Length=524

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/449 (72%), Positives = 365/449 (81%), Gaps = 13/449 (3%)
 Frame = -2

Query  1596  VVGSGQGLKMGAGEAPIWV-----QIFRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiI  1435
             V G G     G  +   W        F  P++  KGL    + ++  K+  S+ +Y    
Sbjct  78    VAGGGAAPNSGDSKEGCWGGSNLGNSFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYK  137

Query  1434  RESTMTLLKSDRNP---EKNDSDKVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARL  1264
             R    T   S + P     N++ K +  + + VELEKSNIL+MGPTGSGKTLLAKTLAR 
Sbjct  138   RIFNET--SSSKWPAGDSDNNNVKTDAVDDDRVELEKSNILLMGPTGSGKTLLAKTLARF  195

Query  1263  VNVPFVIADATTLTQAGYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAES  1084
             VNVPFVIADAT+LTQAGYVGEDVESILYKLL VADYNV AAQQGIVYIDEVDKITKKAES
Sbjct  196   VNVPFVIADATSLTQAGYVGEDVESILYKLLMVADYNVAAAQQGIVYIDEVDKITKKAES  255

Query  1083  LNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLE  904
             LNISRDVSGEGVQQALLKMLEGT+VNVPEKGARKHPRGDNIQIDTK+ILFICGGAF+DLE
Sbjct  256   LNISRDVSGEGVQQALLKMLEGTVVNVPEKGARKHPRGDNIQIDTKNILFICGGAFVDLE  315

Query  903   KTISERRQDSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPI  724
             KTISE R DSSIGFGAP+R NMRTG VT A V SSLL+TVESSDL++YGLIPEFVGRFPI
Sbjct  316   KTISESRHDSSIGFGAPIRANMRTGKVTEAAVASSLLQTVESSDLVAYGLIPEFVGRFPI  375

Query  723   LVSLTALTENQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGAR  544
             LVSL+ALTENQL+QVLTEPKNALGKQYKKMFQMN VKLHFTE+ALRSIARKAI+KNTGAR
Sbjct  376   LVSLSALTENQLIQVLTEPKNALGKQYKKMFQMNGVKLHFTENALRSIARKAISKNTGAR  435

Query  543   GLRSILESILMDAMYEIPDVRSGdnvidavivddeaVGHEGRGCGAKILYGKGALDCYLS  364
             GLRSILE++L+DAMYEIPD+R+GD+VIDAV+VD+EAVG EGRG GAKILYGK ALD YLS
Sbjct  436   GLRSILENVLVDAMYEIPDIRTGDDVIDAVVVDEEAVGGEGRGRGAKILYGKDALDRYLS  495

Query  363   GNEQKEPKKIVEGSEADIEVERDLPSIVA  277
               EQK   + +E S AD E + +LPSIVA
Sbjct  496   --EQKNDSETMEASAADNEADTELPSIVA  522


 Score =   134 bits (337),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 99/184 (54%), Gaps = 45/184 (24%)
 Frame = -1

Query  1963  LRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFKPVSV  1784
             L+  S +ETA+   SH R+ + N  +AG  G                 R  F        
Sbjct  6     LKPGSYKETATLALSHFRHLVFNFTRAGDSG--------------CPPRAGFG-------  44

Query  1783  RGEFVDRGYDNSRNLSSCGKIDISSSYGDPPEVWQPPGDGIVVRPGVKFVQVGEVDgpss  1604
                 V RGY+            + SS GDPPEVW   G GIVVRPG     V        
Sbjct  45    ----VRRGYN------------VVSSLGDPPEVWS--GGGIVVRPGNSNFDVA------G  80

Query  1603  gsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIY  1424
             G        +K+GCWGGSNLG +FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRI+
Sbjct  81    GGAAPNSGDSKEGCWGGSNLGNSFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIF  140

Query  1423  NDSA  1412
             N+++
Sbjct  141   NETS  144



>ref|XP_009349952.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Pyrus x bretschneideri]
Length=587

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/421 (76%), Positives = 359/421 (85%), Gaps = 4/421 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  +GL    + +++ K+  S+ +Y    R    +L K       N   KV+  +
Sbjct  167   FPTPKEICQGLDKFVIGQEKAKKVLSVAVYNHYKRIYHESLQKWSTGDSSNG--KVDAMD  224

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  225   DDRVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  284

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  285   LLTVADYNVTAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPE  344

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRG+NIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTGGVT 
Sbjct  345   KGARKHPRGENIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTGGVTD  404

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A VTSSLLE VESSDLI YGLIPEFVGRFPILVSL+ALTENQLV+VLTEPKNALGKQYKK
Sbjct  405   AAVTSSLLEIVESSDLIRYGLIPEFVGRFPILVSLSALTENQLVEVLTEPKNALGKQYKK  464

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MF+MN VKLHFTE ALR IARKAI+KNTGARGLR+ILE+ILMDAMYEIP+VR+GD++IDA
Sbjct  465   MFRMNGVKLHFTESALRLIARKAISKNTGARGLRAILENILMDAMYEIPEVRTGDDIIDA  524

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPK-KIVEGSEADIEVERDLPSIV  280
             V++D+EAVG +G+GCGAKILYGKGALD Y S N+ K+ +    E ++ + E E +L S+V
Sbjct  525   VVIDEEAVGLDGKGCGAKILYGKGALDRYHSQNKAKDAEIATTEVTDGEPEAETELSSVV  584

Query  279   A  277
             A
Sbjct  585   A  585


 Score =   182 bits (462),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 134/211 (64%), Gaps = 23/211 (11%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAALRSK  R+TAS+  S  RYF+ N+M A R+ +  +  R KS++ F N+ + F  F 
Sbjct  1     MAAALRSKPSRDTASSAVSQFRYFVFNYMHASRVASSHYAHRTKSEDLFMNTPYHFPSFN  60

Query  1795  PVSVRGEFVDRGYD-------------NS-----RNLSSCGKIDISSSYGDPPEVWQPPG  1670
             PV + G+FV++G               NS     R LSS     + SS GDPPEVW   G
Sbjct  61    PVLLGGKFVEKGSQIFNHPRASQRVSKNSDKNWGRKLSSSRCNTVVSSQGDPPEVWS--G  118

Query  1669  DGIVVR--PGVKFVQVGEVDgpssgsgggf-gsGAKDGCWGGSNLGPNFPTPKEICKGLD  1499
             DGIVVR  PG   V+ G   G  S   GG   S +KD  WGGSNLG NFPTPKEIC+GLD
Sbjct  119   DGIVVRTAPGSNLVRGGGGGGGPSPGSGGGFDSNSKDDNWGGSNLGNNFPTPKEICQGLD  178

Query  1498  KFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             KFVIGQE+AKKVLSVAVYNHYKRIY++S QK
Sbjct  179   KFVIGQEKAKKVLSVAVYNHYKRIYHESLQK  209



>ref|XP_004502651.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like 
isoform X1 [Cicer arietinum]
Length=576

 Score =   572 bits (1473),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 295/356 (83%), Positives = 326/356 (92%), Gaps = 2/356 (1%)
 Frame = -2

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLL+
Sbjct  220   VELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLS  279

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              ADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPEKGA
Sbjct  280   AADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPEKGA  339

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPRGDNIQIDTK+ILFICGGAFIDLEKTISERRQDSSIGFGAPVR  M+ GGVT   +
Sbjct  340   RKHPRGDNIQIDTKNILFICGGAFIDLEKTISERRQDSSIGFGAPVRAKMKAGGVTDGAI  399

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
              SSLL TVESSDLI+YGLIPEFVGRFPILVSL+ALTENQL+QV TEPKNALGKQY+KMFQ
Sbjct  400   ASSLLGTVESSDLIAYGLIPEFVGRFPILVSLSALTENQLIQVFTEPKNALGKQYRKMFQ  459

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             MN VKLH+TE ALRSIARKAI+KNTGARGLR+ILES+L+D+M+EIPD+R+GD+VIDAV+V
Sbjct  460   MNGVKLHYTESALRSIARKAISKNTGARGLRAILESVLVDSMFEIPDIRTGDDVIDAVVV  519

Query  447   ddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIV  280
             D+++VG EG   GAKIL+G+GALD YLS  E+K+  + +E S  D E E +LPSIV
Sbjct  520   DEDSVGGEGCVKGAKILHGRGALDRYLS--EEKKDSESMEVSGGDQEAETELPSIV  573


 Score =   161 bits (408),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 123/206 (60%), Gaps = 24/206 (12%)
 Frame = -1

Query  1978  AMAAALRSKSC--RETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFS  1805
             A AAA RSK    +E A+   S LRYF  N+  AG       NS   S+    N+ + F+
Sbjct  2     AAAAAFRSKPSNYKEKATLALSQLRYFAFNYTHAG-------NSHYPSRTPLINTPYHFT  54

Query  1804  LFKPVSVRGEFVDRGYDNSRNLSSCGKID------------ISSSYGDPPEVWQPPGDGI  1661
              FKP+S+RG+F      NS   +     +            + SS+GDPPEVW   G GI
Sbjct  55    SFKPLSLRGDFTQTHNGNSTTTTPNPNPNNHLPYDTTAYRVLVSSFGDPPEVWS--GGGI  112

Query  1660  VVRPGVKFVQVGEVDgpssgsgggfgsG-AKDGCWGGSNLGPNFPTPKEICKGLDKFVIG  1484
             VVRPG     V    G    S GG  S  +KDGCWGGSNLG +FPTPKEICKGLDK+VIG
Sbjct  113   VVRPGNSNYDVSGGGGAGGASSGGGDSANSKDGCWGGSNLGGSFPTPKEICKGLDKYVIG  172

Query  1483  QERAKKVLSVAVYNHYKRIYNDSAQK  1406
             QERAKKVLSVAVYNHYKRI+++S+ K
Sbjct  173   QERAKKVLSVAVYNHYKRIFHESSPK  198



>ref|XP_004307989.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like 
[Fragaria vesca subsp. vesca]
Length=572

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/425 (76%), Positives = 363/425 (85%), Gaps = 10/425 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDS-DKVEGT  1360
             F  P++  KGL    + ++  K+  S+ +Y    R       +S +     DS +K +  
Sbjct  150   FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKR----IYHESQQKWSAGDSGNKADAM  205

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQ---AGYVGEDVES  1189
               + VELEKSNILVMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ   AGYVGEDVES
Sbjct  206   NDDRVELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQESFAGYVGEDVES  265

Query  1188  ILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  1009
             ILYKLL+VADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+V
Sbjct  266   ILYKLLSVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVV  325

Query  1008  NVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTG  829
             NVPEKGARKHPRG+NIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTG
Sbjct  326   NVPEKGARKHPRGENIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTG  385

Query  828   GVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGK  649
             GVT AVVTSSLLE VESSDLI YGLIPEFVGRFPILVSL+ALTE+QLVQVLTEPKNALGK
Sbjct  386   GVTDAVVTSSLLEIVESSDLIRYGLIPEFVGRFPILVSLSALTEDQLVQVLTEPKNALGK  445

Query  648   QYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdn  469
             QYKKMFQMN+V+LHFT+ ALR IA+KAI+KNTGARGLR+ILE+ILMDAMYEIPDVR+GD+
Sbjct  446   QYKKMFQMNDVRLHFTKSALRLIAKKAISKNTGARGLRAILETILMDAMYEIPDVRTGDD  505

Query  468   vidavivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPK-KIVEGSEADIEVERDL  292
             +IDAV++D+EAVG +G+GCGAKILYGKGALD YLS N++K+ +    EGS+ + E E +L
Sbjct  506   IIDAVVIDEEAVGTDGQGCGAKILYGKGALDRYLSQNKEKDVQIATTEGSDVEPEGEAEL  565

Query  291   PSIVA  277
              S+VA
Sbjct  566   SSVVA  570


 Score =   184 bits (466),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 130/199 (65%), Gaps = 19/199 (10%)
 Frame = -1

Query  1972  AAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFKP  1793
             AAALRSK  RETAS      RYF LN+M  GR+ N     R KS + F N+ + F+ F+P
Sbjct  3     AAALRSKPSRETAS----QFRYFFLNYMHTGRVANSHCVYRTKSDDLFVNTPYHFTAFRP  58

Query  1792  VSVRGEFVDR---GYDNS--RNLSSCGKIDISSSYGDPPEVWQPPGDGIVVRPG-----V  1643
             VS+ G   D    G D S  + L+  G   + ++YGDPPEVW   GDGIVVR G     V
Sbjct  59    VSLSGNLKDSRSGGGDRSWGQRLNGSG---VVATYGDPPEVWS--GDGIVVRGGPGSDVV  113

Query  1642  KFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKV  1463
             K    G       G GGGF S  KDGCWGGSNLG +FPTPKEICKGLDKFVIGQERAKKV
Sbjct  114   KGGGGGGGGAAGGGGGGGFDSNGKDGCWGGSNLGGSFPTPKEICKGLDKFVIGQERAKKV  173

Query  1462  LSVAVYNHYKRIYNDSAQK  1406
             LSVAVYNHYKRIY++S QK
Sbjct  174   LSVAVYNHYKRIYHESQQK  192



>emb|CDY14385.1| BnaA10g06700D [Brassica napus]
Length=558

 Score =   579 bits (1493),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 305/387 (79%), Positives = 339/387 (88%), Gaps = 15/387 (4%)
 Frame = -2

Query  1392  EKNDSDKVEGT-----EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATT  1228
             +K  + + EGT     + + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATT
Sbjct  170   QKRSTGETEGTAAKPADDDLVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATT  229

Query  1227  LTQA-------GYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISR  1069
             LTQA       GYVGEDVESILYKLLTVADYNV AAQQGIVYIDEVDKITKKAESLNISR
Sbjct  230   LTQATLAFLLAGYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISR  289

Query  1068  DVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISE  889
             DVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISE
Sbjct  290   DVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISE  349

Query  888   RRQDSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLT  709
             RR DSSIGFGAPVR NMR GGVT+A V S+L+ETVESSDLI+YGLIPEFVGRFP+LVSL+
Sbjct  350   RRHDSSIGFGAPVRANMRAGGVTNAAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLS  409

Query  708   ALTENQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSI  529
             ALTENQL++VLTEPKNALGKQYKKM+QMN+VKLHFTE ALR IARKAITKNTGARGLR++
Sbjct  410   ALTENQLMEVLTEPKNALGKQYKKMYQMNSVKLHFTETALRLIARKAITKNTGARGLRAL  469

Query  528   LESILMDAMYEIPDVRSGdnvidavivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQ  352
             LESILMD+MYEIPD  +G ++I+AV+VD+EAV  EG RG GAKIL GKGAL  YLS   +
Sbjct  470   LESILMDSMYEIPDEGTGKDMIEAVVVDEEAVEGEGRRGSGAKILRGKGALSLYLSETTK  529

Query  351   KE--PKKIVEGSEADIEVERDLPSIVA  277
              +  P+   EGSE +IEVE ++PS+VA
Sbjct  530   SKDSPRTTKEGSEGEIEVEAEIPSVVA  556


 Score =   152 bits (385),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 116/197 (59%), Gaps = 33/197 (17%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAALRS + RETAS T SH RYF  N + A                   N R+  +  K
Sbjct  1     MAAALRSNTSRETASLTLSHFRYFFFNRLHAA--------------TPHCNHRNKIASVK  46

Query  1795  PVSVRGEFVDRGYDNSRNLSSCG----KIDISSSYGDPPEVWQPPGDGIVVRP---GVKF  1637
             P+  R     RG       SS G    K    SS GDPP++WQPP DG+ +R        
Sbjct  47    PMGAR-----RG-------SSMGYAGVKSATLSSQGDPPDLWQPPRDGLSLRADGSSGVH  94

Query  1636  VQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLS  1457
             +  G   G S G+G G GS +K+  WGGSNLG +FPTPKEICKGLDKFVIGQERAKKVLS
Sbjct  95    LGRGGGGGSSPGAGNGTGSNSKEDSWGGSNLGSSFPTPKEICKGLDKFVIGQERAKKVLS  154

Query  1456  VAVYNHYKRIYNDSAQK  1406
             VAVYNHYKRIY +S+QK
Sbjct  155   VAVYNHYKRIYYESSQK  171



>ref|XP_008466826.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Cucumis melo]
Length=576

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/422 (75%), Positives = 359/422 (85%), Gaps = 6/422 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++ AKGL    + +   K+  S+ +Y    R    +L +   +   N   K +  +
Sbjct  155   FPTPKEIAKGLDKFVIGQDRAKKVLSVGVYNHYKRIYHESLQRPTGDAFNN---KADAAD  211

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  212   DDKVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  271

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL VADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  272   LLMVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  331

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRG+NIQIDTKDILFICGGAFIDLEKTISERRQDSS+GFGAPVR NMR GGVT 
Sbjct  332   KGARKHPRGENIQIDTKDILFICGGAFIDLEKTISERRQDSSLGFGAPVRANMRAGGVTD  391

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A+VTSSLLETVESSDLI+YGLIPEFVGRFPILVSL+ALTENQLVQVLTEPKNALGKQY+K
Sbjct  392   AMVTSSLLETVESSDLIAYGLIPEFVGRFPILVSLSALTENQLVQVLTEPKNALGKQYRK  451

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN+VKLHFTE+ALR IARKA++KNTGARGLRSILE++LMD+MYEIPD+R+G ++IDA
Sbjct  452   MFQMNDVKLHFTENALRLIARKAMSKNTGARGLRSILENLLMDSMYEIPDIRTGKDIIDA  511

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEV--ERDLPSI  283
             V+VD+E+VG +  G GAKILYGKGALD YLSG + ++ K   + SE + E   E DLPS+
Sbjct  512   VVVDEESVGSDSPGFGAKILYGKGALDRYLSGQKVEDRKATSQDSEREPEPEGETDLPSV  571

Query  282   VA  277
             VA
Sbjct  572   VA  573


 Score =   153 bits (387),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 125/200 (63%), Gaps = 23/200 (12%)
 Frame = -1

Query  1963  LRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFKPVSV  1784
             LRS+S +E A+ T S  R+ I N + A         S  KS + F NS +    FKPVS+
Sbjct  7     LRSRSSKEVATLTLSRCRHCISNSIHAAF-------SPKKSNDCFLNSPYHLVSFKPVSL  59

Query  1783  RGEFVDRG---------YDNSR---NLSSCGKIDISSSYGDPPEVWQPPGDGIVVRPGVK  1640
             RG+F D G         Y NS    N     K    S+YGDPPEVW   GDGIV+R    
Sbjct  60    RGDFFDSGTQPLDHRRIYQNSTKSLNHRLSKKGCFMSTYGDPPEVWS--GDGIVIRGSNS  117

Query  1639  FV--QVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKK  1466
              +  + G+    + GSGGGFGS + DGCWGGS+LGPNFPTPKEI KGLDKFVIGQ+RAKK
Sbjct  118   SLNGRGGDGGSSNPGSGGGFGSNSNDGCWGGSSLGPNFPTPKEIAKGLDKFVIGQDRAKK  177

Query  1465  VLSVAVYNHYKRIYNDSAQK  1406
             VLSV VYNHYKRIY++S Q+
Sbjct  178   VLSVGVYNHYKRIYHESLQR  197



>ref|XP_006401716.1| hypothetical protein EUTSA_v10013106mg [Eutrema salsugineum]
 gb|ESQ43169.1| hypothetical protein EUTSA_v10013106mg [Eutrema salsugineum]
Length=572

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/422 (75%), Positives = 358/422 (85%), Gaps = 5/422 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  S+ +Y    R    +L K  R+  + DS   +  +
Sbjct  151   FPTPKEICKGLNKFVIGQERAKKVLSVAVYNHYKRIYYESLQK--RSTGETDSTTAKPAD  208

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  209   DDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  268

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  269   LLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  328

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERR DSSIGFGAPVR NMR GGVT+
Sbjct  329   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRHDSSIGFGAPVRANMRAGGVTN  388

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A V S+L+ETVESSDLI+YGLIPEFVGRFP+LVSL+ALTENQL+QVLTEPKNALGKQYKK
Sbjct  389   AAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLSALTENQLMQVLTEPKNALGKQYKK  448

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             M+QMN+VKLHFTE ALR IA+KAITKNTGARGLR++LESILMD+MYEIPD  +G ++I+A
Sbjct  449   MYQMNSVKLHFTESALRLIAKKAITKNTGARGLRALLESILMDSMYEIPDESTGSDMIEA  508

Query  456   vivddeaVGHEG-RGCGAKILYGKGALDCYLS-GNEQKEPKKIVEGSEADIEVERDLPSI  283
             V+VD+EAV  EG RG GAKIL GKGAL  YLS  N +  P+   EGSE +IEVE ++PS+
Sbjct  509   VVVDEEAVEGEGRRGSGAKILRGKGALSLYLSETNSKDSPQTTKEGSEGEIEVEAEIPSV  568

Query  282   VA  277
             VA
Sbjct  569   VA  570


 Score =   164 bits (414),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 116/197 (59%), Gaps = 11/197 (6%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAALRS + RETAS T S  RYF+ N +   R  +   N R K  +         +  +
Sbjct  1     MAAALRSSTSRETASLTLSQFRYFVFNRVHTARTASPQCNHRNKIDDPSNKFPDRIASLR  60

Query  1795  PVSVRGEFVDRGYDNSRNLSSCG------KIDISSSYGDPPEVWQPPGDGIVVRPGVKFV  1634
             P      F+D      R  SS G      K  + SS GDPP++WQPPGDG+ VR     V
Sbjct  61    PTGT--SFMDN--QGERRSSSKGYATNGVKSAVLSSQGDPPDLWQPPGDGVSVRVNGSSV  116

Query  1633  QVGEVDgpssgsgggfgsG-AKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLS  1457
              +G   G S    G      +KD CWGGSNLG +FPTPKEICKGL+KFVIGQERAKKVLS
Sbjct  117   NLGRGGGGSGAGAGNGTGSNSKDDCWGGSNLGSDFPTPKEICKGLNKFVIGQERAKKVLS  176

Query  1456  VAVYNHYKRIYNDSAQK  1406
             VAVYNHYKRIY +S QK
Sbjct  177   VAVYNHYKRIYYESLQK  193



>ref|XP_011044638.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Populus euphratica]
Length=572

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/423 (76%), Positives = 358/423 (85%), Gaps = 9/423 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIR---ESTMTLLKSDRNPEKNDSDKVE  1366
             F  P++  K L +  + ++  K+  S+ +Y    R   ES      +D   EK D+    
Sbjct  153   FPTPKEICKALDNFVIGQRRAKKVLSVAVYNHYKRIYLESVKKWSNTDSGNEKADT----  208

Query  1365  GTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESI  1186
               + + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESI
Sbjct  209   -MDDDGVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESI  267

Query  1185  LYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVN  1006
             LYKLLT ADYNV AAQQGI+YIDE+DKITKK+ES+NISRDVSGEGVQQALLKMLEGTIVN
Sbjct  268   LYKLLTAADYNVAAAQQGIIYIDEIDKITKKSESVNISRDVSGEGVQQALLKMLEGTIVN  327

Query  1005  VPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGG  826
             VPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTGG
Sbjct  328   VPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTGG  387

Query  825   VTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQ  646
             VTS  VTSSLLET ESSDL+SYGLIPEFVGRFPILVSL ALTE+QLVQVLTEPKNALGKQ
Sbjct  388   VTSTAVTSSLLETAESSDLVSYGLIPEFVGRFPILVSLAALTEDQLVQVLTEPKNALGKQ  447

Query  645   YKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnv  466
             YKK+FQMN+VKLH TE+ALRSIARKAITKNTGAR LRSILE+ILMD+MYEIPDVR+GD++
Sbjct  448   YKKLFQMNDVKLHVTENALRSIARKAITKNTGARALRSILENILMDSMYEIPDVRTGDDI  507

Query  465   idavivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPS  286
             IDAV+VD+ A+G E R  GA ILYG+GALD YLS  + K  KK +EGS+ + EVE +LPS
Sbjct  508   IDAVVVDEVAIGSEERSIGATILYGRGALDHYLSKEKLKSSKKTMEGSDGEPEVESELPS  567

Query  285   IVA  277
             IVA
Sbjct  568   IVA  570


 Score =   155 bits (392),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 125/210 (60%), Gaps = 40/210 (19%)
 Frame = -1

Query  1969  AALRSKSCRETASATASHLRYFILNHMQAG-RLGNLGWNSRIKSKN-YFTNSRHSFSLFK  1796
             AA+R K  +     TAS  RYF+ N+M  G RL +    ++I +++ +F N+ + F+ FK
Sbjct  4     AAVRCKPPK----VTASQFRYFMFNYMHVGSRLSSSHCANKIATRDDHFANTPYHFTSFK  59

Query  1795  PVSVRGEFV-----------------DRGYDNSRNLSSCGKIDISSSYGDPPEVWQPPGD  1667
             PVS+RGEF                  DR +  + + +S G     S+YGDPPEVWQPPGD
Sbjct  60    PVSLRGEFFEKSTQLLGNMRSRSSSSDRNWRETVSSNSGG----GSNYGDPPEVWQPPGD  115

Query  1666  GIV---VRPGVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDK  1496
             G+    V  G    +V              GSG+KDG WGGSNLG +FPTPKEICK LD 
Sbjct  116   GVAKMRVSDGGGDFKV----------WSRGGSGSKDGYWGGSNLGSSFPTPKEICKALDN  165

Query  1495  FVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             FVIGQ RAKKVLSVAVYNHYKRIY +S +K
Sbjct  166   FVIGQRRAKKVLSVAVYNHYKRIYLESVKK  195



>ref|XP_007039051.1| CLP protease regulatory subunit X isoform 1 [Theobroma cacao]
 gb|EOY23552.1| CLP protease regulatory subunit X isoform 1 [Theobroma cacao]
Length=594

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/420 (76%), Positives = 359/420 (85%), Gaps = 3/420 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P+   KGL    + ++  K+  S+ +Y   +R    +L K  R    + S+  +  +
Sbjct  175   FPTPKDICKGLDKFVIGQERAKKVLSVAVYNHYMRIYHESLQK--RPAGDSVSNIADVLD  232

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  233   DDIVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  292

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL VADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  293   LLVVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  352

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRG+NIQIDTKDILFICGGAFID+EKTISERRQDSSIGFGAPVR NMR GGVT+
Sbjct  353   KGARKHPRGENIQIDTKDILFICGGAFIDIEKTISERRQDSSIGFGAPVRANMRAGGVTN  412

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A V S+L+E+VESSDLI+YGLIPEFVGRFP+LVSL ALTE QLVQVLTEPKNALGKQYK+
Sbjct  413   AAVASTLMESVESSDLIAYGLIPEFVGRFPVLVSLLALTEEQLVQVLTEPKNALGKQYKR  472

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN VKLH TE+AL+ IARKAI+KNTGARGLR+ILE+ILMD+MYEIPDVR+GD+VIDA
Sbjct  473   MFQMNGVKLHITENALKLIARKAISKNTGARGLRAILENILMDSMYEIPDVRTGDDVIDA  532

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
             V+VD+EAVG EGRG GAKILYGKGALD YLS  + K+ +   EGS+ + EVE +LPS+VA
Sbjct  533   VVVDEEAVGSEGRGTGAKILYGKGALDRYLSQQKSKDLETTAEGSDGEPEVETELPSVVA  592


 Score =   195 bits (496),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 146/219 (67%), Gaps = 31/219 (14%)
 Frame = -1

Query  1978  AMAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSK--NYFTNSRHSFS  1805
             A AAALRSK   ETAS T S  R+F+ N+M  GR+ +   ++  ++K  ++F N+ + F+
Sbjct  2     AAAAALRSKPSVETASLTVSQFRHFLSNYMHCGRMASSSHSTTYRTKWDDHFVNTPYHFT  61

Query  1804  LFKPVSVRGEFVDRGYD------NSR--------------NLSSCGKIDISSSYGDPPEV  1685
              FKPVS+RGE V++G        NSR              N S+C    + SSYGDPPEV
Sbjct  62    SFKPVSLRGELVEKGSQLLDIRRNSRGLNKDFDRELREKLNYSNC---TVLSSYGDPPEV  118

Query  1684  WQPPGDGIVVR-PGVKF-----VQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTP  1523
             WQPPGDG+ +R  GV          G   G S+GSGGGFG G+KDGCWGGSNLG NFPTP
Sbjct  119   WQPPGDGVAIRVSGVNLGRGGGGGAGGGGGASTGSGGGFGPGSKDGCWGGSNLGHNFPTP  178

Query  1522  KEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             K+ICKGLDKFVIGQERAKKVLSVAVYNHY RIY++S QK
Sbjct  179   KDICKGLDKFVIGQERAKKVLSVAVYNHYMRIYHESLQK  217



>gb|EPS62752.1| hypothetical protein M569_12037, partial [Genlisea aurea]
Length=408

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/386 (80%), Positives = 338/386 (88%), Gaps = 16/386 (4%)
 Frame = -2

Query  1383  DSDKVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQA----  1216
             DS K E T+ + VELEKSNIL+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQA    
Sbjct  23    DSGKNESTDDDHVELEKSNILLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQASLCS  82

Query  1215  --------GYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVS  1060
                     GYVGEDVESILYKLL+VADYNVQAAQQGIVYIDEVDKITKKAES+NISRDVS
Sbjct  83    TRFIQRIAGYVGEDVESILYKLLSVADYNVQAAQQGIVYIDEVDKITKKAESMNISRDVS  142

Query  1059  GEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQ  880
             GEGVQQALLKMLEGT+VNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKT+SERR 
Sbjct  143   GEGVQQALLKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTVSERRH  202

Query  879   DSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALT  700
             DSSIGFGAPVR NMR GG+TSAVVTSSLLETVES DLI+YGLIPEFVGRFPILV+L ALT
Sbjct  203   DSSIGFGAPVRANMRAGGITSAVVTSSLLETVESGDLIAYGLIPEFVGRFPILVNLLALT  262

Query  699   ENQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILES  520
             E+QLVQVLTEPK+ALGKQYKK+F+MN VKLHFTE+ALR IAR AITKNTGARGLRS+LE+
Sbjct  263   EDQLVQVLTEPKSALGKQYKKLFRMNGVKLHFTEEALRLIARNAITKNTGARGLRSMLEN  322

Query  519   ILMDAMYEIPDVRSGdnvidavivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEP-  343
             +LMDAMYEIPD RS D+VIDAV+VD E+VG +GRGCGAKILYG G  + YL   + +E  
Sbjct  323   VLMDAMYEIPDERSEDDVIDAVVVDAESVGADGRGCGAKILYGTGEFNRYLLQQKHRESS  382

Query  342   -KKIVE--GSEADIEVERDLPSIVAL  274
               K++   GSE + E E +LPSIVAL
Sbjct  383   HHKVLPDGGSEVEPEAEHELPSIVAL  408



>ref|XP_008466827.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Cucumis melo]
 gb|ADN33742.1| ATP-dependent clp protease ATP-binding subunit clpx [Cucumis 
melo subsp. melo]
Length=571

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/420 (76%), Positives = 357/420 (85%), Gaps = 7/420 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++ AKGL    + +   K+  S+ +Y    R    +L +   +   N   K +  +
Sbjct  155   FPTPKEIAKGLDKFVIGQDRAKKVLSVGVYNHYKRIYHESLQRPTGDAFNN---KADAAD  211

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  212   DDKVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  271

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL VADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  272   LLMVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  331

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRG+NIQIDTKDILFICGGAFIDLEKTISERRQDSS+GFGAPVR NMR GGVT 
Sbjct  332   KGARKHPRGENIQIDTKDILFICGGAFIDLEKTISERRQDSSLGFGAPVRANMRAGGVTD  391

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A+VTSSLLETVESSDLI+YGLIPEFVGRFPILVSL+ALTENQLVQVLTEPKNALGKQY+K
Sbjct  392   AMVTSSLLETVESSDLIAYGLIPEFVGRFPILVSLSALTENQLVQVLTEPKNALGKQYRK  451

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN+VKLHFTE+ALR IARKA++KNTGARGLRSILE++LMD+MYEIPD+R+G ++IDA
Sbjct  452   MFQMNDVKLHFTENALRLIARKAMSKNTGARGLRSILENLLMDSMYEIPDIRTGKDIIDA  511

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
             V+VD+E+VG +  G GAKILYGKGALD YLSG  QK   +  E  E + E E DLPS+VA
Sbjct  512   VVVDEESVGSDSPGFGAKILYGKGALDRYLSG--QKATSQDSE-REPEPEGETDLPSVVA  568


 Score =   153 bits (387),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 125/200 (63%), Gaps = 23/200 (12%)
 Frame = -1

Query  1963  LRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFKPVSV  1784
             LRS+S +E A+ T S  R+ I N + A         S  KS + F NS +    FKPVS+
Sbjct  7     LRSRSSKEVATLTLSRCRHCISNSIHAAF-------SPKKSNDCFLNSPYHLVSFKPVSL  59

Query  1783  RGEFVDRG---------YDNSR---NLSSCGKIDISSSYGDPPEVWQPPGDGIVVRPGVK  1640
             RG+F D G         Y NS    N     K    S+YGDPPEVW   GDGIV+R    
Sbjct  60    RGDFFDSGTQPLDHRRIYQNSTKSLNHRLSKKGCFMSTYGDPPEVWS--GDGIVIRGSNS  117

Query  1639  FV--QVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKK  1466
              +  + G+    + GSGGGFGS + DGCWGGS+LGPNFPTPKEI KGLDKFVIGQ+RAKK
Sbjct  118   SLNGRGGDGGSSNPGSGGGFGSNSNDGCWGGSSLGPNFPTPKEIAKGLDKFVIGQDRAKK  177

Query  1465  VLSVAVYNHYKRIYNDSAQK  1406
             VLSV VYNHYKRIY++S Q+
Sbjct  178   VLSVGVYNHYKRIYHESLQR  197



>ref|XP_002864237.1| hypothetical protein ARALYDRAFT_918413 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40496.1| hypothetical protein ARALYDRAFT_918413 [Arabidopsis lyrata subsp. 
lyrata]
Length=572

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/422 (75%), Positives = 358/422 (85%), Gaps = 5/422 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  S+ +Y    R    +  K  R+  + DS  V+  +
Sbjct  151   FPTPKEICKGLNKFVIGQERAKKVLSVAVYNHYKRIYHESSQK--RSAGETDSTAVKPAD  208

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  209   DDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  268

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  269   LLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  328

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERR DSSIGFGAPVR NMR GGVT+
Sbjct  329   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRHDSSIGFGAPVRANMRAGGVTN  388

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A V S+L+ETVESSDLI+YGLIPEFVGRFP+LVSL+ALTENQL+QVLTEPKNALGKQYKK
Sbjct  389   AAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLSALTENQLMQVLTEPKNALGKQYKK  448

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             M+QMN+VKLHFTE ALR IARKAITKNTGARGLRS+LESILMD+MYEIPD  +G ++I+A
Sbjct  449   MYQMNSVKLHFTESALRLIARKAITKNTGARGLRSLLESILMDSMYEIPDESTGSDMIEA  508

Query  456   vivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKE-PKKIVEGSEADIEVERDLPSI  283
             V+VD+EAV  EG RG GAKIL GKGAL  YLS  + K+ P+   +GS+ + EVE ++PS+
Sbjct  509   VVVDEEAVEGEGRRGSGAKILRGKGALGRYLSETKSKDSPQTTKDGSDGETEVEAEIPSV  568

Query  282   VA  277
             VA
Sbjct  569   VA  570


 Score =   162 bits (411),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 121/205 (59%), Gaps = 27/205 (13%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNL-GWNSRIKSKNYFTNSRHSFSLF  1799
             MAAALRS + RETAS T S  RYF  N +   R       N R KS N  +         
Sbjct  1     MAAALRSNTSRETASLTLSQFRYFFFNRIHTARTATSPQCNHRSKSPNKIS---------  51

Query  1798  KPVSVRGEFVDRGYDNSRNLSSC----------GKIDISSSYGDPPEVWQPPGDGIVVRP  1649
                S+   F+D      RN ++C            + + SS GDPP++WQPPGDG+ VR 
Sbjct  52    ---SLGTSFLDNRGGERRNSTNCYASQKLNGVGSSVVMLSSQGDPPDLWQPPGDGVSVRV  108

Query  1648  GVKFVQVGEVDgpssgsggg----fgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQ  1481
                 V +G   G    S GG     GS +K+ CWGGSNLG +FPTPKEICKGL+KFVIGQ
Sbjct  109   NGSSVNLGRGGGGGGSSPGGPGNGTGSNSKEDCWGGSNLGSDFPTPKEICKGLNKFVIGQ  168

Query  1480  ERAKKVLSVAVYNHYKRIYNDSAQK  1406
             ERAKKVLSVAVYNHYKRIY++S+QK
Sbjct  169   ERAKKVLSVAVYNHYKRIYHESSQK  193



>ref|XP_004146223.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like 
[Cucumis sativus]
 gb|KGN57670.1| hypothetical protein Csa_3G239830 [Cucumis sativus]
Length=571

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/420 (76%), Positives = 358/420 (85%), Gaps = 7/420 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++ AKGL    + ++  K+  S+ +Y    R    +L +   +   N   K +  +
Sbjct  155   FPTPKEIAKGLDKFVIGQERAKKVLSVGVYNHYKRIYHESLQRPTGDTFNN---KADAAD  211

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  212   DDKVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  271

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL VADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  272   LLMVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  331

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRG+NIQIDTKDILFICGGAFIDLEKTISERRQDSS+GFGAPVR NMR GGVT 
Sbjct  332   KGARKHPRGENIQIDTKDILFICGGAFIDLEKTISERRQDSSLGFGAPVRANMRAGGVTD  391

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A+VTSSLLETVESSDLI+YGLIPEFVGRFPILVSL+ALTENQLVQVLTEPKNALGKQY+K
Sbjct  392   AMVTSSLLETVESSDLIAYGLIPEFVGRFPILVSLSALTENQLVQVLTEPKNALGKQYRK  451

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN+VKLHFTE++LR IARKA++KNTGARGLRSILE++LMD+MYEIPDVR+G ++IDA
Sbjct  452   MFQMNDVKLHFTENSLRLIARKAMSKNTGARGLRSILENLLMDSMYEIPDVRTGKDIIDA  511

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
             VIVD+E+VG +  G GAKILYGKGALD +LSG  QK   +  E  E + E E DLPS+VA
Sbjct  512   VIVDEESVGSDSPGFGAKILYGKGALDRHLSG--QKATSQDSE-REPEPEGETDLPSVVA  568


 Score =   155 bits (393),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 122/200 (61%), Gaps = 23/200 (12%)
 Frame = -1

Query  1963  LRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFKPVSV  1784
             LRS+S +E A+ T S  R+ I N + A    N       KS + F NS +    FKPVS+
Sbjct  7     LRSRSSKEVATLTLSRCRHCISNSIHAAFTPN-------KSNDCFLNSPYHLVSFKPVSL  59

Query  1783  RGEFVDRG---YDNSRNLSSCGKID---------ISSSYGDPPEVWQPPGDGIVVRPGVK  1640
             RG+F D G    D+ R   S  K             S+YGDPPEVW   GDGIV+R    
Sbjct  60    RGDFFDTGTQPLDHRRIYQSPTKTLNHRLSKKGCFMSTYGDPPEVWS--GDGIVIRGSNS  117

Query  1639  FVQVGEVDgpssgsgggfgsGAK--DGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKK  1466
              +     DG SS SG G G G+   DGCWGGS+LGPNFPTPKEI KGLDKFVIGQERAKK
Sbjct  118   SLNGRGGDGGSSNSGSGGGFGSNSNDGCWGGSSLGPNFPTPKEIAKGLDKFVIGQERAKK  177

Query  1465  VLSVAVYNHYKRIYNDSAQK  1406
             VLSV VYNHYKRIY++S Q+
Sbjct  178   VLSVGVYNHYKRIYHESLQR  197



>emb|CDY35643.1| BnaC09g29650D [Brassica napus]
Length=597

 Score =   580 bits (1496),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 304/385 (79%), Positives = 338/385 (88%), Gaps = 10/385 (3%)
 Frame = -2

Query  1401  RNPEKNDSDKVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLT  1222
             R+  + DS   +  + + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLT
Sbjct  211   RSTGETDSTAAKPADDDLVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLT  270

Query  1221  QA-------GYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDV  1063
             QA       GYVGEDVESILYKLLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDV
Sbjct  271   QATLAFLLAGYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDV  330

Query  1062  SGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERR  883
             SGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERR
Sbjct  331   SGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERR  390

Query  882   QDSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTAL  703
              DSSIGFGAPVR NMR GGVT+A V S+L+ETVESSDLI+YGLIPEFVGRFP+LVSL+AL
Sbjct  391   HDSSIGFGAPVRANMRAGGVTNAAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLSAL  450

Query  702   TENQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILE  523
             TENQL++VLTEPKNALGKQYKKM+QMN+VKLHFTE ALR IARKAITKNTGARGLR++LE
Sbjct  451   TENQLMEVLTEPKNALGKQYKKMYQMNSVKLHFTETALRLIARKAITKNTGARGLRALLE  510

Query  522   SILMDAMYEIPDVRSGdnvidavivddeaVGHEG-RGCGAKILYGKGALDCYLS--GNEQ  352
             SILMD+MYEIPD  +G ++I+AV+VD+EAV  EG RG GAKIL GKGAL  YLS     +
Sbjct  511   SILMDSMYEIPDEGTGKDMIEAVVVDEEAVEGEGRRGSGAKILRGKGALSLYLSETTKSK  570

Query  351   KEPKKIVEGSEADIEVERDLPSIVA  277
               P+  +EGSE +IEVE ++PS+VA
Sbjct  571   DSPRTTMEGSEGEIEVEAEIPSVVA  595


 Score =   142 bits (358),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 124/226 (55%), Gaps = 52/226 (23%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAALRS + RETAS T SH RYF  N              R+ + +   N R+  +  K
Sbjct  1     MAAALRSNTSRETASLTLSHFRYFFFN--------------RLHTASPHCNHRNKIAYVK  46

Query  1795  PVSVRGEFVD-RGYDNSRNL---SSCG-KIDISSSYGDPPEVWQPPGDGIVVRPG----V  1643
             P+     F+D RG   S ++   ++CG K    SS GDPP++WQPP DG+ VR      V
Sbjct  47    PMGT--SFLDNRGERRSSSMGYATNCGVKSATLSSQGDPPDLWQPPRDGLSVRADGSSGV  104

Query  1642  KFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKK-  1466
                + G   G S G+G G GS +K+  WGGSNLG +FPTPKEICKGLDKFVIGQERAKK 
Sbjct  105   HLGRGGGGGGSSPGAGNGTGSNSKEDSWGGSNLGSSFPTPKEICKGLDKFVIGQERAKKD  164

Query  1465  --------------------------VLSVAVYNHYKRIYNDSAQK  1406
                                       VLSVAVYNHYKRIY +S QK
Sbjct  165   LNGANLNCVFSDQFLLGLWSVENLNYVLSVAVYNHYKRIYYESLQK  210



>ref|NP_568792.1| CLP protease regulatory subunit X [Arabidopsis thaliana]
 dbj|BAB09797.1| ATP-dependent Clp protease regulatory subunit CLPX [Arabidopsis 
thaliana]
 gb|AAK59608.1| putative ATP-dependent Clp protease ATP-binding subunit ClpX1 
[Arabidopsis thaliana]
 gb|AAN13130.1| putative ATP-dependent Clp protease ATP-binding subunit ClpX1 
[Arabidopsis thaliana]
 gb|AED96343.1| CLP protease regulatory subunit X [Arabidopsis thaliana]
Length=579

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/422 (74%), Positives = 356/422 (84%), Gaps = 5/422 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  S+ +Y    R    +  K  R+  + DS   +  +
Sbjct  158   FPTPKEICKGLNKFVIGQERAKKVLSVAVYNHYKRIYHESSQK--RSAGETDSTAAKPAD  215

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  216   DDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  275

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  276   LLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  335

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERR DSSIGFGAPVR NMR GGVT+
Sbjct  336   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRHDSSIGFGAPVRANMRAGGVTN  395

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A V S+L+ETVESSDLI+YGLIPEFVGRFP+LVSL+ALTENQL+QVLTEPKNALGKQYKK
Sbjct  396   AAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLSALTENQLMQVLTEPKNALGKQYKK  455

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             M+QMN+VKLHFTE ALR IARKAITKNTGARGLR++LESILMD+MYEIPD  +G ++I+A
Sbjct  456   MYQMNSVKLHFTESALRLIARKAITKNTGARGLRALLESILMDSMYEIPDEGTGSDMIEA  515

Query  456   vivddeaVGHEG-RGCGAKILYGKGALDCYLS-GNEQKEPKKIVEGSEADIEVERDLPSI  283
             V+VD+EAV  EG RG GAKIL GKGAL  YLS  N +  P+   EGS+ + EVE ++PS+
Sbjct  516   VVVDEEAVEGEGRRGSGAKILRGKGALARYLSETNSKDSPQTTKEGSDGETEVEAEIPSV  575

Query  282   VA  277
             VA
Sbjct  576   VA  577


 Score =   171 bits (432),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 125/208 (60%), Gaps = 26/208 (13%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNL--GWNSRIKSKNYFTNSRHSFSL  1802
             MAAALRS + RETAS T SH RYFI N +   R        N R KS   F         
Sbjct  1     MAAALRSNTSRETASLTLSHFRYFIFNRIHTARTATSPPHCNHRSKSDEKFP--------  52

Query  1801  FKPVSVRGEFVD-RGYDNSRNLSSC-----------GKIDISSSYGDPPEVWQPPGDGIV  1658
             +K  S+   F+D RG    RN + C             + I SS GDPP++WQPPGDG+ 
Sbjct  53    YKISSLGTSFLDNRGGGERRNSTKCYAAQKKLSGVGSSVVILSSQGDPPDLWQPPGDGVS  112

Query  1657  VRPGVKFVQVGEVDgpssgsggg----fgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFV  1490
             VR     V +G   G    S GG     GS +K+ CWGGSNLG +FPTPKEICKGL+KFV
Sbjct  113   VRVNGSSVNLGRGGGGGGSSPGGPGNGTGSNSKEDCWGGSNLGSDFPTPKEICKGLNKFV  172

Query  1489  IGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             IGQERAKKVLSVAVYNHYKRIY++S+QK
Sbjct  173   IGQERAKKVLSVAVYNHYKRIYHESSQK  200



>ref|XP_007136523.1| hypothetical protein PHAVU_009G052400g [Phaseolus vulgaris]
 gb|ESW08517.1| hypothetical protein PHAVU_009G052400g [Phaseolus vulgaris]
Length=520

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/421 (75%), Positives = 353/421 (84%), Gaps = 4/421 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  S+ +Y    R    + L      + +D+ K +  E
Sbjct  100   FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIFNESSLPKWPAGDSDDNVKADAVE  159

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADAT+LTQA YVGEDVESILYK
Sbjct  160   DDKVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATSLTQASYVGEDVESILYK  219

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL VADYNV AAQQGI+YIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  220   LLMVADYNVAAAQQGIIYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  279

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTK+ILFICGGAFIDLEKTISERR DSSIGFGAP+R NMRTG VT 
Sbjct  280   KGARKHPRGDNIQIDTKNILFICGGAFIDLEKTISERRHDSSIGFGAPIRANMRTGKVTE  339

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A V SSLLETVESSDLI+YGLIPEFVGRFPILVSL+ALTENQL+QVLTEPKNALGKQY+K
Sbjct  340   AAVASSLLETVESSDLIAYGLIPEFVGRFPILVSLSALTENQLIQVLTEPKNALGKQYQK  399

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN VKLHFTE +L SIARKAI+KNTGARGLRSILE++L+DAMYEIPDVR+GD+VIDA
Sbjct  400   MFQMNGVKLHFTESSLSSIARKAISKNTGARGLRSILENVLVDAMYEIPDVRTGDDVIDA  459

Query  456   vivddeaVGHEGRGC-GAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIV  280
              +VD+EAVG  G G  GAKILYG+GALD YL+  +QK   + +E S  D E + +LPSIV
Sbjct  460   AVVDEEAVGSVGCGGRGAKILYGQGALDRYLT--KQKNDSETMETSATDHEADPELPSIV  517

Query  279   A  277
             A
Sbjct  518   A  518


 Score =   140 bits (354),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 99/185 (54%), Gaps = 47/185 (25%)
 Frame = -1

Query  1966  ALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFKPVS  1787
             A RSK CRE A+       + + N  +AG       NSR   +  F              
Sbjct  3     AFRSKPCREIATLALVRFNHLLFNFTRAG-------NSRCPPRATFG-------------  42

Query  1786  VRGEFVDRGYDNSRNLSSCGKIDISSSYGDPPEVWQPPGDGIVVRPGVKFVQVGEVDgps  1607
                  V RGY             + +S GDPPEVW   G GIVVRPG    +V       
Sbjct  43    -----VSRGYS------------VVASLGDPPEVWS--GGGIVVRPGNSNFEVA------  77

Query  1606  sgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRI  1427
                G      +K+GCWGGSNLG NFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRI
Sbjct  78    --GGAPNTGDSKEGCWGGSNLGTNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRI  135

Query  1426  YNDSA  1412
             +N+S+
Sbjct  136   FNESS  140



>gb|AAB88706.1| CLP protease regulatory subunit CLPX [Arabidopsis thaliana]
Length=579

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/422 (74%), Positives = 355/422 (84%), Gaps = 5/422 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  S+ +Y    R    +  K  R+  + DS   +  +
Sbjct  158   FPTPKEICKGLNKFVIGQERAKKVLSVAVYNHYKRIYHESSQK--RSAGETDSTAAKPAD  215

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  216   DDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  275

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVADYNV AAQQGIVYIDEVDKITKKAESL ISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  276   LLTVADYNVAAAQQGIVYIDEVDKITKKAESLYISRDVSGEGVQQALLKMLEGTIVNVPE  335

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERR DSSIGFGAPVR NMR GGVT+
Sbjct  336   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRHDSSIGFGAPVRANMRAGGVTT  395

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A V S+L+ETVE+SDLI+YGLIPEFVGRFP+LVSL+ALTENQL+QVLTEPKNALGKQYKK
Sbjct  396   AAVASNLMETVETSDLIAYGLIPEFVGRFPVLVSLSALTENQLMQVLTEPKNALGKQYKK  455

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             M+QMN+VKLHFTE ALR IARKAITKNTGARGLR++LESILMD+MYEIPD  +G ++I+A
Sbjct  456   MYQMNSVKLHFTESALRLIARKAITKNTGARGLRALLESILMDSMYEIPDEGTGSDMIEA  515

Query  456   vivddeaVGHEG-RGCGAKILYGKGALDCYLS-GNEQKEPKKIVEGSEADIEVERDLPSI  283
             V+VD+EAV  EG RG GAKIL GKGAL  YLS  N +  P+   EGS+ + EVE ++PS+
Sbjct  516   VVVDEEAVEGEGRRGSGAKILRGKGALARYLSETNSKDSPQTTKEGSDGETEVEAEIPSV  575

Query  282   VA  277
             VA
Sbjct  576   VA  577


 Score =   170 bits (431),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 125/208 (60%), Gaps = 26/208 (13%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNL--GWNSRIKSKNYFTNSRHSFSL  1802
             MAAALRS + RETAS T SH RYFI N +   R        N R KS   F         
Sbjct  1     MAAALRSNTSRETASLTLSHFRYFIFNRIHTARTATSPPHCNHRSKSDEKFP--------  52

Query  1801  FKPVSVRGEFVD-RGYDNSRNLSSC-----------GKIDISSSYGDPPEVWQPPGDGIV  1658
             +K  S+   F+D RG    RN + C             + I SS GDPP++WQPPGDG+ 
Sbjct  53    YKISSLGTSFLDNRGGGERRNSTKCYAAQKKLSGVGSSVVILSSQGDPPDLWQPPGDGVS  112

Query  1657  VRPGVKFVQVGEVDgpssgsgggfg----sGAKDGCWGGSNLGPNFPTPKEICKGLDKFV  1490
             VR     V +G   G    + GG G    S +K+ CWGGSNLG +FPTPKEICKGL+KFV
Sbjct  113   VRVNGSSVNLGRGGGGGGSNPGGPGNGTGSNSKEDCWGGSNLGSDFPTPKEICKGLNKFV  172

Query  1489  IGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             IGQERAKKVLSVAVYNHYKRIY++S+QK
Sbjct  173   IGQERAKKVLSVAVYNHYKRIYHESSQK  200



>ref|XP_010482726.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Camelina sativa]
Length=577

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/423 (74%), Positives = 356/423 (84%), Gaps = 6/423 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  ++ +Y    R    +  K  R+  + +S   +  +
Sbjct  155   FPTPKEICKGLNKFVIGQERAKKVLAVAVYNHYKRIYHESAQK--RSTGETESTAAKPAD  212

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  213   DDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  272

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  273   LLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  332

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERR DSSIGFGAPVR NMR GGVT+
Sbjct  333   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRHDSSIGFGAPVRANMRAGGVTN  392

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A V S+L+ETVESSDLI+YGLIPEFVGRFP+LVSL+ALTENQL++VLTEPKNALGKQYKK
Sbjct  393   AAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLSALTENQLMEVLTEPKNALGKQYKK  452

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             M+QMN+VKLHFTE ALR IARKAITKNTGARGLR++LESILMD+MYEIPD  +G ++I+A
Sbjct  453   MYQMNSVKLHFTESALRLIARKAITKNTGARGLRALLESILMDSMYEIPDESTGSDMIEA  512

Query  456   vivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKE--PKKIVEGSEADIEVERDLPS  286
             V+VD+EAV  EG RG GAKIL GKGAL  YLS    K+  P+   EGS+ + EVE ++PS
Sbjct  513   VVVDEEAVEGEGRRGSGAKILRGKGALGRYLSETNSKDSSPQTTKEGSDGENEVEAEIPS  572

Query  285   IVA  277
             +VA
Sbjct  573   VVA  575


 Score =   150 bits (380),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 119/209 (57%), Gaps = 31/209 (15%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTN--SRHSFSL  1802
             MAAALRS + RETAS T S  RYFI N +   R           S N F N  S    SL
Sbjct  1     MAAALRSNTSRETASLTLSQFRYFIFNRIHTARTATSRSRPDNSSNNRFPNKISPLGTSL  60

Query  1801  FKPVSVRGEFVDRGYDNSRNLSSCGK----------IDISSSYGDPPEVWQPPGDGIVVR  1652
             F   S       +GY      ++C +          + I SS GDPP++WQPPGDG+ VR
Sbjct  61    FGNSS-------KGY-----ATNCAQKMNAVTSSSSVVILSSQGDPPDLWQPPGDGVSVR  108

Query  1651  PGVKFVQVGEVDgpssgsgggfg-------sGAKDGCWGGSNLGPNFPTPKEICKGLDKF  1493
                  V +G   G   G G   G       S +K+  WGGSNLG  FPTPKEICKGL+KF
Sbjct  109   VNGSSVNLGRGGGGGGGGGSPGGGPGDGTGSNSKEDSWGGSNLGSEFPTPKEICKGLNKF  168

Query  1492  VIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             VIGQERAKKVL+VAVYNHYKRIY++SAQK
Sbjct  169   VIGQERAKKVLAVAVYNHYKRIYHESAQK  197



>ref|XP_010267611.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Nelumbo nucifera]
Length=581

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/455 (70%), Positives = 371/455 (82%), Gaps = 11/455 (2%)
 Frame = -2

Query  1617  MVRARALVVGSGQGLKMGAG-EAPIWV-----QIFRPPRKFAKGLISL*LVRKEPKRS-S  1459
             +VR   +  GSG G   G+  E   W        F  P++  K L    + ++  K+  S
Sbjct  128   LVRGGGVTPGSGSGAAFGSSLEDGCWGGANFGDHFPTPKEICKRLDKFVIGQERAKKVLS  187

Query  1458  L*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEAVELEKSNILVMGPTGSGKTLLAK  1279
             + +Y    R    +L K     E  D+ + +  + ++VELEKSNIL+MGPTGSGKTLLAK
Sbjct  188   VAVYNHYKRIYYESLRKWP--TEDLDNGERDEMDSDSVELEKSNILLMGPTGSGKTLLAK  245

Query  1278  TLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKIT  1099
             TLARLVNVPFVIADATTLTQAGYVGEDVESILYKLL VAD+NV AAQQGIVYIDEVDKIT
Sbjct  246   TLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLAVADFNVTAAQQGIVYIDEVDKIT  305

Query  1098  KKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGA  919
             KKAESLN+SRDVSGEGVQQALLKMLEGT+VNVPEKGARKHPRGDNIQIDTKDILFICGGA
Sbjct  306   KKAESLNLSRDVSGEGVQQALLKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGA  365

Query  918   FIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFV  739
             F+DLEKTISERRQDSSIGFGAP+R NMRT G+T+A+V S+LLE VESSDLI+YGLIPEF+
Sbjct  366   FVDLEKTISERRQDSSIGFGAPIRANMRTSGLTNAIVASNLLENVESSDLIAYGLIPEFI  425

Query  738   GRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITK  559
             GRFPILVSL+ALTE+QLV+VL EPKNALGKQY+K+FQMN VKLHFTE++LR IARKA+ K
Sbjct  426   GRFPILVSLSALTEDQLVKVLIEPKNALGKQYRKLFQMNGVKLHFTENSLRVIARKAMAK  485

Query  558   NTGARGLRSILESILMDAMYEIPDVRSGdnvidavivddeaVG-HEGRGCGAKILYGKGA  382
             NTGARGLRSILE+ILMDAMYEIPD R+G++ IDAV+VD+EAVG  EG GCGAKILYG GA
Sbjct  486   NTGARGLRSILENILMDAMYEIPDTRTGNDKIDAVVVDEEAVGAAEGHGCGAKILYGDGA  545

Query  381   LDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
             LD YLS N+  + + I+ GS+ + +VE++L SIVA
Sbjct  546   LDHYLSQNKPSDSETILVGSDGEPDVEQEL-SIVA  579


 Score =   171 bits (434),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 128/205 (62%), Gaps = 16/205 (8%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAA RSKS +E    T S  RY +LNHM  GR+ N     R K  ++ T + + F  FK
Sbjct  1     MAAAFRSKSLKEAVFRTVSQSRYLVLNHMHVGRIFNTHCKYRRKWDDFPTKTPYRFCSFK  60

Query  1795  PVSVRGEFVDRGY---DNSRNLSSCGKI---------DISSSYGDPPEVWQPPGDGIVVR  1652
              VS++G+FV+      DN + +S   K          D   SYG+PPE WQP GDG+ VR
Sbjct  61    LVSIQGDFVNMSTVRSDNRQIVSDFSKERCKESSSLPDSLRSYGEPPEYWQPSGDGLTVR  120

Query  1651  P---GVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQ  1481
                     V+ G V  P SGSG  FGS  +DGCWGG+N G +FPTPKEICK LDKFVIGQ
Sbjct  121   SVPQNTNLVRGGGV-TPGSGSGAAFGSSLEDGCWGGANFGDHFPTPKEICKRLDKFVIGQ  179

Query  1480  ERAKKVLSVAVYNHYKRIYNDSAQK  1406
             ERAKKVLSVAVYNHYKRIY +S +K
Sbjct  180   ERAKKVLSVAVYNHYKRIYYESLRK  204



>ref|XP_006280226.1| hypothetical protein CARUB_v10026143mg [Capsella rubella]
 gb|EOA13124.1| hypothetical protein CARUB_v10026143mg [Capsella rubella]
Length=581

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/422 (74%), Positives = 356/422 (84%), Gaps = 5/422 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  S+ +Y    R    +  K  R+  + +S   +  +
Sbjct  160   FPTPKEICKGLNKFVIGQERAKKVLSVAVYNHYKRIYHESSQK--RSSGETESTAAKPAD  217

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  218   DDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  277

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  278   LLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  337

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERR DSSIGFGAPVR NMR GGVT+
Sbjct  338   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRHDSSIGFGAPVRANMRAGGVTN  397

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A V S+L+ETVESSDLI+YGLIPEFVGRFP+LVSL+ALTENQL+QVLTEPKNALGKQYKK
Sbjct  398   AAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLSALTENQLMQVLTEPKNALGKQYKK  457

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             M+QMN+VKLHFTE ALR IA+KAITKNTGARGLR++LESILMD+MYEIPD  +  ++I+A
Sbjct  458   MYQMNSVKLHFTESALRLIAQKAITKNTGARGLRALLESILMDSMYEIPDEGTDSDMIEA  517

Query  456   vivddeaVGHEG-RGCGAKILYGKGALDCYLS-GNEQKEPKKIVEGSEADIEVERDLPSI  283
             V+VD+EAV  EG RG GAKIL GKGAL  YLS  N +  P+   EGS+ +IEVE ++PS+
Sbjct  518   VVVDEEAVEGEGRRGSGAKILRGKGALGRYLSETNSKDSPQTTKEGSDGEIEVEAEIPSV  577

Query  282   VA  277
             VA
Sbjct  578   VA  579


 Score =   159 bits (401),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 127/205 (62%), Gaps = 18/205 (9%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNL-GWNSRIKSKNYFTNSRHSFSLF  1799
             MAAALRS + RETAS T S  RYF  N +   R       N R K  +  +N++   S  
Sbjct  1     MAAALRSNTSRETASLTLSQFRYFFFNRIHTARTATSPHCNHRSKKADDPSNNK---SPG  57

Query  1798  KPVSVRGEFVD----------RGYDN--SRNLSSCGKIDISSSYGDPPEVWQPPGDGIVV  1655
             K  S+   F+D          RGY    ++ ++  G   I SS GDPP++WQPPGDG+ V
Sbjct  58    KISSLGTSFLDHRGGERRNSSRGYATNCAQKVNGVGSSVILSSQGDPPDLWQPPGDGVSV  117

Query  1654  RPGVKFVQVGEVDgpssgsgggfgsG--AKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQ  1481
             R     V +G   G  S  G G G+G  +K+  WGGSNLG +FPTPKEICKGL+KFVIGQ
Sbjct  118   RVNGSSVNLGRGGGGGSPGGPGNGAGSNSKEDSWGGSNLGSDFPTPKEICKGLNKFVIGQ  177

Query  1480  ERAKKVLSVAVYNHYKRIYNDSAQK  1406
             ERAKKVLSVAVYNHYKRIY++S+QK
Sbjct  178   ERAKKVLSVAVYNHYKRIYHESSQK  202



>ref|XP_010442896.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Camelina sativa]
Length=579

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/423 (74%), Positives = 356/423 (84%), Gaps = 6/423 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  ++ +Y    R    +  K  R+  + +S   +  +
Sbjct  157   FPTPKEICKGLNKFVIGQERAKKVLAVAVYNHYKRIYHESAQK--RSTGETESTAAKPAD  214

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  215   DDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  274

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  275   LLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  334

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERR DSSIGFGAPVR NMR GGVT+
Sbjct  335   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRHDSSIGFGAPVRANMRAGGVTN  394

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A V S+L+ETVESSDLI+YGLIPEFVGRFP+LVSL+ALTENQL++VLTEPKNALGKQYKK
Sbjct  395   AAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLSALTENQLMEVLTEPKNALGKQYKK  454

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             M+QMN+VKLHFTE ALR IARKAITKNTGARGLR++LESILMD+MYEIPD  +G ++I+A
Sbjct  455   MYQMNSVKLHFTESALRLIARKAITKNTGARGLRALLESILMDSMYEIPDESTGSDMIEA  514

Query  456   vivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKE--PKKIVEGSEADIEVERDLPS  286
             V+VD+EAV  EG RG GAKIL GKGAL  YLS    K+  P+   EGS+ + EVE ++PS
Sbjct  515   VVVDEEAVEGEGRRGSGAKILRGKGALGRYLSETYSKDSSPQTTKEGSDGENEVEAEIPS  574

Query  285   IVA  277
             +VA
Sbjct  575   VVA  577


 Score =   151 bits (381),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 120/206 (58%), Gaps = 23/206 (11%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTN--SRHSFSL  1802
             MAAALRS + RETAS T S  RYFI N +   R           S N F N  S    SL
Sbjct  1     MAAALRSNTSRETASLTLSQFRYFIFNRIHTARTATTRSRPDDSSNNRFPNKISPLGTSL  60

Query  1801  FKPVSVRGEFVDRGYDN---------SRNLSSCGKIDISSSYGDPPEVWQPPGDGIVVRP  1649
             F   S       +GY           + + SS   + I SS GDPP++WQPPGDG+ VR 
Sbjct  61    FGNSS-------KGYATNCAQKMNGVASSSSSSSSVVILSSQGDPPDLWQPPGDGVSVRV  113

Query  1648  GVKFVQVGEVDgpssgsgggfg-----sGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIG  1484
                 V +G   G   GS GG       S +K+  WGGSNLG  FPTPKEICKGL+KFVIG
Sbjct  114   NGSSVNLGRGGGGGGGSPGGGPGDGTGSNSKEDSWGGSNLGSEFPTPKEICKGLNKFVIG  173

Query  1483  QERAKKVLSVAVYNHYKRIYNDSAQK  1406
             QERAKKVL+VAVYNHYKRIY++SAQK
Sbjct  174   QERAKKVLAVAVYNHYKRIYHESAQK  199



>ref|XP_009132481.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Brassica rapa]
 emb|CDY47070.1| BnaA03g12280D [Brassica napus]
Length=547

 Score =   570 bits (1470),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 297/356 (83%), Positives = 323/356 (91%), Gaps = 3/356 (1%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  186   DDDLVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILY  245

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP
Sbjct  246   KLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  305

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERR DSSIGFGAPVR NMR GGVT
Sbjct  306   EKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRHDSSIGFGAPVRANMRAGGVT  365

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             +A V S+L+ETVESSDLI+YGLIPEFVGRFP+LVSL+ALTENQL+QVLTEPKNALGKQYK
Sbjct  366   NAAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLSALTENQLMQVLTEPKNALGKQYK  425

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             KM+QMN+VKLHFTE ALR IARKAITKNTGARGLR++LESILMD+MYEIPD  +G ++I+
Sbjct  426   KMYQMNSVKLHFTETALRLIARKAITKNTGARGLRALLESILMDSMYEIPDEGTGKDMIE  485

Query  459   avivddeaVGHEG-RGCGAKILYGKGALDCYLS--GNEQKEPKKIVEGSEADIEVE  301
             AV+VD+EAV  EG RG GAKIL GKGAL  YLS     +  P+   EGSE + EVE
Sbjct  486   AVVVDEEAVEGEGRRGSGAKILRGKGALALYLSETTKSKDSPQTTKEGSEGETEVE  541


 Score =   144 bits (364),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 111/191 (58%), Gaps = 22/191 (12%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAALRS + RETAS   SH RYF  N +               S    ++ R+  +  K
Sbjct  1     MAAALRSNTSRETASLALSHFRYFFFNRLHTS------------STPPRSSHRNKIASLK  48

Query  1795  PVSVRGEFVDRGYDNSRNLSSCGKIDISSSYGDPPEVWQPPGDGIVVRPGVKF-VQVGEV  1619
             P    GE      +  + + S     +  S GDPP++WQPPGDG      ++        
Sbjct  49    PTG--GERRCYATEKVKGVKSA----LLCSQGDPPDLWQPPGDGA---SSLRLNTGRVGG  99

Query  1618  DgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNH  1439
              G S+G G G GS +K+ CWGGSNLG +FPTPKEIC GLDKFVIGQERAKKVLSVAVYNH
Sbjct  100   GGGSAGVGNGAGSDSKEDCWGGSNLGSSFPTPKEICNGLDKFVIGQERAKKVLSVAVYNH  159

Query  1438  YKRIYNDSAQK  1406
             YKRIY +S QK
Sbjct  160   YKRIYYESIQK  170



>ref|XP_004502652.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like 
isoform X2 [Cicer arietinum]
Length=381

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/356 (83%), Positives = 326/356 (92%), Gaps = 2/356 (1%)
 Frame = -2

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLL+
Sbjct  25    VELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLS  84

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              ADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPEKGA
Sbjct  85    AADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPEKGA  144

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPRGDNIQIDTK+ILFICGGAFIDLEKTISERRQDSSIGFGAPVR  M+ GGVT   +
Sbjct  145   RKHPRGDNIQIDTKNILFICGGAFIDLEKTISERRQDSSIGFGAPVRAKMKAGGVTDGAI  204

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
              SSLL TVESSDLI+YGLIPEFVGRFPILVSL+ALTENQL+QV TEPKNALGKQY+KMFQ
Sbjct  205   ASSLLGTVESSDLIAYGLIPEFVGRFPILVSLSALTENQLIQVFTEPKNALGKQYRKMFQ  264

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             MN VKLH+TE ALRSIARKAI+KNTGARGLR+ILES+L+D+M+EIPD+R+GD+VIDAV+V
Sbjct  265   MNGVKLHYTESALRSIARKAISKNTGARGLRAILESVLVDSMFEIPDIRTGDDVIDAVVV  324

Query  447   ddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIV  280
             D+++VG EG   GAKIL+G+GALD YLS  E+K+  + +E S  D E E +LPSIV
Sbjct  325   DEDSVGGEGCVKGAKILHGRGALDRYLS--EEKKDSESMEVSGGDQEAETELPSIV  378



>ref|XP_010445728.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Camelina sativa]
Length=581

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/424 (73%), Positives = 355/424 (84%), Gaps = 7/424 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  ++ +Y    R    +  K  R+  + +S   +  +
Sbjct  158   FPTPKEICKGLNKFVIGQERAKKVLAVAVYNHYKRIYHESAQK--RSTGETESTAAKPAD  215

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  216   DDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  275

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  276   LLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  335

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERR DSSIGFGAPVR NMR GGVT+
Sbjct  336   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRHDSSIGFGAPVRANMRAGGVTN  395

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A V S+L+ETVESSDLI+YGLIPEFVGRFP+LVSL+ALTENQL++VLTEPKNALGKQYKK
Sbjct  396   AAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLSALTENQLMEVLTEPKNALGKQYKK  455

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             M+QMN+VKLHFTE ALR IARKAITKNTGARGLR++LESILMD+MYEIPD  +G ++I+A
Sbjct  456   MYQMNSVKLHFTESALRLIARKAITKNTGARGLRALLESILMDSMYEIPDESTGSDMIEA  515

Query  456   vivddeaVGHEG-RGCGAKILYGKGALDCYLS---GNEQKEPKKIVEGSEADIEVERDLP  289
             V+VD+EAV  EG RG GAKIL GKGAL  YLS    ++   P+    GS+ + EVE ++P
Sbjct  516   VVVDEEAVEGEGRRGSGAKILRGKGALGRYLSETTNSKDSSPQTTKVGSDGENEVEAEIP  575

Query  288   SIVA  277
             S+VA
Sbjct  576   SVVA  579


 Score =   154 bits (389),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 118/207 (57%), Gaps = 24/207 (12%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHS---FS  1805
             MAAALRS + RETAS T S  RYFI N +   R           S N F N   S    S
Sbjct  1     MAAALRSNTSRETASLTLSQFRYFIFNRIHTARTATTRSRPDDSSNNRFQNKISSPLGTS  60

Query  1804  LFKPVSVRGEFVDRGYD-------NSRNLSSCGKIDISSSYGDPPEVWQPPGDGIVVRPG  1646
             LF   S       +GY        N+   SS   +   SS GDPP++WQPPGDG+ VR  
Sbjct  61    LFGNSS-------KGYATNCAQKMNAVASSSSYSVVTLSSQGDPPDLWQPPGDGVSVRVN  113

Query  1645  VKFVQVGEVDgpssgsgggfg-------sGAKDGCWGGSNLGPNFPTPKEICKGLDKFVI  1487
                V +G   G   G G   G       S +K+  WGGSNLG  FPTPKEICKGL+KFVI
Sbjct  114   GSSVNLGRGGGGGGGGGNPGGGPGDGTGSNSKEDSWGGSNLGSEFPTPKEICKGLNKFVI  173

Query  1486  GQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             GQERAKKVL+VAVYNHYKRIY++SAQK
Sbjct  174   GQERAKKVLAVAVYNHYKRIYHESAQK  200



>ref|XP_010671440.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Beta vulgaris subsp. vulgaris]
Length=580

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/420 (75%), Positives = 354/420 (84%), Gaps = 9/420 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  +GL    + +++ K+  S+ +Y    R    TL +          D  +   
Sbjct  167   FPTPKEICRGLDKFVIGQEKAKKVLSVAVYNHYKRIYYETLQRQSGESANGKLDPAD---  223

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              E VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  224   -EVVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  282

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTV+DYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  283   LLTVSDYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  342

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERR DSSIGFGAPVR NMRTGG TS
Sbjct  343   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRHDSSIGFGAPVRANMRTGGATS  402

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A + SSLL+ VESSDLI+YGLIPEFVGRFP+LV+L+ALTENQLV+VLTEPKNALGKQYKK
Sbjct  403   AAIASSLLDNVESSDLIAYGLIPEFVGRFPVLVNLSALTENQLVEVLTEPKNALGKQYKK  462

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN VKLHFT++ALR IA+KAI KNTGARGLR+ILE++LMDAMYEIPD R+GD++IDA
Sbjct  463   MFQMNGVKLHFTDEALRLIAKKAINKNTGARGLRAILENVLMDAMYEIPDTRTGDSIIDA  522

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
             VIVD+EA+G EG+G G  ILYGKG+LD YLS    ++ +  VE SE ++E E DLPS+VA
Sbjct  523   VIVDEEAIGLEGKGRGGNILYGKGSLDRYLS----QKNRNEVESSEGEVEGETDLPSVVA  578


 Score =   189 bits (480),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 135/209 (65%), Gaps = 22/209 (11%)
 Frame = -1

Query  1972  AAALRSKSCRETASATASHLRYFILNHMQA--GRLGNLGWNSRIKSKNYFTNSRHSFSLF  1799
             AA LRSKS +ETA  TA   RYF++NHM    GR+ +    ++ K ++YF N+ + F  F
Sbjct  3     AAVLRSKSTKETAILTAYQFRYFVMNHMHMHMGRMASSHAANKAKQEDYFINTPYHFMSF  62

Query  1798  KPVSVRGEFVDRGYD--------NSRNLSSCGKIDISSSYGDPPEVWQPPGDGIVVRP--  1649
             KPVS+RGEF+D+G +        N R L S   +   S  GDPPEVWQPP DG+VVR   
Sbjct  63    KPVSLRGEFMDKGTNFMGFNSNHNKRKLGSDSNVLRCS--GDPPEVWQPPSDGVVVRARG  120

Query  1648  --------GVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKF  1493
                     G      G      +G GGG GS  KDGCWGGS+LG +FPTPKEIC+GLDKF
Sbjct  121   GGGGGGGGGGGSGGNGGGSNAGAGGGGGSGSNPKDGCWGGSSLGSSFPTPKEICRGLDKF  180

Query  1492  VIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             VIGQE+AKKVLSVAVYNHYKRIY ++ Q+
Sbjct  181   VIGQEKAKKVLSVAVYNHYKRIYYETLQR  209



>emb|CDY54345.1| BnaC03g14910D [Brassica napus]
Length=546

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/416 (74%), Positives = 348/416 (84%), Gaps = 7/416 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVE-GT  1360
             F  P++   GL    + ++  K+  S+ +Y    R    +L K  R+  + DS   +   
Sbjct  127   FPTPKEICNGLDKFVIGQERAKKVLSVAVYNHYKRIYYESLQK--RSSGETDSTAAKPAD  184

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  185   DDDLVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILY  244

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP
Sbjct  245   KLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  304

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERR DSSIGFGAPVR NMR GGVT
Sbjct  305   EKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRHDSSIGFGAPVRANMRAGGVT  364

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             +A V S+L+ETVESSDLI+YGLIPEFVGRFP+LVSL+ALTENQL+QVLTEPKNALGKQYK
Sbjct  365   NAAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLSALTENQLMQVLTEPKNALGKQYK  424

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             KM+QMN+VKLHFTE ALR IARKAITKNTGARGLR++LESILMD+MYEIPD  +G ++I+
Sbjct  425   KMYQMNSVKLHFTETALRLIARKAITKNTGARGLRALLESILMDSMYEIPDEGTGKDMIE  484

Query  459   avivddeaVGHEG-RGCGAKILYGKGALDCYLS--GNEQKEPKKIVEGSEADIEVE  301
             AV+VD++AV  EG RG GAKIL GKGAL  YLS     +  P+   EGSE + EVE
Sbjct  485   AVVVDEKAVEGEGRRGSGAKILRGKGALALYLSETTKSKDSPQTTKEGSEGETEVE  540


 Score =   155 bits (391),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 117/193 (61%), Gaps = 27/193 (14%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAALRS + RETAS T SH RYF  N +                  + T++ HS    K
Sbjct  1     MAAALRSNTSRETASLTLSHFRYFFFNRL------------------HTTSTPHSSHRNK  42

Query  1795  PVSVRGEFVDR---GYDNSRNLSSCGKIDISSSYGDPPEVWQPPGDGIVVRPGVKFVQVG  1625
               S++ +  DR     + +R + S     +  S GDPP++WQPPGDG+ +R         
Sbjct  43    IASLKPKGGDRRCYATEKARGVKSA----LLCSQGDPPDLWQPPGDGVSLRANPSHGG--  96

Query  1624  EVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVY  1445
                G S+G G G GS +K+ CWGGSNLG +FPTPKEIC GLDKFVIGQERAKKVLSVAVY
Sbjct  97    GGGGSSAGVGNGAGSDSKEDCWGGSNLGSSFPTPKEICNGLDKFVIGQERAKKVLSVAVY  156

Query  1444  NHYKRIYNDSAQK  1406
             NHYKRIY +S QK
Sbjct  157   NHYKRIYYESLQK  169



>ref|XP_006647394.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Oryza brachyantha]
Length=386

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/357 (81%), Positives = 319/357 (89%), Gaps = 4/357 (1%)
 Frame = -2

Query  1368  EGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVES  1189
             E  + + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVES
Sbjct  24    EADDDDGVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVES  83

Query  1188  ILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  1009
             ILYKLLTVAD+NVQAAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV
Sbjct  84    ILYKLLTVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  143

Query  1008  NVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTG  829
             NVPEKGARKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR G
Sbjct  144   NVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRAG  203

Query  828   GVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGK  649
             GV+SA VTSSLLE+VES DLI+YGLIPEF+GRFPILVSL AL E+QLVQVL EPKNALGK
Sbjct  204   GVSSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLAALNEDQLVQVLMEPKNALGK  263

Query  648   QYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdn  469
             Q+KK+F MNNVKLHFT+ ALR I++KA++KNTGARGLR+ILE+ILMDAMYEIPD +SG+ 
Sbjct  264   QFKKLFSMNNVKLHFTDAALRIISKKAMSKNTGARGLRTILENILMDAMYEIPDAKSGEK  323

Query  468   vidavivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVE  301
              IDAV+VD++AVG  +  GCGAKILYG GA D YLS   + +      GSE D E E
Sbjct  324   RIDAVVVDEDAVGSVDQPGCGAKILYGDGAFDRYLS---EMKAAGDAAGSEVDREAE  377



>ref|XP_004164772.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent Clp protease ATP-binding 
subunit ClpX-like [Cucumis sativus]
Length=571

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/420 (75%), Positives = 353/420 (84%), Gaps = 7/420 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++ AKGL    + ++  K+  S+ +Y    R    +L +   +   N   K +  +
Sbjct  155   FPTPKEIAKGLDKFVIGQERAKKVLSVGVYNHYKRIYHESLQRPTGDTFNN---KADAAD  211

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  212   DDKVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  271

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL VADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  272   LLMVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  331

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRG+NIQIDTKDILFICG   + L KTISERRQDSS+GFGAPVR NMR GGVT 
Sbjct  332   KGARKHPRGENIQIDTKDILFICGVPSLXLGKTISERRQDSSLGFGAPVRANMRAGGVTD  391

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A+VTSSLLETVESSDLI+YGLIPEFVGRFPILVSL+ALTENQLVQVLTEPKNALGKQY+K
Sbjct  392   AMVTSSLLETVESSDLIAYGLIPEFVGRFPILVSLSALTENQLVQVLTEPKNALGKQYRK  451

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN+VKLHFTE++LR IARKA++KNTGARGLRSILE++LMD+MYEIPDVR+G ++IDA
Sbjct  452   MFQMNDVKLHFTENSLRLIARKAMSKNTGARGLRSILENLLMDSMYEIPDVRTGKDIIDA  511

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
             VIVD+E+VG +  G GAKILYGKGALD +LSG  QK   +  E  E + E E DLPS+VA
Sbjct  512   VIVDEESVGSDSPGFGAKILYGKGALDRHLSG--QKATSQDSE-REPEPEGETDLPSVVA  568


 Score =   155 bits (393),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 122/200 (61%), Gaps = 23/200 (12%)
 Frame = -1

Query  1963  LRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFKPVSV  1784
             LRS+S +E A+ T S  R+ I N + A    N       KS + F NS +    FKPVS+
Sbjct  7     LRSRSSKEVATLTLSRCRHCISNSIHAAFTPN-------KSNDCFLNSPYHLVSFKPVSL  59

Query  1783  RGEFVDRG---YDNSRNLSSCGKID---------ISSSYGDPPEVWQPPGDGIVVRPGVK  1640
             RG+F D G    D+ R   S  K             S+YGDPPEVW   GDGIV+R    
Sbjct  60    RGDFFDTGTQPLDHRRIYQSPTKTLNHRLSKKGCFMSTYGDPPEVWS--GDGIVIRGSNS  117

Query  1639  FVQVGEVDgpssgsgggfgsGAK--DGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKK  1466
              +     DG SS SG G G G+   DGCWGGS+LGPNFPTPKEI KGLDKFVIGQERAKK
Sbjct  118   SLNGRGGDGGSSNSGSGGGFGSNSNDGCWGGSSLGPNFPTPKEIAKGLDKFVIGQERAKK  177

Query  1465  VLSVAVYNHYKRIYNDSAQK  1406
             VLSV VYNHYKRIY++S Q+
Sbjct  178   VLSVGVYNHYKRIYHESLQR  197



>ref|XP_010555729.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Tarenaya hassleriana]
Length=574

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/424 (72%), Positives = 356/424 (84%), Gaps = 10/424 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + +++ K+  S+ +Y    R    +L K  R   ++ S   + T+
Sbjct  156   FPTPKEICKGLDRFVIGQEKAKKVLSVAVYNHYKRIHYESLQK--RPAGESGSSTAKATD  213

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              E VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFV+ADATTLTQAGYVGEDVESILYK
Sbjct  214   DEFVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVLADATTLTQAGYVGEDVESILYK  273

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVAD+NV AAQQGIVYIDEVDKITKKAE+LNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  274   LLTVADHNVAAAQQGIVYIDEVDKITKKAENLNISRDVSGEGVQQALLKMLEGTIVNVPE  333

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+++EKTISERR DSSIGFGAPVR NMR GGVT 
Sbjct  334   KGARKHPRGDNIQIDTKDILFICGGAFVNIEKTISERRHDSSIGFGAPVRANMRAGGVTD  393

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A V S+L+ETVESSDLI+YGLIPEFVGRFP+LVSL+AL+ENQLVQVLTEPKNALGKQYKK
Sbjct  394   ATVASTLMETVESSDLIAYGLIPEFVGRFPVLVSLSALSENQLVQVLTEPKNALGKQYKK  453

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MF+MN VKLHFTE ALR IARKAITKNTGARGLR++LESIL+D+MYEIPDV++GD+ ++A
Sbjct  454   MFEMNRVKLHFTEGALRRIARKAITKNTGARGLRALLESILVDSMYEIPDVKTGDDAVEA  513

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSG---NEQKEPKKIVEGSEADIEVERDLPS  286
             V+VD+EAV       GAKIL G+G+LD YLS    +++   ++  EG E + EVE +LPS
Sbjct  514   VVVDEEAV----ESGGAKILRGEGSLDRYLSQTTMSDESSSQRRKEGPEGEAEVETELPS  569

Query  285   IVAL  274
             +VA+
Sbjct  570   VVAV  573


 Score =   183 bits (465),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 130/202 (64%), Gaps = 16/202 (8%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAALR+ + RETAS T S  RYFI N + +GR  +   N R K  +  TN     + FK
Sbjct  1     MAAALRTNTSRETASLTLSQFRYFIFNRVHSGRAASSQCNHRTKCDDPLTN----VTSFK  56

Query  1795  PVSVRGEFVDRG---YDNSRN--------LSSCGKIDISSSYGDPPEVWQPPGDGIVVRP  1649
             P+ + G  V++G    D+ R+         ++CGK  +SSSYGDPP+VWQPP D + VR 
Sbjct  57    PIVLAGMVVEKGPSVVDHRRDNRNPSKSFATNCGKSAMSSSYGDPPDVWQPPVDEVTVRI  116

Query  1648  GVKFVQVGEVDgpssgsgggfgsGA-KDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERA  1472
                 V +G   G +S   G     + KD  WGGSNLGP+FPTPKEICKGLD+FVIGQE+A
Sbjct  117   NGSTVNLGRGGGGASPGSGNGAGSSSKDESWGGSNLGPSFPTPKEICKGLDRFVIGQEKA  176

Query  1471  KKVLSVAVYNHYKRIYNDSAQK  1406
             KKVLSVAVYNHYKRI+ +S QK
Sbjct  177   KKVLSVAVYNHYKRIHYESLQK  198



>ref|XP_006836922.1| hypothetical protein AMTR_s00099p00142540 [Amborella trichopoda]
 gb|ERM99775.1| hypothetical protein AMTR_s00099p00142540 [Amborella trichopoda]
Length=709

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/364 (81%), Positives = 335/364 (92%), Gaps = 1/364 (0%)
 Frame = -2

Query  1374  KVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDV  1195
             + E  + + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDV
Sbjct  341   EAETDDGDHVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDV  400

Query  1194  ESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT  1015
             ESILYKLLTVA++NV AAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT
Sbjct  401   ESILYKLLTVAEFNVAAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT  460

Query  1014  IVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMR  835
             +VNVPEKGARKHPRGDNIQIDTK+ILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR
Sbjct  461   VVNVPEKGARKHPRGDNIQIDTKEILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMR  520

Query  834   TGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNAL  655
             TGG+T+AVVTSSLLE+VES DL++YGLIPEF+GRFPILVSL+AL E+QLVQVLTEPKNAL
Sbjct  521   TGGLTNAVVTSSLLESVESGDLMAYGLIPEFIGRFPILVSLSALNEDQLVQVLTEPKNAL  580

Query  654   GKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSG  475
             GKQYKKMF MNNVKLHFTE+ALR IA+KA++KNTGARGLR+ILESIL +AMYEIPDV++G
Sbjct  581   GKQYKKMFSMNNVKLHFTENALRLIAKKAMSKNTGARGLRAILESILTEAMYEIPDVKTG  640

Query  474   dnvidavivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVER  298
             ++ +DAV+VD+EAVG+ +  G GAKIL G GALDCYL+ ++ K+P   V+GSE + EVE 
Sbjct  641   NDRVDAVVVDEEAVGYGDMPGTGAKILRGDGALDCYLADHKLKDPVLSVDGSEGESEVEA  700

Query  297   DLPS  286
             +L S
Sbjct  701   ELAS  704


 Score =   115 bits (288),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 74/110 (67%), Gaps = 9/110 (8%)
 Frame = -1

Query  1708  SYGDPPEVWQPP-GDGIVVRP--------GVKFVQVGEVDgpssgsgggfgsGAKDGCWG  1556
             SYGDPPE WQPP G+GI V+          +  V+     G   GS  G GS      WG
Sbjct  222   SYGDPPEHWQPPPGNGIAVQSPPGPPFPPNLNVVRASGPGGGGGGSSNGGGSFGSKDAWG  281

Query  1555  GSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             G+NLG + PTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIY+ S QK
Sbjct  282   GANLGKDLPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYHASLQK  331



>ref|XP_010035267.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Eucalyptus grandis]
 gb|KCW46558.1| hypothetical protein EUGRSUZ_K00383 [Eucalyptus grandis]
Length=594

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/425 (74%), Positives = 358/425 (84%), Gaps = 6/425 (1%)
 Frame = -2

Query  1545  WVQIFRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSD-K  1372
             W   F  P++  KGL    + ++  K+  S+ +Y    R       +S + P  +  D +
Sbjct  172   WGSNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKR----IYHESVKRPSGDSEDAR  227

Query  1371  VEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVE  1192
              E  + + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVE
Sbjct  228   PESADDDLVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVE  287

Query  1191  SILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTI  1012
             SIL+KLLT ADYNV AAQQGIVYIDEVDKITKKAES+NISRDVSGEGVQQALLKMLEGT+
Sbjct  288   SILHKLLTAADYNVAAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQALLKMLEGTV  347

Query  1011  VNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRT  832
             VNVPEKGARKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR 
Sbjct  348   VNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRA  407

Query  831   GGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALG  652
               VT+AVV SSLLE+VESSDLISYGLIPEFVGRFPILVSL+AL+E+QLV+VLTEPKNALG
Sbjct  408   SNVTNAVVASSLLESVESSDLISYGLIPEFVGRFPILVSLSALSEDQLVEVLTEPKNALG  467

Query  651   KQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGd  472
             KQY+KMFQMN VKLH+T++ALR IARKAI KNTGARGLRSILE+ILM+AMYEIPDVR+G+
Sbjct  468   KQYRKMFQMNGVKLHYTDNALRLIARKAIAKNTGARGLRSILENILMEAMYEIPDVRTGE  527

Query  471   nvidavivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDL  292
             ++IDAV+VD+EAVG EGRG GAKILYGKGA D YLS  + K+ +  +E  + + EVE ++
Sbjct  528   DIIDAVVVDEEAVGIEGRGHGAKILYGKGAFDRYLSQKKVKDQETSIESPDGEPEVEAEI  587

Query  291   PSIVA  277
             P IVA
Sbjct  588   PKIVA  592


 Score =   169 bits (429),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 125/225 (56%), Gaps = 42/225 (19%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILN-HMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLF  1799
             MAA L+ K  RETA+  AS  R F+ N  M AGR+ N    S      +F N+ + F+ F
Sbjct  1     MAAVLKCKPSRETAAFAASQFRCFMFNNQMHAGRVPNSHRASHSNWDRFFANTPYLFTSF  60

Query  1798  KPVSVRGEFVDRG----------------------------------YDNSRNLSSCGKI  1721
             KPV++RG+FV++G                                  YD  R  S   K 
Sbjct  61    KPVTLRGDFVEQGTQFLSDRRVNSIVGTKKGAVTCDEREELGNFRGDYDGGRRWSE--KF  118

Query  1720  DISSSYGDPPEVWQPPGDGIVVRPGVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLG  1541
             +++SS GDPPEVWQPPG G+ VR G     V        G  G      KD  WGGSN G
Sbjct  119   NMASSNGDPPEVWQPPGGGVTVRLGNSGYVV-----TRGGGSGSESDSPKDESWGGSNWG  173

Query  1540  PNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              NFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIY++S ++
Sbjct  174   SNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYHESVKR  218



>ref|XP_011044639.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Populus euphratica]
Length=539

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/386 (77%), Positives = 331/386 (86%), Gaps = 9/386 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIR---ESTMTLLKSDRNPEKNDSDKVE  1366
             F  P++  K L +  + ++  K+  S+ +Y    R   ES      +D   EK D+    
Sbjct  153   FPTPKEICKALDNFVIGQRRAKKVLSVAVYNHYKRIYLESVKKWSNTDSGNEKADT----  208

Query  1365  GTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESI  1186
               + + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESI
Sbjct  209   -MDDDGVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESI  267

Query  1185  LYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVN  1006
             LYKLLT ADYNV AAQQGI+YIDE+DKITKK+ES+NISRDVSGEGVQQALLKMLEGTIVN
Sbjct  268   LYKLLTAADYNVAAAQQGIIYIDEIDKITKKSESVNISRDVSGEGVQQALLKMLEGTIVN  327

Query  1005  VPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGG  826
             VPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTGG
Sbjct  328   VPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTGG  387

Query  825   VTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQ  646
             VTS  VTSSLLET ESSDL+SYGLIPEFVGRFPILVSL ALTE+QLVQVLTEPKNALGKQ
Sbjct  388   VTSTAVTSSLLETAESSDLVSYGLIPEFVGRFPILVSLAALTEDQLVQVLTEPKNALGKQ  447

Query  645   YKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnv  466
             YKK+FQMN+VKLH TE+ALRSIARKAITKNTGAR LRSILE+ILMD+MYEIPDVR+GD++
Sbjct  448   YKKLFQMNDVKLHVTENALRSIARKAITKNTGARALRSILENILMDSMYEIPDVRTGDDI  507

Query  465   idavivddeaVGHEGRGCGAKILYGK  388
             IDAV+VD+ A+G E R  GA ILYG+
Sbjct  508   IDAVVVDEVAIGSEERSIGATILYGR  533


 Score =   155 bits (391),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 125/210 (60%), Gaps = 40/210 (19%)
 Frame = -1

Query  1969  AALRSKSCRETASATASHLRYFILNHMQAG-RLGNLGWNSRIKSKN-YFTNSRHSFSLFK  1796
             AA+R K  +     TAS  RYF+ N+M  G RL +    ++I +++ +F N+ + F+ FK
Sbjct  4     AAVRCKPPK----VTASQFRYFMFNYMHVGSRLSSSHCANKIATRDDHFANTPYHFTSFK  59

Query  1795  PVSVRGEFV-----------------DRGYDNSRNLSSCGKIDISSSYGDPPEVWQPPGD  1667
             PVS+RGEF                  DR +  + + +S G     S+YGDPPEVWQPPGD
Sbjct  60    PVSLRGEFFEKSTQLLGNMRSRSSSSDRNWRETVSSNSGG----GSNYGDPPEVWQPPGD  115

Query  1666  GIV---VRPGVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDK  1496
             G+    V  G    +V              GSG+KDG WGGSNLG +FPTPKEICK LD 
Sbjct  116   GVAKMRVSDGGGDFKV----------WSRGGSGSKDGYWGGSNLGSSFPTPKEICKALDN  165

Query  1495  FVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             FVIGQ RAKKVLSVAVYNHYKRIY +S +K
Sbjct  166   FVIGQRRAKKVLSVAVYNHYKRIYLESVKK  195



>ref|XP_002452300.1| hypothetical protein SORBIDRAFT_04g023280 [Sorghum bicolor]
 gb|EES05276.1| hypothetical protein SORBIDRAFT_04g023280 [Sorghum bicolor]
Length=640

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/336 (85%), Positives = 313/336 (93%), Gaps = 1/336 (0%)
 Frame = -2

Query  1368  EGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVES  1189
             E  + + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVES
Sbjct  282   EADDDDNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVES  341

Query  1188  ILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  1009
             ILYKLLTVAD+NVQAAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV
Sbjct  342   ILYKLLTVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  401

Query  1008  NVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTG  829
             NVPEKGARKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR G
Sbjct  402   NVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRAG  461

Query  828   GVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGK  649
             G++SA VTSSLLE+VES DLI+YGLIPEF+GRFPILVSL AL E+QLVQVLTEPKNALGK
Sbjct  462   GISSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLAALNEDQLVQVLTEPKNALGK  521

Query  648   QYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdn  469
             Q+KK+F MNNVKLHFT+ ALR IA+KA++KNTGARGLR+ILE+ILMD+MYEIPD RSG+ 
Sbjct  522   QFKKLFSMNNVKLHFTDGALRIIAKKAMSKNTGARGLRTILETILMDSMYEIPDARSGEK  581

Query  468   vidavivddeaVGH-EGRGCGAKILYGKGALDCYLS  364
              IDAV+VD++AVG  +  GCGAKILYG GALD YLS
Sbjct  582   RIDAVVVDEDAVGSVDQPGCGAKILYGDGALDQYLS  617


 Score = 89.4 bits (220),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -1

Query  1552  SNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             SNLG + PTPKEICKGLDK+VIGQ+RAKKVLSVAVYNHYKRIY+ S QK
Sbjct  222   SNLGRDLPTPKEICKGLDKYVIGQDRAKKVLSVAVYNHYKRIYHQSLQK  270



>gb|AES72507.2| ATP-dependent Clp protease regulatory subunit ClpX [Medicago 
truncatula]
Length=581

 Score =   542 bits (1396),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 292/356 (82%), Positives = 320/356 (90%), Gaps = 2/356 (1%)
 Frame = -2

Query  1344  ELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLTV  1165
             ELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLL  
Sbjct  226   ELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLAA  285

Query  1164  ADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGAR  985
             ADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGAR
Sbjct  286   ADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGAR  345

Query  984   KHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVVT  805
             KHPRGDNIQIDTK+ILFICGGAFIDLEKTISERRQDSSIGFGAPVR  M+ G VT A + 
Sbjct  346   KHPRGDNIQIDTKNILFICGGAFIDLEKTISERRQDSSIGFGAPVRAKMKAGSVTEASIA  405

Query  804   SSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQM  625
             SSLL TVESSDLI+YGLIPEFVGRFPILVSL+ALTENQL+QVLTEPK+AL KQYKK FQ+
Sbjct  406   SSLLGTVESSDLIAYGLIPEFVGRFPILVSLSALTENQLIQVLTEPKSALEKQYKKTFQI  465

Query  624   NNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidavivd  445
             N VKLHFTE A +SIAR+A++KNTGARGLR+I+ESIL+DAMYEIPD+R+GD+VIDAV+VD
Sbjct  466   NGVKLHFTESARKSIARQAMSKNTGARGLRAIIESILVDAMYEIPDIRTGDDVIDAVVVD  525

Query  444   deaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
             +++VG EG   GAKILYG+GA D YLS  ++K   +  E S  D E E +LPSIVA
Sbjct  526   EDSVGGEGSVRGAKILYGRGAFDRYLS--KEKNDSETTEVSGGDQEAETELPSIVA  579


 Score =   144 bits (363),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 120/210 (57%), Gaps = 33/210 (16%)
 Frame = -1

Query  1978  AMAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLF  1799
             A AAA RSK  +E A+   S LRYF  N+  AG       +S    ++   N+ + F+ F
Sbjct  2     AAAAAFRSKPSKEKATLALSQLRYFAFNYTHAG-------HSHSPPRSPLINTPYHFTSF  54

Query  1798  KPVSVRG-EFVDRGY---------------DNSRNLSSCGKIDIS------SSYGDPPEV  1685
             KP+S+RG +F+ +                 D+++N +     D++      SS+ DPPEV
Sbjct  55    KPLSLRGVDFIHKSSNNNTSTASTSTTLIEDSNQNPNHV-PYDVTAYRVLVSSFVDPPEV  113

Query  1684  WQPPGDGIVVRPG-VKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICK  1508
             W   G GIVVRPG       G   G    +  G    +KD CWGGSN+G  FPTPKEICK
Sbjct  114   WS--GGGIVVRPGNYDVSGGGGGGGGGGAASSGDSGNSKDWCWGGSNMGGTFPTPKEICK  171

Query  1507  GLDKFVIGQERAKKVLSVAVYNHYKRIYND  1418
             GLDK VIGQERAKKVLSVAVYNHYKRIY++
Sbjct  172   GLDKHVIGQERAKKVLSVAVYNHYKRIYHE  201



>ref|XP_010915955.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Elaeis guineensis]
Length=568

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/421 (70%), Positives = 344/421 (82%), Gaps = 4/421 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  +GL +  + ++  K+  S+ +Y    R    +L  S      ++ ++   T+
Sbjct  148   FPTPKEICRGLDNFVIGQERAKKVLSVAVYNHYKRIYYESL--SKWCAAGSNENEASTTD  205

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVES+LYK
Sbjct  206   IDTVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESVLYK  265

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL  AD+NV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  266   LLVAADFNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPE  325

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERR DSSIGF AP+R NMRTG VT+
Sbjct  326   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRHDSSIGFRAPIRANMRTGSVTN  385

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A V SSLLE+VES DLI+YGLIPEFVGRFPILVSL+AL E+QLV+VLT+PKNA+GKQY K
Sbjct  386   AAVASSLLESVESGDLIAYGLIPEFVGRFPILVSLSALNEDQLVEVLTKPKNAVGKQYIK  445

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             +FQMN+V+LHFTE ALR IA+KA+ KNTGARGLRSILE+IL +AMYEIPD R+G   IDA
Sbjct  446   LFQMNDVRLHFTEKALRLIAKKAMAKNTGARGLRSILENILTEAMYEIPDTRTGKEKIDA  505

Query  456   vivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIV  280
             V+VD+E+VG  +  GCGAKIL G+GAL+ Y S    KE +   E SE + E + +LPS V
Sbjct  506   VVVDEESVGSVDSHGCGAKILCGEGALENYFSQQNLKEAETTFERSEGEPEADLELPSRV  565

Query  279   A  277
             A
Sbjct  566   A  566


 Score =   145 bits (365),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 124/198 (63%), Gaps = 16/198 (8%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             M+AA+RS   R   +A A    Y   + M AGR+ N+    R +  +++T +   F   +
Sbjct  1     MSAAVRS---RAVGAAAAVQSVYVSSHRMHAGRISNVHGKYRRRWDDFWTWAPRYFRPLE  57

Query  1795  PVSVRGEFVDRG--YDNSRNLSSCGKIDISSSYGDPPEVWQPPGD-GIVVRPG----VKF  1637
              VSV+G  VDRG  + N+ +L + G+     S  +PPE+WQ PGD G+ V       +  
Sbjct  58    LVSVQGHLVDRGTLFPNAPSLETNGR-----SGWEPPEIWQQPGDSGVTVHSASLGRINV  112

Query  1636  VQVGEVDgpssgsgggfgs-GAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVL  1460
             ++VG   G  +G+GGG G   +KDGCWGGSNLG  FPTPKEIC+GLD FVIGQERAKKVL
Sbjct  113   IRVGGGGGGGTGAGGGGGGFDSKDGCWGGSNLGNKFPTPKEICRGLDNFVIGQERAKKVL  172

Query  1459  SVAVYNHYKRIYNDSAQK  1406
             SVAVYNHYKRIY +S  K
Sbjct  173   SVAVYNHYKRIYYESLSK  190



>dbj|BAH01586.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73425.1| hypothetical protein OsI_07697 [Oryza sativa Indica Group]
Length=645

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/357 (82%), Positives = 319/357 (89%), Gaps = 4/357 (1%)
 Frame = -2

Query  1368  EGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVES  1189
             E  + + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVES
Sbjct  283   EADDDDGVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVES  342

Query  1188  ILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  1009
             ILYKLL VAD+NVQAAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV
Sbjct  343   ILYKLLAVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  402

Query  1008  NVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTG  829
             NVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMR G
Sbjct  403   NVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRAG  462

Query  828   GVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGK  649
             G++SA VTSSLLE+VES DLI+YGLIPEF+GRFPILVSL AL E+QLVQVL EPKNALGK
Sbjct  463   GISSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLAALNEDQLVQVLMEPKNALGK  522

Query  648   QYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdn  469
             Q+KK+F MNNVKLHFT+ ALR IA+KA++KNTGARGLR+ILE+ILMDAMYEIPD +SG+ 
Sbjct  523   QFKKLFSMNNVKLHFTDAALRIIAKKAMSKNTGARGLRTILENILMDAMYEIPDAKSGEK  582

Query  468   vidavivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVE  301
              IDAV+VD++AVG  +  GCGAKILYG GA + YLS   Q +      GSEAD E E
Sbjct  583   RIDAVVVDEDAVGAVDQPGCGAKILYGDGAFERYLS---QIKVAGDAAGSEADGEAE  636


 Score = 97.8 bits (242),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  1573  KDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             KDG WGGSNLG + PTPKEIC+GLDK+VIGQ+RAKKVLSVAVYNHYKRIY+ S QK
Sbjct  217   KDG-WGGSNLGKDLPTPKEICQGLDKYVIGQDRAKKVLSVAVYNHYKRIYHKSLQK  271



>ref|XP_003575174.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Brachypodium distachyon]
Length=640

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/422 (71%), Positives = 351/422 (83%), Gaps = 9/422 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++ +KGL    + ++  K+  S+ +Y    R    ++ K       +   + +G +
Sbjct  224   FPTPKEISKGLDKYVIGQERAKKVLSVAVYNHYKRIYHQSVQKGSGADLGSSDGEADGDD  283

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
             +  VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  284   N--VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  341

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVAD+NVQAAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  342   LLTVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  401

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR +MRTGG++S
Sbjct  402   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRASMRTGGISS  461

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A VTSSLLE+VES DLI+YGLIPEF+GRFPILVSL AL E+QLVQVLTEPKNALGKQ++K
Sbjct  462   AQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLAALNEDQLVQVLTEPKNALGKQFRK  521

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             +F MNNVKLHFT+ ALR IA+KA+ KNTGARGLR+ILE+ILMD+MYEIPD +SG+  IDA
Sbjct  522   LFSMNNVKLHFTDSALRIIAKKAMCKNTGARGLRTILENILMDSMYEIPDTKSGEKRIDA  581

Query  456   vivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIV  280
             V+VD++AVG   R GCGAKILYG G+ D YLS     + K + +G+ ++ + E DL S  
Sbjct  582   VVVDEDAVGSVDRPGCGAKILYGDGSFDHYLS-----QIKAMGDGAGSEADGEADLSSSR  636

Query  279   AL  274
             A+
Sbjct  637   AM  638



>ref|XP_008676716.1| PREDICTED: uncharacterized protein LOC100272327 isoform X1 [Zea 
mays]
 gb|AFW62659.1| hypothetical protein ZEAMMB73_067276 [Zea mays]
 gb|AFW62660.1| hypothetical protein ZEAMMB73_067276 [Zea mays]
 gb|AFW62661.1| hypothetical protein ZEAMMB73_067276 [Zea mays]
 gb|AFW62662.1| hypothetical protein ZEAMMB73_067276 [Zea mays]
Length=346

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/319 (86%), Positives = 299/319 (94%), Gaps = 1/319 (0%)
 Frame = -2

Query  1317  MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLTVADYNVQAAQ  1138
             MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLLTVAD+NVQAAQ
Sbjct  1     MGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLTVADFNVQAAQ  60

Query  1137  QGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQ  958
             QG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQ
Sbjct  61    QGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQ  120

Query  957   IDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVES  778
             IDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR GG++SA VTSSLLE+VES
Sbjct  121   IDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRAGGISSAQVTSSLLESVES  180

Query  777   SDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTE  598
              DLI+YGLIPEF+GRFPILVSL AL E+QLVQVL EPKNALGKQ+KK+F MNNVKLHFT+
Sbjct  181   GDLIAYGLIPEFIGRFPILVSLAALNEDQLVQVLIEPKNALGKQFKKLFSMNNVKLHFTD  240

Query  597   DALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidavivddeaVGH-EG  421
              ALR IA+KA++KNTGARGLR+ILE+ILMD+MYEIPD +SG+  IDAV+VD++AVG  + 
Sbjct  241   GALRIIAKKAMSKNTGARGLRTILENILMDSMYEIPDAKSGEKRIDAVVVDEDAVGSVDQ  300

Query  420   RGCGAKILYGKGALDCYLS  364
              GCGAKILYG GALD YLS
Sbjct  301   PGCGAKILYGDGALDQYLS  319



>gb|EYU25234.1| hypothetical protein MIMGU_mgv1a003646mg [Erythranthe guttata]
Length=499

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/348 (80%), Positives = 304/348 (87%), Gaps = 7/348 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  S+ +Y    R      + SD +    D  K EG +
Sbjct  157   FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKR------IYSDSSQRPADGGKTEGAD  210

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              E VELEKSNIL+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  211   DENVELEKSNILLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  270

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVADYNV AAQQGI+YIDEVDKITKKAES+NISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  271   LLTVADYNVVAAQQGIIYIDEVDKITKKAESMNISRDVSGEGVQQALLKMLEGTVVNVPE  330

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERR DSSIGFGAPVR NMR GGVTS
Sbjct  331   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRHDSSIGFGAPVRANMRMGGVTS  390

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A VTSSLLETVESSDLI+YGLIPEFVGRFP+LV+L+ALTE QLVQVLTEPKNALGKQY+K
Sbjct  391   AAVTSSLLETVESSDLIAYGLIPEFVGRFPVLVNLSALTEEQLVQVLTEPKNALGKQYRK  450

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEI  493
             MFQMN VKLHFTEDALR IARKAITKNTGARGLRS+LE++LMDAMYE+
Sbjct  451   MFQMNGVKLHFTEDALRLIARKAITKNTGARGLRSMLENVLMDAMYEM  498


 Score =   213 bits (542),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 147/199 (74%), Gaps = 9/199 (5%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRH------  1814
             MAA LRSKS R+  S   S  RYFI NH+ AGR+ +  W+S   + +Y +NS        
Sbjct  1     MAAVLRSKSSRDRTSVAISQFRYFIQNHLHAGRVNHFQWSSGFDNSSYRSNSSFISNPPF  60

Query  1813  SFSLFKPVSVRGEFVDRGYDNSRNLSSCGKIDISSSYGDPPEVWQPPG---DGIVVRPGV  1643
             + + FKP S RG+++D G +      +   I+ SSS GDPPEVWQPPG   DGI+VRPGV
Sbjct  61    NMTPFKPPSPRGDYIDSGKNFPNFFRNKRIIENSSSQGDPPEVWQPPGGGGDGIMVRPGV  120

Query  1642  KFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKV  1463
             KF+ VGE DG +SGSGGGFGSG KDG WGGSNLGP+FPTPKEICKGLDKFVIGQERAKKV
Sbjct  121   KFIHVGEGDGSNSGSGGGFGSGQKDGSWGGSNLGPDFPTPKEICKGLDKFVIGQERAKKV  180

Query  1462  LSVAVYNHYKRIYNDSAQK  1406
             LSVAVYNHYKRIY+DS+Q+
Sbjct  181   LSVAVYNHYKRIYSDSSQR  199



>ref|XP_004952735.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Setaria italica]
Length=647

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/336 (84%), Positives = 311/336 (93%), Gaps = 1/336 (0%)
 Frame = -2

Query  1368  EGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVES  1189
             E  + + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVES
Sbjct  285   EADDDDNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVES  344

Query  1188  ILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  1009
             ILYKLLTVAD+NVQAAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV
Sbjct  345   ILYKLLTVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  404

Query  1008  NVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTG  829
             NVPEKGARKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR  
Sbjct  405   NVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRGS  464

Query  828   GVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGK  649
             G++SA VTSSLLE+VES DLI+YGLIPEF+GRFPILVSL AL E+QLVQVL EPKNALGK
Sbjct  465   GISSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLAALNEDQLVQVLMEPKNALGK  524

Query  648   QYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdn  469
             Q+KK+F MNNVKLHFT+ ALR IA+KA++KNTGARGLR+ILE+ILMD+MYEIPD +SG+ 
Sbjct  525   QFKKLFSMNNVKLHFTDGALRIIAKKAMSKNTGARGLRTILENILMDSMYEIPDAKSGEK  584

Query  468   vidavivddeaVGH-EGRGCGAKILYGKGALDCYLS  364
              IDAV+VD++AVG  +  GCGAKILYG GALD YLS
Sbjct  585   RIDAVVVDEDAVGSVDQPGCGAKILYGDGALDQYLS  620


 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -1

Query  1552  SNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             S+LG + PTPKEICKGLDK+VIGQ+RAKKVLSVAVYNHYKRIY+ S QK
Sbjct  225   SSLGKDLPTPKEICKGLDKYVIGQDRAKKVLSVAVYNHYKRIYHQSLQK  273



>dbj|BAJ98835.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=637

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/366 (79%), Positives = 326/366 (89%), Gaps = 6/366 (2%)
 Frame = -2

Query  1368  EGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVES  1189
             E    + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVES
Sbjct  275   EADGEDNVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVES  334

Query  1188  ILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  1009
             ILYKLL+VAD+NVQAAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV
Sbjct  335   ILYKLLSVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  394

Query  1008  NVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTG  829
             NVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR +MRT 
Sbjct  395   NVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRASMRTS  454

Query  828   GVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGK  649
             G++SA VTSSLLE+VES DLI+YGLIPEF+GRFPILVSL+AL E+QLVQVLTEPKNALGK
Sbjct  455   GISSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLSALNEDQLVQVLTEPKNALGK  514

Query  648   QYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdn  469
             Q+KK+F MNNVKLHFT+ ALR IA+KA+ KNTGARGLR+ILE+ILMD+MYEIPD +SG+ 
Sbjct  515   QFKKLFSMNNVKLHFTDAALRIIAQKAMCKNTGARGLRTILENILMDSMYEIPDTKSGEK  574

Query  468   vidavivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDL  292
              IDAV+VD+ AVG  +  GCGAKILYG GA D YLS     + K + +G+ ++++ + DL
Sbjct  575   RIDAVVVDEGAVGLVDQPGCGAKILYGDGAFDRYLS-----QIKVMGDGAGSEVDGDPDL  629

Query  291   PSIVAL  274
              S  A+
Sbjct  630   SSSRAM  635


 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -1

Query  1552  SNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             SNLG +FPTPKEI KGLDK+VIGQ+RAKKVLSVAVYNHYKRIY+ S QK
Sbjct  215   SNLGKDFPTPKEISKGLDKYVIGQDRAKKVLSVAVYNHYKRIYHQSLQK  263



>emb|CAN75136.1| hypothetical protein VITISV_040753 [Vitis vinifera]
Length=600

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/436 (70%), Positives = 346/436 (79%), Gaps = 17/436 (4%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSD-----RNPEKNDSDK  1372
             F  P++  +GL    + ++  K+  S+ +Y    R    +L K D     R  E    DK
Sbjct  163   FPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKRIYHZSLQKCDPTWRIRPAEDTSDDK  222

Query  1371  VEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVI--------ADATT--LT  1222
              E T++++VELEKSNIL+MGPTGSG T     +   +   F           D T   L 
Sbjct  223   AEATDNDSVELEKSNILLMGPTGSGSTGSLSIIMLFLITWFTWYFHFFKDREDITCQNLG  282

Query  1221  QAGYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQ  1042
              AGYVGEDVESILYKLL VADYNV AAQQGIVYIDEVDKITKKAESLN+SRDVSGEGVQQ
Sbjct  283   TAGYVGEDVESILYKLLMVADYNVVAAQQGIVYIDEVDKITKKAESLNLSRDVSGEGVQQ  342

Query  1041  ALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGF  862
             ALLKMLEGT+VNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGF
Sbjct  343   ALLKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGF  402

Query  861   GAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQ  682
             GAPVR NMRTGG T A V SSLLETVESSDLISYGLIPEFVGRFPILVSL+ALTENQLV+
Sbjct  403   GAPVRANMRTGGPTXAAVASSLLETVESSDLISYGLIPEFVGRFPILVSLSALTENQLVE  462

Query  681   VLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAM  502
             VLTEPKNALGKQYKKMFQMN VKLHFT++ALR I+RKA +KNTGARGLRS LE+ILM+AM
Sbjct  463   VLTEPKNALGKQYKKMFQMNGVKLHFTKNALRLISRKAXSKNTGARGLRSXLENILMBAM  522

Query  501   YEIPDVRSGdnvidavivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEG-  325
             YEIPDVR+G+++IDAV+VDDEAVG +G G GAKILYGKGALDCYLS ++ KE +  +EG 
Sbjct  523   YEIPDVRTGNDIIDAVVVDDEAVGSDGHGFGAKILYGKGALDCYLSQHKLKETETPMEGS  582

Query  324   SEADIEVERDLPSIVA  277
             S+ + E E ++PSIVA
Sbjct  583   SDGEAEAEAEIPSIVA  598


 Score =   195 bits (496),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 142/207 (69%), Gaps = 19/207 (9%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSR--HSFSL  1802
             MAAALRSKS RETA  T S  RYFILNHM AGRL N   + +    + FT+S   + F+ 
Sbjct  1     MAAALRSKSSRETALLTFSQFRYFILNHMHAGRLPNSYISHKPNCDHCFTHSHTPYHFTS  60

Query  1801  FKPVSVRGEFVDRG---YDNSR--------NLSSCGKID-ISSSYGDPPEVWQPPGDGIV  1658
             FKPVS+RGE VD+G   +DN R        N S     D I +S+GDPPEVW   GDGIV
Sbjct  61    FKPVSLRGELVDKGLEFFDNQRFSKVGFSTNESKKLSXDTILNSFGDPPEVWS--GDGIV  118

Query  1657  VR---PGVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVI  1487
             VR    G   V+ G   G + G+G GFGS +KD  WGGSNLG NFPTPKEIC+GLDKFVI
Sbjct  119   VRQGGSGSNLVRGGGGAGANGGAGSGFGSNSKDESWGGSNLGHNFPTPKEICRGLDKFVI  178

Query  1486  GQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             GQERAKKVLSVAVYNHYKRIY++S QK
Sbjct  179   GQERAKKVLSVAVYNHYKRIYHZSLQK  205



>gb|AFW71882.1| hypothetical protein ZEAMMB73_870207 [Zea mays]
Length=642

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/336 (85%), Positives = 310/336 (92%), Gaps = 1/336 (0%)
 Frame = -2

Query  1368  EGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVES  1189
             E  +   VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVES
Sbjct  280   EADDDNNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVES  339

Query  1188  ILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  1009
             ILYKLLTVAD+NVQAAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV
Sbjct  340   ILYKLLTVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  399

Query  1008  NVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTG  829
             NVPEKGARKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR G
Sbjct  400   NVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRVG  459

Query  828   GVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGK  649
             G +SA VTSSLLE+VES DLI+YGLIPEF+GRFPILVSLTAL E+QLVQVLTEPKNALGK
Sbjct  460   GTSSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLTALNEDQLVQVLTEPKNALGK  519

Query  648   QYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdn  469
             Q+KK+F MN+VKLHFT+ ALR IA KA++KNTGARGLR+ILE+ILMD+MYEIPD +SG+ 
Sbjct  520   QFKKLFSMNDVKLHFTDGALRIIAEKAMSKNTGARGLRTILENILMDSMYEIPDAKSGEK  579

Query  468   vidavivddeaVGH-EGRGCGAKILYGKGALDCYLS  364
              IDAV+VD++AVG  +  G GAKILYG GALD YLS
Sbjct  580   RIDAVVVDEDAVGSVDQPGYGAKILYGDGALDQYLS  615


 Score = 97.1 bits (240),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGGSNLG + PTPKEICKGLDK+VIGQ+RAKKVLSVAVYNHYKRIY+ S QK
Sbjct  217   WGGSNLGRDLPTPKEICKGLDKYVIGQDRAKKVLSVAVYNHYKRIYHQSLQK  268



>gb|EEE57209.1| hypothetical protein OsJ_07170 [Oryza sativa Japonica Group]
Length=583

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/371 (78%), Positives = 319/371 (86%), Gaps = 18/371 (5%)
 Frame = -2

Query  1368  EGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQA---------  1216
             E  + + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQA         
Sbjct  207   EADDDDGVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAIPKVKLNSC  266

Query  1215  -----GYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEG  1051
                  GYVGEDVESILYKLL VAD+NVQAAQQG+VYIDEVDKITKKAESLNISRDVSGEG
Sbjct  267   AFLQAGYVGEDVESILYKLLAVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEG  326

Query  1050  VQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSS  871
             VQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSS
Sbjct  327   VQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSS  386

Query  870   IGFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQ  691
             IGFGAPVR NMR GG++SA VTSSLLE+VES DLI+YGLIPEF+GRFPILVSL AL E+Q
Sbjct  387   IGFGAPVRANMRAGGISSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLAALNEDQ  446

Query  690   LVQVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILM  511
             LVQVL EPKNALGKQ+KK+F MNNVKLHFT+ ALR IA+KA++KNTGARGLR+ILE+ILM
Sbjct  447   LVQVLMEPKNALGKQFKKLFSMNNVKLHFTDAALRIIAKKAMSKNTGARGLRTILENILM  506

Query  510   DAMYEIPDVRSGdnvidavivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKI  334
             DAMYEIPD +SG+  IDAV+VD++AVG  +  GCGAKILYG GA + YLS   Q +    
Sbjct  507   DAMYEIPDAKSGEKRIDAVVVDEDAVGAVDQPGCGAKILYGDGAFERYLS---QIKVAGD  563

Query  333   VEGSEADIEVE  301
               GSEAD E E
Sbjct  564   AAGSEADGEAE  574


 Score = 97.8 bits (242),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  1573  KDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             KDG WGGSNLG + PTPKEIC+GLDK+VIGQ+RAKKVLSVAVYNHYKRIY+ S QK
Sbjct  141   KDG-WGGSNLGKDLPTPKEICQGLDKYVIGQDRAKKVLSVAVYNHYKRIYHKSLQK  195



>ref|XP_010252309.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Nelumbo nucifera]
Length=678

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/423 (71%), Positives = 353/423 (83%), Gaps = 10/423 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLK-SDRNPEKNDSDKVEGT  1360
             F  P++  K L    + ++  K+  S+ +Y    R    +L K S   P  ++++     
Sbjct  261   FPTPKEICKNLDKFVIGQQRAKKVLSVAVYNHYKRIYHASLQKGSGAEPGNSEAE----N  316

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + ++VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  317   DDDSVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILY  376

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVA++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP
Sbjct  377   KLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  436

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMRTGG+T
Sbjct  437   EKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRTGGLT  496

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             +A VTSSLLE+VES+DLI+YGLIPEF+GRFPILVSL+AL E QLVQVL EPKNALGKQYK
Sbjct  497   NAAVTSSLLESVESADLIAYGLIPEFIGRFPILVSLSALNEGQLVQVLKEPKNALGKQYK  556

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             KMF MNNVKLHFT++ALR IA+KA+ K+TGARGLR+ILESIL +AMYEIPDV++G++ +D
Sbjct  557   KMFSMNNVKLHFTDNALRLIAKKAMAKSTGARGLRAILESILTEAMYEIPDVKTGNDRVD  616

Query  459   avivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSI  283
             AV++D+EAVG  +  G GAKIL G GAL+ YLS  + +   ++ EG   +IE E ++ S 
Sbjct  617   AVVIDEEAVGSVDAPGLGAKILRGDGALERYLSETKSEGNGEVAEG---EIEGESEVSSS  673

Query  282   VAL  274
              A+
Sbjct  674   RAM  676


 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 68/122 (56%), Gaps = 20/122 (16%)
 Frame = -1

Query  1717  ISSSYGDPPE-----------------VWQPPGDGIVVRPGVKFVQVGEVDgpssgsggg  1589
             + S  GDPPE                 V  PPG      PGV  ++     G      G 
Sbjct  184   LRSFSGDPPENWPPPPAPPPGNGNGLAVHTPPGPPFA--PGVNVIRASGPGGSGGSGNGS  241

Query  1588  fgsGAKD-GCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSA  1412
              G    +   WGGSNLG +FPTPKEICK LDKFVIGQ+RAKKVLSVAVYNHYKRIY+ S 
Sbjct  242   GGGSFGEKNGWGGSNLGKDFPTPKEICKNLDKFVIGQQRAKKVLSVAVYNHYKRIYHASL  301

Query  1411  QK  1406
             QK
Sbjct  302   QK  303



>ref|XP_008681399.1| PREDICTED: uncharacterized protein LOC100272848 isoform X2 [Zea 
mays]
Length=671

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/336 (85%), Positives = 310/336 (92%), Gaps = 1/336 (0%)
 Frame = -2

Query  1368  EGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVES  1189
             E  +   VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVES
Sbjct  309   EADDDNNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVES  368

Query  1188  ILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  1009
             ILYKLLTVAD+NVQAAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV
Sbjct  369   ILYKLLTVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  428

Query  1008  NVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTG  829
             NVPEKGARKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR G
Sbjct  429   NVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRVG  488

Query  828   GVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGK  649
             G +SA VTSSLLE+VES DLI+YGLIPEF+GRFPILVSLTAL E+QLVQVLTEPKNALGK
Sbjct  489   GTSSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLTALNEDQLVQVLTEPKNALGK  548

Query  648   QYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdn  469
             Q+KK+F MN+VKLHFT+ ALR IA KA++KNTGARGLR+ILE+ILMD+MYEIPD +SG+ 
Sbjct  549   QFKKLFSMNDVKLHFTDGALRIIAEKAMSKNTGARGLRTILENILMDSMYEIPDAKSGEK  608

Query  468   vidavivddeaVGH-EGRGCGAKILYGKGALDCYLS  364
              IDAV+VD++AVG  +  G GAKILYG GALD YLS
Sbjct  609   RIDAVVVDEDAVGSVDQPGYGAKILYGDGALDQYLS  644


 Score = 97.4 bits (241),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGGSNLG + PTPKEICKGLDK+VIGQ+RAKKVLSVAVYNHYKRIY+ S QK
Sbjct  246   WGGSNLGRDLPTPKEICKGLDKYVIGQDRAKKVLSVAVYNHYKRIYHQSLQK  297



>ref|XP_003556404.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Glycine max]
Length=513

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/332 (83%), Positives = 309/332 (93%), Gaps = 1/332 (0%)
 Frame = -2

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLL 
Sbjct  155   VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLA  214

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              A++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE+GA
Sbjct  215   AAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTMVNVPERGA  274

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPRGDNIQIDTK+ILFICGGAFIDLEKTISERRQDSSIGFG+PVR+NMRTGGVT+A V
Sbjct  275   RKHPRGDNIQIDTKNILFICGGAFIDLEKTISERRQDSSIGFGSPVRSNMRTGGVTNAAV  334

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VES+DLI+YGLIPEF+GRFPIL+SL+ALTE+QL+QVLTEPKNAL KQYKK+F 
Sbjct  335   TSSLLESVESADLIAYGLIPEFIGRFPILISLSALTEDQLMQVLTEPKNALAKQYKKLFN  394

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             MNNVKLHFTE ALR IA+KA+ KNTGARGLR++LESIL +AM+EIPDV++G+ +I AV+V
Sbjct  395   MNNVKLHFTEKALRLIAKKAMAKNTGARGLRALLESILTEAMFEIPDVKAGNELIGAVVV  454

Query  447   ddeaVGH-EGRGCGAKILYGKGALDCYLSGNE  355
             D+E+VG     GCG KIL G GAL+ YL+  E
Sbjct  455   DEESVGSVNAPGCGGKILCGDGALELYLAKME  486


 Score = 94.7 bits (234),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -1

Query  1573  KDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDS  1415
             +DG  GGSNLG +FPTPKEICKGLDKFVIGQ RAKKVLSVAVYNHY+RIY  S
Sbjct  87    RDGWVGGSNLGRDFPTPKEICKGLDKFVIGQHRAKKVLSVAVYNHYQRIYQGS  139



>gb|AFW71881.1| hypothetical protein ZEAMMB73_870207 [Zea mays]
Length=643

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/336 (85%), Positives = 310/336 (92%), Gaps = 1/336 (0%)
 Frame = -2

Query  1368  EGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVES  1189
             E  +   VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVES
Sbjct  281   EADDDNNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVES  340

Query  1188  ILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  1009
             ILYKLLTVAD+NVQAAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV
Sbjct  341   ILYKLLTVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  400

Query  1008  NVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTG  829
             NVPEKGARKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR G
Sbjct  401   NVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRVG  460

Query  828   GVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGK  649
             G +SA VTSSLLE+VES DLI+YGLIPEF+GRFPILVSLTAL E+QLVQVLTEPKNALGK
Sbjct  461   GTSSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLTALNEDQLVQVLTEPKNALGK  520

Query  648   QYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdn  469
             Q+KK+F MN+VKLHFT+ ALR IA KA++KNTGARGLR+ILE+ILMD+MYEIPD +SG+ 
Sbjct  521   QFKKLFSMNDVKLHFTDGALRIIAEKAMSKNTGARGLRTILENILMDSMYEIPDAKSGEK  580

Query  468   vidavivddeaVGH-EGRGCGAKILYGKGALDCYLS  364
              IDAV+VD++AVG  +  G GAKILYG GALD YLS
Sbjct  581   RIDAVVVDEDAVGSVDQPGYGAKILYGDGALDQYLS  616



>emb|CDP05061.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/318 (86%), Positives = 297/318 (93%), Gaps = 0/318 (0%)
 Frame = -2

Query  1227  LTQAGYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGV  1048
             L QAGYVGEDVESILYKLLTVADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGV
Sbjct  3     LLQAGYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGV  62

Query  1047  QQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSI  868
             QQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAF+DL+KTISERRQDSSI
Sbjct  63    QQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLDKTISERRQDSSI  122

Query  867   GFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQL  688
             GFGAPVR NMRTGGVT+A VTSSLLETVESSDLI+YGLIPEFVGRFPILVSL+ALTENQL
Sbjct  123   GFGAPVRANMRTGGVTTAAVTSSLLETVESSDLIAYGLIPEFVGRFPILVSLSALTENQL  182

Query  687   VQVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMD  508
             VQVLTEP+NALGKQYKKMFQMN VKLHFTE ALR IARKAITKNTGARGLRS+LESILMD
Sbjct  183   VQVLTEPRNALGKQYKKMFQMNGVKLHFTEVALRLIARKAITKNTGARGLRSLLESILMD  242

Query  507   AMYEIPDVRSGdnvidavivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVE  328
             +MYEIPDVR+G+ +IDAV+V+ E+VGHEGRG GAKILYGKGALD Y+S  + K+ +   E
Sbjct  243   SMYEIPDVRTGNEIIDAVVVNGESVGHEGRGSGAKILYGKGALDRYISQLKFKDRETTAE  302

Query  327   GSEADIEVERDLPSIVAL  274
             GS+ + EVE++LPSI AL
Sbjct  303   GSDGEPEVEQELPSIAAL  320



>ref|NP_001140773.1| uncharacterized protein LOC100272848 [Zea mays]
 gb|ACF84596.1| unknown [Zea mays]
Length=346

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/319 (86%), Positives = 298/319 (93%), Gaps = 1/319 (0%)
 Frame = -2

Query  1317  MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLTVADYNVQAAQ  1138
             MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLLTVAD+NVQAAQ
Sbjct  1     MGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLTVADFNVQAAQ  60

Query  1137  QGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQ  958
             QG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQ
Sbjct  61    QGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQ  120

Query  957   IDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVES  778
             IDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR GG +SA VTSSLLE+VES
Sbjct  121   IDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRVGGTSSAQVTSSLLESVES  180

Query  777   SDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTE  598
              DLI+YGLIPEF+GRFPILVSLTAL E+QLVQVLTEPKNALGKQ+KK+F MN+VKLHFT+
Sbjct  181   GDLIAYGLIPEFIGRFPILVSLTALNEDQLVQVLTEPKNALGKQFKKLFSMNDVKLHFTD  240

Query  597   DALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidavivddeaVGH-EG  421
              ALR IA KA++KNTGARGLR+ILE+ILMD+MYEIPD +SG+  IDAV+VD++AVG  + 
Sbjct  241   GALRIIAEKAMSKNTGARGLRTILENILMDSMYEIPDAKSGEKRIDAVVVDEDAVGSVDQ  300

Query  420   RGCGAKILYGKGALDCYLS  364
              G GAKILYG GALD YLS
Sbjct  301   PGYGAKILYGDGALDQYLS  319



>ref|XP_008681398.1| PREDICTED: uncharacterized protein LOC100272848 isoform X1 [Zea 
mays]
Length=672

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/336 (85%), Positives = 310/336 (92%), Gaps = 1/336 (0%)
 Frame = -2

Query  1368  EGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVES  1189
             E  +   VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVES
Sbjct  310   EADDDNNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVES  369

Query  1188  ILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  1009
             ILYKLLTVAD+NVQAAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV
Sbjct  370   ILYKLLTVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  429

Query  1008  NVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTG  829
             NVPEKGARKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR G
Sbjct  430   NVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRVG  489

Query  828   GVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGK  649
             G +SA VTSSLLE+VES DLI+YGLIPEF+GRFPILVSLTAL E+QLVQVLTEPKNALGK
Sbjct  490   GTSSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLTALNEDQLVQVLTEPKNALGK  549

Query  648   QYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdn  469
             Q+KK+F MN+VKLHFT+ ALR IA KA++KNTGARGLR+ILE+ILMD+MYEIPD +SG+ 
Sbjct  550   QFKKLFSMNDVKLHFTDGALRIIAEKAMSKNTGARGLRTILENILMDSMYEIPDAKSGEK  609

Query  468   vidavivddeaVGH-EGRGCGAKILYGKGALDCYLS  364
              IDAV+VD++AVG  +  G GAKILYG GALD YLS
Sbjct  610   RIDAVVVDEDAVGSVDQPGYGAKILYGDGALDQYLS  645



>emb|CBI16961.3| unnamed protein product [Vitis vinifera]
Length=562

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/349 (82%), Positives = 323/349 (93%), Gaps = 3/349 (1%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + ++VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  197   DDDSVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILY  256

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVA++NVQAAQQG+VYIDEVDKITKKAESLN+SRDVSGEGVQQALLKMLEGTIVNVP
Sbjct  257   KLLTVAEFNVQAAQQGMVYIDEVDKITKKAESLNLSRDVSGEGVQQALLKMLEGTIVNVP  316

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARKHPRGDNIQIDTKDILFICGGAF+DLEKTIS+RRQDSSIGFGAPVR NMRTGG+T
Sbjct  317   EKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISDRRQDSSIGFGAPVRANMRTGGLT  376

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             +AVVTSSLLE+VESSDLI+YGLIPEF+GRFPILVSL+ALTE+QLV+VLTEPKNALGKQYK
Sbjct  377   NAVVTSSLLESVESSDLIAYGLIPEFIGRFPILVSLSALTEDQLVKVLTEPKNALGKQYK  436

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE ALR IA+KA+ KNTGARGLR++LESIL +AMYEIPDV++G + +D
Sbjct  437   KLFSMNNVKLHFTEKALRQIAKKAMVKNTGARGLRALLESILTEAMYEIPDVKTGKDRVD  496

Query  459   avivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEA  316
             AV+VD+E+VG     GCG KIL G GALDCYL+  + K+P  +  G EA
Sbjct  497   AVVVDEESVGSVNAPGCGGKILRGDGALDCYLAETKLKDP--VESGGEA  543


 Score = 88.2 bits (217),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 52/77 (68%), Gaps = 21/77 (27%)
 Frame = -1

Query  1576  AKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKK--------------------VLS  1457
             A++G WGGSNLG + PTPKEICKGLDKFVIGQERAKK                    VLS
Sbjct  110   ARNG-WGGSNLGKDLPTPKEICKGLDKFVIGQERAKKLDFIPFSDFLVRSNWCQTWEVLS  168

Query  1456  VAVYNHYKRIYNDSAQK  1406
             VAVYNHYKRIY+ S QK
Sbjct  169   VAVYNHYKRIYHGSLQK  185



>ref|XP_010930370.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent Clp protease ATP-binding 
subunit clpX-like, mitochondrial [Elaeis guineensis]
Length=664

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/364 (81%), Positives = 332/364 (91%), Gaps = 1/364 (0%)
 Frame = -2

Query  1374  KVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDV  1195
             + E  + + VEL+KSN+L+MGPTGSGKTLLAKTLAR V+VPFVIADATTLTQAGYVGEDV
Sbjct  296   EAENDDDDNVELDKSNVLLMGPTGSGKTLLAKTLARFVHVPFVIADATTLTQAGYVGEDV  355

Query  1194  ESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT  1015
             ESILYKLLTVAD+NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT
Sbjct  356   ESILYKLLTVADFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT  415

Query  1014  IVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMR  835
             IVNVPEKGARKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR
Sbjct  416   IVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMR  475

Query  834   TGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNAL  655
             TGG+T+AVVTSSLLE+VESSDLI+YGLIPEF+GRFP+LVSL AL E+QLVQVL EPKNAL
Sbjct  476   TGGLTNAVVTSSLLESVESSDLIAYGLIPEFIGRFPVLVSLLALNEDQLVQVLMEPKNAL  535

Query  654   GKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSG  475
             GKQ+KK+F MNNVKLHFT+ ALR IA+KA++KNTGARGLR+ILE+IL DAMYEIPDV++ 
Sbjct  536   GKQFKKLFSMNNVKLHFTDPALRLIAKKAMSKNTGARGLRAILENILTDAMYEIPDVKTS  595

Query  474   dnvidavivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVER  298
             D  IDAV+VD+EAVG   R GCGAKIL G+GAL+ YL  N+ K+ + IV+GSE D+E E 
Sbjct  596   DGQIDAVVVDEEAVGSIDRSGCGAKILCGEGALERYLKENKTKDREAIVDGSEGDLEGES  655

Query  297   DLPS  286
             +L S
Sbjct  656   ELSS  659


 Score = 97.8 bits (242),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 92/169 (54%), Gaps = 35/169 (21%)
 Frame = -1

Query  1810  FSLFKPVSVRGEFVD----RGYDNSRN-LSSCGK-------------IDISSSYG-DPPE  1688
             F   K V ++G FV+    RG D  R  LS  G+               + SSYG +PPE
Sbjct  119   FRPHKLVPLQGTFVEIGRVRGPDPERERLSGTGEDGEQGNRLKTSFWEALRSSYGGEPPE  178

Query  1687  VWQP-----PGDGIVVRP----------GVKFVQVGEVDgpssgsgggfgsGAKDGCWGG  1553
              W P      G+G+ V             V  V      G    +GGG G   K+G WGG
Sbjct  179   NWPPMPGLPEGNGLAVHTPPGPPFPPNLNVVRVAGPGGGGGGGETGGGAGFRGKEG-WGG  237

Query  1552  SNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             SNLG + PTPKEICKGLDK+VIGQ+RAKKVLSVAVYNHYKRIY+ S QK
Sbjct  238   SNLGKDLPTPKEICKGLDKYVIGQDRAKKVLSVAVYNHYKRIYHASLQK  286



>ref|XP_008783202.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Phoenix dactylifera]
Length=350

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/348 (79%), Positives = 306/348 (88%), Gaps = 1/348 (0%)
 Frame = -2

Query  1317  MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLTVADYNVQAAQ  1138
             MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLL  AD+NV AAQ
Sbjct  1     MGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLVAADFNVAAAQ  60

Query  1137  QGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQ  958
             QGIVYIDEVDKITK+AESLNISRDVSGEGVQQALLKMLEGT+VNVPEKGARKHPRGDNIQ
Sbjct  61    QGIVYIDEVDKITKRAESLNISRDVSGEGVQQALLKMLEGTVVNVPEKGARKHPRGDNIQ  120

Query  957   IDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVES  778
             IDTKDILFICGGAFIDLEKTISERR DSSIGF AP+R NMRTG VT+A V SSLLE+VES
Sbjct  121   IDTKDILFICGGAFIDLEKTISERRHDSSIGFRAPIRANMRTGSVTNAAVASSLLESVES  180

Query  777   SDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTE  598
              DLI+YGLIPEFVGRFPILVSL+AL E+QLV+VL++PKNA+GKQY K+FQMN+VKLHFTE
Sbjct  181   GDLIAYGLIPEFVGRFPILVSLSALNEDQLVEVLSKPKNAIGKQYIKLFQMNDVKLHFTE  240

Query  597   DALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidavivddeaVGH-EG  421
              ALR IA+KA+ KNTGARGLRSILE+IL +AMYEIPD R+G   IDAV+VD+E+VG  + 
Sbjct  241   KALRLIAKKAMQKNTGARGLRSILENILTEAMYEIPDTRTGKEKIDAVVVDEESVGSVDS  300

Query  420   RGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
              GCGAKIL G+GAL+ Y S    KE +   E SE + E + +LPS VA
Sbjct  301   HGCGAKILCGEGALEHYFSQQNLKEAETTFERSEGEPEADLELPSRVA  348



>ref|XP_002519956.1| ATP-dependent clp protease ATP-binding subunit clpx, putative 
[Ricinus communis]
 gb|EEF42560.1| ATP-dependent clp protease ATP-binding subunit clpx, putative 
[Ricinus communis]
Length=698

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/370 (78%), Positives = 324/370 (88%), Gaps = 3/370 (1%)
 Frame = -2

Query  1413  LKSDRNPEKNDSDKVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADA  1234
             LK     E   SD V+  + + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADA
Sbjct  318   LKKGPGEESGSSDAVD--DDDNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADA  375

Query  1233  TTLTQAGYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGE  1054
             T LTQAGYVGEDVESILYKLL+VA++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGE
Sbjct  376   TALTQAGYVGEDVESILYKLLSVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGE  435

Query  1053  GVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDS  874
             GVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDS
Sbjct  436   GVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDS  495

Query  873   SIGFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTEN  694
             SIGFGAPVR NMR GGVT+A VTSSLLE+VES+DLI+YGLIPEF+GRFPILVSL+ALTE+
Sbjct  496   SIGFGAPVRANMRAGGVTNAAVTSSLLESVESADLIAYGLIPEFIGRFPILVSLSALTED  555

Query  693   QLVQVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESIL  514
             QLV+VLTEPKNALGKQYKK+F MN VKLHFTE ALR IA+KA+ KNTGARGLR+ILES L
Sbjct  556   QLVRVLTEPKNALGKQYKKLFSMNKVKLHFTEKALRLIAKKAMAKNTGARGLRAILESTL  615

Query  513   MDAMYEIPDVRSGdnvidavivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKK  337
              +AMYEIPDV++G + +DAVIVD+E++G     G G KIL G GAL+ YL+  + KE  +
Sbjct  616   TEAMYEIPDVKTGSDRVDAVIVDEESIGSVNASGHGGKILRGDGALESYLAEYKLKESAE  675

Query  336   IVEGSEADIE  307
              VE  + +++
Sbjct  676   NVEAGDTELQ  685


 Score = 77.0 bits (188),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 101/196 (52%), Gaps = 33/196 (17%)
 Frame = -1

Query  1927  TASHLRYFILNHMQA-----GRLGNLGWNSRIKSKNYFTNSRHSFSLFKPVSVRGEFVDR  1763
             TA + R + +  +Q      GR+GN   N++ +++      +H  +         E ++ 
Sbjct  136   TAYYFRPYKITPLQGSFIEIGRVGNNSPNNKSRNRIGSLTKQHPST---------EDLEE  186

Query  1762  GYDN---SRNLSSCGKIDISSSYGDPPE-------------VWQPPGDGIVVRPGVKFVQ  1631
             G+D+   S  L +     + S  GDPPE             V  PPG      PGV  ++
Sbjct  187   GFDSNAISGRLRASFWNTLRSYAGDPPENWPPPPLNGNGLAVHTPPGPPFA--PGVNVIR  244

Query  1630  VG-EVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSV  1454
                   G     GG    G   G WGGSNLG + PTPKEIC+GLDKFVIGQ+RAKKVLSV
Sbjct  245   ANGPGGGGGGEGGGEKSGGGGGGGWGGSNLGKDLPTPKEICRGLDKFVIGQDRAKKVLSV  304

Query  1453  AVYNHYKRIYNDSAQK  1406
             AVYNHYKRIY+ S +K
Sbjct  305   AVYNHYKRIYHASLKK  320



>gb|KHN05027.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Glycine 
soja]
Length=517

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/336 (82%), Positives = 309/336 (92%), Gaps = 5/336 (1%)
 Frame = -2

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQA----GYVGEDVESILY  1180
             VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQA    GYVGEDVESILY
Sbjct  155   VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQASMYAGYVGEDVESILY  214

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL  A++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVP
Sbjct  215   KLLAAAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTMVNVP  274

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             E+GARKHPRGDNIQIDTK+ILFICGGAFIDLEKTISERRQDSSIGFG+PVR+NMRTGGVT
Sbjct  275   ERGARKHPRGDNIQIDTKNILFICGGAFIDLEKTISERRQDSSIGFGSPVRSNMRTGGVT  334

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             +A VTSSLLE+VES+DLI+YGLIPEF+GRFPIL+SL+ALTE+QL+QVLTEPKNAL KQYK
Sbjct  335   NAAVTSSLLESVESADLIAYGLIPEFIGRFPILISLSALTEDQLMQVLTEPKNALAKQYK  394

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE ALR IA+KA+ KNTGARGLR++LESIL +AM+EIPDV++G+ +I 
Sbjct  395   KLFNMNNVKLHFTEKALRLIAKKAMAKNTGARGLRALLESILTEAMFEIPDVKAGNELIG  454

Query  459   avivddeaVGH-EGRGCGAKILYGKGALDCYLSGNE  355
             AV+VD+E+VG     GCG KIL G GAL+ YL+  E
Sbjct  455   AVVVDEESVGSVNAPGCGGKILCGDGALELYLAKME  490


 Score = 94.7 bits (234),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -1

Query  1573  KDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDS  1415
             +DG  GGSNLG +FPTPKEICKGLDKFVIGQ RAKKVLSVAVYNHY+RIY  S
Sbjct  87    RDGWVGGSNLGRDFPTPKEICKGLDKFVIGQHRAKKVLSVAVYNHYQRIYQGS  139



>emb|CBI29632.3| unnamed protein product [Vitis vinifera]
Length=545

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/396 (71%), Positives = 337/396 (85%), Gaps = 4/396 (1%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL    + +++ K+  S+ +Y    R    +L K   +  ++   +++  ++++
Sbjct  128   PKEICKGLDEFVIGQEQAKKVLSVAVYNHYKRIHHASLQKE--SGAESTKAEIDNDDNDS  185

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L++GPTGSGKTLLAKTLAR+VNVPFVIADATTLTQA YVGEDVESIL+KLL 
Sbjct  186   VELEKSNVLLLGPTGSGKTLLAKTLARVVNVPFVIADATTLTQASYVGEDVESILHKLLM  245

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
             VA++NV+AAQQGIVYIDEVDKITKKAESLN  RDVSGEGVQQALLKMLEGTIVNVP+KG 
Sbjct  246   VAEFNVEAAQQGIVYIDEVDKITKKAESLNTGRDVSGEGVQQALLKMLEGTIVNVPDKGG  305

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMRTGG+T AVV
Sbjct  306   RKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRTGGLTDAVV  365

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VES DLI+YGLIPEF+GRFPILVSL+AL E+QLVQVLTEPKNALGKQYKKM  
Sbjct  366   TSSLLESVESGDLIAYGLIPEFIGRFPILVSLSALNEDQLVQVLTEPKNALGKQYKKMLS  425

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             MNNVKLHFTE+ALR IA+KAI KNTGAR LR+ILE IL +AM+EIPDV++G +++DAV+V
Sbjct  426   MNNVKLHFTENALRLIAKKAIAKNTGARSLRAILEKILTEAMFEIPDVKTGTDMVDAVLV  485

Query  447   ddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEP  343
             D+EAV   E +GCGAK+L G+GAL+ +L   +   P
Sbjct  486   DEEAVESIEEQGCGAKVLRGEGALEQFLHETKSSNP  521


 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  1537  NFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
               PTPKEICKGLD+FVIGQE+AKKVLSVAVYNHYKRI++ S QK
Sbjct  124   ELPTPKEICKGLDEFVIGQEQAKKVLSVAVYNHYKRIHHASLQK  167



>gb|KCW46559.1| hypothetical protein EUGRSUZ_K00383 [Eucalyptus grandis]
Length=561

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/388 (77%), Positives = 335/388 (86%), Gaps = 6/388 (2%)
 Frame = -2

Query  1545  WVQIFRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSD-K  1372
             W   F  P++  KGL    + ++  K+  S+ +Y    R       +S + P  +  D +
Sbjct  172   WGSNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKR----IYHESVKRPSGDSEDAR  227

Query  1371  VEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVE  1192
              E  + + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVE
Sbjct  228   PESADDDLVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVE  287

Query  1191  SILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTI  1012
             SIL+KLLT ADYNV AAQQGIVYIDEVDKITKKAES+NISRDVSGEGVQQALLKMLEGT+
Sbjct  288   SILHKLLTAADYNVAAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQALLKMLEGTV  347

Query  1011  VNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRT  832
             VNVPEKGARKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR 
Sbjct  348   VNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRA  407

Query  831   GGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALG  652
               VT+AVV SSLLE+VESSDLISYGLIPEFVGRFPILVSL+AL+E+QLV+VLTEPKNALG
Sbjct  408   SNVTNAVVASSLLESVESSDLISYGLIPEFVGRFPILVSLSALSEDQLVEVLTEPKNALG  467

Query  651   KQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGd  472
             KQY+KMFQMN VKLH+T++ALR IARKAI KNTGARGLRSILE+ILM+AMYEIPDVR+G+
Sbjct  468   KQYRKMFQMNGVKLHYTDNALRLIARKAIAKNTGARGLRSILENILMEAMYEIPDVRTGE  527

Query  471   nvidavivddeaVGHEGRGCGAKILYGK  388
             ++IDAV+VD+EAVG EGRG GAKILYGK
Sbjct  528   DIIDAVVVDEEAVGIEGRGHGAKILYGK  555


 Score =   169 bits (428),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 125/225 (56%), Gaps = 42/225 (19%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILN-HMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLF  1799
             MAA L+ K  RETA+  AS  R F+ N  M AGR+ N    S      +F N+ + F+ F
Sbjct  1     MAAVLKCKPSRETAAFAASQFRCFMFNNQMHAGRVPNSHRASHSNWDRFFANTPYLFTSF  60

Query  1798  KPVSVRGEFVDRG----------------------------------YDNSRNLSSCGKI  1721
             KPV++RG+FV++G                                  YD  R  S   K 
Sbjct  61    KPVTLRGDFVEQGTQFLSDRRVNSIVGTKKGAVTCDEREELGNFRGDYDGGRRWSE--KF  118

Query  1720  DISSSYGDPPEVWQPPGDGIVVRPGVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLG  1541
             +++SS GDPPEVWQPPG G+ VR G     V        G  G      KD  WGGSN G
Sbjct  119   NMASSNGDPPEVWQPPGGGVTVRLGNSGYVV-----TRGGGSGSESDSPKDESWGGSNWG  173

Query  1540  PNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              NFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIY++S ++
Sbjct  174   SNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYHESVKR  218



>ref|XP_007143921.1| hypothetical protein PHAVU_007G113600g [Phaseolus vulgaris]
 gb|ESW15915.1| hypothetical protein PHAVU_007G113600g [Phaseolus vulgaris]
Length=505

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/336 (82%), Positives = 308/336 (92%), Gaps = 1/336 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  143   DDDNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILY  202

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL  A++NVQAA+QGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP
Sbjct  203   KLLAAAEFNVQAAKQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  262

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARKHPRGDNIQIDTK+ILFICGGAF+DLEKTISERRQDSSIGFGAP+R NMRT GVT
Sbjct  263   EKGARKHPRGDNIQIDTKNILFICGGAFVDLEKTISERRQDSSIGFGAPIRANMRTSGVT  322

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
              A VTS+LLE+VES+DLI+YGLIPEF+GRFPIL+SL+ALTE+QL+QVLTEPKNAL KQYK
Sbjct  323   YAAVTSTLLESVESADLIAYGLIPEFIGRFPILISLSALTEDQLMQVLTEPKNALAKQYK  382

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE ALR IA+KA+ KNTGARGLR++LE IL +AM+EIPDV++G+ +ID
Sbjct  383   KLFDMNNVKLHFTEKALRLIAKKAMGKNTGARGLRALLEIILTEAMFEIPDVKAGNELID  442

Query  459   avivddeaVGH-EGRGCGAKILYGKGALDCYLSGNE  355
             AV+VD+E+VG     GCG KIL G GALD YL+  E
Sbjct  443   AVVVDEESVGSVNSPGCGGKILCGDGALDLYLAKME  478


 Score = 95.1 bits (235),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 62/104 (60%), Gaps = 16/104 (15%)
 Frame = -1

Query  1711  SSYGDPPEVWQPPGDGIVVRP---GVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLG  1541
             SS G+PP+ W  P D  V       V FV+                     G  GGSNLG
Sbjct  43    SSNGEPPQDW--PQDAAVPSQTPFSVNFVRASS-----------GPRQENTGWLGGSNLG  89

Query  1540  PNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQ  1409
              +FPTPKEICKGLDKFVIGQ RAKKVLSVAVYNHYKRI+N S +
Sbjct  90    RDFPTPKEICKGLDKFVIGQHRAKKVLSVAVYNHYKRIFNGSGE  133



>ref|XP_010665487.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Vitis vinifera]
Length=686

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/349 (82%), Positives = 323/349 (93%), Gaps = 3/349 (1%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + ++VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  321   DDDSVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILY  380

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVA++NVQAAQQG+VYIDEVDKITKKAESLN+SRDVSGEGVQQALLKMLEGTIVNVP
Sbjct  381   KLLTVAEFNVQAAQQGMVYIDEVDKITKKAESLNLSRDVSGEGVQQALLKMLEGTIVNVP  440

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARKHPRGDNIQIDTKDILFICGGAF+DLEKTIS+RRQDSSIGFGAPVR NMRTGG+T
Sbjct  441   EKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISDRRQDSSIGFGAPVRANMRTGGLT  500

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             +AVVTSSLLE+VESSDLI+YGLIPEF+GRFPILVSL+ALTE+QLV+VLTEPKNALGKQYK
Sbjct  501   NAVVTSSLLESVESSDLIAYGLIPEFIGRFPILVSLSALTEDQLVKVLTEPKNALGKQYK  560

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE ALR IA+KA+ KNTGARGLR++LESIL +AMYEIPDV++G + +D
Sbjct  561   KLFSMNNVKLHFTEKALRQIAKKAMVKNTGARGLRALLESILTEAMYEIPDVKTGKDRVD  620

Query  459   avivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEA  316
             AV+VD+E+VG     GCG KIL G GALDCYL+  + K+P  +  G EA
Sbjct  621   AVVVDEESVGSVNAPGCGGKILRGDGALDCYLAETKLKDP--VESGGEA  667


 Score =   100 bits (248),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGGSNLG + PTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIY+ S QK
Sbjct  258   WGGSNLGKDLPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYHGSLQK  309



>ref|XP_004241855.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Solanum lycopersicum]
Length=682

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/330 (84%), Positives = 307/330 (93%), Gaps = 1/330 (0%)
 Frame = -2

Query  1353  EAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKL  1174
             E VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKL
Sbjct  320   ENVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKL  379

Query  1173  LTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEK  994
             LTVA++NVQAAQQG++YIDEVDKITKKAESLN+SRDVSGEGVQQALLKMLEGTIV+VPEK
Sbjct  380   LTVAEFNVQAAQQGMIYIDEVDKITKKAESLNVSRDVSGEGVQQALLKMLEGTIVSVPEK  439

Query  993   GARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSA  814
             GARKHPRG+NIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTGG+T+A
Sbjct  440   GARKHPRGENIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTGGITNA  499

Query  813   VVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKM  634
              VTS+LLE+ ESSD I+YGLIPEF+GRFPILVSL+ALTE+QLVQVLTEPKNAL KQYKK+
Sbjct  500   TVTSTLLESAESSDFITYGLIPEFIGRFPILVSLSALTEDQLVQVLTEPKNALCKQYKKL  559

Query  633   FQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidav  454
             F MNN KLHFTE ALR IA+KA+ KNTGARGLR++LESIL DAMYEIPDV+SGD+ IDA+
Sbjct  560   FSMNNTKLHFTEGALRLIAKKAMVKNTGARGLRALLESILTDAMYEIPDVKSGDDRIDAI  619

Query  453   ivddeaVGH-EGRGCGAKILYGKGALDCYL  367
             +VD+E+VG    RGCG K+L G GAL  YL
Sbjct  620   VVDEESVGAVNARGCGGKVLRGDGALQRYL  649


 Score =   116 bits (290),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 81/133 (61%), Gaps = 10/133 (8%)
 Frame = -1

Query  1780  GEFVDRGYDNSRNLSSCGKIDISSSYGDPPEVWQPPGDGIVVR--------PGVKFVQVG  1625
             G+ V+   DN +         + S  G+PPE W PPG+G+ V         PG+  ++V 
Sbjct  177   GKRVNNDEDNGKRQKPSFWESLKSYGGEPPENWTPPGNGLAVHTPPGPPFAPGLNLIRVT  236

Query  1624  EVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVY  1445
               DG + G         K G WGGSNLG N PTPKEICKGLDKFVIGQERAKKVLSV VY
Sbjct  237   GTDGKNGGGKDEDSDE-KSG-WGGSNLGKNLPTPKEICKGLDKFVIGQERAKKVLSVGVY  294

Query  1444  NHYKRIYNDSAQK  1406
             NHYKRIY+ S QK
Sbjct  295   NHYKRIYHASLQK  307



>ref|XP_010657908.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Vitis vinifera]
 ref|XP_010657909.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Vitis vinifera]
Length=607

 Score =   542 bits (1397),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 284/396 (72%), Positives = 338/396 (85%), Gaps = 4/396 (1%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL    + +++ K+  S+ +Y    R    +L K   +  ++   +++  ++++
Sbjct  190   PKEICKGLDEFVIGQEQAKKVLSVAVYNHYKRIHHASLQKE--SGAESTKAEIDNDDNDS  247

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L++GPTGSGKTLLAKTLAR+VNVPFVIADATTLTQAGYVGEDVESIL+KLL 
Sbjct  248   VELEKSNVLLLGPTGSGKTLLAKTLARVVNVPFVIADATTLTQAGYVGEDVESILHKLLM  307

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
             VA++NV+AAQQGIVYIDEVDKITKKAESLN  RDVSGEGVQQALLKMLEGTIVNVP+KG 
Sbjct  308   VAEFNVEAAQQGIVYIDEVDKITKKAESLNTGRDVSGEGVQQALLKMLEGTIVNVPDKGG  367

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMRTGG+T AVV
Sbjct  368   RKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRTGGLTDAVV  427

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VES DLI+YGLIPEF+GRFPILVSL+AL E+QLVQVLTEPKNALGKQYKKM  
Sbjct  428   TSSLLESVESGDLIAYGLIPEFIGRFPILVSLSALNEDQLVQVLTEPKNALGKQYKKMLS  487

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             MNNVKLHFTE+ALR IA+KAI KNTGAR LR+ILE IL +AM+EIPDV++G +++DAV+V
Sbjct  488   MNNVKLHFTENALRLIAKKAIAKNTGARSLRAILEKILTEAMFEIPDVKTGTDMVDAVLV  547

Query  447   ddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEP  343
             D+EAV   E +GCGAK+L G+GAL+ +L   +   P
Sbjct  548   DEEAVESIEEQGCGAKVLRGEGALEQFLHETKSSNP  583



>dbj|BAD15818.1| putative ATP-dependent Clp protease ATP-binding subunit ClpX1 
(CLPX) [Oryza sativa Japonica Group]
Length=666

 Score =   543 bits (1400),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 291/378 (77%), Positives = 319/378 (84%), Gaps = 25/378 (7%)
 Frame = -2

Query  1368  EGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQA---------  1216
             E  + + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQA         
Sbjct  283   EADDDDGVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAIPKVKLNSC  342

Query  1215  -----GYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKA-------ESLNIS  1072
                  GYVGEDVESILYKLL VAD+NVQAAQQG+VYIDEVDKITKKA       ESLNIS
Sbjct  343   AFLQAGYVGEDVESILYKLLAVADFNVQAAQQGMVYIDEVDKITKKADVFNMQAESLNIS  402

Query  1071  RDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTIS  892
             RDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTIS
Sbjct  403   RDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTIS  462

Query  891   ERRQDSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSL  712
             ERRQDSSIGFGAPVR NMR GG++SA VTSSLLE+VES DLI+YGLIPEF+GRFPILVSL
Sbjct  463   ERRQDSSIGFGAPVRANMRAGGISSAQVTSSLLESVESGDLIAYGLIPEFIGRFPILVSL  522

Query  711   TALTENQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRS  532
              AL E+QLVQVL EPKNALGKQ+KK+F MNNVKLHFT+ ALR IA+KA++KNTGARGLR+
Sbjct  523   AALNEDQLVQVLMEPKNALGKQFKKLFSMNNVKLHFTDAALRIIAKKAMSKNTGARGLRT  582

Query  531   ILESILMDAMYEIPDVRSGdnvidavivddeaVGH-EGRGCGAKILYGKGALDCYLSGNE  355
             ILE+ILMDAMYEIPD +SG+  IDAV+VD++AVG  +  GCGAKILYG GA + YLS   
Sbjct  583   ILENILMDAMYEIPDAKSGEKRIDAVVVDEDAVGAVDQPGCGAKILYGDGAFERYLS---  639

Query  354   QKEPKKIVEGSEADIEVE  301
             Q +      GSEAD E E
Sbjct  640   QIKVAGDAAGSEADGEAE  657


 Score = 97.8 bits (242),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  1573  KDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             KDG WGGSNLG + PTPKEIC+GLDK+VIGQ+RAKKVLSVAVYNHYKRIY+ S QK
Sbjct  217   KDG-WGGSNLGKDLPTPKEICQGLDKYVIGQDRAKKVLSVAVYNHYKRIYHKSLQK  271



>ref|XP_010063745.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Eucalyptus grandis]
 gb|KCW71000.1| hypothetical protein EUGRSUZ_F04107 [Eucalyptus grandis]
Length=724

 Score =   545 bits (1404),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 278/352 (79%), Positives = 318/352 (90%), Gaps = 1/352 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  360   DDDNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILY  419

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVA++NVQAAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP
Sbjct  420   KLLTVAEFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  479

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARKHPRGDNIQ+DTKDILF+CGGAF+DLEKTISERRQDSSIGFGAPVR NMR GGVT
Sbjct  480   EKGARKHPRGDNIQMDTKDILFVCGGAFVDLEKTISERRQDSSIGFGAPVRANMRAGGVT  539

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             +A VTSSLLE+VES+DLI+YGLIPEF+GRFPILVSL+ALTE+QLVQVLTEP+NALGKQYK
Sbjct  540   NAAVTSSLLESVESADLIAYGLIPEFIGRFPILVSLSALTEDQLVQVLTEPRNALGKQYK  599

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNV+LHFTE ALR IA+KA+ KNTGARGLR+ILESIL +AMYEIPD+++G+  +D
Sbjct  600   KLFSMNNVRLHFTEKALRLIAKKAMVKNTGARGLRAILESILTEAMYEIPDIKTGNERVD  659

Query  459   avivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIE  307
             AV+VD+E+VG  E  G G KIL G  AL+ YL+  + +     V+  E +++
Sbjct  660   AVVVDEESVGSIEALGFGGKILRGDNALERYLAETKFQNSAANVDAPEGEMQ  711


 Score = 82.8 bits (203),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 71/115 (62%), Gaps = 18/115 (16%)
 Frame = -1

Query  1717  ISSSYGDPPE-----VWQPPGDGIVVR--------PGVKFVQVGEVDgpssgsgggfgsG  1577
             + S  GDPPE        P G+G+ V         PGV  ++     G  SG   G  +G
Sbjct  228   LRSYSGDPPENWPPPPGPPAGNGLAVHSPPGPPFAPGVNVIRAAGPGGGGSGGSSGGAAG  287

Query  1576  A----KDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIY  1424
                  K+G WGG+NLG + PTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIY
Sbjct  288   GNGGEKNG-WGGANLGKDLPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIY  341



>ref|XP_007019731.1| ATP-dependent clp protease ATP-binding subunit clpx isoform 2 
[Theobroma cacao]
 gb|EOY16956.1| ATP-dependent clp protease ATP-binding subunit clpx isoform 2 
[Theobroma cacao]
Length=677

 Score =   542 bits (1397),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 292/413 (71%), Positives = 341/413 (83%), Gaps = 11/413 (3%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL    + ++  K+  S+ +Y    R    +L K     E   S+ ++  + + 
Sbjct  260   PKEICKGLDQFVIGQRRAKKVLSVAVYNHYKRIYHASLQKGS-GAEAGSSESID--DDDK  316

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L++GPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLL+
Sbjct  317   VELEKSNVLLVGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLS  376

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
             VA++NV+AAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA
Sbjct  377   VAEFNVEAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  436

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPRGDNIQIDTKDILFICGGAF+DL+KTISERRQDSSIGFGAPVR NMR  G+T+A V
Sbjct  437   RKHPRGDNIQIDTKDILFICGGAFVDLDKTISERRQDSSIGFGAPVRANMRATGLTNAAV  496

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLETVESSDLI+YGLIPEF+GRFPILVSL+ALTE+QL+QVLTEPKNALGKQYKK+F 
Sbjct  497   TSSLLETVESSDLIAYGLIPEFIGRFPILVSLSALTEDQLMQVLTEPKNALGKQYKKLFS  556

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             MNNVKLHFT  ALR IA+KA+ KNTGARGLR+ILE IL +AMYEIPD ++G+N +DAV+V
Sbjct  557   MNNVKLHFTSKALRLIAKKAMAKNTGARGLRAILEGILTEAMYEIPDAKTGNNRLDAVVV  616

Query  447   ddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDL  292
             D+E+VG     GCG KIL G GAL+ Y +        K+ + +E    VER+L
Sbjct  617   DEESVGSTNIPGCGGKILCGDGALENYFA------EAKLKDSAENLASVEREL  663


 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = -1

Query  1567  GCW-GGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             G W GG+NLG + PTPKEICKGLD+FVIGQ RAKKVLSVAVYNHYKRIY+ S QK
Sbjct  245   GAWLGGANLGKDLPTPKEICKGLDQFVIGQRRAKKVLSVAVYNHYKRIYHASLQK  299



>ref|XP_010442897.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Camelina sativa]
Length=562

 Score =   538 bits (1386),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 294/423 (70%), Positives = 339/423 (80%), Gaps = 23/423 (5%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  ++ +Y    R    +  K  R+  + +S   +  +
Sbjct  157   FPTPKEICKGLNKFVIGQERAKKVLAVAVYNHYKRIYHESAQK--RSTGETESTAAKPAD  214

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ              
Sbjct  215   DDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ--------------  260

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
                VADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  261   ---VADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  317

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERR DSSIGFGAPVR NMR GGVT+
Sbjct  318   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRHDSSIGFGAPVRANMRAGGVTN  377

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A V S+L+ETVESSDLI+YGLIPEFVGRFP+LVSL+ALTENQL++VLTEPKNALGKQYKK
Sbjct  378   AAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLSALTENQLMEVLTEPKNALGKQYKK  437

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             M+QMN+VKLHFTE ALR IARKAITKNTGARGLR++LESILMD+MYEIPD  +G ++I+A
Sbjct  438   MYQMNSVKLHFTESALRLIARKAITKNTGARGLRALLESILMDSMYEIPDESTGSDMIEA  497

Query  456   vivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKE--PKKIVEGSEADIEVERDLPS  286
             V+VD+EAV  EG RG GAKIL GKGAL  YLS    K+  P+   EGS+ + EVE ++PS
Sbjct  498   VVVDEEAVEGEGRRGSGAKILRGKGALGRYLSETYSKDSSPQTTKEGSDGENEVEAEIPS  557

Query  285   IVA  277
             +VA
Sbjct  558   VVA  560


 Score =   151 bits (381),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 120/206 (58%), Gaps = 23/206 (11%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTN--SRHSFSL  1802
             MAAALRS + RETAS T S  RYFI N +   R           S N F N  S    SL
Sbjct  1     MAAALRSNTSRETASLTLSQFRYFIFNRIHTARTATTRSRPDDSSNNRFPNKISPLGTSL  60

Query  1801  FKPVSVRGEFVDRGYDN---------SRNLSSCGKIDISSSYGDPPEVWQPPGDGIVVRP  1649
             F   S       +GY           + + SS   + I SS GDPP++WQPPGDG+ VR 
Sbjct  61    FGNSS-------KGYATNCAQKMNGVASSSSSSSSVVILSSQGDPPDLWQPPGDGVSVRV  113

Query  1648  GVKFVQVGEVDgpssgsgggfg-----sGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIG  1484
                 V +G   G   GS GG       S +K+  WGGSNLG  FPTPKEICKGL+KFVIG
Sbjct  114   NGSSVNLGRGGGGGGGSPGGGPGDGTGSNSKEDSWGGSNLGSEFPTPKEICKGLNKFVIG  173

Query  1483  QERAKKVLSVAVYNHYKRIYNDSAQK  1406
             QERAKKVL+VAVYNHYKRIY++SAQK
Sbjct  174   QERAKKVLAVAVYNHYKRIYHESAQK  199



>ref|XP_009366893.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Pyrus x bretschneideri]
Length=707

 Score =   543 bits (1399),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 291/388 (75%), Positives = 328/388 (85%), Gaps = 5/388 (1%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL    + ++  K+  S+ +Y    R    +L K     E    +KV+  + + 
Sbjct  291   PKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHASL-KKGSGAESGIPNKVD--DDDK  347

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVI DATTLTQAGYVGEDVESILYKLL 
Sbjct  348   VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVITDATTLTQAGYVGEDVESILYKLLM  407

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              A++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA
Sbjct  408   AAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  467

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMR GGV ++VV
Sbjct  468   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRAGGVINSVV  527

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE VESSDLI+YGLIPEF+GRFPILVSL+ALTE+QLVQVL EPKNALGKQYKK+F 
Sbjct  528   TSSLLELVESSDLIAYGLIPEFIGRFPILVSLSALTEDQLVQVLMEPKNALGKQYKKLFG  587

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             MNNVKLHF E+ALR IA KA+ KNTGARGLR++LESIL +AMYEIPDV++G + IDAV+V
Sbjct  588   MNNVKLHFMENALRLIANKAMAKNTGARGLRALLESILTEAMYEIPDVKTGKDRIDAVVV  647

Query  447   ddeaVGH-EGRGCGAKILYGKGALDCYL  367
             D+E+VG     GCG KI+ G GAL+ YL
Sbjct  648   DEESVGTVNAHGCGGKIVRGDGALERYL  675


 Score = 99.0 bits (245),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -1

Query  1564  CWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              WGGSNLG N PTPKEICKGLDKFVIGQ+RAKKVLSVAVYNHYKRIY+ S +K
Sbjct  278   AWGGSNLGNNLPTPKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHASLKK  330



>ref|XP_006647186.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like, partial [Oryza brachyantha]
Length=432

 Score =   533 bits (1373),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 284/421 (67%), Positives = 347/421 (82%), Gaps = 4/421 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  +GL    + ++  K+  S+ +Y    R     LL S    + +++D    ++
Sbjct  12    FPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKR-IHCDLLSSRSAGDCSETDSCS-SD  69

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNILVMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  70    TDGVELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  129

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL  AD++V AAQQGIVYIDEVDKITKKAES+N+SRDVSGEGVQQALLKMLEGT+V+VPE
Sbjct  130   LLAAADFDVSAAQQGIVYIDEVDKITKKAESINLSRDVSGEGVQQALLKMLEGTVVSVPE  189

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGAR+HPRGDNIQIDTK+ILFICGGAF+DLEKTISERR DSSIGF AP+R+NMRTGGV +
Sbjct  190   KGARRHPRGDNIQIDTKNILFICGGAFVDLEKTISERRHDSSIGFQAPIRSNMRTGGVIN  249

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A +TSSLLE+VES DLI+YGLIPEFVGRFPILVSL++L+E+QLV+VLT+PKNALG+QY K
Sbjct  250   AEITSSLLESVESGDLIAYGLIPEFVGRFPILVSLSSLSEDQLVEVLTKPKNALGRQYTK  309

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             +F+MN+VKLHFTE ALR I+++AI KNTGARGLRSILESIL +AMYEIP+ R+G + IDA
Sbjct  310   LFEMNDVKLHFTEKALRLISKRAIAKNTGARGLRSILESILTEAMYEIPETRTGKDKIDA  369

Query  456   vivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIV  280
             V+VD+E+VG   + G GAKIL G+GALD YL  + ++   +  E  + + +++ + PS V
Sbjct  370   VVVDEESVGPTNQHGFGAKILCGEGALDLYLDEHNKESTPRRPEKLDGEPDIDTEAPSRV  429

Query  279   A  277
             A
Sbjct  430   A  430


 Score = 95.9 bits (237),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYND  1418
             WGGSNLG  FPTPKEIC+GLDKFVIGQERAKKVLSVAVYNHYKRI+ D
Sbjct  3     WGGSNLGRRFPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKRIHCD  50



>ref|XP_009379893.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Musa acuminata subsp. malaccensis]
Length=677

 Score =   541 bits (1394),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 293/362 (81%), Positives = 329/362 (91%), Gaps = 3/362 (1%)
 Frame = -2

Query  1368  EGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVES  1189
             EG     VELEKSN+L++GPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVES
Sbjct  313   EGDNDNNVELEKSNVLLLGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVES  372

Query  1188  ILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  1009
             ILYKLLTVA++NVQAAQQGIVYIDEVDKITKKAESLN+SRDVSGEGVQQALLKMLEGTI+
Sbjct  373   ILYKLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNLSRDVSGEGVQQALLKMLEGTII  432

Query  1008  NVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTG  829
             NVPEKGARKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR+G
Sbjct  433   NVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRSG  492

Query  828   GVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGK  649
             G+T+AVV SSLLE+VESSDLI+YGLIPEFVGRFPILVSL+AL+E+QLVQVLTEPKNALG+
Sbjct  493   GLTNAVVASSLLESVESSDLIAYGLIPEFVGRFPILVSLSALSEDQLVQVLTEPKNALGR  552

Query  648   QYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdn  469
             QYKK+F MNNVKLHFT+ ALR IA+KA+ KNTGARGLR+ILE+IL++AM+EIPDV++GD 
Sbjct  553   QYKKLFSMNNVKLHFTDAALRLIAKKAMAKNTGARGLRAILENILIEAMFEIPDVKTGDE  612

Query  468   vidavivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDL  292
              IDAV+VD+EAVG   + GCGAKIL+G  ALD YLS  E K    IVE SE ++E + +L
Sbjct  613   RIDAVVVDEEAVGSVDKPGCGAKILHGDDALDHYLS--ENKRSDVIVEVSEGELEGDSEL  670

Query  291   PS  286
              S
Sbjct  671   TS  672


 Score = 87.8 bits (216),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -1

Query  1552  SNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             SNLG + PTPKEICKGLDK+VIGQERAKKVL+VAVYNHYKRIY+ S Q+
Sbjct  253   SNLGKDLPTPKEICKGLDKYVIGQERAKKVLAVAVYNHYKRIYHASLQE  301



>ref|XP_006376103.1| hypothetical protein POPTR_0013s09570g [Populus trichocarpa]
 gb|ERP53900.1| hypothetical protein POPTR_0013s09570g [Populus trichocarpa]
Length=715

 Score =   542 bits (1397),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 278/354 (79%), Positives = 316/354 (89%), Gaps = 3/354 (1%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  356   DEDNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILY  415

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL+ A++NVQAAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP
Sbjct  416   KLLSAAEFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  475

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARKHPRGDNIQIDTK+ILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR GGVT
Sbjct  476   EKGARKHPRGDNIQIDTKNILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRAGGVT  535

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             +A +TSSLLE+VES+DLI+YGLIPEF+GRFPILVSL ALTE+QLV+VL EP+NALGKQYK
Sbjct  536   NAAITSSLLESVESADLIAYGLIPEFIGRFPILVSLAALTEDQLVKVLMEPRNALGKQYK  595

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFT+ ALR IA+KA+ KNTGARGLRSILESIL +AMYEIPD+++G + +D
Sbjct  596   KLFSMNNVKLHFTDKALRLIAKKAMAKNTGARGLRSILESILTEAMYEIPDIKTGSDRVD  655

Query  459   avivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVE  301
             AV++D+E+VG     G G KIL G GAL+ YL+  E K+  +  +G   D E E
Sbjct  656   AVVIDEESVGSVHAPGSGGKILRGDGALEHYLA--EYKDTVEAADGELQDAESE  707



>ref|XP_011009777.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Populus euphratica]
Length=714

 Score =   540 bits (1390),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 277/354 (78%), Positives = 316/354 (89%), Gaps = 3/354 (1%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  355   DEDNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILY  414

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL+ A++NVQAAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP
Sbjct  415   KLLSAAEFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  474

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARKHPRGDNIQIDTK+ILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR GGVT
Sbjct  475   EKGARKHPRGDNIQIDTKNILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRAGGVT  534

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             +A +TSSLLE+VES+DLI+YGLIPEF+GRFPILVSL ALTE+QLV+VL EP+NALGKQYK
Sbjct  535   NAAITSSLLESVESADLIAYGLIPEFIGRFPILVSLAALTEDQLVRVLMEPRNALGKQYK  594

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKL+FTE ALR IA+KA+ KNTGARGLR+ILESIL +AMYEIPD+++G + +D
Sbjct  595   KLFSMNNVKLNFTEKALRLIAKKAMAKNTGARGLRAILESILTEAMYEIPDIKTGSDRVD  654

Query  459   avivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVE  301
             AV++D+E+VG     G G KIL G GAL+ YL+  E K+  +  +G   D E E
Sbjct  655   AVVIDEESVGSVHAPGSGGKILRGDGALEHYLA--EYKDSVEAADGELQDAESE  706



>ref|XP_010445732.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Camelina sativa]
Length=564

 Score =   534 bits (1375),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 292/424 (69%), Positives = 338/424 (80%), Gaps = 24/424 (6%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  ++ +Y    R    +  K  R+  + +S   +  +
Sbjct  158   FPTPKEICKGLNKFVIGQERAKKVLAVAVYNHYKRIYHESAQK--RSTGETESTAAKPAD  215

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQ              
Sbjct  216   DDMVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQ--------------  261

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
                VADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  262   ---VADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  318

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERR DSSIGFGAPVR NMR GGVT+
Sbjct  319   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRHDSSIGFGAPVRANMRAGGVTN  378

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A V S+L+ETVESSDLI+YGLIPEFVGRFP+LVSL+ALTENQL++VLTEPKNALGKQYKK
Sbjct  379   AAVASNLMETVESSDLIAYGLIPEFVGRFPVLVSLSALTENQLMEVLTEPKNALGKQYKK  438

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             M+QMN+VKLHFTE ALR IARKAITKNTGARGLR++LESILMD+MYEIPD  +G ++I+A
Sbjct  439   MYQMNSVKLHFTESALRLIARKAITKNTGARGLRALLESILMDSMYEIPDESTGSDMIEA  498

Query  456   vivddeaVGHEG-RGCGAKILYGKGALDCYLS---GNEQKEPKKIVEGSEADIEVERDLP  289
             V+VD+EAV  EG RG GAKIL GKGAL  YLS    ++   P+    GS+ + EVE ++P
Sbjct  499   VVVDEEAVEGEGRRGSGAKILRGKGALGRYLSETTNSKDSSPQTTKVGSDGENEVEAEIP  558

Query  288   SIVA  277
             S+VA
Sbjct  559   SVVA  562


 Score =   154 bits (389),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 118/207 (57%), Gaps = 24/207 (12%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHS---FS  1805
             MAAALRS + RETAS T S  RYFI N +   R           S N F N   S    S
Sbjct  1     MAAALRSNTSRETASLTLSQFRYFIFNRIHTARTATTRSRPDDSSNNRFQNKISSPLGTS  60

Query  1804  LFKPVSVRGEFVDRGYD-------NSRNLSSCGKIDISSSYGDPPEVWQPPGDGIVVRPG  1646
             LF   S       +GY        N+   SS   +   SS GDPP++WQPPGDG+ VR  
Sbjct  61    LFGNSS-------KGYATNCAQKMNAVASSSSYSVVTLSSQGDPPDLWQPPGDGVSVRVN  113

Query  1645  VKFVQVGEVDgpssgsgggfg-------sGAKDGCWGGSNLGPNFPTPKEICKGLDKFVI  1487
                V +G   G   G G   G       S +K+  WGGSNLG  FPTPKEICKGL+KFVI
Sbjct  114   GSSVNLGRGGGGGGGGGNPGGGPGDGTGSNSKEDSWGGSNLGSEFPTPKEICKGLNKFVI  173

Query  1486  GQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             GQERAKKVL+VAVYNHYKRIY++SAQK
Sbjct  174   GQERAKKVLAVAVYNHYKRIYHESAQK  200



>ref|XP_001773526.1| predicted protein [Physcomitrella patens]
 gb|EDQ61726.1| predicted protein [Physcomitrella patens]
Length=433

 Score =   528 bits (1361),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 277/370 (75%), Positives = 317/370 (86%), Gaps = 4/370 (1%)
 Frame = -2

Query  1461  SL*LYiiiIRESTMTLLKSD--RNPEKNDSDKVEGTEHEAVELEKSNILVMGPTGSGKTL  1288
             S+ +Y    R    +LLKS+     E      +E  E++ VELEKSN+L+MGPTGSGKTL
Sbjct  60    SVAVYNHYKRIHYESLLKSNIRLTDEGAGHSDMEDEENDGVELEKSNVLLMGPTGSGKTL  119

Query  1287  LAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVD  1108
             LAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLL  A++NV AAQQGIVYIDEVD
Sbjct  120   LAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLMAAEFNVPAAQQGIVYIDEVD  179

Query  1107  KITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFIC  928
             KITKKAE++NISRDVSGEGVQQALLKMLEGT+VNVPEKGARKHPRGD+IQ+DTKDILFIC
Sbjct  180   KITKKAENMNISRDVSGEGVQQALLKMLEGTVVNVPEKGARKHPRGDHIQVDTKDILFIC  239

Query  927   GGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIP  748
             GGAFI+LEKTI+ERRQDSSIGFGAPVR NMR   + +A VTSSLLE VESSDLISYGLIP
Sbjct  240   GGAFIELEKTIAERRQDSSIGFGAPVRANMRVNKLVNAAVTSSLLELVESSDLISYGLIP  299

Query  747   EFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKA  568
             EF+GRFP+LVSL AL E+QLVQVLTEP+NALGKQYKKMF MNNVKLH+TE ALR IA+KA
Sbjct  300   EFIGRFPVLVSLAALNEDQLVQVLTEPRNALGKQYKKMFAMNNVKLHYTEGALRRIAQKA  359

Query  567   ITKNTGARGLRSILESILMDAMYEIPD-VRSGdnvidavivddeaVG-HEGRGCGAKILY  394
             + KNTGARGLRSI+E++L D+MY++PD V   D  IDAV++D++AVG  +G G GAKIL 
Sbjct  360   MIKNTGARGLRSIMEALLTDSMYQVPDSVSETDEKIDAVVLDEDAVGPPDGVGSGAKILR  419

Query  393   GKGALDCYLS  364
             G+GALD YL+
Sbjct  420   GEGALDIYLN  429


 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 12/65 (18%)
 Frame = -1

Query  1564  CWGGSNLGPNFPTPKEICKGLDKFVIGQERAKK------------VLSVAVYNHYKRIYN  1421
              WGG+ LG   PTP+EI + LDKFV+GQE+AKK            +LSVAVYNHYKRI+ 
Sbjct  13    SWGGAALGKELPTPREISQALDKFVVGQEKAKKAFSLFPSFNSLAILSVAVYNHYKRIHY  72

Query  1420  DSAQK  1406
             +S  K
Sbjct  73    ESLLK  77



>ref|XP_009420156.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Musa acuminata subsp. malaccensis]
 ref|XP_009420157.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Musa acuminata subsp. malaccensis]
 ref|XP_009420158.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Musa acuminata subsp. malaccensis]
 ref|XP_009420159.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Musa acuminata subsp. malaccensis]
Length=671

 Score =   536 bits (1382),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 273/370 (74%), Positives = 325/370 (88%), Gaps = 6/370 (2%)
 Frame = -2

Query  1386  NDSDKVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYV  1207
             +D+ K E  E++ VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYV
Sbjct  304   SDNVKAEKDEYDDVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYV  363

Query  1206  GEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKM  1027
             GEDVESILYKLL  AD+NVQAAQQGIVYIDEVDKI KKAESLN+SRDVSGEGVQQALLKM
Sbjct  364   GEDVESILYKLLAAADFNVQAAQQGIVYIDEVDKIAKKAESLNVSRDVSGEGVQQALLKM  423

Query  1026  LEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR  847
             LEGT+V+VPEKGARK  RG+ IQI+TKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR
Sbjct  424   LEGTMVSVPEKGARKQSRGETIQINTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVR  483

Query  846   TNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEP  667
              N+RTGG T++ VTS+L+E+VES DL++YGLIPEF+GRFP+LVSL++L E+QLVQVLTEP
Sbjct  484   ANLRTGGTTNSAVTSTLMESVESGDLVAYGLIPEFIGRFPVLVSLSSLNEDQLVQVLTEP  543

Query  666   KNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPD  487
             KNALGKQYKK F +N+VKLHFT+ ALR IARKA+ KNTGARGLR+ILES L +AMYEIPD
Sbjct  544   KNALGKQYKKTFSLNDVKLHFTDAALRLIARKAMVKNTGARGLRAILESTLTEAMYEIPD  603

Query  486   VRSGdnvidavivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADI  310
             V++G++ +DA++VD++A+G  +  GCGAKIL G GAL+ YL+ N++   +     SE ++
Sbjct  604   VKTGNDRVDAIVVDEDAIGSLDKSGCGAKILRGNGALEGYLARNKENNGQ-----SENEV  658

Query  309   EVERDLPSIV  280
             E E +L S+V
Sbjct  659   EGESELSSVV  668


 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  1576  AKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             +K   WGGSNLG + PTPKEICK LDKFVIGQ+RAKKVL+VAVYNHYKRI + S +K
Sbjct  242   SKKEAWGGSNLGKDLPTPKEICKALDKFVIGQDRAKKVLAVAVYNHYKRISHSSTKK  298



>gb|KGN52598.1| hypothetical protein Csa_5G646720 [Cucumis sativus]
Length=634

 Score =   535 bits (1377),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 297/419 (71%), Positives = 345/419 (82%), Gaps = 7/419 (2%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL    + +++ K+  S+ ++    R    +L K     E    D V+  + ++
Sbjct  218   PKEICKGLDKFVIGQEKAKKVLSVAVHNHYKRIYHASLQKGRSGNESGTQDTVD--DDDS  275

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFV+ADATTLTQAGYVGEDVESILYKLL 
Sbjct  276   VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVLADATTLTQAGYVGEDVESILYKLLA  335

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              A++NVQAAQQG++YIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKG+
Sbjct  336   AAEFNVQAAQQGMIYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGS  395

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPRGDNIQIDTKDILFICGGAF+DLEKTIS+RRQDSSIGFGAPVR NMR GG TSA V
Sbjct  396   RKHPRGDNIQIDTKDILFICGGAFVDLEKTISDRRQDSSIGFGAPVRANMRIGGATSAAV  455

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VESSDLI+YGLIPEF+GRFPILVSL ALTE+QLVQVLTEPKNALGKQYKK+F 
Sbjct  456   TSSLLESVESSDLIAYGLIPEFIGRFPILVSLLALTEDQLVQVLTEPKNALGKQYKKLFG  515

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             MN VKLH+TE ALR IA+KAI KNTGARGLR+ILESIL +AMYEIPDV++G   +DAV+V
Sbjct  516   MNKVKLHYTEKALRMIAKKAIAKNTGARGLRAILESILTEAMYEIPDVKTGIERVDAVVV  575

Query  447   ddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPK---KIVEGSEADIEVERDLPSI  283
             D+E+VG    RGCG KIL G GAL+ YL+  + KE +   ++VE  E + E+     SI
Sbjct  576   DEESVGPLNSRGCGGKILRGDGALERYLAETKLKESQENLEVVELQEGETELSSRAMSI  634



>ref|XP_006599644.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Glycine max]
Length=711

 Score =   537 bits (1383),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 289/417 (69%), Positives = 342/417 (82%), Gaps = 10/417 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEG-T  1360
             F  P++  KGL    + ++  K+  S+ +Y    R    TL K        DS   E   
Sbjct  293   FPSPKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHATLQKG----SAADSGVSEVLD  348

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFV+ DATTLTQAGYVGEDVESILY
Sbjct  349   DDDNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVVTDATTLTQAGYVGEDVESILY  408

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLT AD+NV AAQQGI+YIDEVDKITKK++SLNISRDVSGEGVQQALLKMLEGTIVNVP
Sbjct  409   KLLTAADFNVAAAQQGIIYIDEVDKITKKSKSLNISRDVSGEGVQQALLKMLEGTIVNVP  468

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARKHPRGDNIQ+DTK+ILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMR GG+T
Sbjct  469   EKGARKHPRGDNIQMDTKNILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRAGGIT  528

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
              + VTSSLLE+VES+DLI+YGLIPEF+GRFPILVSL+ALTE+QL+ VLTEPKNALGKQYK
Sbjct  529   DSAVTSSLLESVESADLIAYGLIPEFIGRFPILVSLSALTEDQLMMVLTEPKNALGKQYK  588

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE ALR IA+KA+ KNTGARGLR++LE+IL +AM+EIPD+++G + +D
Sbjct  589   KLFSMNNVKLHFTEKALRLIAKKAMAKNTGARGLRALLENILTEAMFEIPDIKTGSDRVD  648

Query  459   avivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDL  292
             AV++D+E+VG     GCG KIL G GAL+ YL+  + K+    V+  E+D++ E DL
Sbjct  649   AVVIDEESVGSLTAPGCGGKILRGDGALEQYLA--KMKDSAVNVDVGESDLQ-EGDL  702


 Score = 97.1 bits (240),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 70/114 (61%), Gaps = 13/114 (11%)
 Frame = -1

Query  1708  SYGDPPEVWQPP-------GDGIVVRPGVKFVQVGEVDgpssg------sgggfgsGAKD  1568
             S G+PPE W          G+G+ V           ++   +       SGGG G   + 
Sbjct  222   SNGEPPESWPLAPDGSNGNGNGLAVHTPPGPPFPPGINVIRATGPRNGGSGGGGGGKGEK  281

Query  1567  GCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
               WGGSNLG +FP+PKEICKGLDKFVIGQ+RAKKVLSVAVYNHYKRIY+ + QK
Sbjct  282   TAWGGSNLGKDFPSPKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHATLQK  335



>ref|XP_010912710.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Elaeis guineensis]
Length=350

 Score =   523 bits (1347),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 279/345 (81%), Positives = 315/345 (91%), Gaps = 1/345 (0%)
 Frame = -2

Query  1317  MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLTVADYNVQAAQ  1138
             MGPTGSGKTLLAKTLAR VNVP VIADATTLTQAGYVGEDVESILYKLL VA++NVQAAQ
Sbjct  1     MGPTGSGKTLLAKTLARFVNVPIVIADATTLTQAGYVGEDVESILYKLLMVAEFNVQAAQ  60

Query  1137  QGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQ  958
             QGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQ
Sbjct  61    QGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQ  120

Query  957   IDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVES  778
             IDTKDILFICGGAFIDLEKTISERRQDSS+GFGAPVR NMRTGG+T+AVVTSSLLE+VES
Sbjct  121   IDTKDILFICGGAFIDLEKTISERRQDSSMGFGAPVRANMRTGGLTNAVVTSSLLESVES  180

Query  777   SDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTE  598
             SDLI+YGLIPEF+GRFP+LVSL+AL+E+QLV+VL EPKNA+GKQ+KK+F MN+VKLHFT+
Sbjct  181   SDLIAYGLIPEFIGRFPVLVSLSALSEDQLVRVLMEPKNAVGKQFKKLFSMNSVKLHFTD  240

Query  597   DALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidavivddeaVGHEGR  418
              ALR IA+KA+ KNTGARGLR+ILE+IL+DAMYEIPD+++GD  IDAV+VD+EAVG   R
Sbjct  241   TALRLIAKKALAKNTGARGLRAILENILIDAMYEIPDLKTGDERIDAVVVDEEAVGSVDR  300

Query  417   -GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPS  286
              GCGAKIL G GAL+ YL  N+ K+   + +GS  ++E E +L S
Sbjct  301   PGCGAKILRGDGALEHYLKENKIKDRTAMTDGSGGELEGESELSS  345



>ref|XP_010908120.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Elaeis guineensis]
Length=670

 Score =   535 bits (1378),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 301/415 (73%), Positives = 339/415 (82%), Gaps = 11/415 (3%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL +  + ++  K+  S+ +Y    R    +L K        D   +E    + 
Sbjct  260   PKEICKGLDTFVIGQQRAKKVLSVAVYNHYKRIYHASLQKG----SAADPGNLEAKIDDH  315

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLLT
Sbjct  316   VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLT  375

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
             VAD+NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA
Sbjct  376   VADFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  435

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPR D+IQIDTKDILFICGGAF+DLEKTISERR DSSIGFGAPVR NMRTG +T+AVV
Sbjct  436   RKHPRNDHIQIDTKDILFICGGAFVDLEKTISERRHDSSIGFGAPVRANMRTGWLTNAVV  495

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
              SSLLE+VESSDLI+YGLIPEF+GRFPILVSL+AL E+QLVQVLTEPKNALGKQYKK+F 
Sbjct  496   ASSLLESVESSDLIAYGLIPEFIGRFPILVSLSALNEDQLVQVLTEPKNALGKQYKKLFS  555

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             MNNVKLH TE ALR IA+KA+ KNTGARGLR+ILES L +AMYEIPDV++G   +DAV+V
Sbjct  556   MNNVKLHVTEAALREIAKKAMVKNTGARGLRAILESTLTEAMYEIPDVKTGTERVDAVVV  615

Query  447   ddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPS  286
             D+EA+G   R GCGAKIL G GAL+ YLS N     K      E D+  +RDL S
Sbjct  616   DEEAIGSLDRPGCGAKILQGDGALEHYLSQN-----KADANQLEGDLVGDRDLAS  665


 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 72/119 (61%), Gaps = 15/119 (13%)
 Frame = -1

Query  1717  ISSSYG-DPPEVWQPP--------GDGIVVR-----PGVKFVQVGEVDgpssgsgggfgs  1580
             + ++YG +PPE W P         G+G+ V      P V  V+VG       G   G G 
Sbjct  181   LKATYGGEPPENWPPMPLPAPAPGGNGLAVHVPPGPPNVNVVKVGGYRKGGGGGNSGDGG  240

Query  1579  GAKDGCW-GGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
                   W GGSNLG + PTPKEICKGLD FVIGQ+RAKKVLSVAVYNHYKRIY+ S QK
Sbjct  241   EFGGKEWCGGSNLGKDLPTPKEICKGLDTFVIGQQRAKKVLSVAVYNHYKRIYHASLQK  299



>emb|CAN64542.1| hypothetical protein VITISV_013764 [Vitis vinifera]
Length=730

 Score =   537 bits (1383),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 287/365 (79%), Positives = 323/365 (88%), Gaps = 19/365 (5%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + ++VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  349   DDDSVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILY  408

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT-----  1015
             KLLTVA++NVQAAQQG+VYIDEVDKITKKAESLN+SRDVSGEGVQQALLKMLEGT     
Sbjct  409   KLLTVAEFNVQAAQQGMVYIDEVDKITKKAESLNLSRDVSGEGVQQALLKMLEGTDLKWS  468

Query  1014  -----------IVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSI  868
                        IVNVPEKGARKHPRGDNIQIDTKDILFICGGAF+DLEKTIS+RRQDSSI
Sbjct  469   GYKILRGIKQXIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISDRRQDSSI  528

Query  867   GFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQL  688
             GFGAPVR NMRTGG+T+AVVTSSLLE+VESSDLI+YGLIPEF+GRFPILVSL+ALTE+QL
Sbjct  529   GFGAPVRANMRTGGLTNAVVTSSLLESVESSDLIAYGLIPEFIGRFPILVSLSALTEDQL  588

Query  687   VQVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMD  508
             V+VLTEPKNALGKQYKK+F MNNVKLHFTE ALR IA+KA+ KNTGARGLR++LESIL +
Sbjct  589   VKVLTEPKNALGKQYKKLFSMNNVKLHFTEKALRQIAKKAMVKNTGARGLRALLESILTE  648

Query  507   AMYEIPDVRSGdnvidavivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIV  331
             AMYEIPDV++G + +DAV+VD+E+VG     GCG KIL G GALDCYL+  + K+P  + 
Sbjct  649   AMYEIPDVKTGKDRVDAVVVDEESVGSVNAPGCGGKILRGDGALDCYLAETKLKDP--VE  706

Query  330   EGSEA  316
              G EA
Sbjct  707   SGGEA  711


 Score = 84.7 bits (208),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 48/80 (60%), Gaps = 28/80 (35%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKK----------------------------  1466
             WGGSNLG + PTPKEICKGLDKFVIGQERAKK                            
Sbjct  258   WGGSNLGKDLPTPKEICKGLDKFVIGQERAKKFSGIEVYIVEIGKWGHSFKRSNWCQTWE  317

Query  1465  VLSVAVYNHYKRIYNDSAQK  1406
             VLSVAVYNHYKRIY+ S QK
Sbjct  318   VLSVAVYNHYKRIYHGSLQK  337



>ref|XP_006587384.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X1 [Glycine max]
 ref|XP_006587385.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X2 [Glycine max]
Length=713

 Score =   536 bits (1380),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 291/417 (70%), Positives = 341/417 (82%), Gaps = 10/417 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEG-T  1360
             F  P++  KGL    + ++  K+  S+ +Y    R    TL K        DS   E   
Sbjct  295   FPSPKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHATLQKG----SAADSGASEVLD  350

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  351   DDDNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILY  410

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL  AD+NV AAQQGI+YIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP
Sbjct  411   KLLVAADFNVAAAQQGIIYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  470

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARK+PRGDNIQ+DTK+ILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMR  G+T
Sbjct  471   EKGARKNPRGDNIQMDTKNILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRAVGIT  530

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
              + VTSSLLE+VES+DLI+YGLIPEF+GRFPILVSL+ALTE+QL  VLTEPKNALGKQYK
Sbjct  531   DSAVTSSLLESVESADLIAYGLIPEFIGRFPILVSLSALTEDQLTMVLTEPKNALGKQYK  590

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE+ALR IA+KA+ KNTGARGLR++LESIL +AM+EIPD+++G + +D
Sbjct  591   KLFSMNNVKLHFTENALRLIAKKAMAKNTGARGLRALLESILTEAMFEIPDIKTGSDRVD  650

Query  459   avivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDL  292
             AV++D+E+VG     GCG KIL+G GAL  YL+  + K+    V+  E+D++ E DL
Sbjct  651   AVVIDEESVGSLTAPGCGGKILHGDGALKQYLA--KMKDSAVNVDVGESDLQ-EGDL  704



>ref|XP_008808963.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent Clp protease ATP-binding 
subunit clpX-like, mitochondrial [Phoenix dactylifera]
Length=664

 Score =   532 bits (1371),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 298/407 (73%), Positives = 341/407 (84%), Gaps = 16/407 (4%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKS------DRNPEKNDSDKVE  1366
             P++  KGL    + +   K+  S+ +Y    R    +L K       +  PE +D D VE
Sbjct  247   PKEICKGLDKYVIGQDRAKKVLSVAVYNHYKRIHHASLQKGSGADSGNFEPENDDDDNVE  306

Query  1365  GTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESI  1186
                     L+KSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESI
Sbjct  307   --------LDKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESI  358

Query  1185  LYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVN  1006
             LYKLLTVAD+NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVN
Sbjct  359   LYKLLTVADFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVN  418

Query  1005  VPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGG  826
             VPEKGARKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMRTGG
Sbjct  419   VPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRTGG  478

Query  825   VTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQ  646
             +T+AVVTSSLLE+VESSDL++YGLIPEF+GRFP+LVSL+AL E+QLVQVL EPKNALGKQ
Sbjct  479   LTNAVVTSSLLESVESSDLMAYGLIPEFIGRFPVLVSLSALNEDQLVQVLMEPKNALGKQ  538

Query  645   YKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnv  466
             +KK+F MNNVKL FT+ ALR I++KA+ KNTGARGLR+ILE+IL +AMYEIPDV++GD  
Sbjct  539   FKKLFSMNNVKLKFTDTALRLISQKAMAKNTGARGLRAILENILTEAMYEIPDVKTGDER  598

Query  465   idavivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVE  328
             IDAV+VD+EAVG   R GCGAKIL G GAL+ YL  N+ K+ + I++
Sbjct  599   IDAVVVDEEAVGSVDRPGCGAKILCGDGALEKYLKENKIKDREAIID  645


 Score = 85.9 bits (211),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 89/169 (53%), Gaps = 34/169 (20%)
 Frame = -1

Query  1810  FSLFKPVSVRGEFVD----RGYDNSRNLSSCGKID--------------ISSSYG-DPPE  1688
             F   K V ++G FV+    RG D+ R   +    D              + SSYG +PPE
Sbjct  118   FRPHKLVPLQGTFVEIGRVRGADSERERPAGAGDDEEQGNRLKTSFWEALRSSYGGEPPE  177

Query  1687  VWQ-----PPGDGIVVRP----------GVKFVQVGEVDgpssgsgggfgsGAKDGCWGG  1553
              W      P G+G+ V             V  V      G   G+GGG G       WGG
Sbjct  178   NWPPMPGLPEGNGLAVHTPPGPPFPPNLNVVRVAGPGGGGGGEGTGGGGGGFGGKDGWGG  237

Query  1552  SNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             SNLG + PTPKEICKGLDK+VIGQ+RAKKVLSVAVYNHYKRI++ S QK
Sbjct  238   SNLGKDLPTPKEICKGLDKYVIGQDRAKKVLSVAVYNHYKRIHHASLQK  286



>ref|XP_004141515.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like 
[Cucumis sativus]
 ref|XP_004163734.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like 
[Cucumis sativus]
Length=699

 Score =   533 bits (1373),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 298/419 (71%), Positives = 346/419 (83%), Gaps = 8/419 (2%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL    + +++ K+  S+ ++    R    +L K   N E    D V+  + ++
Sbjct  284   PKEICKGLDKFVIGQEKAKKVLSVAVHNHYKRIYHASLQKGSGN-ESGTQDTVD--DDDS  340

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFV+ADATTLTQAGYVGEDVESILYKLL 
Sbjct  341   VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVLADATTLTQAGYVGEDVESILYKLLA  400

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              A++NVQAAQQG++YIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKG+
Sbjct  401   AAEFNVQAAQQGMIYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGS  460

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPRGDNIQIDTKDILFICGGAF+DLEKTIS+RRQDSSIGFGAPVR NMR GG TSA V
Sbjct  461   RKHPRGDNIQIDTKDILFICGGAFVDLEKTISDRRQDSSIGFGAPVRANMRIGGATSAAV  520

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VESSDLI+YGLIPEF+GRFPILVSL ALTE+QLVQVLTEPKNALGKQYKK+F 
Sbjct  521   TSSLLESVESSDLIAYGLIPEFIGRFPILVSLLALTEDQLVQVLTEPKNALGKQYKKLFG  580

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             MN VKLH+TE ALR IA+KAI KNTGARGLR+ILESIL +AMYEIPDV++G   +DAV+V
Sbjct  581   MNKVKLHYTEKALRMIAKKAIAKNTGARGLRAILESILTEAMYEIPDVKTGIERVDAVVV  640

Query  447   ddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPK---KIVEGSEADIEVERDLPSI  283
             D+E+VG    RGCG KIL G GAL+ YL+  + KE +   ++VE  E + E+     SI
Sbjct  641   DEESVGPLNSRGCGGKILRGDGALERYLAETKLKESQENLEVVELQEGETELSSRAMSI  699


 Score = 95.5 bits (236),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 83/137 (61%), Gaps = 18/137 (13%)
 Frame = -1

Query  1774  FVDRGYDNSRNLSSCGKIDISSSYG-DPPE-------------VWQPPGDGIVVRPGVKF  1637
             F D  Y N+R   S    + + S+G +PPE             V  PPG      PGV F
Sbjct  191   FSDENYVNNRLRVSF--FETARSFGGEPPENWPPGPPPVNGLAVHSPPGPPFA--PGVNF  246

Query  1636  VQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLS  1457
             V+    +G +SGSGG      K   WGGSNLG + PTPKEICKGLDKFVIGQE+AKKVLS
Sbjct  247   VRATGPNGSTSGSGGNGAGDGKKNEWGGSNLGKDLPTPKEICKGLDKFVIGQEKAKKVLS  306

Query  1456  VAVYNHYKRIYNDSAQK  1406
             VAV+NHYKRIY+ S QK
Sbjct  307   VAVHNHYKRIYHASLQK  323



>ref|XP_010677229.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Beta vulgaris subsp. vulgaris]
Length=636

 Score =   530 bits (1366),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 266/338 (79%), Positives = 309/338 (91%), Gaps = 1/338 (0%)
 Frame = -2

Query  1362  TEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESIL  1183
              E++ VELEKSN+++MGPTGSGKTLLAKTLAR VNVPFV+ADATTLTQAGYVGEDVESIL
Sbjct  296   AENDDVELEKSNVILMGPTGSGKTLLAKTLARFVNVPFVVADATTLTQAGYVGEDVESIL  355

Query  1182  YKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNV  1003
             YKLLT ADYNVQAAQQGIVYIDE+DKITKKAE+ N+SRDVSGEGVQQALLK+LEG+IVNV
Sbjct  356   YKLLTAADYNVQAAQQGIVYIDEIDKITKKAENFNVSRDVSGEGVQQALLKILEGSIVNV  415

Query  1002  PEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGV  823
             PEKG RK PRG+++QIDTKDILFICGGAF+DL+KTISERRQD+SIGFGAPVR N+R+ GV
Sbjct  416   PEKGGRKPPRGEHVQIDTKDILFICGGAFVDLDKTISERRQDASIGFGAPVRENLRSAGV  475

Query  822   TSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQY  643
              SAVVTS+LLETVESSDLI+YGLIPEF+GRFPILVSL++LTE+QLVQVLTEPKNALGKQY
Sbjct  476   ASAVVTSALLETVESSDLIAYGLIPEFIGRFPILVSLSSLTEDQLVQVLTEPKNALGKQY  535

Query  642   KKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvi  463
             KK+F MNNVKLHFTE ALR IA+K++ KNTGARGLR+ LES+L +AMYEIPD+++G++ I
Sbjct  536   KKLFSMNNVKLHFTEKALRLIAKKSMVKNTGARGLRAQLESVLTEAMYEIPDMKAGNDGI  595

Query  462   davivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQ  352
             +AV+VDDE++G     GCGAKIL G G+L  YL+  E 
Sbjct  596   NAVLVDDESMGSVSSPGCGAKILRGDGSLKDYLANAEH  633


 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDS  1415
             WGG+ LG + PTPKEICKGLDKFVIGQ  AKKVLSVAV+NHYKRI + S
Sbjct  235   WGGAQLGKDLPTPKEICKGLDKFVIGQHHAKKVLSVAVHNHYKRIQHAS  283



>ref|XP_006303712.1| hypothetical protein CARUB_v10011824mg [Capsella rubella]
 gb|EOA36610.1| hypothetical protein CARUB_v10011824mg [Capsella rubella]
Length=652

 Score =   531 bits (1367),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 272/339 (80%), Positives = 307/339 (91%), Gaps = 1/339 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VEL+KSN+L+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVG+DVESIL+
Sbjct  299   DDDNVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGDDVESILH  358

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVA++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLK+LEGTIVNVP
Sbjct  359   KLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKLLEGTIVNVP  418

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
              KGARKHPRGD+IQIDTKDILFICGGAF+DLEKTI +RRQDSSIGFGAPVR NM T GVT
Sbjct  419   GKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDRRQDSSIGFGAPVRANMATSGVT  478

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             S  +TSSLLE+VES+DL +YGLIPEFVGRFPILVSL+ALTE+QLV+VL EPKNALGKQYK
Sbjct  479   SGAITSSLLESVESADLTAYGLIPEFVGRFPILVSLSALTEDQLVRVLVEPKNALGKQYK  538

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE AL  I+++A+ KNTGARGLR++LESIL +AM+EIPD + GD  ID
Sbjct  539   KLFSMNNVKLHFTEKALGIISKQAMVKNTGARGLRALLESILTEAMFEIPDDKKGDERID  598

Query  459   avivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKE  346
             AVIVD+E+ G E  RGC AK+L G GA + YLS N+ KE
Sbjct  599   AVIVDEESTGSEASRGCIAKVLRGDGAFERYLSENKSKE  637


 Score = 91.7 bits (226),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG+ LG +FPTPKEICK LDKFVIGQ RAKKVLSVAVYNHYKRIY+ S +K
Sbjct  239   WGGAGLGRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIYHTSMKK  290



>ref|XP_002893761.1| hypothetical protein ARALYDRAFT_473508 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70020.1| hypothetical protein ARALYDRAFT_473508 [Arabidopsis lyrata subsp. 
lyrata]
Length=660

 Score =   531 bits (1368),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 270/339 (80%), Positives = 306/339 (90%), Gaps = 1/339 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VEL+KSN+L+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVG+DVESIL+
Sbjct  304   DDDNVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGDDVESILH  363

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVA++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLK+LEGTIVNVP
Sbjct  364   KLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKLLEGTIVNVP  423

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
              KGARKHPRGD+IQIDTKDILFICGGAF+DLEKTI +RRQDSSIGFGAPVR NM T GVT
Sbjct  424   GKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDRRQDSSIGFGAPVRANMATSGVT  483

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             S  +TSSLLE+VES+DL +YGLIPEFVGRFPILVSL+ALTE+QL++VL EPKNALGKQYK
Sbjct  484   SGAITSSLLESVESADLTAYGLIPEFVGRFPILVSLSALTEDQLIRVLVEPKNALGKQYK  543

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE AL  I+++A+ KNTGARGLR++LESIL +AM+EIPD + GD  ID
Sbjct  544   KLFSMNNVKLHFTEKALEIISKQAMVKNTGARGLRALLESILTEAMFEIPDDKKGDERID  603

Query  459   avivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKE  346
             AVIVD+E+   E  RGC AKIL G GA + YLS N+ K+
Sbjct  604   AVIVDEESTSSEASRGCSAKILRGDGAFERYLSENKSKD  642


 Score = 92.4 bits (228),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG++LG +FPTPKEICK LDKFVIGQ RAKKVLSVAVYNHYKRIY+ S +K
Sbjct  244   WGGASLGRDFPTPKEICKWLDKFVIGQTRAKKVLSVAVYNHYKRIYHTSMKK  295



>ref|XP_010677227.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Beta vulgaris subsp. vulgaris]
Length=655

 Score =   531 bits (1367),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 266/338 (79%), Positives = 309/338 (91%), Gaps = 1/338 (0%)
 Frame = -2

Query  1362  TEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESIL  1183
              E++ VELEKSN+++MGPTGSGKTLLAKTLAR VNVPFV+ADATTLTQAGYVGEDVESIL
Sbjct  296   AENDDVELEKSNVILMGPTGSGKTLLAKTLARFVNVPFVVADATTLTQAGYVGEDVESIL  355

Query  1182  YKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNV  1003
             YKLLT ADYNVQAAQQGIVYIDE+DKITKKAE+ N+SRDVSGEGVQQALLK+LEG+IVNV
Sbjct  356   YKLLTAADYNVQAAQQGIVYIDEIDKITKKAENFNVSRDVSGEGVQQALLKILEGSIVNV  415

Query  1002  PEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGV  823
             PEKG RK PRG+++QIDTKDILFICGGAF+DL+KTISERRQD+SIGFGAPVR N+R+ GV
Sbjct  416   PEKGGRKPPRGEHVQIDTKDILFICGGAFVDLDKTISERRQDASIGFGAPVRENLRSAGV  475

Query  822   TSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQY  643
              SAVVTS+LLETVESSDLI+YGLIPEF+GRFPILVSL++LTE+QLVQVLTEPKNALGKQY
Sbjct  476   ASAVVTSALLETVESSDLIAYGLIPEFIGRFPILVSLSSLTEDQLVQVLTEPKNALGKQY  535

Query  642   KKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvi  463
             KK+F MNNVKLHFTE ALR IA+K++ KNTGARGLR+ LES+L +AMYEIPD+++G++ I
Sbjct  536   KKLFSMNNVKLHFTEKALRLIAKKSMVKNTGARGLRAQLESVLTEAMYEIPDMKAGNDGI  595

Query  462   davivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQ  352
             +AV+VDDE++G     GCGAKIL G G+L  YL+  E 
Sbjct  596   NAVLVDDESMGSVSSPGCGAKILRGDGSLKDYLANAEH  633


 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDS  1415
             WGG+ LG + PTPKEICKGLDKFVIGQ  AKKVLSVAV+NHYKRI + S
Sbjct  235   WGGAQLGKDLPTPKEICKGLDKFVIGQHHAKKVLSVAVHNHYKRIQHAS  283



>gb|KFK45073.1| hypothetical protein AALP_AA1G339900 [Arabis alpina]
Length=653

 Score =   531 bits (1367),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 271/339 (80%), Positives = 308/339 (91%), Gaps = 1/339 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VEL+KSN+L+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESIL+
Sbjct  297   DDDNVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILH  356

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLT A++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLK+LEGTIVNVP
Sbjct  357   KLLTAAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKLLEGTIVNVP  416

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
              KGARKHPRGD+IQIDTKDILFICGGAF+DLEKTI +RRQDSSIGFGAPVR NM T GVT
Sbjct  417   GKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDRRQDSSIGFGAPVRANMATSGVT  476

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             S VVTSSLLE+VES+DL +YGLIPEFVGRFPILVSL+ALTE+QL++VL EPKNALGKQYK
Sbjct  477   SGVVTSSLLESVESADLTAYGLIPEFVGRFPILVSLSALTEDQLIRVLVEPKNALGKQYK  536

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE AL  I+++A+ KNTGARGLR++LE+IL +AM+EIPD ++GD  ID
Sbjct  537   KLFSMNNVKLHFTEKALGLISKQAMVKNTGARGLRALLETILTEAMFEIPDAKNGDERID  596

Query  459   avivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKE  346
             AVIVD+E+ G E  RGC A+IL G GA + YLS N+ K+
Sbjct  597   AVIVDEESTGSEASRGCTAEILRGDGAFERYLSENKLKD  635


 Score = 92.0 bits (227),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG++LG +FPTPKEICK LDKFVIGQ RAKKVLSVAVYNHYKRIY+ S +K
Sbjct  237   WGGASLGRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIYHTSMKK  288



>gb|KDP37794.1| hypothetical protein JCGZ_06696 [Jatropha curcas]
Length=726

 Score =   533 bits (1373),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 294/408 (72%), Positives = 343/408 (84%), Gaps = 5/408 (1%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL    + + + K+  S+ +Y    R    +L K     E  +SD ++  + + 
Sbjct  309   PKEICKGLDKFVIGQDKAKKVLSVAVYNHYKRIYHASLPKGSA-AEAGNSDAID--DDDN  365

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADAT LTQAGYVGEDVESILYKLLT
Sbjct  366   VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATALTQAGYVGEDVESILYKLLT  425

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
             VA++NVQAAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA
Sbjct  426   VAEFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  485

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR G V +A V
Sbjct  486   RKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRAGRVINAAV  545

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VESSDLI+YGLIPEFVGRFPILVSL ALTE+QLV++LTEPKNALGKQYKK+F 
Sbjct  546   TSSLLESVESSDLIAYGLIPEFVGRFPILVSLLALTEDQLVRILTEPKNALGKQYKKLFS  605

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             MNNV LHFTE ALR IA+KA+ KNTGARGLR+ILE+IL +AMYEIPDVR+G++ ID V+V
Sbjct  606   MNNVTLHFTEKALRLIAKKAMAKNTGARGLRAILENILTEAMYEIPDVRTGNDRIDTVVV  665

Query  447   ddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIE  307
             D+E+VG     GCG KIL G+GAL+ YL+  + K+  + VE ++ +++
Sbjct  666   DEESVGSVNAPGCGGKILRGEGALEHYLAEYKMKQAMENVEAADTELQ  713


 Score =   100 bits (248),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 71/120 (59%), Gaps = 16/120 (13%)
 Frame = -1

Query  1717  ISSSYGDPPEVWQPPGDGIVV---------RPGVKFVQVGEVDgpssgsgggfgsGA---  1574
             + S  G+PPE W PPG  ++           PGV  ++     G   GS GG G      
Sbjct  229   LRSYAGEPPENWPPPGGNVLAVHTPPGPPFAPGVNVIRTAGPGGGGGGSNGGGGGAEGAA  288

Query  1573  ----KDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
                 +   WGGSNLG   PTPKEICKGLDKFVIGQ++AKKVLSVAVYNHYKRIY+ S  K
Sbjct  289   GGGERSNGWGGSNLGKELPTPKEICKGLDKFVIGQDKAKKVLSVAVYNHYKRIYHASLPK  348



>ref|XP_009616314.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Nicotiana tomentosiformis]
Length=693

 Score =   531 bits (1368),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 294/390 (75%), Positives = 332/390 (85%), Gaps = 10/390 (3%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLK-SDRNPEKNDSDKVEGTEHE  1351
             P++  KGL    + ++  K+  S+ +Y    R    +L K S     ++DS+       E
Sbjct  279   PKEICKGLDKFVIGQERAKKVLSVGVYNHYKRIYHASLQKGSGAESARDDSE-------E  331

Query  1350  AVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLL  1171
              VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLL
Sbjct  332   NVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLL  391

Query  1170  TVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKG  991
             TVA++NVQAAQQG++YIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKG
Sbjct  392   TVAEFNVQAAQQGMIYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKG  451

Query  990   ARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAV  811
              RKHPRGD+IQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTGGVT+A 
Sbjct  452   QRKHPRGDHIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTGGVTNAT  511

Query  810   VTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMF  631
             VTSSLLE+VESSD ISYGLIPEF+GRFPILVSL+ALTE+QLVQVLTEPKNAL KQYKK+F
Sbjct  512   VTSSLLESVESSDFISYGLIPEFIGRFPILVSLSALTEDQLVQVLTEPKNALCKQYKKLF  571

Query  630   QMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidavi  451
              MNN KLHFTE ALR IA+KA+ KNTGARGLR+ILESIL DAMYEIPDV++GD+ +DA++
Sbjct  572   SMNNTKLHFTEGALRLIAKKAMAKNTGARGLRAILESILTDAMYEIPDVKAGDDRVDAIV  631

Query  450   vddeaVGH-EGRGCGAKILYGKGALDCYLS  364
             VD+E+VG     GCG K+L G GAL  YL+
Sbjct  632   VDEESVGAVNAPGCGGKVLRGDGALQRYLA  661


 Score = 99.4 bits (246),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGGSNLG N PTPKEICKGLDKFVIGQERAKKVLSV VYNHYKRIY+ S QK
Sbjct  267   WGGSNLGKNLPTPKEICKGLDKFVIGQERAKKVLSVGVYNHYKRIYHASLQK  318



>ref|XP_008459496.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial, partial [Cucumis melo]
Length=669

 Score =   530 bits (1365),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 297/419 (71%), Positives = 345/419 (82%), Gaps = 8/419 (2%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL    + +++ K+  S+ ++    R    +L K   N E    D ++  + ++
Sbjct  254   PKEICKGLDKFVIGQEKAKKVLSVAVHNHYKRIYHASLQKGSGN-ESGTRDTID--DDDS  310

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLL 
Sbjct  311   VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLA  370

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              A++NVQAAQQG++YIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKG+
Sbjct  371   AAEFNVQAAQQGMIYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGS  430

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPRGDNIQIDTKDILFICGGAF+DLEKTIS+RRQDSSIGFGAPVR NMR  G TSA V
Sbjct  431   RKHPRGDNIQIDTKDILFICGGAFVDLEKTISDRRQDSSIGFGAPVRANMRISGATSAAV  490

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VESSDLI+YGLIPEF+GRFPILVSL ALTE+QLVQVLTEPKNALGKQYKK+F 
Sbjct  491   TSSLLESVESSDLIAYGLIPEFIGRFPILVSLLALTEDQLVQVLTEPKNALGKQYKKLFG  550

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             MN VKLH+TE ALR IA+KAI KNTGARGLR+ILESIL +AMYEIPDV++G+  +DAV+V
Sbjct  551   MNKVKLHYTEKALRMIAKKAIAKNTGARGLRAILESILTEAMYEIPDVKTGNERVDAVVV  610

Query  447   ddeaVGH-EGRGCGAKILYGKGALDCYLSG---NEQKEPKKIVEGSEADIEVERDLPSI  283
             D+E+VG    RGCG KIL G GAL+ YL+     E +E  ++VE  E + E+     SI
Sbjct  611   DEESVGPLNSRGCGGKILRGDGALERYLAEIKLKESQENFEVVELQEGETELSSRAMSI  669


 Score = 95.9 bits (237),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 83/137 (61%), Gaps = 18/137 (13%)
 Frame = -1

Query  1774  FVDRGYDNSRNLSSCGKIDISSSYG-DPPE-------------VWQPPGDGIVVRPGVKF  1637
             F D  Y N+R   S    + + S+G +PPE             V  PPG      PGV F
Sbjct  161   FSDENYVNNRLRVSF--FETARSFGGEPPENWPPGPPPVNGLAVHSPPGPPFA--PGVNF  216

Query  1636  VQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLS  1457
             V+    +G +SGSGG      K   WGGSNLG + PTPKEICKGLDKFVIGQE+AKKVLS
Sbjct  217   VRATGPNGSTSGSGGNGAGDGKKSEWGGSNLGKDLPTPKEICKGLDKFVIGQEKAKKVLS  276

Query  1456  VAVYNHYKRIYNDSAQK  1406
             VAV+NHYKRIY+ S QK
Sbjct  277   VAVHNHYKRIYHASLQK  293



>ref|XP_009781367.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Nicotiana sylvestris]
Length=694

 Score =   531 bits (1368),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 293/390 (75%), Positives = 331/390 (85%), Gaps = 10/390 (3%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLK-SDRNPEKNDSDKVEGTEHE  1351
             P++  KGL    + ++  K+  S+ +Y    R    +L K S     ++DS+       E
Sbjct  280   PKEICKGLDKFVIGQERAKKVLSVGVYNHYKRIYHASLQKGSGAESARDDSE-------E  332

Query  1350  AVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLL  1171
              VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLL
Sbjct  333   NVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLL  392

Query  1170  TVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKG  991
             TVA++NVQAAQQG++YIDEVDKITKKAESLN+SRDVSGEGVQQALLKMLEGTIVNVPEKG
Sbjct  393   TVAEFNVQAAQQGMIYIDEVDKITKKAESLNVSRDVSGEGVQQALLKMLEGTIVNVPEKG  452

Query  990   ARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAV  811
              RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMRTGGVT+A 
Sbjct  453   QRKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRTGGVTNAT  512

Query  810   VTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMF  631
             VTSSLLE+VESSD ISYGLIPEF+GRFPILV+L+ALTE+QLVQVLTEPKNAL KQYKK+F
Sbjct  513   VTSSLLESVESSDFISYGLIPEFIGRFPILVNLSALTEDQLVQVLTEPKNALCKQYKKLF  572

Query  630   QMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidavi  451
              MNN KLHFTE ALR IA KA+ KNTGARGLR+ILESIL DAMYEIPDV++GD+ +DA++
Sbjct  573   SMNNTKLHFTEGALRLIAEKAMAKNTGARGLRAILESILTDAMYEIPDVKAGDDRVDAIV  632

Query  450   vddeaVGH-EGRGCGAKILYGKGALDCYLS  364
             VD+E+VG     GCG K+L G GAL  YL+
Sbjct  633   VDEESVGAVNAPGCGGKVLRGDGALQRYLA  662


 Score = 99.4 bits (246),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGGSNLG N PTPKEICKGLDKFVIGQERAKKVLSV VYNHYKRIY+ S QK
Sbjct  268   WGGSNLGKNLPTPKEICKGLDKFVIGQERAKKVLSVGVYNHYKRIYHASLQK  319



>gb|KHN27868.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Glycine 
soja]
Length=635

 Score =   528 bits (1361),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 276/364 (76%), Positives = 318/364 (87%), Gaps = 11/364 (3%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQA-------GYVGE  1201
             + + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQA       GYVGE
Sbjct  266   DDDNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAKDSTLQAGYVGE  325

Query  1200  DVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLE  1021
             DVESILYKLL  AD+NV AAQQGI+YIDEVDKITKKAESLNISRDVSGEGVQQALLKMLE
Sbjct  326   DVESILYKLLVAADFNVAAAQQGIIYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLE  385

Query  1020  GTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTN  841
             GTIVNVPEKGARK+PRGDNIQ+DTK+ILFICGGAFIDLEKTISERRQDSSIGFGAPVR N
Sbjct  386   GTIVNVPEKGARKNPRGDNIQMDTKNILFICGGAFIDLEKTISERRQDSSIGFGAPVRAN  445

Query  840   MRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKN  661
             MR  G+T + VTSSLLE+VES+DLI+YGLIPEF+GRFPILVSL+ALTE+QL  VLTEPKN
Sbjct  446   MRAVGITDSAVTSSLLESVESADLIAYGLIPEFIGRFPILVSLSALTEDQLTMVLTEPKN  505

Query  660   ALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVR  481
             ALGKQYKK+F MNNVKLHFTE+ALR IA+KA+ KNTGARGLR++LESIL +AM+EIPD++
Sbjct  506   ALGKQYKKLFSMNNVKLHFTENALRLIAKKAMAKNTGARGLRALLESILTEAMFEIPDIK  565

Query  480   SGdnvidavivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEV  304
             +G + +DAV++D+E+VG     GCG KIL+G GAL  YL+  + K+    V+  E+D++ 
Sbjct  566   TGSDRVDAVVIDEESVGSLTAPGCGGKILHGDGALKQYLA--KMKDSAVNVDVGESDLQ-  622

Query  303   ERDL  292
             E DL
Sbjct  623   EGDL  626



>ref|XP_010499875.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Camelina sativa]
 ref|XP_010499877.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Camelina sativa]
Length=666

 Score =   530 bits (1364),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 269/339 (79%), Positives = 307/339 (91%), Gaps = 1/339 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VEL+KSN+L+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVG+DVESIL+
Sbjct  310   DDDNVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGDDVESILH  369

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVA++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLK+LEGTIVNVP
Sbjct  370   KLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKLLEGTIVNVP  429

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
              KGARKHPRGD++QIDTKDILFICGGAF+DLEKTI +RRQDSSIGFGAPVR NM T GVT
Sbjct  430   GKGARKHPRGDHLQIDTKDILFICGGAFVDLEKTIVDRRQDSSIGFGAPVRANMATSGVT  489

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             S  +TSSLLE+VES+DL +YGLIPEFVGRFPILVSL+ALTE+QL++VL EPKNALGKQYK
Sbjct  490   SGALTSSLLESVESADLTAYGLIPEFVGRFPILVSLSALTEDQLIRVLVEPKNALGKQYK  549

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE AL  I+++A+ KNTGARGLR++LESIL +AM+EIPD + GD  ID
Sbjct  550   KLFSMNNVKLHFTEKALEIISKQAMVKNTGARGLRALLESILTEAMFEIPDDKKGDERID  609

Query  459   avivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKE  346
             AVIVD+E+ G E  RGC AK+L G GA + YLS N+ K+
Sbjct  610   AVIVDEESTGSEASRGCTAKVLKGDGAFERYLSENKSKD  648


 Score = 92.0 bits (227),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG++LG +FPTPKEICK LDKFVIGQ RAKKVLSVAVYNHYKRIY+ S +K
Sbjct  250   WGGASLGRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIYHTSMKK  301



>ref|NP_564423.3| ATP-dependent Clp protease [Arabidopsis thaliana]
 gb|AAU05486.1| At1g33360 [Arabidopsis thaliana]
 gb|AAU95429.1| At1g33360 [Arabidopsis thaliana]
 gb|AEE31587.1| ATP-dependent Clp protease [Arabidopsis thaliana]
Length=656

 Score =   529 bits (1362),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 270/339 (80%), Positives = 306/339 (90%), Gaps = 1/339 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VEL+KSN+L+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVG+DVESIL+
Sbjct  300   DDDNVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGDDVESILH  359

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVA++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLK+LEGTIVNVP
Sbjct  360   KLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKLLEGTIVNVP  419

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
              KGARKHPRGD+IQIDTKDILFICGGAF+DLEKTI +RRQDSSIGFGAPVR NM T GVT
Sbjct  420   GKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDRRQDSSIGFGAPVRANMATSGVT  479

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             S  +TSSLLE+VES+DL +YGLIPEFVGRFPILVSL+ALTE+QL++VL EPKNALGKQYK
Sbjct  480   SGAITSSLLESVESADLTAYGLIPEFVGRFPILVSLSALTEDQLIRVLVEPKNALGKQYK  539

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE AL  I+++A+ KNTGARGLR++LESIL +AM+EIPD + GD  ID
Sbjct  540   KLFSMNNVKLHFTEKALEIISKQAMVKNTGARGLRALLESILTEAMFEIPDDKKGDERID  599

Query  459   avivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKE  346
             AVIVD+E+   E  RGC AKIL G GA + YLS N+ K+
Sbjct  600   AVIVDEESTSSEASRGCTAKILRGDGAFERYLSENKSKD  638


 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG+ LG +FPTPKEICK LDKFVIGQ RAKKVLSVAVYNHYKRIY+ S +K
Sbjct  240   WGGAGLGRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIYHTSMKK  291



>gb|AAG51286.1|AC027035_9 CLP protease regulatory subunit CLPX, putative [Arabidopsis thaliana]
Length=650

 Score =   529 bits (1362),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 270/339 (80%), Positives = 306/339 (90%), Gaps = 1/339 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VEL+KSN+L+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVG+DVESIL+
Sbjct  306   DDDNVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGDDVESILH  365

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVA++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLK+LEGTIVNVP
Sbjct  366   KLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKLLEGTIVNVP  425

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
              KGARKHPRGD+IQIDTKDILFICGGAF+DLEKTI +RRQDSSIGFGAPVR NM T GVT
Sbjct  426   GKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDRRQDSSIGFGAPVRANMATSGVT  485

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             S  +TSSLLE+VES+DL +YGLIPEFVGRFPILVSL+ALTE+QL++VL EPKNALGKQYK
Sbjct  486   SGAITSSLLESVESADLTAYGLIPEFVGRFPILVSLSALTEDQLIRVLVEPKNALGKQYK  545

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE AL  I+++A+ KNTGARGLR++LESIL +AM+EIPD + GD  ID
Sbjct  546   KLFSMNNVKLHFTEKALEIISKQAMVKNTGARGLRALLESILTEAMFEIPDDKKGDERID  605

Query  459   avivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKE  346
             AVIVD+E+   E  RGC AKIL G GA + YLS N+ K+
Sbjct  606   AVIVDEESTSSEASRGCTAKILRGDGAFERYLSENKSKD  644


 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG+ LG +FPTPKEICK LDKFVIGQ RAKKVLSVAVYNHYKRIY+ S +K
Sbjct  240   WGGAGLGRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIYHTSMKK  291



>ref|XP_010682114.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Beta vulgaris subsp. vulgaris]
Length=677

 Score =   530 bits (1364),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 275/366 (75%), Positives = 320/366 (87%), Gaps = 6/366 (2%)
 Frame = -2

Query  1383  DSDKVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVG  1204
             D ++V+  + + VELEKSN+L+MGPTG GKTLLAKT+ARLVNVPFVIADATTLTQAGYVG
Sbjct  305   DGNEVKQDDFDIVELEKSNVLLMGPTGCGKTLLAKTMARLVNVPFVIADATTLTQAGYVG  364

Query  1203  EDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKML  1024
             EDVESILYKLLT A++NV+AAQQGIVYIDEVDKITKKAES N+ RDVSGEGVQQALLKML
Sbjct  365   EDVESILYKLLTAAEFNVEAAQQGIVYIDEVDKITKKAESSNVGRDVSGEGVQQALLKML  424

Query  1023  EGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRT  844
             EGTIVNVP+KG+RK+PRGD+IQI+TKDILFICGGAF+DLEKTISERR DSSIGFGAPVR 
Sbjct  425   EGTIVNVPDKGSRKNPRGDSIQINTKDILFICGGAFVDLEKTISERRHDSSIGFGAPVRA  484

Query  843   NMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPK  664
             NMR+GG+T+AVV SSLLETVESSDLI+YGLIPEFVGRFP+LVSL+AL E+QLVQVL EPK
Sbjct  485   NMRSGGMTNAVVASSLLETVESSDLIAYGLIPEFVGRFPVLVSLSALNEDQLVQVLMEPK  544

Query  663   NALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDV  484
             NALGKQYKKMF MN+ K H TE+ALR IARKAI KNTGARGLRSILE+IL +AMYE+PDV
Sbjct  545   NALGKQYKKMFSMNDAKFHITEEALRLIARKAIVKNTGARGLRSILEAILTEAMYEVPDV  604

Query  483   RSGdnvidavivddeaVGHEGR-GCGAKILYGKGALDCYLS---GNEQKEPKKI--VEGS  322
             ++G + +DAV+VD EAVG   R G GAKIL G  A D +L     ++Q E  ++  +E  
Sbjct  605   KTGTDRVDAVLVDGEAVGSAERLGSGAKILRGDHAFDHFLQETKSSDQMEEYEVGKIESL  664

Query  321   EADIEV  304
             E+D+++
Sbjct  665   ESDLQI  670


 Score = 92.4 bits (228),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG+NLG +FPTPKEIC+GLD+FVIGQERAKKVLSVAVYNHYKR+   S +K
Sbjct  247   WGGANLGKDFPTPKEICRGLDEFVIGQERAKKVLSVAVYNHYKRVNYASEEK  298



>ref|XP_010461163.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Camelina sativa]
Length=665

 Score =   529 bits (1362),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 269/339 (79%), Positives = 306/339 (90%), Gaps = 1/339 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VEL+KSN+L+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVG+DVESIL+
Sbjct  309   DDDNVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGDDVESILH  368

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVA++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLK+LEGT VNVP
Sbjct  369   KLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKLLEGTTVNVP  428

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
              KGARKHPRGD+IQIDTKDILFICGGAF+DLEKTI +RRQDSSIGFGAPVR NM T GVT
Sbjct  429   GKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDRRQDSSIGFGAPVRANMATSGVT  488

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             S  +TSSLLE+VES+DL +YGLIPEFVGRFPILVSL+ALTE+QL++VL EPKNALGKQYK
Sbjct  489   SGALTSSLLESVESADLTAYGLIPEFVGRFPILVSLSALTEDQLIRVLVEPKNALGKQYK  548

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE AL  I+++A+ KNTGARGLR++LESIL +AM+EIPD + GD  ID
Sbjct  549   KLFSMNNVKLHFTEKALEIISKQAMVKNTGARGLRALLESILTEAMFEIPDDKKGDERID  608

Query  459   avivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKE  346
             AVIVD+E+ G E  RGC AK+L G GA + YLS N+ K+
Sbjct  609   AVIVDEESTGSEASRGCTAKVLRGDGAFERYLSENKSKD  647


 Score = 92.4 bits (228),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG++LG +FPTPKEICK LDKFVIGQ RAKKVLSVAVYNHYKRIY+ S +K
Sbjct  249   WGGASLGRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIYHTSMKK  300



>emb|CDX86004.1| BnaC06g21300D [Brassica napus]
Length=615

 Score =   527 bits (1357),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 267/339 (79%), Positives = 305/339 (90%), Gaps = 1/339 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VEL+KSN+L+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVG+DVESIL+
Sbjct  259   DDDNVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGDDVESILH  318

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVA++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLK+LEGTIVNVP
Sbjct  319   KLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKLLEGTIVNVP  378

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
              KGARKHPR D+IQIDTKDILFICGGAF+DLEKTI +RRQDSSIGFGAPVR NM T GVT
Sbjct  379   GKGARKHPRADHIQIDTKDILFICGGAFVDLEKTIVDRRQDSSIGFGAPVRANMATSGVT  438

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             S  +TSSLLE+VES+DL +YGLIPEFVGRFPILVSL+ALTE+QL++VL EPKNALGKQYK
Sbjct  439   SGAITSSLLESVESADLAAYGLIPEFVGRFPILVSLSALTEDQLIRVLVEPKNALGKQYK  498

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE AL  I++ A+ KNTGARGLR++LESIL +AM+EIPD + GD  ID
Sbjct  499   KLFSMNNVKLHFTEKALGIISKLAMVKNTGARGLRALLESILTEAMFEIPDAKKGDERID  558

Query  459   avivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKE  346
             AVIVD+++ G E  RGC AK+L G GA + YL+ N+ K+
Sbjct  559   AVIVDEDSTGSEASRGCTAKLLRGDGAFERYLNENKSKD  597


 Score = 92.4 bits (228),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG++LG +FPTPKEICK LDKFVIGQ RAKKVLSVAVYNHYKRIY+ S +K
Sbjct  199   WGGASLGRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIYHTSMKK  250



>gb|AAG51217.1|AC051630_14 CLP protease regulatory subunit CLPX, putative; 15869-19379 [Arabidopsis 
thaliana]
Length=670

 Score =   529 bits (1362),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 270/339 (80%), Positives = 306/339 (90%), Gaps = 1/339 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VEL+KSN+L+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVG+DVESIL+
Sbjct  326   DDDNVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGDDVESILH  385

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVA++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLK+LEGTIVNVP
Sbjct  386   KLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKLLEGTIVNVP  445

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
              KGARKHPRGD+IQIDTKDILFICGGAF+DLEKTI +RRQDSSIGFGAPVR NM T GVT
Sbjct  446   GKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDRRQDSSIGFGAPVRANMATSGVT  505

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             S  +TSSLLE+VES+DL +YGLIPEFVGRFPILVSL+ALTE+QL++VL EPKNALGKQYK
Sbjct  506   SGAITSSLLESVESADLTAYGLIPEFVGRFPILVSLSALTEDQLIRVLVEPKNALGKQYK  565

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE AL  I+++A+ KNTGARGLR++LESIL +AM+EIPD + GD  ID
Sbjct  566   KLFSMNNVKLHFTEKALEIISKQAMVKNTGARGLRALLESILTEAMFEIPDDKKGDERID  625

Query  459   avivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKE  346
             AVIVD+E+   E  RGC AKIL G GA + YLS N+ K+
Sbjct  626   AVIVDEESTSSEASRGCTAKILRGDGAFERYLSENKSKD  664


 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG+ LG +FPTPKEICK LDKFVIGQ RAKKVLSVAVYNHYKRIY+ S +K
Sbjct  240   WGGAGLGRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIYHTSMKK  291



>ref|XP_009114799.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent Clp protease ATP-binding 
subunit clpX-like, mitochondrial [Brassica rapa]
Length=647

 Score =   528 bits (1359),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 268/339 (79%), Positives = 305/339 (90%), Gaps = 1/339 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VEL+KSN+L+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVG+DVESIL+
Sbjct  291   DDDNVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGDDVESILH  350

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVA++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLK+LEGTIVNVP
Sbjct  351   KLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKLLEGTIVNVP  410

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
              KGARKHPR D+IQIDTKDILFICGGAF+DLEKTI +RRQDSSIGFGAPVR NM T GVT
Sbjct  411   GKGARKHPRADHIQIDTKDILFICGGAFVDLEKTIVDRRQDSSIGFGAPVRANMATSGVT  470

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             S  VTSSLLE+VES+DL +YGLIPEFVGRFPILVSL+ALTE+QL++VL EPKNALGKQYK
Sbjct  471   SGAVTSSLLESVESADLTAYGLIPEFVGRFPILVSLSALTEDQLIRVLVEPKNALGKQYK  530

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE AL  I++ A+ KNTGARGLR++LESIL +AM+EIPD + GD  ID
Sbjct  531   KLFSMNNVKLHFTEKALGIISKLAMVKNTGARGLRALLESILTEAMFEIPDAKKGDERID  590

Query  459   avivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKE  346
             AVIVD+++ G E  RGC AK+L G GA + YL+ N+ K+
Sbjct  591   AVIVDEDSTGSEASRGCTAKLLRGDGAFERYLNENKSKD  629


 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG+ LG +FPTPKEICK LDKFVIGQ RAKKVLSVAVYNHYKRIY+ S +K
Sbjct  231   WGGATLGTDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIYHTSMKK  282



>ref|XP_008788320.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Phoenix dactylifera]
 ref|XP_008788321.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Phoenix dactylifera]
Length=671

 Score =   528 bits (1361),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 298/415 (72%), Positives = 339/415 (82%), Gaps = 11/415 (3%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL    + ++  K+  S+ +Y    R    +L K        D  K+E    + 
Sbjct  261   PKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHASLQKGS----AADPGKLEVKIDDH  316

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLLT
Sbjct  317   VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLT  376

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
             VAD+NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA
Sbjct  377   VADFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  436

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPR D+IQIDTKDILFICGGAF+DLEKTISERR DSSIGFGAPVR NM TGG+T+ VV
Sbjct  437   RKHPRNDHIQIDTKDILFICGGAFVDLEKTISERRHDSSIGFGAPVRANMSTGGLTNLVV  496

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VESSDL++YGLIPEF+GRFPILVSL+AL E+QL QVLTEPKNALGKQYKK+F 
Sbjct  497   TSSLLESVESSDLVAYGLIPEFIGRFPILVSLSALNEDQLFQVLTEPKNALGKQYKKLFS  556

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             MNNVKLHFT+ ALR IA+KA+ KNTGARGLR+ILESIL +AMYEIPD+++G+  +D V+V
Sbjct  557   MNNVKLHFTKAALRLIAKKAMEKNTGARGLRAILESILTEAMYEIPDMKTGNERVDGVVV  616

Query  447   ddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPS  286
             D+EA+G   R GCGAKIL G GAL+ YL  N     K      E D+E E +L S
Sbjct  617   DEEAIGSLDRPGCGAKILQGDGALEHYLLQN-----KADTNQLEGDLEGETELAS  666


 Score = 94.4 bits (233),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -1

Query  1558  GGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             GGSNLG + PTPKEICKGLDKFVIGQ+RAKKVLSVAVYNHYKRIY+ S QK
Sbjct  250   GGSNLGKDLPTPKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHASLQK  300



>emb|CDX93769.1| BnaA09g23690D [Brassica napus]
Length=641

 Score =   528 bits (1359),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 268/339 (79%), Positives = 305/339 (90%), Gaps = 1/339 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VEL+KSN+L+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVG+DVESIL+
Sbjct  285   DDDNVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGDDVESILH  344

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVA++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLK+LEGTIVNVP
Sbjct  345   KLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKLLEGTIVNVP  404

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
              KGARKHPR D+IQIDTKDILFICGGAF+DLEKTI +RRQDSSIGFGAPVR NM T GVT
Sbjct  405   GKGARKHPRADHIQIDTKDILFICGGAFVDLEKTIVDRRQDSSIGFGAPVRANMATSGVT  464

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             S  VTSSLLE+VES+DL +YGLIPEFVGRFPILVSL+ALTE+QL++VL EPKNALGKQYK
Sbjct  465   SGAVTSSLLESVESADLTAYGLIPEFVGRFPILVSLSALTEDQLIRVLVEPKNALGKQYK  524

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE AL  I++ A+ KNTGARGLR++LESIL +AM+EIPD + GD  ID
Sbjct  525   KLFSMNNVKLHFTEKALGIISKLAMVKNTGARGLRALLESILTEAMFEIPDAKKGDERID  584

Query  459   avivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKE  346
             AVIVD+++ G E  RGC AK+L G GA + YL+ N+ K+
Sbjct  585   AVIVDEDSTGSEASRGCTAKLLRGDGAFERYLNENKSKD  623


 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG+ LG +FPTPKEICK LDKFVIGQ RAKKVLSVAVYNHYKRIY+ S +K
Sbjct  225   WGGATLGTDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIYHTSMKK  276



>ref|XP_009404286.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Musa acuminata subsp. malaccensis]
Length=682

 Score =   529 bits (1362),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 292/396 (74%), Positives = 336/396 (85%), Gaps = 4/396 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  ++ +Y    R    +L K       N     EG  
Sbjct  261   FPTPKEICKGLDKYVIGQERAKKVLAVAVYNHYKRIYHASLQKGSEADHGNFD--TEGNN  318

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  319   DDNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  378

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTVA++NV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  379   LLTVAEFNVLAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  438

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR+GG+T+
Sbjct  439   KGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRSGGLTN  498

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A+VTSSLLE+VESSDLI+YGLIPEFVGRFPILVSL +L+E+QLVQVLTEPKNALG+QY+K
Sbjct  499   ALVTSSLLESVESSDLIAYGLIPEFVGRFPILVSLLSLSEDQLVQVLTEPKNALGRQYRK  558

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             +F MNNVKLHFT  ALR IA+KA+ KNTGARGLR+ILES+L++AM+EIPDV++G   IDA
Sbjct  559   LFSMNNVKLHFTGTALRLIAKKAMAKNTGARGLRAILESMLIEAMFEIPDVKTGCERIDA  618

Query  456   vivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQ  352
             V+VD+EA+G   + GCGAKIL G  AL+ YLS N++
Sbjct  619   VVVDEEAIGSADKPGCGAKILRGVDALEGYLSENDK  654


 Score = 90.1 bits (222),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 72/119 (61%), Gaps = 15/119 (13%)
 Frame = -1

Query  1717  ISSSYG-DPPEVWQP-PG----DGIVVRP--------GVKFVQVG-EVDgpssgsgggfg  1583
             + SSYG +PPE W P PG    +G+ V           +  V+V         G   G  
Sbjct  185   LKSSYGGEPPEKWPPMPGPPESNGLAVHTPPGPPFPPNLNVVRVAGPGGSGGGGGSSGGS  244

Query  1582  sGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
                    WGGSNLG NFPTPKEICKGLDK+VIGQERAKKVL+VAVYNHYKRIY+ S QK
Sbjct  245   GFGGKDGWGGSNLGKNFPTPKEICKGLDKYVIGQERAKKVLAVAVYNHYKRIYHASLQK  303



>ref|XP_008781975.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Phoenix dactylifera]
Length=666

 Score =   528 bits (1360),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 287/368 (78%), Positives = 327/368 (89%), Gaps = 2/368 (1%)
 Frame = -2

Query  1383  DSDKVEG-TEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYV  1207
             DS   E   + + VELEKSN+L+MG TGSGKTLLAKTLAR VNVPFVIADATTLTQAGYV
Sbjct  294   DSGNFEAENDDDNVELEKSNVLLMGLTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYV  353

Query  1206  GEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKM  1027
             GEDVES+LYKLLTVA++NVQAAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKM
Sbjct  354   GEDVESMLYKLLTVAEFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKM  413

Query  1026  LEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR  847
             LEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAP+R
Sbjct  414   LEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPIR  473

Query  846   TNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEP  667
              NMR  G+T+A VTSSLLE+VESSD I+YGLIPEFVGRFP+LVSL+AL+E+QLVQVL EP
Sbjct  474   ANMRASGLTNAAVTSSLLESVESSDFIAYGLIPEFVGRFPVLVSLSALSEDQLVQVLMEP  533

Query  666   KNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPD  487
             KNA+GKQ+KK+F+MNNV LHFT+ ALR IA+KA+ KNTGARGLR+ILE+IL DAMYEIPD
Sbjct  534   KNAIGKQFKKLFRMNNVTLHFTDTALRLIAKKALAKNTGARGLRAILENILTDAMYEIPD  593

Query  486   VRSGdnvidavivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADI  310
             V++GD  IDAV+VD+EAVG   R G GAKIL+G GAL+ YL  N+ K+   +V+GSE ++
Sbjct  594   VKTGDEQIDAVVVDEEAVGSVDRPGSGAKILHGDGALEQYLKENKIKDRVAMVDGSEGEL  653

Query  309   EVERDLPS  286
             E   +L S
Sbjct  654   EGGSELSS  661


 Score = 92.0 bits (227),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = -1

Query  1573  KDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             +DG WGG+NLG   PTPKEICKGLDK+V+GQ+ AKKVLSVAVYNHYKRIY+ S QK
Sbjct  235   EDG-WGGANLGKELPTPKEICKGLDKYVVGQDNAKKVLSVAVYNHYKRIYHASLQK  289



>ref|XP_006356538.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Solanum tuberosum]
Length=684

 Score =   528 bits (1360),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 295/426 (69%), Positives = 345/426 (81%), Gaps = 15/426 (4%)
 Frame = -2

Query  1617  MVRARALVVGSGQGLKMGAGEAPIWV-----QIFRPPRKFAKGLISL*LVRKEPKRS-SL  1456
             ++RA      +G G   G+ E   W      +    P++  KGL +  + ++  K+  S+
Sbjct  234   LIRANGTEGKNGGGKDEGSDEKSGWGGSNLGKNLPTPKEICKGLDTFVIGQERAKKVLSV  293

Query  1455  *LYiiiIRESTMTLLK-SDRNPEKNDSDKVEGTEHEAVELEKSNILVMGPTGSGKTLLAK  1279
              +Y    R    +L K S     K+D++       E VELEKSN+L+MGPTGSGKTLLAK
Sbjct  294   GVYNHYKRIYHASLQKGSGAESPKDDNE-------ENVELEKSNVLLMGPTGSGKTLLAK  346

Query  1278  TLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKIT  1099
             TLAR VNVPFVIADATTLTQAGYVGEDVESILYKLL+VA++NVQAAQQG++YIDEVDKIT
Sbjct  347   TLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLSVAEFNVQAAQQGMIYIDEVDKIT  406

Query  1098  KKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGA  919
             KKAESLN+SRDVSGEGVQQALLKMLEGTIV+VPEKGARKHPRG+NIQIDTKDILFICGGA
Sbjct  407   KKAESLNVSRDVSGEGVQQALLKMLEGTIVSVPEKGARKHPRGENIQIDTKDILFICGGA  466

Query  918   FIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFV  739
             FIDLEKTISERRQDSSIGFGAPVR NMRTGG+T+A +TSSLLE+ ESSD I+YGLIPEF+
Sbjct  467   FIDLEKTISERRQDSSIGFGAPVRANMRTGGITNATITSSLLESAESSDFITYGLIPEFI  526

Query  738   GRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITK  559
             GRFPILVSL+ALTE+QLVQVLTEPKNAL KQYKK+F MNN KLHFTE ALR IA+KA+ K
Sbjct  527   GRFPILVSLSALTEDQLVQVLTEPKNALCKQYKKLFSMNNTKLHFTEGALRLIAKKAMVK  586

Query  558   NTGARGLRSILESILMDAMYEIPDVRSGdnvidavivddeaVGH-EGRGCGAKILYGKGA  382
             NTGARGLR++LESIL DAMYEIPDV+ GD+ +DA++VD+E+VG    RGCG K+L G GA
Sbjct  587   NTGARGLRALLESILTDAMYEIPDVKYGDDRVDAIVVDEESVGAVNARGCGGKVLRGDGA  646

Query  381   LDCYLS  364
             L  YL+
Sbjct  647   LQRYLA  652


 Score =   110 bits (276),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 79/133 (59%), Gaps = 10/133 (8%)
 Frame = -1

Query  1780  GEFVDRGYDNSRNLSSCGKIDISSSYGDPPEVWQPPGDGIVVR--------PGVKFVQVG  1625
             G+ V+   DN +         + S  G+PPE W PPG+G+ V         PG+  ++  
Sbjct  179   GKRVNNDEDNGKRQKPSFWESLKSYGGEPPENWTPPGNGLAVHTPPGPPFAPGLNLIRAN  238

Query  1624  EVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVY  1445
               +G + G         K G WGGSNLG N PTPKEICKGLD FVIGQERAKKVLSV VY
Sbjct  239   GTEGKNGGGKDEGSDE-KSG-WGGSNLGKNLPTPKEICKGLDTFVIGQERAKKVLSVGVY  296

Query  1444  NHYKRIYNDSAQK  1406
             NHYKRIY+ S QK
Sbjct  297   NHYKRIYHASLQK  309



>gb|EEE56773.1| hypothetical protein OsJ_06335 [Oryza sativa Japonica Group]
Length=479

 Score =   520 bits (1339),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 281/421 (67%), Positives = 348/421 (83%), Gaps = 4/421 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  +GL    + ++  K+  S+ +Y    R     LL S    + +++D    ++
Sbjct  59    FPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKR-IHCELLSSRSAGDCSETDSC-ASD  116

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNILVMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  117   TDGVELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  176

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL  AD++V AAQQGIVYIDEVDKITKKAES+N+SRDVSGEGVQQALLKMLEGT+V+VPE
Sbjct  177   LLAAADFDVAAAQQGIVYIDEVDKITKKAESINLSRDVSGEGVQQALLKMLEGTVVSVPE  236

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGAR+HPRGDNIQIDTK+ILFICGGAF+DLEKTISERR DSSIGF AP+R+NMRTGGV +
Sbjct  237   KGARRHPRGDNIQIDTKNILFICGGAFVDLEKTISERRHDSSIGFQAPIRSNMRTGGVIN  296

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A +TSSLLE+VES DLI+YGLIPEFVGRFPILVSL++L+E+QLV+VLT+PKNALG+QY K
Sbjct  297   AEITSSLLESVESGDLIAYGLIPEFVGRFPILVSLSSLSEDQLVEVLTKPKNALGRQYTK  356

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             +F+MN+VKLHFTE ALR I+++AI KNTGARGLRSILES+L ++MYEIP++R+G + IDA
Sbjct  357   LFEMNDVKLHFTEKALRLISKRAIAKNTGARGLRSILESLLTESMYEIPEIRTGKDKIDA  416

Query  456   vivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIV  280
             V+VD+++VG   + G GAKIL G+GALD YL  + ++   +  E  + + +++ + PS V
Sbjct  417   VVVDEDSVGSTNQHGSGAKILCGEGALDLYLDEHNKESTLRRSEKVDGEPDIDTEAPSRV  476

Query  279   A  277
             A
Sbjct  477   A  477


 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -1

Query  1552  SNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIY  1424
             SNLG  FPTPKEIC+GLDKFVIGQERAKKVLSVAVYNHYKRI+
Sbjct  53    SNLGRRFPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKRIH  95



>ref|XP_006587386.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X3 [Glycine max]
Length=721

 Score =   529 bits (1362),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 291/425 (68%), Positives = 341/425 (80%), Gaps = 18/425 (4%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEG-T  1360
             F  P++  KGL    + ++  K+  S+ +Y    R    TL K        DS   E   
Sbjct  295   FPSPKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHATLQKG----SAADSGASEVLD  350

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  351   DDDNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILY  410

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL  AD+NV AAQQGI+YIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP
Sbjct  411   KLLVAADFNVAAAQQGIIYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  470

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARK+PRGDNIQ+DTK+ILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMR  G+T
Sbjct  471   EKGARKNPRGDNIQMDTKNILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRAVGIT  530

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
              + VTSSLLE+VES+DLI+YGLIPEF+GRFPILVSL+ALTE+QL  VLTEPKNALGKQYK
Sbjct  531   DSAVTSSLLESVESADLIAYGLIPEFIGRFPILVSLSALTEDQLTMVLTEPKNALGKQYK  590

Query  639   KMFQMNN--------VKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDV  484
             K+F MNN        VKLHFTE+ALR IA+KA+ KNTGARGLR++LESIL +AM+EIPD+
Sbjct  591   KLFSMNNVSISVCDRVKLHFTENALRLIAKKAMAKNTGARGLRALLESILTEAMFEIPDI  650

Query  483   RSGdnvidavivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIE  307
             ++G + +DAV++D+E+VG     GCG KIL+G GAL  YL+  + K+    V+  E+D++
Sbjct  651   KTGSDRVDAVVIDEESVGSLTAPGCGGKILHGDGALKQYLA--KMKDSAVNVDVGESDLQ  708

Query  306   VERDL  292
              E DL
Sbjct  709   -EGDL  712



>ref|XP_010478756.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Camelina sativa]
Length=661

 Score =   526 bits (1356),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 269/339 (79%), Positives = 305/339 (90%), Gaps = 1/339 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VEL+KSN+L+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVG+DVESIL+
Sbjct  309   DDDNVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGDDVESILH  368

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVA++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLK+LEGTIVNVP
Sbjct  369   KLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKLLEGTIVNVP  428

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
              KGARKHPRGD+IQIDTKDILFICGGAF+DLEKTI +RRQDSSIGFGAPVR NM T  VT
Sbjct  429   GKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDRRQDSSIGFGAPVRANMATSRVT  488

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             S  +TSSLLE+VES+DL +YGLIPEFVGRFPILVSL+ALTE+QL++VL EPKNALGKQYK
Sbjct  489   SGAITSSLLESVESADLTAYGLIPEFVGRFPILVSLSALTEDQLIRVLVEPKNALGKQYK  548

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE AL  I+++A+ KNTGARGLR++LESIL +AM+EIPD + GD  ID
Sbjct  549   KLFSMNNVKLHFTEKALEIISKQAMVKNTGARGLRALLESILTEAMFEIPDDKKGDERID  608

Query  459   avivddeaVGHE-GRGCGAKILYGKGALDCYLSGNEQKE  346
             AVIVD+E  G E  RGC AK+L G GA + YLS N+ K+
Sbjct  609   AVIVDEELTGSEVSRGCTAKVLKGDGAFERYLSENKSKD  647


 Score = 91.7 bits (226),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG++LG +FPTPKEICK LDKFVIGQ RAKKVLSVAVYNHYKRIY+ S +K
Sbjct  249   WGGASLGRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIYHTSMKK  300



>ref|XP_007019730.1| ATP-dependent clp protease ATP-binding subunit clpx isoform 1 
[Theobroma cacao]
 gb|EOY16955.1| ATP-dependent clp protease ATP-binding subunit clpx isoform 1 
[Theobroma cacao]
Length=703

 Score =   528 bits (1359),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 292/439 (67%), Positives = 341/439 (78%), Gaps = 37/439 (8%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL    + ++  K+  S+ +Y    R    +L K     E   S+ ++  + + 
Sbjct  260   PKEICKGLDQFVIGQRRAKKVLSVAVYNHYKRIYHASLQKGS-GAEAGSSESID--DDDK  316

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L++GPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLL+
Sbjct  317   VELEKSNVLLVGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLS  376

Query  1167  --------------------------VADYNVQAAQQGIVYIDEVDKITKKAESLNISRD  1066
                                       VA++NV+AAQQG+VYIDEVDKITKKAESLNISRD
Sbjct  377   YDEGEGRQTSGSRHLLPTNETSIPQFVAEFNVEAAQQGMVYIDEVDKITKKAESLNISRD  436

Query  1065  VSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  886
             VSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAF+DL+KTISER
Sbjct  437   VSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLDKTISER  496

Query  885   RQDSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTA  706
             RQDSSIGFGAPVR NMR  G+T+A VTSSLLETVESSDLI+YGLIPEF+GRFPILVSL+A
Sbjct  497   RQDSSIGFGAPVRANMRATGLTNAAVTSSLLETVESSDLIAYGLIPEFIGRFPILVSLSA  556

Query  705   LTENQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSIL  526
             LTE+QL+QVLTEPKNALGKQYKK+F MNNVKLHFT  ALR IA+KA+ KNTGARGLR+IL
Sbjct  557   LTEDQLMQVLTEPKNALGKQYKKLFSMNNVKLHFTSKALRLIAKKAMAKNTGARGLRAIL  616

Query  525   ESILMDAMYEIPDVRSGdnvidavivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQK  349
             E IL +AMYEIPD ++G+N +DAV+VD+E+VG     GCG KIL G GAL+ Y +     
Sbjct  617   EGILTEAMYEIPDAKTGNNRLDAVVVDEESVGSTNIPGCGGKILCGDGALENYFA-----  671

Query  348   EPKKIVEGSEADIEVERDL  292
                K+ + +E    VER+L
Sbjct  672   -EAKLKDSAENLASVEREL  689


 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = -1

Query  1567  GCW-GGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             G W GG+NLG + PTPKEICKGLD+FVIGQ RAKKVLSVAVYNHYKRIY+ S QK
Sbjct  245   GAWLGGANLGKDLPTPKEICKGLDQFVIGQRRAKKVLSVAVYNHYKRIYHASLQK  299



>ref|XP_008788322.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Phoenix dactylifera]
Length=648

 Score =   526 bits (1354),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 291/392 (74%), Positives = 331/392 (84%), Gaps = 6/392 (2%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL    + ++  K+  S+ +Y    R    +L K        D  K+E    + 
Sbjct  261   PKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHASLQKGS----AADPGKLEVKIDDH  316

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLLT
Sbjct  317   VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLT  376

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
             VAD+NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA
Sbjct  377   VADFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  436

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPR D+IQIDTKDILFICGGAF+DLEKTISERR DSSIGFGAPVR NM TGG+T+ VV
Sbjct  437   RKHPRNDHIQIDTKDILFICGGAFVDLEKTISERRHDSSIGFGAPVRANMSTGGLTNLVV  496

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VESSDL++YGLIPEF+GRFPILVSL+AL E+QL QVLTEPKNALGKQYKK+F 
Sbjct  497   TSSLLESVESSDLVAYGLIPEFIGRFPILVSLSALNEDQLFQVLTEPKNALGKQYKKLFS  556

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             MNNVKLHFT+ ALR IA+KA+ KNTGARGLR+ILESIL +AMYEIPD+++G+  +D V+V
Sbjct  557   MNNVKLHFTKAALRLIAKKAMEKNTGARGLRAILESILTEAMYEIPDMKTGNERVDGVVV  616

Query  447   ddeaVGHEGR-GCGAKILYGKGALDCYLSGNE  355
             D+EA+G   R GCGAKIL G GAL+ YL  N+
Sbjct  617   DEEAIGSLDRPGCGAKILQGDGALEHYLLQNK  648


 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = -1

Query  1558  GGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             GGSNLG + PTPKEICKGLDKFVIGQ+RAKKVLSVAVYNHYKRIY+ S QK
Sbjct  250   GGSNLGKDLPTPKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHASLQK  300



>gb|KHN24432.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Glycine 
soja]
Length=649

 Score =   526 bits (1354),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 288/439 (66%), Positives = 344/439 (78%), Gaps = 31/439 (7%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  S+ +Y    R    TL K     +   S+ ++  +
Sbjct  208   FPSPKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHATLQKGSA-ADSGVSEVLD--D  264

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQA-------------  1216
              + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVI DATTLTQA             
Sbjct  265   DDNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVITDATTLTQAIGSPVLRQSFVVI  324

Query  1215  ----------GYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRD  1066
                       GYVGEDVESILYKLLT AD+NV AAQQGI+YIDEVDKITKK++SLNISRD
Sbjct  325   DLNKFSTLQAGYVGEDVESILYKLLTAADFNVAAAQQGIIYIDEVDKITKKSKSLNISRD  384

Query  1065  VSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISER  886
             VSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQ+DTK+ILFICGGAFIDLEKTISER
Sbjct  385   VSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQMDTKNILFICGGAFIDLEKTISER  444

Query  885   RQDSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTA  706
             RQDSSIGFGAPVR NMR GG+T + VTSSLLE+VES+DLI+YGLIPEF+GRFPILVSL+A
Sbjct  445   RQDSSIGFGAPVRANMRAGGITDSAVTSSLLESVESADLIAYGLIPEFIGRFPILVSLSA  504

Query  705   LTENQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSIL  526
             LTE+QL+ VLTEPKNALGKQYKK+F MNNVKLHFTE ALR IA+KA+ KNTGARGLR++L
Sbjct  505   LTEDQLMMVLTEPKNALGKQYKKLFSMNNVKLHFTEKALRLIAKKAMAKNTGARGLRALL  564

Query  525   ESILMDAMYEIPDVRSGdnvidavivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQK  349
             E+IL +AM+EIPD+++G + +DAV++D+E+VG     GCG KIL G GAL+ YL+  + K
Sbjct  565   ENILTEAMFEIPDIKTGSDRVDAVVIDEESVGSLTAPGCGGKILRGDGALEQYLA--KMK  622

Query  348   EPKKIVEGSEADIEVERDL  292
             +    V+  E+D++ E DL
Sbjct  623   DSAVNVDVGESDLQ-EGDL  640


 Score = 97.4 bits (241),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 70/114 (61%), Gaps = 13/114 (11%)
 Frame = -1

Query  1708  SYGDPPEVWQPP-------GDGIVVRPGVKFVQVGEVDgpssg------sgggfgsGAKD  1568
             S G+PPE W          G+G+ V           ++   +       SGGG G   + 
Sbjct  137   SNGEPPESWPLAPDGSNGNGNGLAVHTPPGPPFPPGINVIRATGPRNGGSGGGGGGKGEK  196

Query  1567  GCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
               WGGSNLG +FP+PKEICKGLDKFVIGQ+RAKKVLSVAVYNHYKRIY+ + QK
Sbjct  197   TAWGGSNLGKDFPSPKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHATLQK  250



>ref|XP_010266546.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Nelumbo nucifera]
Length=361

 Score =   514 bits (1325),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 273/374 (73%), Positives = 308/374 (82%), Gaps = 21/374 (6%)
 Frame = -2

Query  1386  NDSDKVEGTE--HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAG  1213
             NDS   EG E  +++VELEKSNIL+MGPTGSGKTLLAKTL +LVNVPF+I DATTLTQ  
Sbjct  3     NDSSGGEGDEIDNDSVELEKSNILLMGPTGSGKTLLAKTLTQLVNVPFIIVDATTLTQ--  60

Query  1212  YVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALL  1033
                            VAD+NV AAQQGIVYIDEVDKITKK ESLN+SRDVSGEGVQQALL
Sbjct  61    ---------------VADFNVAAAQQGIVYIDEVDKITKKTESLNLSRDVSGEGVQQALL  105

Query  1032  KMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAP  853
             KMLE T+VNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKT  ERRQDSSIGFGAP
Sbjct  106   KMLEETVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTTLERRQDSSIGFGAP  165

Query  852   VRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLT  673
             V  NM+TGG+T+A VTSSLLET E  DLI+YGLIPEF+GRF ILVSL+ALTE+QL++VL 
Sbjct  166   VHANMKTGGLTNAFVTSSLLETAEGGDLIAYGLIPEFIGRFQILVSLSALTEDQLIEVLA  225

Query  672   EPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEI  493
             EPKNAL KQY+K+FQMN VKLHFTE ALR IARKA+ K+TGARGLRSILE+ILMDAMYEI
Sbjct  226   EPKNALAKQYRKLFQMNGVKLHFTEKALRLIARKAMLKDTGARGLRSILENILMDAMYEI  285

Query  492   PDVRSGdnvidavivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGS--E  319
             PD R+G++ IDAV+VD+E +   G  C AKILYG GALD YLS ++  + +  +EGS  E
Sbjct  286   PDTRTGNDKIDAVVVDEEVIVAAGHHCSAKILYGDGALDHYLSQHKSSDRQTNLEGSDRE  345

Query  318   ADIEVERDLPSIVA  277
              D+E E DL SIVA
Sbjct  346   VDVEPEGDLSSIVA  359



>gb|ACR33872.1| unknown [Zea mays]
Length=362

 Score =   514 bits (1325),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 272/359 (76%), Positives = 318/359 (89%), Gaps = 2/359 (1%)
 Frame = -2

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSNILVMGPTGSGKTLLAKTLAR VNVPFVIADAT+LTQAGYVGEDVESILYKLL 
Sbjct  2     VELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATSLTQAGYVGEDVESILYKLLA  61

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              AD++V AAQQGIVYIDEVDKITKKAES+N+SRDVSGEGVQQALLKMLEGT+V+VPEKGA
Sbjct  62    AADFDVAAAQQGIVYIDEVDKITKKAESINLSRDVSGEGVQQALLKMLEGTVVSVPEKGA  121

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             R+HPRGDNIQIDTK+ILFICGGAF+DLEKTISERR DSSIGF A VR+NMR+GGV +A +
Sbjct  122   RRHPRGDNIQIDTKNILFICGGAFVDLEKTISERRHDSSIGFRAQVRSNMRSGGVINAEI  181

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLL++VES DLI+YGLIPEFVGRFPILV L++L+E+QLV+VLTEPKNALG+QY K+F+
Sbjct  182   TSSLLKSVESGDLIAYGLIPEFVGRFPILVGLSSLSEDQLVEVLTEPKNALGRQYTKLFE  241

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             MN+VKLHFTE+ALR IA++AI+KNTGARGLRSILESIL +AMYEIP+ R+G + IDAV+V
Sbjct  242   MNDVKLHFTEEALRLIAKRAISKNTGARGLRSILESILTEAMYEIPETRTGKDKIDAVVV  301

Query  447   ddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPK-KIVEGSEADIEVERDLPSIVA  277
             D+E+VG     G GAKIL G+ ALD YL+ +  KE   ++ E    + E++ + PS VA
Sbjct  302   DEESVGSVNQHGIGAKILCGEKALDVYLANHNNKESTGQLQERPNGESEIDTEAPSRVA  360



>ref|XP_008388035.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Malus domestica]
Length=728

 Score =   528 bits (1359),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 293/388 (76%), Positives = 329/388 (85%), Gaps = 5/388 (1%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P+   KGL    + ++  K+  S+ +Y    R    +L K     E    +KV+  + + 
Sbjct  312   PKDICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHASL-KKGSGAESGIPNKVD--DDDK  368

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVI DATTLTQAGYVGEDVESILYKLL 
Sbjct  369   VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVITDATTLTQAGYVGEDVESILYKLLM  428

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              A++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA
Sbjct  429   AAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  488

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMR GGVT++VV
Sbjct  489   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRAGGVTNSVV  548

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VESSDLISYGLIPEF+GRFPILVSL+ALTE+QLVQVL EPKNALGKQYKK+F 
Sbjct  549   TSSLLESVESSDLISYGLIPEFIGRFPILVSLSALTEDQLVQVLMEPKNALGKQYKKLFG  608

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             MNNVKLHF E+ALR IA KA+ KNTGARGLR++LESIL +AMYEIPDV++G + IDAV+V
Sbjct  609   MNNVKLHFMENALRLIANKAMAKNTGARGLRALLESILTEAMYEIPDVKTGKDRIDAVVV  668

Query  447   ddeaVGH-EGRGCGAKILYGKGALDCYL  367
             D+E+VG     GCG KI+ G GAL+ YL
Sbjct  669   DEESVGTVNAPGCGGKIVRGDGALERYL  696


 Score = 97.1 bits (240),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -1

Query  1564  CWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              WGGSNLG N PTPK+ICKGLDKFVIGQ+RAKKVLSVAVYNHYKRIY+ S +K
Sbjct  299   AWGGSNLGNNLPTPKDICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHASLKK  351



>ref|XP_007039052.1| CLP protease regulatory subunit X isoform 2 [Theobroma cacao]
 gb|EOY23553.1| CLP protease regulatory subunit X isoform 2 [Theobroma cacao]
Length=526

 Score =   520 bits (1340),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 266/348 (76%), Positives = 300/348 (86%), Gaps = 3/348 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P+   KGL    + ++  K+  S+ +Y   +R    +L K  R    + S+  +  +
Sbjct  175   FPTPKDICKGLDKFVIGQERAKKVLSVAVYNHYMRIYHESLQK--RPAGDSVSNIADVLD  232

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  233   DDIVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  292

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL VADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  293   LLVVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  352

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRG+NIQIDTKDILFICGGAFID+EKTISERRQDSSIGFGAPVR NMR GGVT+
Sbjct  353   KGARKHPRGENIQIDTKDILFICGGAFIDIEKTISERRQDSSIGFGAPVRANMRAGGVTN  412

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A V S+L+E+VESSDLI+YGLIPEFVGRFP+LVSL ALTE QLVQVLTEPKNALGKQYK+
Sbjct  413   AAVASTLMESVESSDLIAYGLIPEFVGRFPVLVSLLALTEEQLVQVLTEPKNALGKQYKR  472

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEI  493
             MFQMN VKLH TE+AL+ IARKAI+KNTGARGLR+ILE+ILMD+++++
Sbjct  473   MFQMNGVKLHITENALKLIARKAISKNTGARGLRAILENILMDSIFQM  520


 Score =   195 bits (496),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 146/219 (67%), Gaps = 31/219 (14%)
 Frame = -1

Query  1978  AMAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSK--NYFTNSRHSFS  1805
             A AAALRSK   ETAS T S  R+F+ N+M  GR+ +   ++  ++K  ++F N+ + F+
Sbjct  2     AAAAALRSKPSVETASLTVSQFRHFLSNYMHCGRMASSSHSTTYRTKWDDHFVNTPYHFT  61

Query  1804  LFKPVSVRGEFVDRGYD------NSR--------------NLSSCGKIDISSSYGDPPEV  1685
              FKPVS+RGE V++G        NSR              N S+C    + SSYGDPPEV
Sbjct  62    SFKPVSLRGELVEKGSQLLDIRRNSRGLNKDFDRELREKLNYSNC---TVLSSYGDPPEV  118

Query  1684  WQPPGDGIVVR-PGVKF-----VQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTP  1523
             WQPPGDG+ +R  GV          G   G S+GSGGGFG G+KDGCWGGSNLG NFPTP
Sbjct  119   WQPPGDGVAIRVSGVNLGRGGGGGAGGGGGASTGSGGGFGPGSKDGCWGGSNLGHNFPTP  178

Query  1522  KEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             K+ICKGLDKFVIGQERAKKVLSVAVYNHY RIY++S QK
Sbjct  179   KDICKGLDKFVIGQERAKKVLSVAVYNHYMRIYHESLQK  217



>ref|XP_010529709.1| PREDICTED: mitochondrial clpX-like chaperone MCX1 [Tarenaya hassleriana]
 ref|XP_010529710.1| PREDICTED: mitochondrial clpX-like chaperone MCX1 [Tarenaya hassleriana]
Length=661

 Score =   525 bits (1352),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 275/339 (81%), Positives = 311/339 (92%), Gaps = 1/339 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VELEKSN+L+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  301   DEDNVELEKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  360

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLT A++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLK+LEGTIVNVP
Sbjct  361   KLLTAAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKLLEGTIVNVP  420

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKG RKHPRGD+IQIDTKDILFICGGAFIDLEKTI ERR DSSIGFGAPVR NMRTGG  
Sbjct  421   EKGTRKHPRGDHIQIDTKDILFICGGAFIDLEKTIVERRHDSSIGFGAPVRANMRTGGPI  480

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             SA+VTSSLLE++ESSDLI+YGLIPEFVGRFPILVSL+ALTE+QL++VL EPKNALGKQY+
Sbjct  481   SALVTSSLLESIESSDLIAYGLIPEFVGRFPILVSLSALTEDQLIRVLVEPKNALGKQYR  540

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE AL  IA++A+ KNTGARGLR++LE+IL +AMYEIPD ++G+   D
Sbjct  541   KLFSMNNVKLHFTEKALELIAKQAMVKNTGARGLRALLENILTEAMYEIPDAKTGNERAD  600

Query  459   avivddeaVGHE-GRGCGAKILYGKGALDCYLSGNEQKE  346
             AV+VD+E+VG E  RGCGAKIL G GAL+ +L+ ++ KE
Sbjct  601   AVVVDEESVGLEAARGCGAKILRGDGALERHLARSKLKE  639


 Score = 94.4 bits (233),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 76/129 (59%), Gaps = 10/129 (8%)
 Frame = -1

Query  1762  GYDNS--RNLSSCGKIDISSSYG-DPPE-VWQPPGDGIVVR--PGVKFVQVGEVDgpssg  1601
             G DNS  RN       D   SYG DPPE +   P +G+ VR  P    V+     G   G
Sbjct  164   GSDNSSGRNRLRSAFWDTLRSYGTDPPEDLPSAPANGVSVRNPPSNNVVRAAGGGGGGDG  223

Query  1600  sgggf----gsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYK  1433
             +         +    G WGG+NLG +FPTPK+IC+ LDKFVIGQ RAKKVLSVAVYNHYK
Sbjct  224   ANVDAPPQPDAAESSGRWGGTNLGKDFPTPKKICEFLDKFVIGQSRAKKVLSVAVYNHYK  283

Query  1432  RIYNDSAQK  1406
             RIY+ S +K
Sbjct  284   RIYHASVRK  292



>ref|XP_006441855.1| hypothetical protein CICLE_v10019167mg [Citrus clementina]
 gb|ESR55095.1| hypothetical protein CICLE_v10019167mg [Citrus clementina]
Length=675

 Score =   525 bits (1352),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 293/395 (74%), Positives = 335/395 (85%), Gaps = 6/395 (2%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL    + +++ K+  S+ +Y    R     L K     E   +D V+  ++  
Sbjct  261   PKEICKGLDKFVIGQEKAKKVLSVAVYNHYKRIYHANL-KKGSGAEPKTADAVDNDDN--  317

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLL 
Sbjct  318   VELEKSNVLLMGPTGSGKTLLAKTLARHVNVPFVIADATTLTQAGYVGEDVESILYKLLA  377

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              A++NV+AAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA
Sbjct  378   QAEFNVEAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  437

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPRGD+IQ+DTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR  GVT A V
Sbjct  438   RKHPRGDSIQMDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRA-GVTDAAV  496

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VESSDLI+YGLIPEFVGRFPILVSLTALTE+QLV+VLTEPKNALGKQYK++F 
Sbjct  497   TSSLLESVESSDLIAYGLIPEFVGRFPILVSLTALTEDQLVKVLTEPKNALGKQYKRLFS  556

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             MNNVKLHFTE ALR IA+KA  KNTGARGLR+ILESIL +AMYEIPDV++G + +DAV+V
Sbjct  557   MNNVKLHFTEKALRVIAKKATAKNTGARGLRAILESILTEAMYEIPDVKTGSDGVDAVVV  616

Query  447   ddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKE  346
             D+E+VG  +  GCG KIL G+GAL+ YL   E+KE
Sbjct  617   DEESVGSVDAPGCGGKILRGEGALERYLVEAERKE  651


 Score = 83.6 bits (205),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -1

Query  1546  LGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             LG + PTPKEICKGLDKFVIGQE+AKKVLSVAVYNHYKRIY+ + +K
Sbjct  254   LGEDLPTPKEICKGLDKFVIGQEKAKKVLSVAVYNHYKRIYHANLKK  300



>ref|XP_001768014.1| predicted protein [Physcomitrella patens]
 gb|EDQ67289.1| predicted protein [Physcomitrella patens]
Length=446

 Score =   516 bits (1330),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 270/398 (68%), Positives = 322/398 (81%), Gaps = 8/398 (2%)
 Frame = -2

Query  1539  QIFRPPRKFAKGLISL*LVRKEPKRS---SL*LYiiiIRESTMTLLKSDRNP--EKNDSD  1375
             ++   PR+  + L    + +++ K++   S+ +Y    R    ++ K +  P  E     
Sbjct  8     KVLPTPREICQALDKFVVGQEQAKKARILSVAVYNHYKRIYFESMRKGNAKPTNEGFGVS  67

Query  1374  KVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDV  1195
             +VE  E++ VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADAT+LTQAGYVGEDV
Sbjct  68    EVECEEND-VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATSLTQAGYVGEDV  126

Query  1194  ESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT  1015
             ESILYKLL  A++NV AAQQGI+YIDEVDKITKKAES NISRDVSGEGVQQALLKMLEGT
Sbjct  127   ESILYKLLVEAEFNVLAAQQGIIYIDEVDKITKKAESKNISRDVSGEGVQQALLKMLEGT  186

Query  1014  IVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMR  835
             +VNVPEKGARKHPRG++IQIDTKDILFICGGAF++LEK+I+ER+QDSSIGFGAPVR NMR
Sbjct  187   VVNVPEKGARKHPRGEHIQIDTKDILFICGGAFVELEKSIAERKQDSSIGFGAPVRANMR  246

Query  834   TGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNAL  655
                +  A +TSSLLETVESSDLISYGLIPEF+GRFP++VSL+AL E+QLVQVLTEP+NAL
Sbjct  247   GNKLIDAAITSSLLETVESSDLISYGLIPEFIGRFPVIVSLSALDEDQLVQVLTEPRNAL  306

Query  654   GKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRS-  478
             GKQYKKMF MNNVKLH+TE  LR IA+KA+ KNTGARGLRS LE++L +AMY++PD  S 
Sbjct  307   GKQYKKMFAMNNVKLHYTEGGLRRIAQKAVVKNTGARGLRSTLETVLTEAMYQVPDSISN  366

Query  477   -GdnvidavivddeaVGHEGRGCGAKILYGKGALDCYL  367
              G+ V   V+ +D     +G G GAKIL GKGALD YL
Sbjct  367   EGEQVDAVVLDEDAVGAPDGNGEGAKILRGKGALDFYL  404


 Score = 84.0 bits (206),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 2/54 (4%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKK--VLSVAVYNHYKRIYNDSAQK  1406
             WGGS+LG   PTP+EIC+ LDKFV+GQE+AKK  +LSVAVYNHYKRIY +S +K
Sbjct  1     WGGSSLGKVLPTPREICQALDKFVVGQEQAKKARILSVAVYNHYKRIYFESMRK  54



>ref|XP_004952279.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X2 [Setaria italica]
Length=560

 Score =   520 bits (1340),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 285/422 (68%), Positives = 344/422 (82%), Gaps = 6/422 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLL-KSDRNPEKNDSDKVEGT  1360
             F  P++  +GL    + ++  K+  S+ +Y    R    +L  +S  N  ++DS     +
Sbjct  140   FPTPKEICRGLDKFVIGQQRAKKVLSVAVYNHYKRIYCESLSSRSAGNCSESDSCM---S  196

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VELEKSNILVMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  197   DTDMVELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILY  256

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL  AD++V AAQQGIVYIDEVDKITKKAES+N+SRDVSGEGVQQALLKMLEGT+V+VP
Sbjct  257   KLLAAADFDVAAAQQGIVYIDEVDKITKKAESINLSRDVSGEGVQQALLKMLEGTVVSVP  316

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGAR+HPRGDNIQIDTK+ILFICGGAF+ LEKTISERR DSSIGF A VR+NMRTGGV 
Sbjct  317   EKGARRHPRGDNIQIDTKNILFICGGAFVGLEKTISERRHDSSIGFRAQVRSNMRTGGVI  376

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             +A +TSSLLE+VES DLI+YGLIPEFVGRFPILVSL++L+E+QLV+VLTEPKNALG+QY 
Sbjct  377   NAEITSSLLESVESGDLIAYGLIPEFVGRFPILVSLSSLSEDQLVEVLTEPKNALGRQYT  436

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F+MN+VKLHFTE ALR IA++AI KNTGARGLRSILESIL +AMYEIP+ R+G + ID
Sbjct  437   KLFEMNDVKLHFTEKALRLIAKRAIVKNTGARGLRSILESILTEAMYEIPETRTGQDKID  496

Query  459   avivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEP-KKIVEGSEADIEVERDLPSI  283
             AV+V++        G GAKIL G+GAL+ YL+ ++ KE   + +E S  + E++ + PS 
Sbjct  497   AVVVEESVGSANQHGIGAKILCGEGALELYLAKHDNKESMHQQLEKSNGESEIDAEAPSR  556

Query  282   VA  277
             VA
Sbjct  557   VA  558


 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 68/104 (65%), Gaps = 6/104 (6%)
 Frame = -1

Query  1711  SSYGDPPEVWQPPGDGIVVRPGVKFVQVGEVDgpssgsgggfgsGAKD-----GCWGGSN  1547
             S  G+PPE+W+ PG+            VG +D       GG G   KD     G WGGSN
Sbjct  77    SDGGEPPEIWRQPGE-APGERAGAAAAVGRIDLVRVAGPGGEGFDGKDGAGETGGWGGSN  135

Query  1546  LGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDS  1415
             LG  FPTPKEIC+GLDKFVIGQ+RAKKVLSVAVYNHYKRIY +S
Sbjct  136   LGRRFPTPKEICRGLDKFVIGQQRAKKVLSVAVYNHYKRIYCES  179



>ref|XP_001774045.1| predicted protein [Physcomitrella patens]
 gb|EDQ61097.1| predicted protein [Physcomitrella patens]
Length=392

 Score =   513 bits (1322),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 256/338 (76%), Positives = 299/338 (88%), Gaps = 3/338 (1%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             E + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPF+IADATTLTQAGYVGEDVESILY
Sbjct  56    EDDVVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFIIADATTLTQAGYVGEDVESILY  115

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL V+++NV AAQQGIVYIDEVDKITKKAES++ISRDVSGEGVQQALLKMLEGTIVNVP
Sbjct  116   KLLMVSEFNVPAAQQGIVYIDEVDKITKKAESVSISRDVSGEGVQQALLKMLEGTIVNVP  175

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARKHPRGD+IQIDTKDILFICGGAFI+L KT++ER+QDSSIGFG+PVR +MR   +T
Sbjct  176   EKGARKHPRGDHIQIDTKDILFICGGAFIELAKTVAERKQDSSIGFGSPVRASMRGNKLT  235

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
              + +TSSLLE VESSDLISYGLIPEF+GRFP+LVSL+AL E+QLVQVLTEP+NALGKQYK
Sbjct  236   DSAITSSLLEMVESSDLISYGLIPEFIGRFPVLVSLSALNEDQLVQVLTEPRNALGKQYK  295

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPD--VRSGdnv  466
             KMF MNNVKLH+T+ ALR IA+KAI KNTGARGLRSI+E++L +AMY++PD  +   ++V
Sbjct  296   KMFSMNNVKLHYTDGALRRIAQKAIVKNTGARGLRSIMETLLTEAMYQVPDTILNRDEHV  355

Query  465   idavivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQ  352
                V+ ++     +G G  AKIL GKGALD +L GN++
Sbjct  356   DAVVLDEEAVGAPDGNGERAKILRGKGALDFFL-GNQK  392


 Score = 94.7 bits (234),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGGS LG + PTP+EIC+ LDKFV+GQERAKK+LSVAVYNHYKRIY++S QK
Sbjct  1     WGGSFLGKDLPTPREICQALDKFVVGQERAKKILSVAVYNHYKRIYHESVQK  52



>ref|XP_006415098.1| hypothetical protein EUTSA_v10007003mg [Eutrema salsugineum]
 gb|ESQ33451.1| hypothetical protein EUTSA_v10007003mg [Eutrema salsugineum]
Length=667

 Score =   524 bits (1349),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 267/339 (79%), Positives = 304/339 (90%), Gaps = 1/339 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VEL+KSN+L+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVG+DVESIL+
Sbjct  311   DDDNVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGDDVESILH  370

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVA +NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLK+LEG+IVNVP
Sbjct  371   KLLTVAKFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKLLEGSIVNVP  430

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
              KGARKHPRGD+IQIDTKDILFICGGAF+DLEKTI +RRQDSSIGFGAPVR NM T GVT
Sbjct  431   GKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDRRQDSSIGFGAPVRANMATSGVT  490

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             S  +TSSLLE+VE +DL +YGLIPEFVGRFPILVSL+ALTE+QL++VL EPKNALGKQYK
Sbjct  491   SGAITSSLLESVEGADLTAYGLIPEFVGRFPILVSLSALTEDQLIRVLVEPKNALGKQYK  550

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE AL  I++ A+ KNTGARGLR++LESIL +AM+EIPD + G+  ID
Sbjct  551   KLFSMNNVKLHFTEKALGMISKLAMVKNTGARGLRALLESILTEAMFEIPDAKKGEERID  610

Query  459   avivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKE  346
             AVIVD+E+ G E  RGC AKIL G GA + YL+ N+ K+
Sbjct  611   AVIVDEESTGPEASRGCTAKILRGDGAFERYLNENKSKD  649


 Score = 89.4 bits (220),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG++LG +FPTPKEIC+ LDKFVIGQ RAKKVLSVAVYNHYKRIY+ S +K
Sbjct  251   WGGASLGRDFPTPKEICQWLDKFVIGQCRAKKVLSVAVYNHYKRIYHTSMKK  302



>gb|AFW62663.1| hypothetical protein ZEAMMB73_067276 [Zea mays]
Length=324

 Score =   510 bits (1314),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 245/275 (89%), Positives = 264/275 (96%), Gaps = 0/275 (0%)
 Frame = -2

Query  1317  MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLTVADYNVQAAQ  1138
             MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLLTVAD+NVQAAQ
Sbjct  1     MGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLTVADFNVQAAQ  60

Query  1137  QGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQ  958
             QG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQ
Sbjct  61    QGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQ  120

Query  957   IDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVES  778
             IDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR GG++SA VTSSLLE+VES
Sbjct  121   IDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRAGGISSAQVTSSLLESVES  180

Query  777   SDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTE  598
              DLI+YGLIPEF+GRFPILVSL AL E+QLVQVL EPKNALGKQ+KK+F MNNVKLHFT+
Sbjct  181   GDLIAYGLIPEFIGRFPILVSLAALNEDQLVQVLIEPKNALGKQFKKLFSMNNVKLHFTD  240

Query  597   DALRSIARKAITKNTGARGLRSILESILMDAMYEI  493
              ALR IA+KA++KNTGARGLR+ILE+ILMD+MYE+
Sbjct  241   GALRIIAKKAMSKNTGARGLRTILENILMDSMYEV  275



>ref|XP_002527823.1| ATP-dependent clp protease ATP-binding subunit clpx, putative 
[Ricinus communis]
 gb|EEF34526.1| ATP-dependent clp protease ATP-binding subunit clpx, putative 
[Ricinus communis]
Length=603

 Score =   521 bits (1341),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 268/341 (79%), Positives = 305/341 (89%), Gaps = 3/341 (1%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             ++E VEL+KSN+L+MGPTGSGKTLLAKTLAR+VNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  238   DNEIVELDKSNVLLMGPTGSGKTLLAKTLARVVNVPFVIADATTLTQAGYVGEDVESILY  297

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL  +++NV+AAQ+GI+YIDEVDKITKKAES NI RDVSGEGVQQALLKMLEGTIVNVP
Sbjct  298   KLLAASEFNVEAAQRGIIYIDEVDKITKKAESSNIGRDVSGEGVQQALLKMLEGTIVNVP  357

Query  999   --EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGG  826
               +KG RKHPRGD IQIDTKDILFICGGAF+DLEKTISERRQD+SIGFGAPVRTNMRTG 
Sbjct  358   VPDKGPRKHPRGDPIQIDTKDILFICGGAFVDLEKTISERRQDASIGFGAPVRTNMRTGR  417

Query  825   VTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQ  646
             +  AVV SSLLE+VES DL++YGLIPEFVGRFPILVSL+AL E+QLVQVL EPKNALGKQ
Sbjct  418   MIDAVVASSLLESVESGDLVAYGLIPEFVGRFPILVSLSALNEDQLVQVLVEPKNALGKQ  477

Query  645   YKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnv  466
             YKKMF MN+VKLHFT++ALR IA+KA+ KNTGARGLR+ILESIL +AMYEIP+ ++G N 
Sbjct  478   YKKMFSMNDVKLHFTDEALRLIAKKAMAKNTGARGLRAILESILTEAMYEIPENKTGSNC  537

Query  465   idavivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKE  346
             I AV+VD+EAVG  +  GCGAKIL+G GAL C     + K+
Sbjct  538   ISAVLVDEEAVGSADEPGCGAKILHGDGALGCSFHATKLKD  578


 Score = 78.6 bits (192),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  1537  NFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
               PTPKEICKGLD+FVIGQ+RAKKVL+VAVYNHYKRIY+ S +K
Sbjct  180   ELPTPKEICKGLDEFVIGQDRAKKVLAVAVYNHYKRIYHGSKRK  223



>ref|XP_009421144.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Musa acuminata subsp. malaccensis]
Length=667

 Score =   523 bits (1346),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 273/350 (78%), Positives = 312/350 (89%), Gaps = 4/350 (1%)
 Frame = -2

Query  1386  NDSDKVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYV  1207
             +  +  EG + + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPF+IADATTLTQAGYV
Sbjct  295   DSENHAEGDDDDNVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFIIADATTLTQAGYV  354

Query  1206  GEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKM  1027
             GEDVESILYKLLTVAD+NVQAAQQGIVYIDEVDKITKK+ESLNISRDVSGEGVQQALLKM
Sbjct  355   GEDVESILYKLLTVADFNVQAAQQGIVYIDEVDKITKKSESLNISRDVSGEGVQQALLKM  414

Query  1026  LEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR  847
             LEGTIVNVPE GARKHPRGDNIQIDTKDILFICGGAF++LEKTISERRQDSSIGFGA VR
Sbjct  415   LEGTIVNVPENGARKHPRGDNIQIDTKDILFICGGAFVNLEKTISERRQDSSIGFGASVR  474

Query  846   TNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEP  667
              NMRT  +T  VVTSSLLE+VES DLI+YGL+PEFVGRFP+LVSL+AL+ENQLVQVL EP
Sbjct  475   ANMRTSWLTD-VVTSSLLESVESGDLIAYGLVPEFVGRFPVLVSLSALSENQLVQVLMEP  533

Query  666   KNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPD  487
             KNALG+QYKK+F MNNVKLHFT+ +L  IA+K++ KNTGARGLR+ILE++L+DAMYEIPD
Sbjct  534   KNALGRQYKKLFSMNNVKLHFTDASLCLIAKKSMAKNTGARGLRAILETVLLDAMYEIPD  593

Query  486   VRSGdnvi--davivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKE  346
             V++ D     DAV+VD++AVG   R G GAKIL G GAL+ Y++ ++ K+
Sbjct  594   VKTKDEDEPIDAVVVDEDAVGSVDRPGSGAKILRGDGALERYITDSKIKD  643


 Score = 81.3 bits (199),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -1

Query  1552  SNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             SNLG + PTPKEI +GLDK+VIGQE AKKVLSVAVYNHYKRIY+ S QK
Sbjct  242   SNLGKDMPTPKEIYEGLDKYVIGQEHAKKVLSVAVYNHYKRIYHASLQK  290



>ref|XP_010234150.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Brachypodium distachyon]
Length=546

 Score =   518 bits (1335),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 281/421 (67%), Positives = 345/421 (82%), Gaps = 7/421 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  +GL    + ++  K+  S+ +Y    R S  +   S R+   +       ++
Sbjct  129   FPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKRISCESF--SSRSAGDSSESDTCTSD  186

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNILVMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  187   TDMVELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  246

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL  AD+++ AAQQGIVYIDEVDKITKKAES+N+SRDVSGEGVQQALLKMLEGT+V+VPE
Sbjct  247   LLAAADFDIAAAQQGIVYIDEVDKITKKAESMNLSRDVSGEGVQQALLKMLEGTVVSVPE  306

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGAR+HPRGDNIQIDTK+ILFICGGAF+DLEKTISERR DSSIGF APVR+NMRTG V +
Sbjct  307   KGARRHPRGDNIQIDTKNILFICGGAFVDLEKTISERRHDSSIGFQAPVRSNMRTGSVIN  366

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A +TS+LLETVES DLI+YGLIPEFVGRFP+LVSL++L+E+QLV+VLT+PKNALG+QY K
Sbjct  367   AEITSTLLETVESGDLIAYGLIPEFVGRFPVLVSLSSLSEDQLVEVLTKPKNALGRQYTK  426

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             +F+MN+VKLHFTE ALR I+++AI+KNTGARGLRSILES+L +AMYEIP++R+G + IDA
Sbjct  427   LFEMNDVKLHFTEKALRLISKRAISKNTGARGLRSILESVLTEAMYEIPEIRTGKDKIDA  486

Query  456   vivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIV  280
             V+VD+E++G   + G GAKIL G+GALD YL   ++   +  +  S  + EV+ + PS V
Sbjct  487   VVVDEESIGSSNQHGFGAKILSGEGALDLYL---DKHSKESTLPQSNGEPEVDAETPSRV  543

Query  279   A  277
             A
Sbjct  544   A  544


 Score =   113 bits (283),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 66/96 (69%), Gaps = 4/96 (4%)
 Frame = -1

Query  1702  GDPPEVWQPPGDGIVVRPGVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTP  1523
             G+PPE+W+ PG+     PG +   VG +D     +G G         WGGSNLG  FPTP
Sbjct  77    GEPPEIWRQPGEA----PGARTGAVGRIDVVRVAAGDGKDGDDSGAGWGGSNLGRQFPTP  132

Query  1522  KEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDS  1415
             KEIC+GLDKFVIGQERAKKVLSVAVYNHYKRI  +S
Sbjct  133   KEICRGLDKFVIGQERAKKVLSVAVYNHYKRISCES  168



>ref|XP_006478287.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Citrus sinensis]
Length=675

 Score =   522 bits (1345),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 293/398 (74%), Positives = 335/398 (84%), Gaps = 6/398 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + +++ K+  S+ +Y    R     L K     E   +  V+  +
Sbjct  258   FPTPKEICKGLDKFVIGQEKAKKVLSVAVYNHYKRIYHANL-KKGSGAEPKTAAAVDNDD  316

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
             +  VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  317   N--VELEKSNVLLMGPTGSGKTLLAKTLARHVNVPFVIADATTLTQAGYVGEDVESILYK  374

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL  A++NV+AAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  375   LLAQAEFNVEAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  434

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGD+IQ+DTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR  GVT 
Sbjct  435   KGARKHPRGDSIQMDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRA-GVTD  493

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A VTSSLLE+VESSDLI+YGLIPEFVGRFPILVSLTALTE+QLV+VLTEPKNALGKQYK+
Sbjct  494   AAVTSSLLESVESSDLIAYGLIPEFVGRFPILVSLTALTEDQLVKVLTEPKNALGKQYKR  553

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             +F MNNVKLHFTE ALR IA+KA  KNTGARGLR+ILESIL +AMYEIPDV++G + +DA
Sbjct  554   LFSMNNVKLHFTEKALRVIAKKATAKNTGARGLRAILESILTEAMYEIPDVKTGSDGVDA  613

Query  456   vivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKE  346
             V+VD+E+VG  +  GCG KIL G+GAL+ YL   E+KE
Sbjct  614   VVVDEESVGSVDAPGCGGKILRGEGALERYLVEAERKE  651



>gb|KDP40893.1| hypothetical protein JCGZ_24892 [Jatropha curcas]
Length=599

 Score =   519 bits (1336),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 267/365 (73%), Positives = 313/365 (86%), Gaps = 6/365 (2%)
 Frame = -2

Query  1377  DKVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGED  1198
             + ++  ++E VEL+KSN+L+MGPTGSGKTLLAKTLAR+VNVPFVIADATTLTQAGYVGED
Sbjct  227   NDLQNDDNEFVELDKSNVLLMGPTGSGKTLLAKTLARIVNVPFVIADATTLTQAGYVGED  286

Query  1197  VESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEG  1018
             VESILY+LL  +++NV+AAQ+GIVYIDEVDK+TKKAES NI RDVSGEGVQQALLKMLEG
Sbjct  287   VESILYRLLEASEFNVEAAQRGIVYIDEVDKMTKKAESSNIGRDVSGEGVQQALLKMLEG  346

Query  1017  TIVNVP--EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRT  844
             T+VNVP  +KG RK  RGD IQ+DTKDILFICGGAF++LEKTISERRQD+SIGFGAPVR 
Sbjct  347   TVVNVPVPDKGPRKQSRGDTIQMDTKDILFICGGAFVNLEKTISERRQDASIGFGAPVRA  406

Query  843   NMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPK  664
             NMRTGG+T A VTSSLLE+VES DLI+YGLIPEFVGRFPILVSL+AL E+QLVQVL EPK
Sbjct  407   NMRTGGMTDAAVTSSLLESVESGDLIAYGLIPEFVGRFPILVSLSALNEDQLVQVLMEPK  466

Query  663   NALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDV  484
             NALGKQYKKMF MNNVKLHFTE++LR IA+KA+ KNTGARGLR+ILE+IL +AMYE+P+ 
Sbjct  467   NALGKQYKKMFNMNNVKLHFTENSLRLIAKKAMAKNTGARGLRAILENILTEAMYEVPEN  526

Query  483   RSGdnvidavivddeaVGH-EGRGCGAKILYGKGALDCYLSG---NEQKEPKKIVEGSEA  316
             ++G N I AV+VD+EAVG  +  GCGAKILYG GA  C          K+  ++ EG  +
Sbjct  527   KTGTNYITAVLVDEEAVGSVDAPGCGAKILYGDGAFGCNFHEMKLTNSKDNSRVAEGESS  586

Query  315   DIEVE  301
             + E E
Sbjct  587   ECEPE  591


 Score = 76.6 bits (187),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  1546  LGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             L    PTPKEI KGLD+FVIGQ++AKKVLSVAVYNHYKRIY+ S QK
Sbjct  172   LEKKLPTPKEISKGLDEFVIGQDKAKKVLSVAVYNHYKRIYHASRQK  218



>ref|XP_008232534.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent Clp protease ATP-binding 
subunit clpX-like, mitochondrial [Prunus mume]
Length=708

 Score =   521 bits (1343),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 280/334 (84%), Positives = 306/334 (92%), Gaps = 2/334 (1%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVI+DATTLTQAGYVGEDVESILY
Sbjct  344   DDDKVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVISDATTLTQAGYVGEDVESILY  403

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGV-QQALLKMLEGTIVNV  1003
             KLL  A++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGE   QQALLKMLEGTIVNV
Sbjct  404   KLLMAAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEXXXQQALLKMLEGTIVNV  463

Query  1002  PEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGV  823
             PEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMR GGV
Sbjct  464   PEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRAGGV  523

Query  822   TSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQY  643
             T AVVTSSLLE+VESSDLI+YGLIPEF+GRFPILVSLTALTE+QLVQVLTEPKNALGKQY
Sbjct  524   TDAVVTSSLLESVESSDLIAYGLIPEFIGRFPILVSLTALTEDQLVQVLTEPKNALGKQY  583

Query  642   KKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvi  463
             KK+F MNNVKLHF E ALR IA+KA+ KNTGARGLR++LESIL +AMYEIPDV++G + I
Sbjct  584   KKLFTMNNVKLHFEEKALRLIAKKAMAKNTGARGLRALLESILTEAMYEIPDVKTGIDRI  643

Query  462   davivddeaVGH-EGRGCGAKILYGKGALDCYLS  364
             DAV+VD+E+VG     GCG K++ G GAL+ YLS
Sbjct  644   DAVVVDEESVGSVNTPGCGGKLVRGDGALERYLS  677


 Score = 99.0 bits (245),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  1570  DGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             +  WGGSNLG + PTPKEICKGLDKFVIGQ+RAKKVLSVAVYNHYKRIY+ S QK
Sbjct  276   NNAWGGSNLGKDLPTPKEICKGLDKFVIGQQRAKKVLSVAVYNHYKRIYHASLQK  330



>ref|XP_006349274.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X1 [Solanum tuberosum]
 ref|XP_006349275.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X2 [Solanum tuberosum]
Length=636

 Score =   519 bits (1336),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 274/385 (71%), Positives = 322/385 (84%), Gaps = 4/385 (1%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL    + ++  K+  S+ +Y    R    +L K  ++  +   D++E  ++++
Sbjct  219   PKEICKGLDQFVVGQERAKKVLSVAVYNHYKRIYHSSLNK--KSDSRKVRDELESIDNDS  276

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L+MGPTGSGKTLLAKTLARL+NVPFVIADATTLTQAGYVGEDVES+LYKLL 
Sbjct  277   VELEKSNVLLMGPTGSGKTLLAKTLARLINVPFVIADATTLTQAGYVGEDVESVLYKLLE  336

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              AD+NV+AAQQGIVYIDEVDKITKKAESLNI RDVSGEGVQQALLKMLEGTIV+VP+  A
Sbjct  337   AADFNVEAAQQGIVYIDEVDKITKKAESLNIGRDVSGEGVQQALLKMLEGTIVSVPDNRA  396

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPRGD IQIDTKDILFICGGAF+ LEKTISERRQDSSIGFGAPVRTNMR GG+T AVV
Sbjct  397   RKHPRGDTIQIDTKDILFICGGAFVGLEKTISERRQDSSIGFGAPVRTNMRVGGLTDAVV  456

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VES DL SYGLIPEFVGRFP+LVSL++L  +QLVQVLTEPKNAL KQYK+MF 
Sbjct  457   TSSLLESVESDDLTSYGLIPEFVGRFPVLVSLSSLDVDQLVQVLTEPKNALCKQYKQMFN  516

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             +NNVKL FTE+ALR IA KAI KNTGARGLRSILESIL +AM+E+P  + G+  ++ V+V
Sbjct  517   LNNVKLQFTENALRLIAEKAIAKNTGARGLRSILESILTEAMFEVPGSKPGEESVEVVLV  576

Query  447   ddeaVG-HEGRGCGAKILYGKGALD  376
             D+EAVG  +  GCGAKIL+G   L+
Sbjct  577   DEEAVGTADTIGCGAKILHGSSGLE  601


 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  1573  KDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             K+  WGG++LG    TPKEICKGLD+FV+GQERAKKVLSVAVYNHYKRIY+ S  K
Sbjct  203   KEEGWGGTDLGIELLTPKEICKGLDQFVVGQERAKKVLSVAVYNHYKRIYHSSLNK  258



>ref|XP_007152420.1| hypothetical protein PHAVU_004G128700g [Phaseolus vulgaris]
 gb|ESW24414.1| hypothetical protein PHAVU_004G128700g [Phaseolus vulgaris]
Length=706

 Score =   520 bits (1340),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 294/413 (71%), Positives = 341/413 (83%), Gaps = 11/413 (3%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL    + +K  K+  S+ +Y    R    TL K       +  D     + + 
Sbjct  294   PKEICKGLDKFVIGQKRAKKVLSVAVYNHYKRIYHATLQKG------STVDSEVLDDDDN  347

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             V+LEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLL 
Sbjct  348   VDLEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLA  407

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              AD+NV AAQQGI+YIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA
Sbjct  408   AADFNVAAAQQGIIYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  467

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPRGDNIQ+DTK+ILFICGGAFIDLEKTISERRQDSSIGFGAPVR NMR GG+T +VV
Sbjct  468   RKHPRGDNIQMDTKNILFICGGAFIDLEKTISERRQDSSIGFGAPVRANMRNGGITDSVV  527

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VES+DLI+YGLIPEF+GRFPILVSL+ALTE+QL+ VLTEPKNALGKQYKK+F 
Sbjct  528   TSSLLESVESADLIAYGLIPEFIGRFPILVSLSALTEDQLMMVLTEPKNALGKQYKKLFS  587

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             MNNVKLHFTE ALR IA+KA++KNTGARGLR++LESIL +AM+EIPD+++G + IDAV+V
Sbjct  588   MNNVKLHFTEKALRLIAKKAMSKNTGARGLRALLESILTEAMFEIPDIKTGSDRIDAVVV  647

Query  447   ddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDL  292
             D+E+VG     GCG KIL G GAL+ YL  ++ K+    VE  E+D+  E DL
Sbjct  648   DEESVGSRTSLGCGGKILRGDGALEQYL--DKMKDSAVNVEVGESDLH-EGDL  697



>gb|AFW70872.1| ATP-dependent Clp protease ATP-binding subunit clpX [Zea mays]
Length=559

 Score =   514 bits (1324),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 284/423 (67%), Positives = 348/423 (82%), Gaps = 7/423 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLL-KSDRNPEKNDSDKVEGT  1360
             F  P++  +GL    + ++  K+  S+ +Y    R    +L+ +S  +  ++DS     +
Sbjct  138   FPTPKEICRGLDKFVIGQQRAKKVLSVAVYNHYKRIYCESLINRSAADCSQSDSCT---S  194

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VELEKSNILVMGPTGSGKTLLAKTLAR VNVPFVIADAT+LTQAGYVGEDVESILY
Sbjct  195   DTDMVELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATSLTQAGYVGEDVESILY  254

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL  AD++V AAQQGIVYIDEVDKITKKAES+N+SRDVSGEGVQQALLKMLEGT+V+VP
Sbjct  255   KLLAAADFDVAAAQQGIVYIDEVDKITKKAESINLSRDVSGEGVQQALLKMLEGTVVSVP  314

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGAR+HPRGDNIQIDTK+ILFICGGAF+DLEKTISERR DSSIGF A VR+NMR+GGV 
Sbjct  315   EKGARRHPRGDNIQIDTKNILFICGGAFVDLEKTISERRHDSSIGFRAQVRSNMRSGGVI  374

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             +A +TSSLL++VES DLI+YGLIPEFVGRFPILV L++L+E+QLV+VLTEPKNALG+QY 
Sbjct  375   NAEITSSLLKSVESGDLIAYGLIPEFVGRFPILVGLSSLSEDQLVEVLTEPKNALGRQYT  434

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F+MN+VKLHFTE+ALR IA++AI+KNTGARGLRSILESIL +AMYEIP+ R+G + ID
Sbjct  435   KLFEMNDVKLHFTEEALRLIAKRAISKNTGARGLRSILESILTEAMYEIPETRTGKDKID  494

Query  459   avivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPK-KIVEGSEADIEVERDLPS  286
             AV+VD+E+VG     G GAKIL G+ ALD YL+ +  KE   ++ E    + E++ + PS
Sbjct  495   AVVVDEESVGSVNQHGIGAKILCGEKALDVYLANHNNKESTGQLQERPNGESEIDTEAPS  554

Query  285   IVA  277
              VA
Sbjct  555   RVA  557


 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 69/104 (66%), Gaps = 7/104 (7%)
 Frame = -1

Query  1711  SSYGDPPEVWQPPGDGIVVRPGVKFVQVGEVDgpssgs-----gggfgsGAKDGCWGGSN  1547
             S   +PPE+W+ PG+  V   GV    VG +D     +       G   G + G WGGSN
Sbjct  76    SDGAEPPEIWRQPGEAPVAPEGVG--AVGRIDVVRVAAPGGEDFDGKDGGGESGGWGGSN  133

Query  1546  LGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDS  1415
             LG  FPTPKEIC+GLDKFVIGQ+RAKKVLSVAVYNHYKRIY +S
Sbjct  134   LGRRFPTPKEICRGLDKFVIGQQRAKKVLSVAVYNHYKRIYCES  177



>gb|EYU22682.1| hypothetical protein MIMGU_mgv1a002117mg [Erythranthe guttata]
Length=711

 Score =   519 bits (1337),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 273/324 (84%), Positives = 301/324 (93%), Gaps = 1/324 (0%)
 Frame = -2

Query  1353  EAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKL  1174
             + V+LEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKL
Sbjct  348   DNVDLEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKL  407

Query  1173  LTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEK  994
             LTVA++NVQAAQQG+VYIDEVDKITKKAESLN SRDVSGEGVQQALLKMLEGT+VNVPEK
Sbjct  408   LTVAEFNVQAAQQGMVYIDEVDKITKKAESLNTSRDVSGEGVQQALLKMLEGTVVNVPEK  467

Query  993   GARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSA  814
             GARKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR GGV  A
Sbjct  468   GARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRAGGVIDA  527

Query  813   VVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKM  634
              +TSSLLE+VESSDLI+YGLIPEF+GRFPILVSL+ALTE+QLVQVLTEPKNALGKQYKK+
Sbjct  528   SITSSLLESVESSDLIAYGLIPEFIGRFPILVSLSALTEDQLVQVLTEPKNALGKQYKKL  587

Query  633   FQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidav  454
              +MNNVKLHFTE ALR I+ KAI+KNTGARGLR+ILES+L DAMYEIPD RSG   +DAV
Sbjct  588   LEMNNVKLHFTEKALRLISNKAISKNTGARGLRTILESLLTDAMYEIPDARSGKERVDAV  647

Query  453   ivddeaVG-HEGRGCGAKILYGKG  385
             +VD+E+VG  +  GCG K+L G+G
Sbjct  648   VVDEESVGTSDVAGCGGKLLEGEG  671



>dbj|BAD21479.1| putative ATP-dependent Clp protease ATP-binding subunit ClpX1 
(CLPX) [Oryza sativa Japonica Group]
Length=554

 Score =   513 bits (1320),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 276/391 (71%), Positives = 333/391 (85%), Gaps = 4/391 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  +GL    + ++  K+  S+ +Y    R     LL S    + +++D    ++
Sbjct  147   FPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKR-IHCELLSSRSAGDCSETDSC-ASD  204

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNILVMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  205   TDGVELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYK  264

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL  AD++V AAQQGIVYIDEVDKITKKAES+N+SRDVSGEGVQQALLKMLEGT+V+VPE
Sbjct  265   LLAAADFDVAAAQQGIVYIDEVDKITKKAESINLSRDVSGEGVQQALLKMLEGTVVSVPE  324

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGAR+HPRGDNIQIDTK+ILFICGGAF+DLEKTISERR DSSIGF AP+R+NMRTGGV +
Sbjct  325   KGARRHPRGDNIQIDTKNILFICGGAFVDLEKTISERRHDSSIGFQAPIRSNMRTGGVIN  384

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A +TSSLLE+VES DLI+YGLIPEFVGRFPILVSL++L+E+QLV+VLT+PKNALG+QY K
Sbjct  385   AEITSSLLESVESGDLIAYGLIPEFVGRFPILVSLSSLSEDQLVEVLTKPKNALGRQYTK  444

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             +F+MN+VKLHFTE ALR I+++AI KNTGARGLRSILES+L ++MYEIP++R+G + IDA
Sbjct  445   LFEMNDVKLHFTEKALRLISKRAIAKNTGARGLRSILESLLTESMYEIPEIRTGKDKIDA  504

Query  456   vivddeaVGHEGR-GCGAKILYGKGALDCYL  367
             V+VD+++VG   + G GAKIL G+GALD YL
Sbjct  505   VVVDEDSVGSTNQHGSGAKILCGEGALDLYL  535


 Score = 85.5 bits (210),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 64/104 (62%), Gaps = 16/104 (15%)
 Frame = -1

Query  1699  DPPEVWQPPGDGIVVRP---GVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSN------  1547
             +PPE+W+ PG+     P   G +  +VG +D     +GGG G G       G        
Sbjct  84    EPPEIWRQPGEA----PPGGGARGAEVGRIDVVRVAAGGGGGGGDGSDGNEGGGGGAGWG  139

Query  1546  ---LGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIY  1424
                LG  FPTPKEIC+GLDKFVIGQERAKKVLSVAVYNHYKRI+
Sbjct  140   GSNLGRRFPTPKEICRGLDKFVIGQERAKKVLSVAVYNHYKRIH  183



>ref|XP_006645143.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Oryza brachyantha]
Length=503

 Score =   511 bits (1315),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 254/352 (72%), Positives = 307/352 (87%), Gaps = 1/352 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             +   +E++KSN+L+MGPTGSGKTLLAKTLAR+VNVPF+IADAT+LTQAGYVGEDVESIL 
Sbjct  141   DQNTIEIDKSNVLLMGPTGSGKTLLAKTLARIVNVPFIIADATSLTQAGYVGEDVESILQ  200

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL  A+YNVQAAQQGIVYIDEVDKITKKAES N+SRDVSGEGVQQALLK+LEGT+V++P
Sbjct  201   KLLVAAEYNVQAAQQGIVYIDEVDKITKKAESANVSRDVSGEGVQQALLKILEGTVVSIP  260

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKG+RK+ R ++IQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAP+RTNMR+ GVT
Sbjct  261   EKGSRKNSRNESIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPIRTNMRSSGVT  320

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
               +VTSSLLE+VES DL  YGLIPEF+GR PILVSLTAL E+QLVQVLTEPKN+L +QY+
Sbjct  321   DPMVTSSLLESVESGDLARYGLIPEFIGRLPILVSLTALNEDQLVQVLTEPKNSLSRQYR  380

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             KMF +NNVKLHFT+ ALR +A+K++ +NTGARGLR+ILES+L++AMYEIPD ++G   +D
Sbjct  381   KMFSLNNVKLHFTDGALRMVAQKSMARNTGARGLRAILESLLLEAMYEIPDEKTGSERVD  440

Query  459   avivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIE  307
             AV++D+EA+G   R GCGAKIL G GAL+ Y++    K   +  EG   ++E
Sbjct  441   AVVLDEEAIGSIDRPGCGAKILRGDGALEEYITTTNTKNSPETNEGLAGELE  492


 Score = 87.8 bits (216),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG++LG   PTP+E+C+ LD+FVIGQ +AKKVLSVAVYNHYKRIYN + QK
Sbjct  75    WGGASLGEELPTPREMCRRLDEFVIGQGKAKKVLSVAVYNHYKRIYNATVQK  126



>ref|NP_001147507.1| ATP-dependent Clp protease ATP-binding subunit clpX [Zea mays]
 gb|ACG27758.1| ATP-dependent Clp protease ATP-binding subunit clpX [Zea mays]
Length=559

 Score =   513 bits (1321),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 284/423 (67%), Positives = 347/423 (82%), Gaps = 7/423 (2%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLL-KSDRNPEKNDSDKVEGT  1360
             F  P++  +GL    + ++  K+  S+ +Y    R    +L+ +S  +  ++DS     +
Sbjct  138   FPTPKEICRGLDKFVIGQQRAKKVLSVAVYNHYKRIYCESLINRSAADCSQSDSCT---S  194

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VELEKSNILVMGPTGSGKTLLAKTLAR VNVPFVIADAT+LTQAGYVGEDVESILY
Sbjct  195   DTDMVELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATSLTQAGYVGEDVESILY  254

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL  AD++V AAQQGIVYIDEVDKITKKAES+N+SRDVSGEGVQQALLKMLEGT+V+VP
Sbjct  255   KLLAAADFDVAAAQQGIVYIDEVDKITKKAESINLSRDVSGEGVQQALLKMLEGTVVSVP  314

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGAR+HPRGDNIQIDTK+ILFICGGAF+DLEKTISERR DSSIGF A VR+NMR+GGV 
Sbjct  315   EKGARRHPRGDNIQIDTKNILFICGGAFVDLEKTISERRHDSSIGFRAQVRSNMRSGGVI  374

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             +A +TSSLL++VES DLI+YGLIPEFVGRFPILV L++L+E+QLV+VLTEPKNALG+QY 
Sbjct  375   NAEITSSLLKSVESGDLIAYGLIPEFVGRFPILVGLSSLSEDQLVEVLTEPKNALGRQYT  434

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F+MN+VKLHFTE+ALR IA++AI+KNTGARGLRSILESIL +AMYEIP+ R G + ID
Sbjct  435   KLFEMNDVKLHFTEEALRLIAKRAISKNTGARGLRSILESILTEAMYEIPETRIGKDKID  494

Query  459   avivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPK-KIVEGSEADIEVERDLPS  286
             AV+VD+E+VG     G GAKIL G+ ALD YL+ +  KE   ++ E    + E++ + PS
Sbjct  495   AVVVDEESVGSVNQHGIGAKILCGEKALDVYLANHNNKESTGQLQERPNGESEIDTEAPS  554

Query  285   IVA  277
              VA
Sbjct  555   RVA  557


 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 69/104 (66%), Gaps = 7/104 (7%)
 Frame = -1

Query  1711  SSYGDPPEVWQPPGDGIVVRPGVKFVQVGEVDgpssgs-----gggfgsGAKDGCWGGSN  1547
             S   +PPE+W+ PG+  V   GV    VG +D     +       G   G + G WGGSN
Sbjct  76    SDGAEPPEIWRQPGEAPVAPEGVG--AVGRIDVVRVAAPGGEDFDGKDGGGESGGWGGSN  133

Query  1546  LGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDS  1415
             LG  FPTPKEIC+GLDKFVIGQ+RAKKVLSVAVYNHYKRIY +S
Sbjct  134   LGRRFPTPKEICRGLDKFVIGQQRAKKVLSVAVYNHYKRIYCES  177



>gb|KHG18905.1| clpX [Gossypium arboreum]
Length=576

 Score =   513 bits (1322),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 291/420 (69%), Positives = 334/420 (80%), Gaps = 19/420 (5%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + +++ K+  S+ +Y   +R    +  K  R+   + SD     +
Sbjct  173   FPTPKEICKGLDKFVIGQEKAKKVLSVAVYNHYMRIYHESSQK--RSAGDSGSDIAYVLD  230

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGS           L++VP        L  AGYVGEDVESILYK
Sbjct  231   DDIVELEKSNILLMGPTGS-------DFDALLSVP-----CAPLHGAGYVGEDVESILYK  278

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL VADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  279   LLVVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  338

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRG+NIQIDTKDILFICGGAFID+EKTISER QDSSIGFGAPVR NMR GGVT+
Sbjct  339   KGARKHPRGENIQIDTKDILFICGGAFIDIEKTISERLQDSSIGFGAPVRANMRAGGVTN  398

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A +TSSL+ETVES+DL++YGLIPEFVGRFP+LVSL ALTE QLVQVLT+PKNAL KQYKK
Sbjct  399   AALTSSLMETVESTDLVAYGLIPEFVGRFPVLVSLLALTEEQLVQVLTKPKNALCKQYKK  458

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN V LH TE AL+SIARKAITKNTGARGLR+ILE+ILMDAMYEIPDVR+GD++IDA
Sbjct  459   MFQMNGVNLHITEGALKSIARKAITKNTGARGLRAILENILMDAMYEIPDVRTGDDIIDA  518

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
             V+VD+EAVG +G G GAKILYGKGALD YLS   Q++ K +    E ++E E  LPS+VA
Sbjct  519   VVVDEEAVGLKGCGSGAKILYGKGALDSYLS---QQKLKDLETSGETEVETEL-LPSVVA  574


 Score =   192 bits (487),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 137/214 (64%), Gaps = 26/214 (12%)
 Frame = -1

Query  1969  AALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSK--NYFTNSRHSFSLFK  1796
             AA R K   ETAS T S  R+F+ N+M  GR+ +    + I++K  ++F N+ + F+ FK
Sbjct  2     AAFRCKPSAETASLTVSQFRHFLSNYMHYGRMASSSHCTTIRNKWDDHFVNTPYHFTSFK  61

Query  1795  PVSVRGEFVDRGYD------NSRNLSS-----------CGKIDISSSYGDPPEVWQPPGD  1667
             PVS+RGE V++G        NS +LS            C    + SSYGDPPEVWQPPGD
Sbjct  62    PVSLRGELVEKGSRFLDIRRNSHDLSKDVDRELREKLGCNSFRVLSSYGDPPEVWQPPGD  121

Query  1666  GIVVR-PGVKFVQVGEVDgpssgsgggfgsGA------KDGCWGGSNLGPNFPTPKEICK  1508
             GI +R  GV   + G   G   G G   GSG       KDGCWGGSNLG NFPTPKEICK
Sbjct  122   GIAIRVSGVNLGRGGGGGGAGGGGGPTAGSGGGFGSDSKDGCWGGSNLGHNFPTPKEICK  181

Query  1507  GLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             GLDKFVIGQE+AKKVLSVAVYNHY RIY++S+QK
Sbjct  182   GLDKFVIGQEKAKKVLSVAVYNHYMRIYHESSQK  215



>ref|XP_009762784.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Nicotiana sylvestris]
Length=644

 Score =   515 bits (1327),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 275/420 (65%), Positives = 335/420 (80%), Gaps = 12/420 (3%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL    + +++ K+  S+ +Y    R    +L K   +      D +E  ++++
Sbjct  225   PKEICKGLDQFVVGQEKAKKVLSVAVYNHYKRIYHSSLYKKSDSDSSKVRDCLEMFDNDS  284

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L+MGPTGSGKTLLAKTLARL+NVPFVIADATTLTQAGYVGEDVES+LYKLL 
Sbjct  285   VELEKSNVLLMGPTGSGKTLLAKTLARLINVPFVIADATTLTQAGYVGEDVESVLYKLLE  344

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              AD+NV+AAQQG+VYIDEVDKITKKAESLNI RDVSGEGVQQALLKMLEGTIV+VP+  A
Sbjct  345   AADFNVEAAQQGVVYIDEVDKITKKAESLNIGRDVSGEGVQQALLKMLEGTIVSVPDNRA  404

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RK PRGD IQIDTKDILFICGGAF+ LEKTISERRQDSSIGFGAPVRTNMR GG+T A+V
Sbjct  405   RKQPRGDTIQIDTKDILFICGGAFVGLEKTISERRQDSSIGFGAPVRTNMRVGGLTDAIV  464

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VES DL +YGLIPEFVGRFP+LVSL++L E+QLVQVLTEPKNAL KQYK+MF 
Sbjct  465   TSSLLESVESDDLTAYGLIPEFVGRFPVLVSLSSLDEDQLVQVLTEPKNALCKQYKQMFN  524

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             +NNVKL FT++ALR IA+KAI KNTGARGLRSILESIL +AM+E+P  + G++ ++ V+V
Sbjct  525   LNNVKLQFTKNALRLIAKKAIAKNTGARGLRSILESILTEAMFEVPGSKPGEDFVEVVLV  584

Query  447   ddeaVG-HEGRGCGAKILYGKGALDCYLSGNEQKEPKKIV-----EGSEADIEVERDLPS  286
             D+EAVG  +  GCGAK+L+    L+     +  + P   V     E ++ D++ E + PS
Sbjct  585   DEEAVGTADISGCGAKVLHRSSVLE-----HASRPPGSTVTMEKKEATKEDLDSESEAPS  639



>gb|KCW46560.1| hypothetical protein EUGRSUZ_K00383 [Eucalyptus grandis]
Length=529

 Score =   511 bits (1315),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 270/353 (76%), Positives = 302/353 (86%), Gaps = 6/353 (2%)
 Frame = -2

Query  1545  WVQIFRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSD-K  1372
             W   F  P++  KGL    + ++  K+  S+ +Y    R       +S + P  +  D +
Sbjct  172   WGSNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKR----IYHESVKRPSGDSEDAR  227

Query  1371  VEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVE  1192
              E  + + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVE
Sbjct  228   PESADDDLVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVE  287

Query  1191  SILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTI  1012
             SIL+KLLT ADYNV AAQQGIVYIDEVDKITKKAES+NISRDVSGEGVQQALLKMLEGT+
Sbjct  288   SILHKLLTAADYNVAAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQALLKMLEGTV  347

Query  1011  VNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRT  832
             VNVPEKGARKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR 
Sbjct  348   VNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRA  407

Query  831   GGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALG  652
               VT+AVV SSLLE+VESSDLISYGLIPEFVGRFPILVSL+AL+E+QLV+VLTEPKNALG
Sbjct  408   SNVTNAVVASSLLESVESSDLISYGLIPEFVGRFPILVSLSALSEDQLVEVLTEPKNALG  467

Query  651   KQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEI  493
             KQY+KMFQMN VKLH+T++ALR IARKAI KNTGARGLRSILE+ILM+AMYE+
Sbjct  468   KQYRKMFQMNGVKLHYTDNALRLIARKAIAKNTGARGLRSILENILMEAMYEV  520


 Score =   169 bits (428),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 125/225 (56%), Gaps = 42/225 (19%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILN-HMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLF  1799
             MAA L+ K  RETA+  AS  R F+ N  M AGR+ N    S      +F N+ + F+ F
Sbjct  1     MAAVLKCKPSRETAAFAASQFRCFMFNNQMHAGRVPNSHRASHSNWDRFFANTPYLFTSF  60

Query  1798  KPVSVRGEFVDRG----------------------------------YDNSRNLSSCGKI  1721
             KPV++RG+FV++G                                  YD  R  S   K 
Sbjct  61    KPVTLRGDFVEQGTQFLSDRRVNSIVGTKKGAVTCDEREELGNFRGDYDGGRRWSE--KF  118

Query  1720  DISSSYGDPPEVWQPPGDGIVVRPGVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLG  1541
             +++SS GDPPEVWQPPG G+ VR G     V        G  G      KD  WGGSN G
Sbjct  119   NMASSNGDPPEVWQPPGGGVTVRLGNSGYVV-----TRGGGSGSESDSPKDESWGGSNWG  173

Query  1540  PNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              NFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIY++S ++
Sbjct  174   SNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYHESVKR  218



>ref|XP_004230411.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Solanum lycopersicum]
Length=636

 Score =   514 bits (1325),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 278/417 (67%), Positives = 335/417 (80%), Gaps = 8/417 (2%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL    + ++  K+  S+ +Y    R    +L K  ++  +   D++E  ++++
Sbjct  219   PKEICKGLDQFVVGQERAKKVLSVAVYNHYKRIYHSSLNK--KSDSRKVRDELENIDNDS  276

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L+MGPTGSGKTLLAKTLARL+NVPFVIADATTLTQAGYVGEDVES+LYKLL 
Sbjct  277   VELEKSNVLLMGPTGSGKTLLAKTLARLINVPFVIADATTLTQAGYVGEDVESVLYKLLE  336

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              AD+N++AAQQGIVYIDEVDKITKKAESLNI RDVSGEGVQQALLKMLEGTIV+VP+  A
Sbjct  337   AADFNIEAAQQGIVYIDEVDKITKKAESLNIGRDVSGEGVQQALLKMLEGTIVSVPDNRA  396

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPRGD IQIDTKDILFICGGAF+ LEKTISERRQDSSIGFGAPVRTNMR GG+T AVV
Sbjct  397   RKHPRGDTIQIDTKDILFICGGAFVGLEKTISERRQDSSIGFGAPVRTNMRAGGLTDAVV  456

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VES DL SYGLIPEFVGRFP+LVSL++L  +QLVQVLTEPKNAL KQYK+MF 
Sbjct  457   TSSLLESVESDDLTSYGLIPEFVGRFPVLVSLSSLDVDQLVQVLTEPKNALCKQYKQMFN  516

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             +NNVKL FT +ALR +A KAI KNTGARGLRSILESIL +AM+E+P  + G+  ++ V+V
Sbjct  517   LNNVKLQFTGNALRLVAEKAIAKNTGARGLRSILESILTEAMFEVPGSKPGEESVEVVLV  576

Query  447   ddeaVG-HEGRGCGAKILYGKGALDCY--LSGNEQKEPKKIVEGSEADIEVERDLPS  286
             D+EAVG  +  GCGAKIL G   L+     +G+     KK  E ++ D++ E + P+
Sbjct  577   DEEAVGTADTIGCGAKILCGSSGLENISPTTGSSMTMEKK--EATKEDLDSESEAPA  631


 Score = 92.0 bits (227),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  1573  KDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             K+  WGG+NLG    TPKEICKGLD+FV+GQERAKKVLSVAVYNHYKRIY+ S  K
Sbjct  203   KEEGWGGTNLGIELLTPKEICKGLDQFVVGQERAKKVLSVAVYNHYKRIYHSSLNK  258



>ref|XP_009421145.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Musa acuminata subsp. malaccensis]
Length=665

 Score =   514 bits (1325),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 271/350 (77%), Positives = 310/350 (89%), Gaps = 6/350 (2%)
 Frame = -2

Query  1386  NDSDKVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYV  1207
             +  +  EG + + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPF+IADATTLTQAGYV
Sbjct  295   DSENHAEGDDDDNVELEKSNILLMGPTGSGKTLLAKTLARFVNVPFIIADATTLTQAGYV  354

Query  1206  GEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKM  1027
             GEDVESILYKLLTVAD+NVQAAQQGIVYIDEVDKITKK+ESLNISRDVSGEGVQQALLKM
Sbjct  355   GEDVESILYKLLTVADFNVQAAQQGIVYIDEVDKITKKSESLNISRDVSGEGVQQALLKM  414

Query  1026  LEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVR  847
             LEGTIVNVPE GARKHPRGDNIQIDTKDILFICGGAF++LEKTISERRQDSSIGFGA VR
Sbjct  415   LEGTIVNVPENGARKHPRGDNIQIDTKDILFICGGAFVNLEKTISERRQDSSIGFGASVR  474

Query  846   TNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEP  667
              NMRT  +T  VVTSSLLE+VES DLI+YGL+PEFVGRFP+LVSL+AL+ENQLVQVL EP
Sbjct  475   ANMRTSWLTD-VVTSSLLESVESGDLIAYGLVPEFVGRFPVLVSLSALSENQLVQVLMEP  533

Query  666   KNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPD  487
             KNALG+QYKK+F MNN  LHFT+ +L  IA+K++ KNTGARGLR+ILE++L+DAMYEIPD
Sbjct  534   KNALGRQYKKLFSMNN--LHFTDASLCLIAKKSMAKNTGARGLRAILETVLLDAMYEIPD  591

Query  486   VRSGdnvi--davivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKE  346
             V++ D     DAV+VD++AVG   R G GAKIL G GAL+ Y++ ++ K+
Sbjct  592   VKTKDEDEPIDAVVVDEDAVGSVDRPGSGAKILRGDGALERYITDSKIKD  641


 Score = 81.3 bits (199),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -1

Query  1552  SNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             SNLG + PTPKEI +GLDK+VIGQE AKKVLSVAVYNHYKRIY+ S QK
Sbjct  242   SNLGKDMPTPKEIYEGLDKYVIGQEHAKKVLSVAVYNHYKRIYHASLQK  290



>ref|XP_009613098.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Nicotiana tomentosiformis]
Length=644

 Score =   513 bits (1321),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 268/378 (71%), Positives = 317/378 (84%), Gaps = 2/378 (1%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL    + ++  K+  S+ +Y    R    +L K   +      D +E  ++++
Sbjct  225   PKEICKGLDQFVVGQERAKKVLSVAVYNHYKRIYHSSLYKKSDSDSSKVRDDLEMFDNDS  284

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L+MGPTGSGKTLLAKTLARL+NVPFVIADATTLTQAGYVGEDVES+LYKLL 
Sbjct  285   VELEKSNVLLMGPTGSGKTLLAKTLARLINVPFVIADATTLTQAGYVGEDVESVLYKLLE  344

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              AD+NV+AAQQG+VYIDEVDKITKKAESLN+ RDVSGEGVQQALLKMLEGTIV+VP+  A
Sbjct  345   AADFNVEAAQQGVVYIDEVDKITKKAESLNVGRDVSGEGVQQALLKMLEGTIVSVPDNRA  404

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RK PRGD IQIDTKDILFICGGAF+ LEKTISERRQDSSIGFGAPVRTNMR GG+T AVV
Sbjct  405   RKQPRGDTIQIDTKDILFICGGAFVGLEKTISERRQDSSIGFGAPVRTNMRVGGLTDAVV  464

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VES DL +YGLIPEFVGRFP+LVSL++L E+QLVQVLTEPKNAL KQYK+MF 
Sbjct  465   TSSLLESVESDDLTAYGLIPEFVGRFPVLVSLSSLDEDQLVQVLTEPKNALCKQYKQMFN  524

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             +NNVKL FTE+ALR IA+KAI KNTGARGLRSILESIL +AM+E+P  + G++ ++ V+V
Sbjct  525   LNNVKLQFTENALRLIAKKAIAKNTGARGLRSILESILTEAMFEVPGSKPGEDSVEVVLV  584

Query  447   ddeaVG-HEGRGCGAKIL  397
             D+EAVG  +  GCGAK+L
Sbjct  585   DEEAVGTADISGCGAKVL  602



>ref|XP_004952278.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X1 [Setaria italica]
Length=644

 Score =   513 bits (1320),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 278/398 (70%), Positives = 331/398 (83%), Gaps = 5/398 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLL-KSDRNPEKNDSDKVEGT  1360
             F  P++  +GL    + ++  K+  S+ +Y    R    +L  +S  N  ++DS     +
Sbjct  140   FPTPKEICRGLDKFVIGQQRAKKVLSVAVYNHYKRIYCESLSSRSAGNCSESDSCM---S  196

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VELEKSNILVMGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  197   DTDMVELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILY  256

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL  AD++V AAQQGIVYIDEVDKITKKAES+N+SRDVSGEGVQQALLKMLEGT+V+VP
Sbjct  257   KLLAAADFDVAAAQQGIVYIDEVDKITKKAESINLSRDVSGEGVQQALLKMLEGTVVSVP  316

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGAR+HPRGDNIQIDTK+ILFICGGAF+ LEKTISERR DSSIGF A VR+NMRTGGV 
Sbjct  317   EKGARRHPRGDNIQIDTKNILFICGGAFVGLEKTISERRHDSSIGFRAQVRSNMRTGGVI  376

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             +A +TSSLLE+VES DLI+YGLIPEFVGRFPILVSL++L+E+QLV+VLTEPKNALG+QY 
Sbjct  377   NAEITSSLLESVESGDLIAYGLIPEFVGRFPILVSLSSLSEDQLVEVLTEPKNALGRQYT  436

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F+MN+VKLHFTE ALR IA++AI KNTGARGLRSILESIL +AMYEIP+ R+G + ID
Sbjct  437   KLFEMNDVKLHFTEKALRLIAKRAIVKNTGARGLRSILESILTEAMYEIPETRTGQDKID  496

Query  459   avivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKE  346
             AV+V++        G GAKIL G+GAL+ YL+ ++ KE
Sbjct  497   AVVVEESVGSANQHGIGAKILCGEGALELYLAKHDNKE  534


 Score = 89.4 bits (220),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 68/104 (65%), Gaps = 6/104 (6%)
 Frame = -1

Query  1711  SSYGDPPEVWQPPGDGIVVRPGVKFVQVGEVDgpssgsgggfgsGAKD-----GCWGGSN  1547
             S  G+PPE+W+ PG+            VG +D       GG G   KD     G WGGSN
Sbjct  77    SDGGEPPEIWRQPGE-APGERAGAAAAVGRIDLVRVAGPGGEGFDGKDGAGETGGWGGSN  135

Query  1546  LGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDS  1415
             LG  FPTPKEIC+GLDKFVIGQ+RAKKVLSVAVYNHYKRIY +S
Sbjct  136   LGRRFPTPKEICRGLDKFVIGQQRAKKVLSVAVYNHYKRIYCES  179



>ref|NP_001045031.1| Os01g0886600 [Oryza sativa Japonica Group]
 dbj|BAD82240.1| putative CLP protease regulatory subunit CLPX [Oryza sativa Japonica 
Group]
 dbj|BAD82124.1| putative CLP protease regulatory subunit CLPX [Oryza sativa Japonica 
Group]
 dbj|BAF06945.1| Os01g0886600 [Oryza sativa Japonica Group]
Length=496

 Score =   506 bits (1303),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 256/359 (71%), Positives = 307/359 (86%), Gaps = 1/359 (0%)
 Frame = -2

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             +E++KSN+L+MGPTGSGKTLLAKTLAR+VNVPF+IADAT+LTQAGYVGEDVESIL KLL 
Sbjct  138   IEIDKSNVLLMGPTGSGKTLLAKTLARIVNVPFIIADATSLTQAGYVGEDVESILQKLLV  197

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              A+YNVQAAQQGIVYIDEVDKITKKAES N+SRDVSGEGVQQALLK+LEGT+V++PEKG+
Sbjct  198   AAEYNVQAAQQGIVYIDEVDKITKKAESANVSRDVSGEGVQQALLKILEGTVVSIPEKGS  257

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RK+ R ++IQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAP+R NMR+  VT  +V
Sbjct  258   RKNSRNESIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPIRINMRSSEVTDPMV  317

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VES DL  YGLIPEF+GR PILVSLTAL E+QLVQVLTEPKN+L +QY+KMF 
Sbjct  318   TSSLLESVESGDLARYGLIPEFIGRLPILVSLTALNEDQLVQVLTEPKNSLSRQYRKMFS  377

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             +N VKLHFT+ ALR +A+KAI +NTGARGLR+ILES+L++AMYEIPD ++G   +DAV+V
Sbjct  378   LNKVKLHFTDGALRIVAKKAIARNTGARGLRAILESLLLEAMYEIPDEKTGSERVDAVVV  437

Query  447   ddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVAL  274
             D+EA+G   R GCGAKIL G GAL+ Y++    K   +  EG   ++E    +   V+L
Sbjct  438   DEEAIGSIDRPGCGAKILRGDGALEQYITNTNMKNSMEANEGLAGELEDAYMMSRFVSL  496


 Score = 88.2 bits (217),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG+ LG   PTP+E+C+ LD+FVIGQ +AKKVLSVAVYNHYKRIYN + QK
Sbjct  68    WGGATLGEELPTPREMCRRLDEFVIGQGKAKKVLSVAVYNHYKRIYNATVQK  119



>dbj|BAJ93977.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=619

 Score =   509 bits (1311),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 263/363 (72%), Positives = 309/363 (85%), Gaps = 1/363 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             +H+ VE++KSN+L+MGPTGSGKTLLAKTLAR+VNVPFVIADAT+LTQAGYVGEDVESIL 
Sbjct  257   DHDNVEIDKSNVLLMGPTGSGKTLLAKTLARIVNVPFVIADATSLTQAGYVGEDVESILQ  316

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL  A+YNVQAAQQGIVYIDEVDKITKKAES N+SRDVSGEGVQQALLK+LEGT+V +P
Sbjct  317   KLLVEAEYNVQAAQQGIVYIDEVDKITKKAESANVSRDVSGEGVQQALLKILEGTVVTIP  376

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKG+RK+ R D+IQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAP+RTN+R+ GVT
Sbjct  377   EKGSRKNSRNDSIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPIRTNIRSSGVT  436

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             S  VTSSLLE+VES DL  +GLIPEF+GR PILVSL AL E+QLVQVLTEPKN+L +QY+
Sbjct  437   SPTVTSSLLESVESGDLAKFGLIPEFIGRLPILVSLAALNEDQLVQVLTEPKNSLSRQYR  496

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             KMF +NNVKLHFT+ ALR +A+KAI KNTGARGLR ILE+IL++AMYEIPD ++G+  +D
Sbjct  497   KMFSLNNVKLHFTDGALRIVAKKAIVKNTGARGLRVILETILLEAMYEIPDEKAGNERVD  556

Query  459   avivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSI  283
             AV+VD+EA+G   R GCGAKIL G GAL  Y+  N      +  E    ++E    L  I
Sbjct  557   AVVVDEEAIGSVDRPGCGAKILRGDGALAQYIIRNNLPNSPETNEALAGELEDAYMLSRI  616

Query  282   VAL  274
             V+L
Sbjct  617   VSL  619


 Score = 86.3 bits (212),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG+ LG   PTP+E+C+ LD+FVIGQ +AKKVLSVAVYNHYKR+YN + QK
Sbjct  191   WGGATLGEELPTPREMCRRLDEFVIGQGKAKKVLSVAVYNHYKRVYNATVQK  242



>ref|XP_003564797.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Brachypodium distachyon]
Length=617

 Score =   508 bits (1309),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 257/348 (74%), Positives = 302/348 (87%), Gaps = 1/348 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             +   VE++KSN+L+MGPTGSGKTLLAKTLAR+VNVPF+IADAT+LTQAGYVGEDVESIL 
Sbjct  257   DQNTVEIDKSNVLLMGPTGSGKTLLAKTLARIVNVPFIIADATSLTQAGYVGEDVESILQ  316

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL  A+YNVQAAQQGIVYIDEVDKITKKAES N+SRDVSGEGVQQALLK+LEGT+V +P
Sbjct  317   KLLVEAEYNVQAAQQGIVYIDEVDKITKKAESANVSRDVSGEGVQQALLKILEGTVVTIP  376

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKG+RK+ R D+IQIDTKDILFICGGAF+DL+KTISERRQDSSIGFGAP+RT MR+ GVT
Sbjct  377   EKGSRKNSRNDSIQIDTKDILFICGGAFVDLDKTISERRQDSSIGFGAPIRTKMRSSGVT  436

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             +  VTSSLLE+VES DL  YGLIPEF+GR PILVSL AL E+QLVQVLTEPKN+L +QY+
Sbjct  437   NPTVTSSLLESVESGDLAKYGLIPEFIGRLPILVSLAALHEDQLVQVLTEPKNSLSRQYR  496

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             KMF +NNVKLHFT+DALR +A+KAI +NTGARGLR+ILESIL++AMYEIPD ++G+  +D
Sbjct  497   KMFSLNNVKLHFTDDALRIVAKKAIARNTGARGLRAILESILLEAMYEIPDEKAGNERVD  556

Query  459   avivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSE  319
             AV+VD+EA+G   R GCGAKIL G GAL  Y++    K   +  E  E
Sbjct  557   AVVVDEEAIGSVDRPGCGAKILRGDGALAQYITRTSAKNSLETNEAGE  604


 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG++LG   PTP+E+C+ LD+FVIGQ +AKKVLSVAVYNHYKRIYN + QK
Sbjct  191   WGGASLGEELPTPREMCRRLDEFVIGQGKAKKVLSVAVYNHYKRIYNANVQK  242



>gb|EEC71918.1| hypothetical protein OsI_04712 [Oryza sativa Indica Group]
Length=630

 Score =   508 bits (1307),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 257/359 (72%), Positives = 309/359 (86%), Gaps = 1/359 (0%)
 Frame = -2

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             +E++KSN+L+MGPTGSGKTLLAKTLAR+VNVPF+IADAT+LTQAGYVGEDVESIL KLL 
Sbjct  272   IEIDKSNVLLMGPTGSGKTLLAKTLARIVNVPFIIADATSLTQAGYVGEDVESILQKLLV  331

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              A+YNVQAAQQGIVYIDEVDKITKKAES+N+SRDVSGEGVQQALLK+LEGT+V++PEKG+
Sbjct  332   AAEYNVQAAQQGIVYIDEVDKITKKAESVNVSRDVSGEGVQQALLKILEGTVVSIPEKGS  391

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RK+ R ++IQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAP+RTNMR+  VT  +V
Sbjct  392   RKNSRNESIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPIRTNMRSSEVTDPMV  451

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VES DL  YGLIPEF+GR PILVSLTAL E+QLVQVLTEPKN+L +QY+KMF 
Sbjct  452   TSSLLESVESGDLARYGLIPEFIGRLPILVSLTALNEDQLVQVLTEPKNSLSRQYRKMFS  511

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             +N VKLHFT+ ALR +A+KAI +NTGARGLR+ILES+L++AMYEIPD ++G   +DAV+V
Sbjct  512   LNKVKLHFTDGALRIVAKKAIARNTGARGLRAILESLLLEAMYEIPDEKTGSERVDAVVV  571

Query  447   ddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVAL  274
             D+EA+G   R GCGAKIL G GAL+ Y++    K   +  EG   ++E    +   V+L
Sbjct  572   DEEAIGSIDRPGCGAKILRGDGALEQYITNTNMKNSMEANEGLAGELEDAYMMSRFVSL  630


 Score = 79.7 bits (195),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 9/61 (15%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKK---------VLSVAVYNHYKRIYNDSAQ  1409
             WGG+ LG   PTP+E+C+ LD+FVIGQ +AKK         VLSVAVYNHYKRIYN + Q
Sbjct  193   WGGATLGEELPTPREMCRRLDEFVIGQGKAKKVLEGACHNWVLSVAVYNHYKRIYNATVQ  252

Query  1408  K  1406
             K
Sbjct  253   K  253



>gb|EEE55774.1| hypothetical protein OsJ_04339 [Oryza sativa Japonica Group]
Length=572

 Score =   505 bits (1300),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 254/352 (72%), Positives = 304/352 (86%), Gaps = 1/352 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             +   +E++KSN+L+MGPTGSGKTLLAKTLAR+VNVPF+IADAT+LTQAGYVGEDVESIL 
Sbjct  61    DQNNIEIDKSNVLLMGPTGSGKTLLAKTLARIVNVPFIIADATSLTQAGYVGEDVESILQ  120

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL  A+YNVQAAQQGIVYIDEVDKITKKAES N+SRDVSGEGVQQALLK+LEGT+V++P
Sbjct  121   KLLVAAEYNVQAAQQGIVYIDEVDKITKKAESANVSRDVSGEGVQQALLKILEGTVVSIP  180

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKG+RK+ R ++IQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAP+R NMR+  VT
Sbjct  181   EKGSRKNSRNESIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPIRINMRSSEVT  240

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
               +VTSSLLE+VES DL  YGLIPEF+GR PILVSLTAL E+QLVQVLTEPKN+L +QY+
Sbjct  241   DPMVTSSLLESVESGDLARYGLIPEFIGRLPILVSLTALNEDQLVQVLTEPKNSLSRQYR  300

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             KMF +N VKLHFT+ ALR +A+KAI +NTGARGLR+ILES+L++AMYEIPD ++G   +D
Sbjct  301   KMFSLNKVKLHFTDGALRIVAKKAIARNTGARGLRAILESLLLEAMYEIPDEKTGSERVD  360

Query  459   avivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIE  307
             AV+VD+EA+G   R GCGAKIL G GAL+ Y++    K   +  EG   ++E
Sbjct  361   AVVVDEEAIGSIDRPGCGAKILRGDGALEQYITNTNMKNSMEANEGLAGELE  412


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 9/46 (20%)
 Frame = -1

Query  1516  ICKGLDKFVIGQERAKKVL---------SVAVYNHYKRIYNDSAQK  1406
             +C+ LD+FVIGQ +AKKVL         SVAVYNHYKRIYN + QK
Sbjct  1     MCRRLDEFVIGQGKAKKVLEGACQNWVLSVAVYNHYKRIYNATVQK  46



>ref|XP_011095003.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent Clp protease ATP-binding 
subunit clpX-like, mitochondrial [Sesamum indicum]
Length=715

 Score =   509 bits (1311),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 285/390 (73%), Positives = 324/390 (83%), Gaps = 15/390 (4%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLK-SDRNPEKNDSDKVEGTEHE  1351
             P++  KGL    + ++  K+  S+ +Y    R    +L K S+  P   D D       +
Sbjct  306   PKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYHASLHKGSEVEPSTLDDD-------D  358

Query  1350  AVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLL  1171
              V+LEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLL
Sbjct  359   NVDLEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLL  418

Query  1170  TVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKG  991
             TVA++NVQAAQQG+VYIDEVDKITKKAESLNISRDVSGEG       MLEGTIVNVPEKG
Sbjct  419   TVAEFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGXS-----MLEGTIVNVPEKG  473

Query  990   ARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAV  811
             ARKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAPVR NMR GGV  A 
Sbjct  474   ARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPVRANMRAGGVIDAA  533

Query  810   VTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMF  631
             VTSSLLE+VESSDLI+YGLIPEF+GRFPILVSL+ALTE+QLVQVL EPKNALGKQYKK+F
Sbjct  534   VTSSLLESVESSDLIAYGLIPEFIGRFPILVSLSALTEDQLVQVLMEPKNALGKQYKKLF  593

Query  630   QMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidavi  451
             +MNNVKLHFTE ALR I+ KA+TKNTGARGLR+ILE++L DAMYEIPD ++G + +DAV+
Sbjct  594   KMNNVKLHFTEKALRLISNKAMTKNTGARGLRAILENLLTDAMYEIPDAKTGKDRVDAVV  653

Query  450   vddeaVGHEGR-GCGAKILYGKGALDCYLS  364
             +DDE+VG     GCG KIL G GAL+ YL+
Sbjct  654   IDDESVGKINEPGCGGKILRGDGALERYLA  683


 Score =   102 bits (255),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 79/158 (50%), Gaps = 23/158 (15%)
 Frame = -1

Query  1810  FSLFKPVSVRGEFVDRGYDNSRNLSSCGKIDISSSYGDP--PEVWQP-------------  1676
             F  FK   ++G F++ G   SRN  S  K      YG    P  W+              
Sbjct  188   FRPFKMSPLQGSFIEIGRVKSRNSGSEKKSTDPQDYGKRLRPSFWETLRSYGGEPPENWP  247

Query  1675  -----PGDGIVVR--PGVKFVQ-VGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPK  1520
                   G+GI V   PG  F   V  +            +  +   WGGSNLG N PTPK
Sbjct  248   PHPPPSGNGIAVHTPPGPPFAPGVNVIRASGGNGTRSGVNNGEKSTWGGSNLGKNLPTPK  307

Query  1519  EICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             EICKGLDKFVIGQERAKKVLSVAVYNHYKRIY+ S  K
Sbjct  308   EICKGLDKFVIGQERAKKVLSVAVYNHYKRIYHASLHK  345



>ref|XP_004970835.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X2 [Setaria italica]
Length=618

 Score =   506 bits (1302),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 257/359 (72%), Positives = 309/359 (86%), Gaps = 1/359 (0%)
 Frame = -2

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VE++KSN+L+MGPTGSGKTLLAKTLAR+VNVPFVIADAT+LTQAGYVGEDVESIL KLL 
Sbjct  260   VEIDKSNVLLMGPTGSGKTLLAKTLARIVNVPFVIADATSLTQAGYVGEDVESILQKLLV  319

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              A+YNVQAAQQGIVYIDE+DKITKKAES N+SRDVSGEGVQQALLK+LEGT+V++PEKG+
Sbjct  320   AAEYNVQAAQQGIVYIDEIDKITKKAESANVSRDVSGEGVQQALLKILEGTVVSIPEKGS  379

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RK+ R ++IQIDT DILFICGGAF+DLEKTISERRQDSSIGFGAP+RTNMR+ G +S ++
Sbjct  380   RKNSRSESIQIDTTDILFICGGAFVDLEKTISERRQDSSIGFGAPIRTNMRSSGASSPMI  439

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VES DL+ YGLIPEF GR PILVSL AL E+QLVQVLTEPKN+L +QY+KMF 
Sbjct  440   TSSLLESVESGDLVRYGLIPEFTGRLPILVSLAALNEDQLVQVLTEPKNSLSRQYRKMFN  499

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             +N V+LHFT+ ALR IA+KAI KNTGARGLR+ILE+IL++AMYEIPD ++G+  +DAV+V
Sbjct  500   LNKVRLHFTDGALRLIAKKAIAKNTGARGLRAILETILLEAMYEIPDEKAGNERVDAVVV  559

Query  447   ddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVAL  274
             D+EA+G   R GCGAKIL G GALD Y++       ++  +G   ++E    L  IV+L
Sbjct  560   DEEAIGSADRPGCGAKILRGDGALDQYITRTNVMNLRETNDGLAGELEEAYMLSRIVSL  618


 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG++LG   PTP+E+C+ LD+FVIGQ +AKKVLSVAVYNHYKRIYN + QK
Sbjct  190   WGGASLGDELPTPREMCRRLDEFVIGQAKAKKVLSVAVYNHYKRIYNANVQK  241



>ref|XP_007023127.1| ATP-dependent Clp protease isoform 2 [Theobroma cacao]
 gb|EOY25749.1| ATP-dependent Clp protease isoform 2 [Theobroma cacao]
Length=547

 Score =   502 bits (1293),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 257/344 (75%), Positives = 301/344 (88%), Gaps = 3/344 (1%)
 Frame = -2

Query  1368  EGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVES  1189
             E   ++ VEL+KSN+L++GPTGSGKTLLAKTLAR+VNVPFVI DATTLTQAGYVGEDVES
Sbjct  200   ENDANDFVELDKSNVLLIGPTGSGKTLLAKTLARIVNVPFVIVDATTLTQAGYVGEDVES  259

Query  1188  ILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  1009
             ILYKLL  A+++V+AAQ GIVYIDEVDKITKKAES NI RDVSGEGVQQALLK+LEGTIV
Sbjct  260   ILYKLLVEAEFDVEAAQHGIVYIDEVDKITKKAESSNIGRDVSGEGVQQALLKLLEGTIV  319

Query  1008  NVP--EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMR  835
             NVP  +KGAR++PRGD+ QIDTKDILF+CGGAFIDLEKTISERRQDSSIGFGAPVR NMR
Sbjct  320   NVPLPDKGARRYPRGDSFQIDTKDILFVCGGAFIDLEKTISERRQDSSIGFGAPVRANMR  379

Query  834   TGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNAL  655
             + G+T+A VTSSLLE+VES DLI+YGLIPEF+GRFPILVSL+ L E+QLV+VL +PKNAL
Sbjct  380   SSGLTTAAVTSSLLESVESDDLIAYGLIPEFIGRFPILVSLSGLNEDQLVEVLMKPKNAL  439

Query  654   GKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSG  475
             GKQYKKMF MN VKLHFT +ALR I++KA+ KNTGARGLR+ILE+IL +AM+EIPD +  
Sbjct  440   GKQYKKMFSMNGVKLHFTANALRLISKKAMAKNTGARGLRAILENILTEAMFEIPDTKME  499

Query  474   dnvidavivddeaVG-HEGRGCGAKILYGKGALDCYLSGNEQKE  346
                ++AV+VD+EAVG  +  GCGAKILYG G LD +L+    K+
Sbjct  500   SQGVNAVLVDEEAVGSFDETGCGAKILYGDGELDRFLAKRTWKD  543


 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -1

Query  1546  LGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQ  1409
             L    PTPKEIC  LD+FVIGQ++AKKVLSVAVYNHYKRIY+ S Q
Sbjct  145   LERELPTPKEICGRLDEFVIGQQKAKKVLSVAVYNHYKRIYHASQQ  190



>ref|XP_004300022.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like 
[Fragaria vesca subsp. vesca]
Length=571

 Score =   503 bits (1294),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 256/329 (78%), Positives = 294/329 (89%), Gaps = 1/329 (0%)
 Frame = -2

Query  1374  KVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDV  1195
             K    + ++VELEKSN+L+MGPTGSGKTLLAKTLAR+VNVPF IADATTLTQAGYVGEDV
Sbjct  202   KPHSVDTDSVELEKSNVLLMGPTGSGKTLLAKTLARVVNVPFAIADATTLTQAGYVGEDV  261

Query  1194  ESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT  1015
             ESILYKLLT A+++V+AAQ+GIVYIDEVDKI KK ES NI RDVSGEGVQQALLKMLEGT
Sbjct  262   ESILYKLLTEAEFDVEAAQKGIVYIDEVDKIIKKVESSNIGRDVSGEGVQQALLKMLEGT  321

Query  1014  IVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMR  835
             +VNVP+KGARKHPRGD+IQ+DTKDILFICGGAF+ LEKTISER QDSSIGFGAPVR NMR
Sbjct  322   VVNVPDKGARKHPRGDSIQMDTKDILFICGGAFVGLEKTISERHQDSSIGFGAPVRANMR  381

Query  834   TGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNAL  655
             + G+  A+VTSSLLE+VES DLI+YGLIPEFVGRFPIL SL++L E+QLVQVLTEPKNAL
Sbjct  382   SSGLIDAIVTSSLLESVESDDLIAYGLIPEFVGRFPILASLSSLNEDQLVQVLTEPKNAL  441

Query  654   GKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSG  475
             GKQYK MF MN+VKLHFT+DALR IARKA+ KNTGARGLR+ILE+IL +AM+E+PD+++ 
Sbjct  442   GKQYKMMFDMNDVKLHFTDDALRLIARKAMAKNTGARGLRAILENILTEAMFEVPDIKTE  501

Query  474   dnvidavivddeaVGH-EGRGCGAKILYG  391
              N I AV+VD+EAVG  +  G GAKIL G
Sbjct  502   TNSIHAVLVDEEAVGSVDAPGRGAKILSG  530


 Score = 77.0 bits (188),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  1537  NFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             + PTPKEICK LD FVIGQERAKKVLSVAVYNHYKRI + S ++
Sbjct  145   DLPTPKEICKALDDFVIGQERAKKVLSVAVYNHYKRIRHSSQER  188



>ref|XP_004970834.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like isoform X1 [Setaria italica]
Length=640

 Score =   504 bits (1297),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 251/329 (76%), Positives = 297/329 (90%), Gaps = 1/329 (0%)
 Frame = -2

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VE++KSN+L+MGPTGSGKTLLAKTLAR+VNVPFVIADAT+LTQAGYVGEDVESIL KLL 
Sbjct  260   VEIDKSNVLLMGPTGSGKTLLAKTLARIVNVPFVIADATSLTQAGYVGEDVESILQKLLV  319

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              A+YNVQAAQQGIVYIDE+DKITKKAES N+SRDVSGEGVQQALLK+LEGT+V++PEKG+
Sbjct  320   AAEYNVQAAQQGIVYIDEIDKITKKAESANVSRDVSGEGVQQALLKILEGTVVSIPEKGS  379

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RK+ R ++IQIDT DILFICGGAF+DLEKTISERRQDSSIGFGAP+RTNMR+ G +S ++
Sbjct  380   RKNSRSESIQIDTTDILFICGGAFVDLEKTISERRQDSSIGFGAPIRTNMRSSGASSPMI  439

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VES DL+ YGLIPEF GR PILVSL AL E+QLVQVLTEPKN+L +QY+KMF 
Sbjct  440   TSSLLESVESGDLVRYGLIPEFTGRLPILVSLAALNEDQLVQVLTEPKNSLSRQYRKMFN  499

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             +N V+LHFT+ ALR IA+KAI KNTGARGLR+ILE+IL++AMYEIPD ++G+  +DAV+V
Sbjct  500   LNKVRLHFTDGALRLIAKKAIAKNTGARGLRAILETILLEAMYEIPDEKAGNERVDAVVV  559

Query  447   ddeaVGHEGR-GCGAKILYGKGALDCYLS  364
             D+EA+G   R GCGAKIL G GALD Y++
Sbjct  560   DEEAIGSADRPGCGAKILRGDGALDQYIT  588


 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG++LG   PTP+E+C+ LD+FVIGQ +AKKVLSVAVYNHYKRIYN + QK
Sbjct  190   WGGASLGDELPTPREMCRRLDEFVIGQAKAKKVLSVAVYNHYKRIYNANVQK  241



>ref|XP_002458882.1| hypothetical protein SORBIDRAFT_03g042120 [Sorghum bicolor]
 gb|EES04002.1| hypothetical protein SORBIDRAFT_03g042120 [Sorghum bicolor]
Length=623

 Score =   501 bits (1291),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 256/359 (71%), Positives = 308/359 (86%), Gaps = 1/359 (0%)
 Frame = -2

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VE++KSN+L+MGPTGSGKTLLAKTLAR+VNVPFVIADAT+LTQAGYVGEDVESIL KLL 
Sbjct  265   VEIDKSNVLLMGPTGSGKTLLAKTLARIVNVPFVIADATSLTQAGYVGEDVESILQKLLV  324

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              A+YNVQAAQQGIVYIDE+DKITKKAES N+SRDVSGEGVQQALLK+LEGT+V++PEKG+
Sbjct  325   AAEYNVQAAQQGIVYIDEIDKITKKAESANVSRDVSGEGVQQALLKILEGTVVSIPEKGS  384

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RK+ R D+IQIDT DILFICGGAF+DLEKTISERRQDSSIGFGAPVRTNMR+ G +  +V
Sbjct  385   RKNSRNDSIQIDTTDILFICGGAFVDLEKTISERRQDSSIGFGAPVRTNMRSSGASCPMV  444

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TS+LLE+VES DL+ YGLIPEF+GR PILVSL AL E QLVQVLTEPKN+L KQY+KMF 
Sbjct  445   TSTLLESVESGDLVRYGLIPEFIGRLPILVSLAALNEGQLVQVLTEPKNSLSKQYRKMFN  504

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             +N V+LHFT+ ALR +A+KAI K+TGARGLR+ILE++L++AMYEIPD ++G+  +DAV+V
Sbjct  505   LNKVRLHFTDGALRLVAKKAIAKSTGARGLRAILETVLLEAMYEIPDEKTGNERVDAVVV  564

Query  447   ddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVAL  274
             D+EA+G   R GCGAKIL G GALD Y++       ++  +G   ++E    L  IV+L
Sbjct  565   DEEAIGSVDRPGCGAKILRGDGALDQYITRTNVMNLRETNDGLAGELEEAYMLSRIVSL  623


 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG++LG   PTP+E+C+ LD+FVIGQ +AKKVLSVAVYNHYKRIYN + QK
Sbjct  195   WGGASLGDELPTPREMCRRLDEFVIGQAKAKKVLSVAVYNHYKRIYNANVQK  246



>gb|AFW84351.1| hypothetical protein ZEAMMB73_159465 [Zea mays]
Length=624

 Score =   501 bits (1289),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 256/359 (71%), Positives = 308/359 (86%), Gaps = 1/359 (0%)
 Frame = -2

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VE++KSN+L+MGPTGSGKTLLAKTLAR+VNVPFVIADAT+LTQAGYVGEDVESIL KLL 
Sbjct  266   VEIDKSNVLLMGPTGSGKTLLAKTLARIVNVPFVIADATSLTQAGYVGEDVESILQKLLV  325

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
              A+YNVQAAQQGIVYIDE+DKITKKAES N+SRDVSGEGVQQALLK+LEGT+V++PEKG+
Sbjct  326   AAEYNVQAAQQGIVYIDEIDKITKKAESANVSRDVSGEGVQQALLKILEGTVVSIPEKGS  385

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RK+ R D+IQIDT DILFICGGAF+DLEKTISERRQDSSIGFGAP+RTNMR+ G +  +V
Sbjct  386   RKNSRNDSIQIDTTDILFICGGAFVDLEKTISERRQDSSIGFGAPIRTNMRSSGASCPMV  445

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VES DL+ YGLIPEF+GR PILVSL AL E QLVQVLTEPKN+L KQY+KMF 
Sbjct  446   TSSLLESVESGDLVRYGLIPEFIGRLPILVSLAALNEGQLVQVLTEPKNSLSKQYRKMFN  505

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             +N VKLHFT+ ALR +A+KAI K+TGARGLR+ILE++L++AMYE+PD ++G+  +DAV+V
Sbjct  506   LNKVKLHFTDGALRLLAKKAIAKSTGARGLRAILETVLLEAMYEVPDEKTGNERVDAVVV  565

Query  447   ddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVAL  274
             D+EA+G   R GCGAKIL G GALD Y++       ++  +G   ++E    L  IV+L
Sbjct  566   DEEAIGSVDRPGCGAKILRGDGALDQYITRTNVMNLQETNDGLAGELEEAYMLSRIVSL  624


 Score = 87.8 bits (216),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG++LG + PTP+E+C+ LD+FVIGQ +AKKVLSVAVYNHYKRIYN + QK
Sbjct  196   WGGASLGDDLPTPRELCRRLDEFVIGQAKAKKVLSVAVYNHYKRIYNANVQK  247



>gb|KDO42064.1| hypothetical protein CISIN_1g038067mg, partial [Citrus sinensis]
Length=510

 Score =   496 bits (1276),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 253/329 (77%), Positives = 291/329 (88%), Gaps = 4/329 (1%)
 Frame = -2

Query  1353  EAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKL  1174
             E VELEKSN+L+MGPTGSGKTLLAKTLAR+VNVPF I DAT LTQAGYVGED ES+LYKL
Sbjct  157   EIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVPFTITDATALTQAGYVGEDAESVLYKL  216

Query  1173  LTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP--  1000
             L  AD++V+AAQ+GIVYIDEVDKI K AES N  RDVSGEGVQQALLKMLEGT+VNVP  
Sbjct  217   LAAADFDVEAAQRGIVYIDEVDKIVK-AESRNNGRDVSGEGVQQALLKMLEGTVVNVPIP  275

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             + G RKHPRGDNI IDTKDILFICGGAF+ LEKTISERRQDSSIGFGAPVR NMRTGG+T
Sbjct  276   DNGPRKHPRGDNIPIDTKDILFICGGAFVGLEKTISERRQDSSIGFGAPVRANMRTGGLT  335

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
              A+VTSSLLE+V+S DL++YGLIPEF+GRFPILVSL+AL E+QLVQVL EPKNALG+QYK
Sbjct  336   DALVTSSLLESVDSGDLVAYGLIPEFIGRFPILVSLSALNEDQLVQVLMEPKNALGRQYK  395

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             KMF MNNVKLHFT+DALR IA+KA+ KNTGARGLR++LE+IL +AM+EIP+ + G + ++
Sbjct  396   KMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGLRALLENILTEAMFEIPETKIGTSSVN  455

Query  459   avivddeaVGH-EGRGCGAKILYGKGALD  376
             AV+VD EAVG  +  GCGAKIL+G G L+
Sbjct  456   AVLVDKEAVGSVDAPGCGAKILHGDGELE  484


 Score = 65.9 bits (159),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 39/59 (66%), Gaps = 15/59 (25%)
 Frame = -1

Query  1537  NFPTPKEICKGLDKFVIGQERAKK-----VL----------SVAVYNHYKRIYNDSAQK  1406
             + PTPKEICKGLD+FVIGQERAKK     +L            AVYNHYKRIY+ S QK
Sbjct  71    DLPTPKEICKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHSSLQK  129



>ref|XP_007023128.1| ATP-dependent Clp protease isoform 3, partial [Theobroma cacao]
 gb|EOY25750.1| ATP-dependent Clp protease isoform 3, partial [Theobroma cacao]
Length=535

 Score =   496 bits (1278),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 254/336 (76%), Positives = 296/336 (88%), Gaps = 3/336 (1%)
 Frame = -2

Query  1368  EGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVES  1189
             E   ++ VEL+KSN+L++GPTGSGKTLLAKTLAR+VNVPFVI DATTLTQA YVGEDVES
Sbjct  200   ENDANDFVELDKSNVLLIGPTGSGKTLLAKTLARIVNVPFVIVDATTLTQASYVGEDVES  259

Query  1188  ILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  1009
             ILYKLL  A+++V+AAQ GIVYIDEVDKITKKAES NI RDVSGEGVQQALLK+LEGTIV
Sbjct  260   ILYKLLVEAEFDVEAAQHGIVYIDEVDKITKKAESSNIGRDVSGEGVQQALLKLLEGTIV  319

Query  1008  NVP--EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMR  835
             NVP  +KGAR++PRGD+ QIDTKDILF+CGGAFIDLEKTISERRQDSSIGFGAPVR NMR
Sbjct  320   NVPLPDKGARRYPRGDSFQIDTKDILFVCGGAFIDLEKTISERRQDSSIGFGAPVRANMR  379

Query  834   TGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNAL  655
             + G+T+A VTSSLLE+VES DLI+YGLIPEF+GRFPILVSL+ L E+QLV+VL +PKNAL
Sbjct  380   SSGLTTAAVTSSLLESVESDDLIAYGLIPEFIGRFPILVSLSGLNEDQLVEVLMKPKNAL  439

Query  654   GKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSG  475
             GKQYKKMF MN VKLHFT +ALR I++KA+ KNTGARGLR+ILE+IL +AM+EIPD +  
Sbjct  440   GKQYKKMFSMNGVKLHFTANALRLISKKAMAKNTGARGLRAILENILTEAMFEIPDTKME  499

Query  474   dnvidavivddeaVG-HEGRGCGAKILYGKGALDCY  370
                ++AV+VD+EAVG  +  GCGAKILYG G LD +
Sbjct  500   SQGVNAVLVDEEAVGSFDETGCGAKILYGDGELDRF  535


 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -1

Query  1546  LGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQ  1409
             L    PTPKEIC  LD+FVIGQ++AKKVLSVAVYNHYKRIY+ S Q
Sbjct  145   LERELPTPKEICGRLDEFVIGQQKAKKVLSVAVYNHYKRIYHASQQ  190



>ref|XP_006470836.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial-like [Citrus sinensis]
Length=592

 Score =   498 bits (1283),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 256/339 (76%), Positives = 296/339 (87%), Gaps = 4/339 (1%)
 Frame = -2

Query  1353  EAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKL  1174
             E VELEKSN+L+MGPTGSGKTLLAKTLAR+VNVPF I DAT LTQAGYVGED ES+LYKL
Sbjct  234   EIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVPFTITDATALTQAGYVGEDAESLLYKL  293

Query  1173  LTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP--  1000
             L  AD++V+AAQ+GIVYIDEVDKI K AES N  RDVSGEGVQQALLKMLEGT+VNVP  
Sbjct  294   LAAADFDVEAAQRGIVYIDEVDKIVK-AESRNNGRDVSGEGVQQALLKMLEGTVVNVPIP  352

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             + G RKHPRGDNI IDTKDILFICGGAF+ LEKTISERRQDSSIGFGAPVR NMRTGG+T
Sbjct  353   DNGPRKHPRGDNIPIDTKDILFICGGAFVGLEKTISERRQDSSIGFGAPVRANMRTGGLT  412

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
              A+VTSSLLE+V+S DL++YGLIPEF+GRFPILVSL+AL E+QLVQVLTEPKNALG+QYK
Sbjct  413   DALVTSSLLESVDSGDLVAYGLIPEFIGRFPILVSLSALNEDQLVQVLTEPKNALGRQYK  472

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             KMF MNNVKLHFT+DALR IA+KA+ KNTGARGLR++LE+IL +AM+EIP+ + G + ++
Sbjct  473   KMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGLRALLENILTEAMFEIPETKIGTSSVN  532

Query  459   avivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKE  346
             AV+VD EAVG  +  GCGAKIL+G G L+  L   + K+
Sbjct  533   AVLVDKEAVGSVDAPGCGAKILHGDGELERVLHETKSKD  571


 Score = 83.2 bits (204),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -1

Query  1558  GGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             G S    + PTPKEICKGLD+FVIGQERAKKVL+VAVYNHYKRIY+ S QK
Sbjct  169   GNSEGNIDLPTPKEICKGLDEFVIGQERAKKVLAVAVYNHYKRIYHSSLQK  219



>ref|XP_008218637.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Prunus mume]
Length=597

 Score =   498 bits (1283),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 258/351 (74%), Positives = 307/351 (87%), Gaps = 5/351 (1%)
 Frame = -2

Query  1413  LKSDRNPEKNDSDKVEGT-EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIAD  1237
             L++    E  DS K++G  + ++VELEKSN+L+MGPTGSGKTLLAKTLAR+VNVPF IAD
Sbjct  208   LQTRSGAESADS-KLQGVLDSDSVELEKSNVLLMGPTGSGKTLLAKTLARVVNVPFAIAD  266

Query  1236  ATTLTQAGYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSG  1057
              TTLTQAGYVGEDVESILY+LL  AD++V+AAQ+GIVYIDEVDKITKKAESL  SRDVSG
Sbjct  267   GTTLTQAGYVGEDVESILYRLLMEADFDVEAAQKGIVYIDEVDKITKKAESL--SRDVSG  324

Query  1056  EGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQD  877
             EGVQQALLKMLEGT+VN+P+KGARKHPRGD+IQ+DT++ILFICGGAF+ LEK ISER QD
Sbjct  325   EGVQQALLKMLEGTVVNIPDKGARKHPRGDSIQMDTRNILFICGGAFVGLEKAISERLQD  384

Query  876   SSIGFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTE  697
             SSIGFGAPVR NMRT  +T A+  S+LLE+VE+ DLI+YGLIPEFVGRFPILVSL++L E
Sbjct  385   SSIGFGAPVRANMRTSKLTDAISASALLESVETGDLIAYGLIPEFVGRFPILVSLSSLNE  444

Query  696   NQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESI  517
             +QLVQVLTEPKNALGKQYKKMF MNNVKLHFT++ALR IA+KA+ KNTGARGLR+ILE+I
Sbjct  445   DQLVQVLTEPKNALGKQYKKMFNMNNVKLHFTDNALRLIAKKAMAKNTGARGLRAILENI  504

Query  516   LMDAMYEIPDVRSGdnvidavivddeaVGH-EGRGCGAKILYGKGALDCYL  367
             L DAM+E+P+++   N + AV+VD+EAVG  +  G GAKIL G GAL+ +L
Sbjct  505   LTDAMFEVPNIKPETNRVCAVLVDEEAVGSVDAPGLGAKILSGDGALEQFL  555


 Score = 72.8 bits (177),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  1543  GPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQ  1409
               + PTPKEI K LD FV+GQERAKKVLSVAVYNHYKRI++ S Q
Sbjct  165   ATDLPTPKEIYKALDDFVVGQERAKKVLSVAVYNHYKRIHHASLQ  209



>ref|XP_006431435.1| hypothetical protein CICLE_v10003616mg [Citrus clementina]
 gb|ESR44675.1| hypothetical protein CICLE_v10003616mg [Citrus clementina]
Length=592

 Score =   497 bits (1280),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 255/339 (75%), Positives = 295/339 (87%), Gaps = 4/339 (1%)
 Frame = -2

Query  1353  EAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKL  1174
             E VELEKSN+L+MGPTGSGKTLLAKTLAR+VNVPF I DAT LTQAGYVGED ES+LYKL
Sbjct  234   EIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVPFTITDATALTQAGYVGEDAESVLYKL  293

Query  1173  LTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP--  1000
             L  AD++V+AAQ+GIVYIDEVDKI K AES N  RDVSGEGVQQALLKMLEGT+VNVP  
Sbjct  294   LAAADFDVEAAQRGIVYIDEVDKIVK-AESRNNGRDVSGEGVQQALLKMLEGTVVNVPIP  352

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             + G RKHPRGDNI IDTKDILFICGGAF+ LEKTISERRQDSSIGFGAPVR NMRTGG+T
Sbjct  353   DNGPRKHPRGDNIPIDTKDILFICGGAFVGLEKTISERRQDSSIGFGAPVRANMRTGGLT  412

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
              A+VTSSLLE+V+S DL++YGLIPEF+GRFPILVSL+AL E+QLVQVL EPKNALG+QYK
Sbjct  413   DALVTSSLLESVDSGDLVAYGLIPEFIGRFPILVSLSALNEDQLVQVLMEPKNALGRQYK  472

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             KMF MNNVKLHFT+DALR IA+KA+ KNTGARGLR++LE+IL +AM+EIP+ + G + ++
Sbjct  473   KMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGLRALLENILTEAMFEIPETKIGTSSVN  532

Query  459   avivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKE  346
             AV+VD EAVG  +  GCGAKIL+G G L+  L   + K+
Sbjct  533   AVLVDKEAVGSVDAPGCGAKILHGDGELERVLHETKSKD  571


 Score = 83.2 bits (204),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  1537  NFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             + PTPKEICKGLD+FVIGQERAKKVL+VAVYNHYKRIY+ S QK
Sbjct  176   DLPTPKEICKGLDEFVIGQERAKKVLAVAVYNHYKRIYHSSLQK  219



>ref|XP_009355384.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Pyrus x bretschneideri]
Length=596

 Score =   495 bits (1275),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 263/361 (73%), Positives = 309/361 (86%), Gaps = 6/361 (2%)
 Frame = -2

Query  1374  KVEGT-EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGED  1198
             K+EG  + ++VELEKSN+L+MGPTGSGKTLLAKTLAR+VNVPF IADATTLTQAGYVGED
Sbjct  226   KLEGVHDSDSVELEKSNVLLMGPTGSGKTLLAKTLARVVNVPFAIADATTLTQAGYVGED  285

Query  1197  VESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEG  1018
             VESILY+LL  AD++V+AAQ+GIVYIDEVDKITKK ESL  SRDVSGEGVQQALLKMLEG
Sbjct  286   VESILYRLLMEADFDVEAAQKGIVYIDEVDKITKKVESL--SRDVSGEGVQQALLKMLEG  343

Query  1017  TIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNM  838
             T+V+V +KGARKH RGD+IQ+DTK+ILFICGGAF+ LEKTISER QDSSIGFG PVR NM
Sbjct  344   TVVSVSDKGARKHSRGDSIQMDTKNILFICGGAFVGLEKTISERLQDSSIGFGVPVRANM  403

Query  837   RTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNA  658
             RT G+T A+VTSSLLE VES DLI+YGLIPEFVGRFP+L SL++L E+QLVQVLTEPKNA
Sbjct  404   RTSGLTDAIVTSSLLEYVESGDLIAYGLIPEFVGRFPVLASLSSLDEDQLVQVLTEPKNA  463

Query  657   LGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRS  478
             LGKQYKKMF MNNV+LHFT++ALR IA+KA+ KN GARGLR+ILE+IL DAM+E+PD+++
Sbjct  464   LGKQYKKMFNMNNVQLHFTDNALRLIAKKAMAKNAGARGLRAILENILTDAMFEVPDMKT  523

Query  477   GdnvidavivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEP--KKIVEGSEADIE  307
               N   AV+VD+EAVG E   G GAKIL G GAL+ +L   +  E   K+ ++G E   E
Sbjct  524   EANSACAVLVDEEAVGSEDTCGLGAKILSGDGALEKFLRETKSGECMGKRGLDGDECLRE  583

Query  306   V  304
             V
Sbjct  584   V  584


 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  1537  NFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDS  1415
             + PTPK ICK LD+FVIGQ+RAKKVLSVAVYNHYKRI++ S
Sbjct  172   DLPTPKFICKALDEFVIGQQRAKKVLSVAVYNHYKRIHHAS  212



>gb|KHG05917.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Gossypium 
arboreum]
Length=565

 Score =   492 bits (1267),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 279/420 (66%), Positives = 325/420 (77%), Gaps = 29/420 (7%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  S+ +Y   +R    ++ K  R    + S+  +  +
Sbjct  172   FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYHESMQK--RPAGDSGSNIADVLD  229

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VN             AGYVGEDVESILYK
Sbjct  230   DDIVELEKSNILLMGPTGSGKTLLAKTLARFVN-------------AGYVGEDVESILYK  276

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL VADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  277   LLVVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  336

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRG+NIQ+ T+ +              +S  RQDSSIGFGAPVR N+R GGVT+
Sbjct  337   KGARKHPRGENIQVCTRVV-------------AVSHGRQDSSIGFGAPVRANIRAGGVTN  383

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             AVV SSL+ETVESSDLI+YGLIPEFVGRFP+LVSL ALTE QLVQVLTEPKNALGKQYKK
Sbjct  384   AVVASSLMETVESSDLIAYGLIPEFVGRFPVLVSLLALTEEQLVQVLTEPKNALGKQYKK  443

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQ+N VKLH TE+AL+ IARKAI KNTGARGLR+ILE+ILMDAMYEIPDVR+GD+VI A
Sbjct  444   MFQINGVKLHITENALKLIARKAINKNTGARGLRAILENILMDAMYEIPDVRTGDDVIGA  503

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
             V+VD+EA+G EG   GAKILYGKGALD YLS  + ++ +  V+G + + EVE +L S+VA
Sbjct  504   VVVDEEAIGSEGNRQGAKILYGKGALDRYLSQQKLRDSETTVDGLDGETEVEAELRSVVA  563


 Score =   185 bits (469),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 132/213 (62%), Gaps = 22/213 (10%)
 Frame = -1

Query  1978  AMAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLG--WNSRIKSKNYFTNSRHSFS  1805
             A AAALRSK   E AS T S  R+F+ N M  GR+ +      +R K  N+  N+ + F+
Sbjct  2     AAAAALRSKPPVEKASLTVSQFRHFLSNFMHYGRVASSSHCTTNRTKWDNHSVNTPYYFT  61

Query  1804  LFKPVSVRGEFVDRGYD------NSRNLS-----------SCGKIDISSSYGDPPEVWQP  1676
              FKPVS+ GE VD+G+       NSR  +           S     + SSYGDPPEVWQP
Sbjct  62    SFKPVSLSGELVDKGFQLLDIRRNSRGTNKDFDKELRDKLSYNNCTVLSSYGDPPEVWQP  121

Query  1675  PGDGIVVR-PGVKFVQVGEVDgpssgsgggfgsGA--KDGCWGGSNLGPNFPTPKEICKG  1505
             PGDG+ +R  GV   + G   G     G G   GA  KD CWGGS+LG NFPTPKEICKG
Sbjct  122   PGDGVAIRVSGVNLGRGGGGGGGGPRPGPGGDFGAGSKDDCWGGSSLGHNFPTPKEICKG  181

Query  1504  LDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             LDKFVIGQERAKKVLSVAVYNHY RIY++S QK
Sbjct  182   LDKFVIGQERAKKVLSVAVYNHYMRIYHESMQK  214



>ref|XP_010065233.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Eucalyptus grandis]
 ref|XP_010065234.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Eucalyptus grandis]
 ref|XP_010065235.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Eucalyptus grandis]
 ref|XP_010065236.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Eucalyptus grandis]
Length=581

 Score =   493 bits (1269),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 252/353 (71%), Positives = 306/353 (87%), Gaps = 1/353 (0%)
 Frame = -2

Query  1419  TLLKSDRNPEKNDSDKVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIA  1240
             T L  + + E +  D  +   + +VELEKSNIL++GPTGSGKTLLAKTLAR+V+VPFVIA
Sbjct  229   TSLGKESDGELSVGDFADDHRYVSVELEKSNILLLGPTGSGKTLLAKTLARVVSVPFVIA  288

Query  1239  DATTLTQAGYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVS  1060
             DATTLT+AGYVGEDVESI+YKLL  AD+NV+AAQQGIVYIDEVDKITKKAE +N  RDVS
Sbjct  289   DATTLTEAGYVGEDVESIMYKLLAAADFNVEAAQQGIVYIDEVDKITKKAEYVNAGRDVS  348

Query  1059  GEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQ  880
             GEGVQQALLKMLEGT+VN+P+KGARKH  GD+I IDTKDILFICGGAF+DL+KTISERRQ
Sbjct  349   GEGVQQALLKMLEGTVVNIPDKGARKHLPGDDIWIDTKDILFICGGAFVDLDKTISERRQ  408

Query  879   DSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALT  700
             DSSIGFGAPVR NMR GG+T  +V SSLL++VES DL++YGLIPEFVGRFP+LVSL+AL+
Sbjct  409   DSSIGFGAPVRANMRKGGLTDTLVASSLLQSVESGDLVAYGLIPEFVGRFPVLVSLSALS  468

Query  699   ENQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILES  520
             E+QLVQVLT+PKNALGKQYKKMF+MNNV+L FT++ALR IA+KA+ KNTGARGLR++LE+
Sbjct  469   EDQLVQVLTKPKNALGKQYKKMFRMNNVELQFTDNALRLIAKKALAKNTGARGLRALLEN  528

Query  519   ILMDAMYEIPDVRSGdnvidavivddeaVGH-EGRGCGAKILYGKGALDCYLS  364
             IL++AM+E+P   +G N + +V+VD+EAVG  +G GCGAKI+     ++  LS
Sbjct  529   ILIEAMFEVPQDTAGVNTVSSVLVDEEAVGPLDGPGCGAKIIQKDLQIEAVLS  581


 Score = 79.3 bits (194),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  1552  SNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             + LG   PTPKEICKGLD+FV+GQE AKKVL+VAVYNHYKRIY+ S  K
Sbjct  185   AKLGRKLPTPKEICKGLDEFVVGQEMAKKVLAVAVYNHYKRIYHTSLGK  233



>ref|XP_003619596.1| ATP-dependent Clp protease ATP-binding subunit clpX [Medicago 
truncatula]
Length=386

 Score =   485 bits (1248),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 273/358 (76%), Positives = 310/358 (87%), Gaps = 13/358 (4%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + E VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  16    DDENVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILY  75

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL  ADYNV AAQQGI+YIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP
Sbjct  76    KLLAAADYNVAAAQQGIIYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  135

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARK+PRGDNIQIDTK+ILFICGGAFIDLEKTISERRQDSSIGFGAPVR N+R+G + 
Sbjct  136   EKGARKNPRGDNIQIDTKNILFICGGAFIDLEKTISERRQDSSIGFGAPVRANIRSGRII  195

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
              + V SSLLE+VESSDLI+YGLIPEF+GRFPILVSL+ALTE QL+QVLTEPK+ALGKQYK
Sbjct  196   DSAVASSLLESVESSDLIAYGLIPEFIGRFPILVSLSALTEEQLMQVLTEPKHALGKQYK  255

Query  639   KMFQMN----------NVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIP  490
             K+  MN           VKLHFT+ ALR IA+KA+ KNTGARGLR+++E+IL DAMYEIP
Sbjct  256   KLVGMNEVSIYVCVFVRVKLHFTDKALRMIAKKAMAKNTGARGLRALIENILTDAMYEIP  315

Query  489   DVRSGdnvidavivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSE  319
             D+++G + IDAV+VD+E+VG     GCG KIL G GAL+ YL+  + K+ + +V  SE
Sbjct  316   DIKTGSDRIDAVVVDEESVGSLTAPGCGGKILRGDGALEQYLA--KIKDSEDVVAESE  371



>ref|XP_010112073.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Morus notabilis]
 gb|EXC32492.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Morus notabilis]
Length=653

 Score =   494 bits (1272),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 270/352 (77%), Positives = 305/352 (87%), Gaps = 18/352 (5%)
 Frame = -2

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L+MGPTGSGKTLLAKTLAR VN             AGYVGEDVESILYKLL 
Sbjct  302   VELEKSNVLLMGPTGSGKTLLAKTLARFVN-------------AGYVGEDVESILYKLLA  348

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGV----QQALLKMLEGTIVNVP  1000
              A++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGV    QQALLKMLE TIVNVP
Sbjct  349   AAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVHEGVQQALLKMLEATIVNVP  408

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARKHPRGDNIQI+TKDILFICGGAFIDL+KTISERRQDSSIGFGAPVR NMRT GVT
Sbjct  409   EKGARKHPRGDNIQINTKDILFICGGAFIDLDKTISERRQDSSIGFGAPVRANMRTSGVT  468

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             +A +TSSLLE+VESSDLI+YGLIPEF+GRFPILVSL+ALTE+QLVQVL EPKNALGKQYK
Sbjct  469   NAAITSSLLESVESSDLIAYGLIPEFIGRFPILVSLSALTEDQLVQVLMEPKNALGKQYK  528

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+F MNNVKLHFTE ALR IA KA+ KNTGARGLR+ILE+IL +AMYEIPDV++G+  ID
Sbjct  529   KLFSMNNVKLHFTEKALRMIANKAMAKNTGARGLRAILETILTEAMYEIPDVKTGNERID  588

Query  459   avivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIE  307
             AV+VD+E+V    G GCG KIL+G GAL+ YL+ ++ K+  + VEG+E +++
Sbjct  589   AVVVDEESVASVNGLGCGGKILHGDGALERYLAESKLKDSVENVEGTEGELQ  640


 Score = 90.1 bits (222),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGGSNLG + PTPK+IC GLDKFVIGQ  AKKVLSV VYNHYKRIY  S QK
Sbjct  240   WGGSNLGKDLPTPKQICMGLDKFVIGQHTAKKVLSVGVYNHYKRIYQASLQK  291



>gb|KCW62577.1| hypothetical protein EUGRSUZ_G00073 [Eucalyptus grandis]
Length=581

 Score =   490 bits (1262),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 251/353 (71%), Positives = 305/353 (86%), Gaps = 1/353 (0%)
 Frame = -2

Query  1419  TLLKSDRNPEKNDSDKVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIA  1240
             T L  + + E +  D  +   + +VELEKSNIL++GPTGSGKTLLAKTLAR+V+VPFVIA
Sbjct  229   TSLGKESDGELSVGDFADDHRYVSVELEKSNILLLGPTGSGKTLLAKTLARVVSVPFVIA  288

Query  1239  DATTLTQAGYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVS  1060
             DATTLT+A YVGEDVESI+YKLL  AD+NV+AAQQGIVYIDEVDKITKKAE +N  RDVS
Sbjct  289   DATTLTEASYVGEDVESIMYKLLAAADFNVEAAQQGIVYIDEVDKITKKAEYVNAGRDVS  348

Query  1059  GEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQ  880
             GEGVQQALLKMLEGT+VN+P+KGARKH  GD+I IDTKDILFICGGAF+DL+KTISERRQ
Sbjct  349   GEGVQQALLKMLEGTVVNIPDKGARKHLPGDDIWIDTKDILFICGGAFVDLDKTISERRQ  408

Query  879   DSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALT  700
             DSSIGFGAPVR NMR GG+T  +V SSLL++VES DL++YGLIPEFVGRFP+LVSL+AL+
Sbjct  409   DSSIGFGAPVRANMRKGGLTDTLVASSLLQSVESGDLVAYGLIPEFVGRFPVLVSLSALS  468

Query  699   ENQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILES  520
             E+QLVQVLT+PKNALGKQYKKMF+MNNV+L FT++ALR IA+KA+ KNTGARGLR++LE+
Sbjct  469   EDQLVQVLTKPKNALGKQYKKMFRMNNVELQFTDNALRLIAKKALAKNTGARGLRALLEN  528

Query  519   ILMDAMYEIPDVRSGdnvidavivddeaVGH-EGRGCGAKILYGKGALDCYLS  364
             IL++AM+E+P   +G N + +V+VD+EAVG  +G GCGAKI+     ++  LS
Sbjct  529   ILIEAMFEVPQDTAGVNTVSSVLVDEEAVGPLDGPGCGAKIIQKDLQIEAVLS  581


 Score = 79.3 bits (194),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  1552  SNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             + LG   PTPKEICKGLD+FV+GQE AKKVL+VAVYNHYKRIY+ S  K
Sbjct  185   AKLGRKLPTPKEICKGLDEFVVGQEMAKKVLAVAVYNHYKRIYHTSLGK  233



>ref|XP_007023126.1| ATP-dependent Clp protease ATP-binding subunit clpX isoform 1 
[Theobroma cacao]
 gb|EOY25748.1| ATP-dependent Clp protease ATP-binding subunit clpX isoform 1 
[Theobroma cacao]
Length=573

 Score =   489 bits (1258),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 257/370 (69%), Positives = 301/370 (81%), Gaps = 29/370 (8%)
 Frame = -2

Query  1368  EGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVES  1189
             E   ++ VEL+KSN+L++GPTGSGKTLLAKTLAR+VNVPFVI DATTLTQAGYVGEDVES
Sbjct  200   ENDANDFVELDKSNVLLIGPTGSGKTLLAKTLARIVNVPFVIVDATTLTQAGYVGEDVES  259

Query  1188  ILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIV  1009
             ILYKLL  A+++V+AAQ GIVYIDEVDKITKKAES NI RDVSGEGVQQALLK+LEGTIV
Sbjct  260   ILYKLLVEAEFDVEAAQHGIVYIDEVDKITKKAESSNIGRDVSGEGVQQALLKLLEGTIV  319

Query  1008  NVP--EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMR  835
             NVP  +KGAR++PRGD+ QIDTKDILF+CGGAFIDLEKTISERRQDSSIGFGAPVR NMR
Sbjct  320   NVPLPDKGARRYPRGDSFQIDTKDILFVCGGAFIDLEKTISERRQDSSIGFGAPVRANMR  379

Query  834   TGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNAL  655
             + G+T+A VTSSLLE+VES DLI+YGLIPEF+GRFPILVSL+ L E+QLV+VL +PKNAL
Sbjct  380   SSGLTTAAVTSSLLESVESDDLIAYGLIPEFIGRFPILVSLSGLNEDQLVEVLMKPKNAL  439

Query  654   GKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYE-------  496
             GKQYKKMF MN VKLHFT +ALR I++KA+ KNTGARGLR+ILE+IL +AM+E       
Sbjct  440   GKQYKKMFSMNGVKLHFTANALRLISKKAMAKNTGARGLRAILENILTEAMFEVRIWFLL  499

Query  495   -------------------IPDVRSGdnvidavivddeaVG-HEGRGCGAKILYGKGALD  376
                                IPD +     ++AV+VD+EAVG  +  GCGAKILYG G LD
Sbjct  500   SFGVMTTIQDEGLFSFSPEIPDTKMESQGVNAVLVDEEAVGSFDETGCGAKILYGDGELD  559

Query  375   CYLSGNEQKE  346
              +L+    K+
Sbjct  560   RFLAKRTWKD  569


 Score = 73.2 bits (178),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -1

Query  1546  LGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQ  1409
             L    PTPKEIC  LD+FVIGQ++AKKVLSVAVYNHYKRIY+ S Q
Sbjct  145   LERELPTPKEICGRLDEFVIGQQKAKKVLSVAVYNHYKRIYHASQQ  190



>gb|AES75813.2| ATP-dependent Clp protease regulatory subunit ClpX [Medicago 
truncatula]
Length=662

 Score =   490 bits (1261),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 269/333 (81%), Positives = 302/333 (91%), Gaps = 1/333 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + E VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  302   DDENVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILY  361

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL  ADYNV AAQQGI+YIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP
Sbjct  362   KLLAAADYNVAAAQQGIIYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  421

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARK+PRGDNIQIDTK+ILFICGGAFIDLEKTISERRQDSSIGFGAPVR N+R+G + 
Sbjct  422   EKGARKNPRGDNIQIDTKNILFICGGAFIDLEKTISERRQDSSIGFGAPVRANIRSGRII  481

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
              + V SSLLE+VESSDLI+YGLIPEF+GRFPILVSL+ALTE QL+QVLTEPK+ALGKQYK
Sbjct  482   DSAVASSLLESVESSDLIAYGLIPEFIGRFPILVSLSALTEEQLMQVLTEPKHALGKQYK  541

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             K+  MN VKLHFT+ ALR IA+KA+ KNTGARGLR+++E+IL DAMYEIPD+++G + ID
Sbjct  542   KLVGMNEVKLHFTDKALRMIAKKAMAKNTGARGLRALIENILTDAMYEIPDIKTGSDRID  601

Query  459   avivddeaVGH-EGRGCGAKILYGKGALDCYLS  364
             AV+VD+E+VG     GCG KIL G GAL+ YL+
Sbjct  602   AVVVDEESVGSLTAPGCGGKILRGDGALEQYLA  634


 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 66/111 (59%), Gaps = 17/111 (15%)
 Frame = -1

Query  1699  DPPEVWQPP-----GDGIVVR--------PGVKFVQVGEVDgpssgsgggfgsGAKDGCW  1559
             +PPE W  P     G+G+ V         PG+  ++           G G G   +   W
Sbjct  182   EPPETWPLPVGGGNGNGLAVHTPPGPPFAPGLNVIRA----RGPQEGGPGGGGNGEKNTW  237

Query  1558  GGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             GGSNLG + P+PKEICKGLDKFVIGQ RAKKVLSVAVYNHYKRIY+ +  K
Sbjct  238   GGSNLGKDLPSPKEICKGLDKFVIGQGRAKKVLSVAVYNHYKRIYHATLPK  288



>ref|XP_007222159.1| hypothetical protein PRUPE_ppa007724mg [Prunus persica]
 gb|EMJ23358.1| hypothetical protein PRUPE_ppa007724mg [Prunus persica]
Length=358

 Score =   477 bits (1228),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 243/318 (76%), Positives = 284/318 (89%), Gaps = 3/318 (1%)
 Frame = -2

Query  1317  MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLTVADYNVQAAQ  1138
             MGPTGSGKTLLAKTLAR+VNVPF IAD+TTLTQA YVGEDVESILY+LL  AD++V+AAQ
Sbjct  1     MGPTGSGKTLLAKTLARVVNVPFAIADSTTLTQASYVGEDVESILYRLLMEADFDVEAAQ  60

Query  1137  QGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQ  958
             +GIVYIDEVDKITKKAESL  SRDVSGEGVQQALLKMLEGT+VN+P+KGARKHPRGD+IQ
Sbjct  61    KGIVYIDEVDKITKKAESL--SRDVSGEGVQQALLKMLEGTVVNIPDKGARKHPRGDSIQ  118

Query  957   IDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVES  778
             +DT++ILFICGGAF+ LEK ISER QDSSIGFGAPVR NMRT  +T A+  S+LLE+VE+
Sbjct  119   MDTRNILFICGGAFVGLEKAISERLQDSSIGFGAPVRANMRTSELTDAISASALLESVET  178

Query  777   SDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTE  598
              DLI+YGLIPEFVGRFPILVSL++L E+QLVQVLTEPKNALGKQYKKMF MNNVKLHFT+
Sbjct  179   GDLIAYGLIPEFVGRFPILVSLSSLNEDQLVQVLTEPKNALGKQYKKMFNMNNVKLHFTD  238

Query  597   DALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidavivddeaVGH-EG  421
             +ALR IA+KA+ KNTGARGLR+ILE+IL DAM+E+P+++   N + AV+VD+EAVG  + 
Sbjct  239   NALRLIAKKAMAKNTGARGLRAILENILTDAMFEVPNIKPETNGVCAVLVDEEAVGSVDA  298

Query  420   RGCGAKILYGKGALDCYL  367
              G GAKIL G GAL+ +L
Sbjct  299   PGLGAKILSGDGALEQFL  316



>ref|XP_008643592.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX 
isoform X1 [Zea mays]
Length=506

 Score =   483 bits (1243),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 251/348 (72%), Positives = 300/348 (86%), Gaps = 5/348 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLL-KSDRNPEKNDSDKVEGT  1360
             F  P++  +GL    + ++  K+  S+ +Y    R    +L+ +S  +  ++DS     +
Sbjct  138   FPTPKEICRGLDKFVIGQQRAKKVLSVAVYNHYKRIYCESLINRSAADCSQSDSCT---S  194

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VELEKSNILVMGPTGSGKTLLAKTLAR VNVPFVIADAT+LTQAGYVGEDVESILY
Sbjct  195   DTDMVELEKSNILVMGPTGSGKTLLAKTLARFVNVPFVIADATSLTQAGYVGEDVESILY  254

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL  AD++V AAQQGIVYIDEVDKITKKAES+N+SRDVSGEGVQQALLKMLEGT+V+VP
Sbjct  255   KLLAAADFDVAAAQQGIVYIDEVDKITKKAESINLSRDVSGEGVQQALLKMLEGTVVSVP  314

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGAR+HPRGDNIQIDTK+ILFICGGAF+DLEKTISERR DSSIGF A VR+NMR+GGV 
Sbjct  315   EKGARRHPRGDNIQIDTKNILFICGGAFVDLEKTISERRHDSSIGFRAQVRSNMRSGGVI  374

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             +A +TSSLL++VES DLI+YGLIPEFVGRFPILV L++L+E+QLV+VLTEPKNALG+QY 
Sbjct  375   NAEITSSLLKSVESGDLIAYGLIPEFVGRFPILVGLSSLSEDQLVEVLTEPKNALGRQYT  434

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYE  496
             K+F+MN+VKLHFTE+ALR IA++AI+KNTGARGLRSILESIL +AMYE
Sbjct  435   KLFEMNDVKLHFTEEALRLIAKRAISKNTGARGLRSILESILTEAMYE  482


 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 69/104 (66%), Gaps = 7/104 (7%)
 Frame = -1

Query  1711  SSYGDPPEVWQPPGDGIVVRPGVKFVQVGEVDgpssgs-----gggfgsGAKDGCWGGSN  1547
             S   +PPE+W+ PG+  V   GV    VG +D     +       G   G + G WGGSN
Sbjct  76    SDGAEPPEIWRQPGEAPVAPEGVG--AVGRIDVVRVAAPGGEDFDGKDGGGESGGWGGSN  133

Query  1546  LGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDS  1415
             LG  FPTPKEIC+GLDKFVIGQ+RAKKVLSVAVYNHYKRIY +S
Sbjct  134   LGRRFPTPKEICRGLDKFVIGQQRAKKVLSVAVYNHYKRIYCES  177



>gb|EMS53220.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Triticum 
urartu]
Length=401

 Score =   478 bits (1230),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 251/363 (69%), Positives = 297/363 (82%), Gaps = 14/363 (4%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             +H+ VE++KSN+L+MGPTGSGKTLLAKTLAR+VN             AGYVGEDVESIL 
Sbjct  52    DHDNVEIDKSNVLLMGPTGSGKTLLAKTLARIVN-------------AGYVGEDVESILQ  98

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL  A+YNVQAAQQGIVYIDEVDKITKKAES N+SRDVSGEGVQQALLK+LEGT+V +P
Sbjct  99    KLLVEAEYNVQAAQQGIVYIDEVDKITKKAESANVSRDVSGEGVQQALLKILEGTVVTIP  158

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKG+RK+ R D+IQIDTKDILFICGGAF+DLEKTISERRQDSSIGFGAP+RTNMR+ GVT
Sbjct  159   EKGSRKNSRNDSIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFGAPIRTNMRSSGVT  218

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             S  VTSSLLE+VES DL  +GLIPEF+GR PILVSL AL E+QLVQVLTEPKN+L +QY+
Sbjct  219   SPTVTSSLLESVESGDLAKFGLIPEFIGRLPILVSLAALDEDQLVQVLTEPKNSLSRQYR  278

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
             KMF +NNVKLHFT+ ALR +A+KAI KNTGARGLR++LE+IL++AMYEIPD ++G+  +D
Sbjct  279   KMFSLNNVKLHFTDGALRIVAKKAIVKNTGARGLRALLETILLEAMYEIPDEKAGNERVD  338

Query  459   avivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSI  283
             AV+VD+EA+G   R GCGAKIL G GAL  Y+  N      +  E    ++E    L  I
Sbjct  339   AVVVDEEAIGSVDRPGCGAKILRGDGALAQYIIRNNIPNSPETNEALAGELEDAYMLSRI  398

Query  282   VAL  274
             V+L
Sbjct  399   VSL  401


 Score = 62.8 bits (151),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  1516  ICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             +C+ LD+FVIGQ +AKKVLSVAVYNHYKR+YN + QK
Sbjct  1     MCRRLDEFVIGQGKAKKVLSVAVYNHYKRVYNATVQK  37



>ref|XP_011028416.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Populus euphratica]
 ref|XP_011028417.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X3 [Populus euphratica]
Length=592

 Score =   483 bits (1244),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 265/397 (67%), Positives = 319/397 (80%), Gaps = 8/397 (2%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL    + + + K+  S+ +Y    R    +  K    P  +     E  E+E 
Sbjct  180   PKEICKGLDEFVIGQDKAKKVLSVAVYNHYKRIYHASKQKKSHAPWSHSDG--ENDENEF  237

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             +EL+KSN+L+MGPTGSGKTLLAKTLAR+VNVPFVIADATTLTQAGYVGEDVESILYKLL 
Sbjct  238   IELDKSNVLLMGPTGSGKTLLAKTLARIVNVPFVIADATTLTQAGYVGEDVESILYKLLV  297

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP--EK  994
             V+++NV+AAQ+GIVYIDEVDKIT KA S +I RDVSGEGVQQALLKMLEGT +NVP  +K
Sbjct  298   VSEFNVEAAQRGIVYIDEVDKITMKAGSSSIGRDVSGEGVQQALLKMLEGTALNVPVPDK  357

Query  993   GARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSA  814
             G  KHPRGD IQ+DTKDILFICGGAF++LEKTISERRQD+SIGFGAPVR NMR G +T+A
Sbjct  358   GPGKHPRGDTIQVDTKDILFICGGAFVNLEKTISERRQDASIGFGAPVRANMRAGAITNA  417

Query  813   VVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKM  634
             +VTSSLLE+VES DL++YGLIPEFVGRFP+L SL AL E+QLVQVL EPKNALGKQYKK+
Sbjct  418   MVTSSLLESVESGDLVAYGLIPEFVGRFPVLASLLALNEDQLVQVLMEPKNALGKQYKKI  477

Query  633   FQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidav  454
             F MNNV L FT +ALR IA+KA+ KNTGARGLR+ILE+IL +AM+EIP+ +S  N I+AV
Sbjct  478   FNMNNVNLDFTGNALRLIAKKAMAKNTGARGLRAILENILTEAMFEIPENKSQSNCINAV  537

Query  453   ivddeaVG-HEGRGCGAKILYGKGALDCYLSGNEQKE  346
             +VD+EAVG  +  G GAKI++G  AL+  L   E+KE
Sbjct  538   LVDEEAVGLMDTPGRGAKIIHGDSALEHKL--QERKE  572


 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  1546  LGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             L    PTPKEICKGLD+FVIGQ++AKKVLSVAVYNHYKRIY+ S QK
Sbjct  173   LERELPTPKEICKGLDEFVIGQDKAKKVLSVAVYNHYKRIYHASKQK  219



>ref|XP_011028415.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Populus euphratica]
Length=593

 Score =   483 bits (1244),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 265/397 (67%), Positives = 319/397 (80%), Gaps = 8/397 (2%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL    + + + K+  S+ +Y    R    +  K    P  +     E  E+E 
Sbjct  181   PKEICKGLDEFVIGQDKAKKVLSVAVYNHYKRIYHASKQKKSHAPWSHSDG--ENDENEF  238

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             +EL+KSN+L+MGPTGSGKTLLAKTLAR+VNVPFVIADATTLTQAGYVGEDVESILYKLL 
Sbjct  239   IELDKSNVLLMGPTGSGKTLLAKTLARIVNVPFVIADATTLTQAGYVGEDVESILYKLLV  298

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP--EK  994
             V+++NV+AAQ+GIVYIDEVDKIT KA S +I RDVSGEGVQQALLKMLEGT +NVP  +K
Sbjct  299   VSEFNVEAAQRGIVYIDEVDKITMKAGSSSIGRDVSGEGVQQALLKMLEGTALNVPVPDK  358

Query  993   GARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSA  814
             G  KHPRGD IQ+DTKDILFICGGAF++LEKTISERRQD+SIGFGAPVR NMR G +T+A
Sbjct  359   GPGKHPRGDTIQVDTKDILFICGGAFVNLEKTISERRQDASIGFGAPVRANMRAGAITNA  418

Query  813   VVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKM  634
             +VTSSLLE+VES DL++YGLIPEFVGRFP+L SL AL E+QLVQVL EPKNALGKQYKK+
Sbjct  419   MVTSSLLESVESGDLVAYGLIPEFVGRFPVLASLLALNEDQLVQVLMEPKNALGKQYKKI  478

Query  633   FQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidav  454
             F MNNV L FT +ALR IA+KA+ KNTGARGLR+ILE+IL +AM+EIP+ +S  N I+AV
Sbjct  479   FNMNNVNLDFTGNALRLIAKKAMAKNTGARGLRAILENILTEAMFEIPENKSQSNCINAV  538

Query  453   ivddeaVG-HEGRGCGAKILYGKGALDCYLSGNEQKE  346
             +VD+EAVG  +  G GAKI++G  AL+  L   E+KE
Sbjct  539   LVDEEAVGLMDTPGRGAKIIHGDSALEHKL--QERKE  573


 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  1546  LGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             L    PTPKEICKGLD+FVIGQ++AKKVLSVAVYNHYKRIY+ S QK
Sbjct  174   LERELPTPKEICKGLDEFVIGQDKAKKVLSVAVYNHYKRIYHASKQK  220



>ref|XP_004142810.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like 
[Cucumis sativus]
Length=619

 Score =   483 bits (1243),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 240/326 (74%), Positives = 284/326 (87%), Gaps = 3/326 (1%)
 Frame = -2

Query  1374  KVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDV  1195
             ++E  ++E VELEKSN+L+MGPTGSGKTLLAKTLAR+VNVPF IADAT LTQAGYVGEDV
Sbjct  253   ELENDDNETVELEKSNLLLMGPTGSGKTLLAKTLARVVNVPFTIADATALTQAGYVGEDV  312

Query  1194  ESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT  1015
             ESILYKLL  A++NV+AAQ+GIVYIDEVDKITKK+ESLN  RDVSGEGVQQALLKMLEGT
Sbjct  313   ESILYKLLLDAEFNVEAAQRGIVYIDEVDKITKKSESLNSGRDVSGEGVQQALLKMLEGT  372

Query  1014  IVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMR  835
             +V+VP+ GARKHPRGD IQ+DTK+ILFICGGAF+ LEK IS+R+ DSSIGFGAPVR +MR
Sbjct  373   VVDVPDTGARKHPRGDTIQMDTKNILFICGGAFVGLEKCISDRQHDSSIGFGAPVRASMR  432

Query  834   TGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNAL  655
             TG +T  +VTSS+LE VES DLI+YGLIPEFVGR PILVSL+AL E+QLVQVLT+PKNAL
Sbjct  433   TGKLTEDLVTSSMLENVESGDLITYGLIPEFVGRCPILVSLSALDEDQLVQVLTKPKNAL  492

Query  654   GKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSG  475
             GKQYKKM +MN+V+LHFTE+ALR IARKA+ KNTGARGLRSILE+IL +AM+E+P+  S 
Sbjct  493   GKQYKKMLRMNDVELHFTENALRMIARKAMKKNTGARGLRSILENILTEAMFEVPESNS-  551

Query  474   dnvidavivddeaVGHEGRGCGAKIL  397
               +   ++ ++     +  GCGAKIL
Sbjct  552   --IKAVLVDEEAVGSVDASGCGAKIL  575


 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  1552  SNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             ++LG    TPKEI   LDKFV+GQE+AKKVLSVAVYNHYKRIY+ S QK
Sbjct  195   ASLGMQLLTPKEISLALDKFVVGQEKAKKVLSVAVYNHYKRIYHSSLQK  243



>ref|XP_008460586.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Cucumis melo]
Length=617

 Score =   482 bits (1241),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 238/326 (73%), Positives = 284/326 (87%), Gaps = 3/326 (1%)
 Frame = -2

Query  1374  KVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDV  1195
             ++E  ++E VELEKSN+L+MGPTGSGKTLLAKTLAR+VNVPF IADAT LTQAGYVGEDV
Sbjct  253   ELENDDNETVELEKSNLLLMGPTGSGKTLLAKTLARVVNVPFTIADATALTQAGYVGEDV  312

Query  1194  ESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT  1015
             ESILYKLL  A++NV+AAQ+GIVYIDEVDKITKK+ES+N  RDVSGEGVQQALLKMLEGT
Sbjct  313   ESILYKLLLDAEFNVEAAQRGIVYIDEVDKITKKSESINSGRDVSGEGVQQALLKMLEGT  372

Query  1014  IVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMR  835
             +V+VP+ GAR+HPRGD IQ+DTK+ILFICGGAF+ LEK IS+R+ DSSIGFGAPVR +MR
Sbjct  373   VVDVPDTGARRHPRGDTIQMDTKNILFICGGAFVGLEKCISDRQHDSSIGFGAPVRASMR  432

Query  834   TGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNAL  655
             T  +T  +VTSS+LE VESSDL++YGLIPEFVGR PILVSL+AL E+QLVQVLT+PKNAL
Sbjct  433   TARLTEDLVTSSMLENVESSDLVTYGLIPEFVGRCPILVSLSALDEDQLVQVLTKPKNAL  492

Query  654   GKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSG  475
             GKQYKKMF+MN+V+LHFTE+ALR IARKA+ KNTGARGLRSILE+IL +AM+E+P+  S 
Sbjct  493   GKQYKKMFRMNDVELHFTENALRMIARKAMKKNTGARGLRSILENILTEAMFEVPESNS-  551

Query  474   dnvidavivddeaVGHEGRGCGAKIL  397
               +   ++  +     +  GCGAKIL
Sbjct  552   --IKAVLVDGESVGSVDAPGCGAKIL  575


 Score = 74.7 bits (182),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  1552  SNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             ++LG    TPKEI   LDKFV+GQE+AKKVLSVAVYNHYKRIY+ S QK
Sbjct  195   ASLGMQLLTPKEISLALDKFVVGQEKAKKVLSVAVYNHYKRIYHSSLQK  243



>ref|XP_004512653.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like 
[Cicer arietinum]
Length=714

 Score =   485 bits (1248),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 279/413 (68%), Positives = 329/413 (80%), Gaps = 25/413 (6%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLK-SDRNPEKNDSDKVEGTEHE  1351
             P++  KGL    + +   K+  S+ +Y    R    TL K S  + E  D D       E
Sbjct  314   PKEICKGLDKFVIGQGRAKKVLSVAVYNHYKRIYHATLPKGSGLDSEVLDDD-------E  366

Query  1350  AVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLL  1171
             AVELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESIL+KLL
Sbjct  367   AVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILHKLL  426

Query  1170  TVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKG  991
             + AD+NV AAQQGI+YIDEVDKITKKAESLNISRDVSGEG            IVNVPEKG
Sbjct  427   SAADFNVAAAQQGIIYIDEVDKITKKAESLNISRDVSGEG------------IVNVPEKG  474

Query  990   ARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAV  811
             ARKHPRGDNIQ+DTK+ILFICGGAFIDLEKTISERRQDSSIGFGAP+R NMR+G +  + 
Sbjct  475   ARKHPRGDNIQMDTKNILFICGGAFIDLEKTISERRQDSSIGFGAPIRANMRSGRIIDSA  534

Query  810   VTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMF  631
             VTSSLLE+VESSDLI+YGLIPEF+GRFPILVSL+ALTE QL+QV TEPKNALGKQYKK+F
Sbjct  535   VTSSLLESVESSDLIAYGLIPEFIGRFPILVSLSALTEEQLMQVFTEPKNALGKQYKKLF  594

Query  630   QMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidavi  451
              MNNVKLH+TE ALR +A+KA+ KNTGARGLR++LE+IL DAM+EIPD +SG + +DAV+
Sbjct  595   SMNNVKLHYTEQALRLVAKKAMAKNTGARGLRALLENILTDAMFEIPDNKSGSDRVDAVV  654

Query  450   vddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERD  295
             VD+E+VG     GCG KIL G GAL+ YL+  + K+    VE ++++++ ERD
Sbjct  655   VDEESVGSLNAPGCGGKILRGDGALEQYLA--KTKDSMVNVEVAQSELQ-ERD  704


 Score = 96.3 bits (238),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 65/107 (61%), Gaps = 9/107 (8%)
 Frame = -1

Query  1702  GDPPEVWQPPGD--------GIVVRPGVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSN  1547
             G+PPE W PP           +   PG  F     V       G G  +G K+  WGGSN
Sbjct  248   GEPPETWPPPVGGGGNGNGLAVHTPPGPPFAPGINVIRAPREGGSGGVNGEKN-TWGGSN  306

Query  1546  LGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             LG + PTPKEICKGLDKFVIGQ RAKKVLSVAVYNHYKRIY+ +  K
Sbjct  307   LGKDLPTPKEICKGLDKFVIGQGRAKKVLSVAVYNHYKRIYHATLPK  353



>ref|XP_010908125.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Elaeis guineensis]
Length=649

 Score =   482 bits (1240),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 282/415 (68%), Positives = 319/415 (77%), Gaps = 32/415 (8%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL +  + ++  K+  S+ +Y    R    +L K        D   +E    + 
Sbjct  260   PKEICKGLDTFVIGQQRAKKVLSVAVYNHYKRIYHASLQKG----SAADPGNLEAKIDDH  315

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYKLLT
Sbjct  316   VELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILYKLLT  375

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
             VAD+NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA
Sbjct  376   VADFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  435

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPR D+IQIDTKDILFICGGAF+DLEKTISERR DSSIGFGAPVR NMRTG +T+AVV
Sbjct  436   RKHPRNDHIQIDTKDILFICGGAFVDLEKTISERRHDSSIGFGAPVRANMRTGWLTNAVV  495

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
              SSLLE+VESSDLI+YGLIPEF+GRFPILVSL+AL E+QLVQ                  
Sbjct  496   ASSLLESVESSDLIAYGLIPEFIGRFPILVSLSALNEDQLVQ------------------  537

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
                VKLH TE ALR IA+KA+ KNTGARGLR+ILES L +AMYEIPDV++G   +DAV+V
Sbjct  538   ---VKLHVTEAALREIAKKAMVKNTGARGLRAILESTLTEAMYEIPDVKTGTERVDAVVV  594

Query  447   ddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPS  286
             D+EA+G   R GCGAKIL G GAL+ YLS N     K      E D+  +RDL S
Sbjct  595   DEEAIGSLDRPGCGAKILQGDGALEHYLSQN-----KADANQLEGDLVGDRDLAS  644


 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 72/119 (61%), Gaps = 15/119 (13%)
 Frame = -1

Query  1717  ISSSYG-DPPEVWQPP--------GDGIVVR-----PGVKFVQVGEVDgpssgsgggfgs  1580
             + ++YG +PPE W P         G+G+ V      P V  V+VG       G   G G 
Sbjct  181   LKATYGGEPPENWPPMPLPAPAPGGNGLAVHVPPGPPNVNVVKVGGYRKGGGGGNSGDGG  240

Query  1579  GAKDGCW-GGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
                   W GGSNLG + PTPKEICKGLD FVIGQ+RAKKVLSVAVYNHYKRIY+ S QK
Sbjct  241   EFGGKEWCGGSNLGKDLPTPKEICKGLDTFVIGQQRAKKVLSVAVYNHYKRIYHASLQK  299



>ref|XP_011087617.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial [Sesamum indicum]
Length=633

 Score =   481 bits (1237),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 245/347 (71%), Positives = 294/347 (85%), Gaps = 2/347 (1%)
 Frame = -2

Query  1374  KVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDV  1195
             +++   ++ VEL+KSN+L++GPTGSGKTLLAKTLAR+VNVPF+IADATTLTQAGYVGEDV
Sbjct  266   ELDSCNNDIVELDKSNVLLIGPTGSGKTLLAKTLARVVNVPFIIADATTLTQAGYVGEDV  325

Query  1194  ESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT  1015
             ESILYKLL VAD++V+AAQ+GIVYIDEVDKITKK ESLNI RDVSGEGVQQALLKMLEGT
Sbjct  326   ESILYKLLMVADFDVEAAQRGIVYIDEVDKITKKTESLNIGRDVSGEGVQQALLKMLEGT  385

Query  1014  IVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMR  835
             IV+VP+    +H R DNIQ+DTKDILFICGGAF+DLEKTISERRQD+SIGFGAPVR NMR
Sbjct  386   IVSVPDNRTPRHARRDNIQVDTKDILFICGGAFVDLEKTISERRQDASIGFGAPVRANMR  445

Query  834   TGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNAL  655
               G+ S    +SLLE VES DL +YGLIPEFVGRFP++V+L+AL E QLVQVLTEPKNAL
Sbjct  446   LSGL-SISAAASLLEHVESGDLTAYGLIPEFVGRFPVVVNLSALDEEQLVQVLTEPKNAL  504

Query  654   GKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSG  475
              KQYK+MF MNNVKL+FT+ ALR IA+KAI KNTGARGLR+ILE IL +AM+E+PD +SG
Sbjct  505   CKQYKRMFSMNNVKLNFTDSALRLIAKKAIAKNTGARGLRAILEDILTEAMFEVPDAKSG  564

Query  474   dnvidavivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKK  337
              +  D V+VD+EAVG  +  GCGAK+L+    L+      + ++P++
Sbjct  565   TDRADTVLVDEEAVGAPDAHGCGAKVLFSDCGLEEIPRRTKSEDPRE  611


 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  1552  SNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             S  G   PTPKEICK L+++VIGQ++AKKVLSVAVYNHYKRI +   QK
Sbjct  208   SRFGKELPTPKEICKVLNEYVIGQDKAKKVLSVAVYNHYKRINHALVQK  256



>ref|XP_003619595.1| ATP-dependent Clp protease ATP-binding subunit clpX [Medicago 
truncatula]
Length=672

 Score =   482 bits (1240),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 273/358 (76%), Positives = 310/358 (87%), Gaps = 13/358 (4%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + E VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  302   DDENVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILY  361

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLL  ADYNV AAQQGI+YIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP
Sbjct  362   KLLAAADYNVAAAQQGIIYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  421

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARK+PRGDNIQIDTK+ILFICGGAFIDLEKTISERRQDSSIGFGAPVR N+R+G + 
Sbjct  422   EKGARKNPRGDNIQIDTKNILFICGGAFIDLEKTISERRQDSSIGFGAPVRANIRSGRII  481

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
              + V SSLLE+VESSDLI+YGLIPEF+GRFPILVSL+ALTE QL+QVLTEPK+ALGKQYK
Sbjct  482   DSAVASSLLESVESSDLIAYGLIPEFIGRFPILVSLSALTEEQLMQVLTEPKHALGKQYK  541

Query  639   KMFQMN----------NVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIP  490
             K+  MN           VKLHFT+ ALR IA+KA+ KNTGARGLR+++E+IL DAMYEIP
Sbjct  542   KLVGMNEVSIYVCVFVRVKLHFTDKALRMIAKKAMAKNTGARGLRALIENILTDAMYEIP  601

Query  489   DVRSGdnvidavivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSE  319
             D+++G + IDAV+VD+E+VG     GCG KIL G GAL+ YL+  + K+ + +V  SE
Sbjct  602   DIKTGSDRIDAVVVDEESVGSLTAPGCGGKILRGDGALEQYLA--KIKDSEDVVAESE  657


 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 66/111 (59%), Gaps = 17/111 (15%)
 Frame = -1

Query  1699  DPPEVWQPP-----GDGIVVR--------PGVKFVQVGEVDgpssgsgggfgsGAKDGCW  1559
             +PPE W  P     G+G+ V         PG+  ++           G G G   +   W
Sbjct  182   EPPETWPLPVGGGNGNGLAVHTPPGPPFAPGLNVIRA----RGPQEGGPGGGGNGEKNTW  237

Query  1558  GGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             GGSNLG + P+PKEICKGLDKFVIGQ RAKKVLSVAVYNHYKRIY+ +  K
Sbjct  238   GGSNLGKDLPSPKEICKGLDKFVIGQGRAKKVLSVAVYNHYKRIYHATLPK  288



>ref|XP_002864018.1| hypothetical protein ARALYDRAFT_495043 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40277.1| hypothetical protein ARALYDRAFT_495043 [Arabidopsis lyrata subsp. 
lyrata]
Length=605

 Score =   479 bits (1234),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 251/360 (70%), Positives = 298/360 (83%), Gaps = 2/360 (1%)
 Frame = -2

Query  1389  KNDSDKVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGY  1210
             ++D+  +E    + VEL+KSN+L++GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQAGY
Sbjct  243   RSDNLDMEDENIDHVELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFAIADATSLTQAGY  302

Query  1209  VGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLK  1030
             VGEDVESILYKL   A  NV+ AQ+GIVYIDEVDK+T K+ S N  RDVSGEGVQQ+LLK
Sbjct  303   VGEDVESILYKLYVEAGCNVEEAQRGIVYIDEVDKMTMKSHSSNGGRDVSGEGVQQSLLK  362

Query  1029  MLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPV  850
             +LEGT+V +PEKG R+ PRGD+IQ+DTKDILFICGGAFIDLEKT+SER+ D+SIGFGA V
Sbjct  363   LLEGTVVPIPEKGLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSERQHDASIGFGASV  422

Query  849   RTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTE  670
             RTNM T G +SA VTSSLLE+++S DL++YGLIPEFVGR PILVSL+AL E+QLVQVLTE
Sbjct  423   RTNMSTSGFSSAAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLSALNEDQLVQVLTE  482

Query  669   PKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIP  490
             PK+ALGKQYKK+F+MNNV+LHFTE A R IARKA++KNTGARGLRSILESIL +AM+E+P
Sbjct  483   PKSALGKQYKKLFRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSILESILTEAMFEVP  542

Query  489   D-VRSGdnvidavivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEA  316
             D V  G   I AV+VD+EAVG  G  GCGAKIL G   L  ++   E KE +K  E   A
Sbjct  543   DSVTEGSQSIKAVLVDEEAVGSVGTPGCGAKILKGDNVLQQFVEETESKEKRKEDEAKRA  602


 Score = 79.0 bits (193),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -1

Query  1534  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              PTPKEIC+GLD+FVIGQE+AKKVLSVAVYNHYKRIY+ S +K
Sbjct  196   LPTPKEICQGLDEFVIGQEKAKKVLSVAVYNHYKRIYHASRKK  238



>gb|KHG18903.1| clpX [Gossypium arboreum]
Length=2054

 Score =   510 bits (1313),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 291/420 (69%), Positives = 334/420 (80%), Gaps = 19/420 (5%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + +++ K+  S+ +Y   +R    +  K  R+   + SD     +
Sbjct  1651  FPTPKEICKGLDKFVIGQEKAKKVLSVAVYNHYMRIYHESSQK--RSAGDSGSDIAYVLD  1708

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGS           L++VP        L  AGYVGEDVESILYK
Sbjct  1709  DDIVELEKSNILLMGPTGS-------DFDALLSVP-----CAPLHGAGYVGEDVESILYK  1756

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL VADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  1757  LLVVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  1816

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRG+NIQIDTKDILFICGGAFID+EKTISER QDSSIGFGAPVR NMR GGVT+
Sbjct  1817  KGARKHPRGENIQIDTKDILFICGGAFIDIEKTISERLQDSSIGFGAPVRANMRAGGVTN  1876

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A +TSSL+ETVES+DL++YGLIPEFVGRFP+LVSL ALTE QLVQVLT+PKNAL KQYKK
Sbjct  1877  AALTSSLMETVESTDLVAYGLIPEFVGRFPVLVSLLALTEEQLVQVLTKPKNALCKQYKK  1936

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN V LH TE AL+SIARKAITKNTGARGLR+ILE+ILMDAMYEIPDVR+GD++IDA
Sbjct  1937  MFQMNGVNLHITEGALKSIARKAITKNTGARGLRAILENILMDAMYEIPDVRTGDDIIDA  1996

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
             V+VD+EAVG +G G GAKILYGKGALD YLS   Q++ K +    E ++E E  LPS+VA
Sbjct  1997  VVVDEEAVGLKGCGSGAKILYGKGALDSYLS---QQKLKDLETSGETEVETEL-LPSVVA  2052


 Score =   192 bits (488),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 128/284 (45%), Positives = 160/284 (56%), Gaps = 33/284 (12%)
 Frame = -1

Query  2158  LSQNLFSYFNLQSLLHFSEN-SILELSIRVKFTALSPKHM------LGILLH*IFLEFFV  2000
             ++ +  S  N+Q  +  +E   +L  S R K   L  K M      L I    + L    
Sbjct  1410  VALDFVSPENVQECIRLTEEFRLLPKSHRAKEDKLEVKKMAVYAATLAIPTLYLLLSAIP  1469

Query  1999  YFCFR**AMAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSK--NYFT  1826
              F        AA R K   ETAS T S  R+F+ N+M  GR+ +    + I++K  ++F 
Sbjct  1470  IFGLSSFFSMAAFRCKPSAETASLTVSQFRHFLSNYMHYGRMASSSHCTTIRNKWDDHFV  1529

Query  1825  NSRHSFSLFKPVSVRGEFVDRG------YDNSRNLSS-----------CGKIDISSSYGD  1697
             N+ + F+ FKPVS+RGE V++G        NS +LS            C    + SSYGD
Sbjct  1530  NTPYHFTSFKPVSLRGELVEKGSRFLDIRRNSHDLSKDVDRELREKLGCNSFRVLSSYGD  1589

Query  1696  PPEVWQPPGDGIVVR-PGVKFVQVGEVDgpssgsgggfgsGA------KDGCWGGSNLGP  1538
             PPEVWQPPGDGI +R  GV   + G   G   G G   GSG       KDGCWGGSNLG 
Sbjct  1590  PPEVWQPPGDGIAIRVSGVNLGRGGGGGGAGGGGGPTAGSGGGFGSDSKDGCWGGSNLGH  1649

Query  1537  NFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             NFPTPKEICKGLDKFVIGQE+AKKVLSVAVYNHY RIY++S+QK
Sbjct  1650  NFPTPKEICKGLDKFVIGQEKAKKVLSVAVYNHYMRIYHESSQK  1693



>ref|XP_010499878.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X3 [Camelina sativa]
Length=645

 Score =   478 bits (1231),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 251/339 (74%), Positives = 288/339 (85%), Gaps = 22/339 (6%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VEL+KSN+L+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVG+DVESIL+
Sbjct  310   DDDNVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGDDVESILH  369

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVA++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLK+LEGTIVNVP
Sbjct  370   KLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKLLEGTIVNVP  429

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
              KGARKHPRGD++QIDTKDILFICGGAF+DLEKTI +RRQDSSIGFGAPVR NM T GVT
Sbjct  430   GKGARKHPRGDHLQIDTKDILFICGGAFVDLEKTIVDRRQDSSIGFGAPVRANMATSGVT  489

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             S  +TSSLLE+VES+DL +YGLIPEFVGRFPILVSL+ALTE+QL++              
Sbjct  490   SGALTSSLLESVESADLTAYGLIPEFVGRFPILVSLSALTEDQLIR--------------  535

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
                    VKLHFTE AL  I+++A+ KNTGARGLR++LESIL +AM+EIPD + GD  ID
Sbjct  536   -------VKLHFTEKALEIISKQAMVKNTGARGLRALLESILTEAMFEIPDDKKGDERID  588

Query  459   avivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKE  346
             AVIVD+E+ G E  RGC AK+L G GA + YLS N+ K+
Sbjct  589   AVIVDEESTGSEASRGCTAKVLKGDGAFERYLSENKSKD  627


 Score = 92.0 bits (227),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG++LG +FPTPKEICK LDKFVIGQ RAKKVLSVAVYNHYKRIY+ S +K
Sbjct  250   WGGASLGRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIYHTSMKK  301



>ref|XP_011028418.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X4 [Populus euphratica]
Length=345

 Score =   467 bits (1201),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 246/327 (75%), Positives = 285/327 (87%), Gaps = 5/327 (2%)
 Frame = -2

Query  1317  MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLTVADYNVQAAQ  1138
             MGPTGSGKTLLAKTLAR+VNVPFVIADATTLTQAGYVGEDVESILYKLL V+++NV+AAQ
Sbjct  1     MGPTGSGKTLLAKTLARIVNVPFVIADATTLTQAGYVGEDVESILYKLLVVSEFNVEAAQ  60

Query  1137  QGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP--EKGARKHPRGDN  964
             +GIVYIDEVDKIT KA S +I RDVSGEGVQQALLKMLEGT +NVP  +KG  KHPRGD 
Sbjct  61    RGIVYIDEVDKITMKAGSSSIGRDVSGEGVQQALLKMLEGTALNVPVPDKGPGKHPRGDT  120

Query  963   IQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVVTSSLLETV  784
             IQ+DTKDILFICGGAF++LEKTISERRQD+SIGFGAPVR NMR G +T+A+VTSSLLE+V
Sbjct  121   IQVDTKDILFICGGAFVNLEKTISERRQDASIGFGAPVRANMRAGAITNAMVTSSLLESV  180

Query  783   ESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQMNNVKLHF  604
             ES DL++YGLIPEFVGRFP+L SL AL E+QLVQVL EPKNALGKQYKK+F MNNV L F
Sbjct  181   ESGDLVAYGLIPEFVGRFPVLASLLALNEDQLVQVLMEPKNALGKQYKKIFNMNNVNLDF  240

Query  603   TEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidavivddeaVG-H  427
             T +ALR IA+KA+ KNTGARGLR+ILE+IL +AM+EIP+ +S  N I+AV+VD+EAVG  
Sbjct  241   TGNALRLIAKKAMAKNTGARGLRAILENILTEAMFEIPENKSQSNCINAVLVDEEAVGLM  300

Query  426   EGRGCGAKILYGKGALDCYLSGNEQKE  346
             +  G GAKI++G  AL+  L   E+KE
Sbjct  301   DTPGRGAKIIHGDSALEHKL--QERKE  325



>ref|XP_010461164.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Camelina sativa]
Length=644

 Score =   477 bits (1228),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 251/339 (74%), Positives = 287/339 (85%), Gaps = 22/339 (6%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VEL+KSN+L+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVG+DVESIL+
Sbjct  309   DDDNVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGDDVESILH  368

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVA++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLK+LEGT VNVP
Sbjct  369   KLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKLLEGTTVNVP  428

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
              KGARKHPRGD+IQIDTKDILFICGGAF+DLEKTI +RRQDSSIGFGAPVR NM T GVT
Sbjct  429   GKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDRRQDSSIGFGAPVRANMATSGVT  488

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             S  +TSSLLE+VES+DL +YGLIPEFVGRFPILVSL+ALTE+QL++              
Sbjct  489   SGALTSSLLESVESADLTAYGLIPEFVGRFPILVSLSALTEDQLIR--------------  534

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
                    VKLHFTE AL  I+++A+ KNTGARGLR++LESIL +AM+EIPD + GD  ID
Sbjct  535   -------VKLHFTEKALEIISKQAMVKNTGARGLRALLESILTEAMFEIPDDKKGDERID  587

Query  459   avivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKE  346
             AVIVD+E+ G E  RGC AK+L G GA + YLS N+ K+
Sbjct  588   AVIVDEESTGSEASRGCTAKVLRGDGAFERYLSENKSKD  626


 Score = 92.4 bits (228),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG++LG +FPTPKEICK LDKFVIGQ RAKKVLSVAVYNHYKRIY+ S +K
Sbjct  249   WGGASLGRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIYHTSMKK  300



>ref|XP_006385093.1| hypothetical protein POPTR_0004s23830g [Populus trichocarpa]
 gb|ERP62890.1| hypothetical protein POPTR_0004s23830g [Populus trichocarpa]
Length=601

 Score =   475 bits (1222),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 266/411 (65%), Positives = 319/411 (78%), Gaps = 22/411 (5%)
 Frame = -2

Query  1524  PRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEA  1348
             P++  KGL    + + + K+  S+ +Y    R    +  K    P  +     E  E+E 
Sbjct  175   PKEICKGLDEFVIGQDKAKKVLSVAVYNHYKRIYHASKQKKSHAPWSHSDG--ENDENEF  232

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQA-------GYVGEDVES  1189
             +EL+KSN+L+MGPTGSGKTLLAKTLAR+VNVPFVIADATTLTQA       GYVGEDVES
Sbjct  233   IELDKSNVLLMGPTGSGKTLLAKTLARIVNVPFVIADATTLTQASLFCCTAGYVGEDVES  292

Query  1188  ILYKLLTVADYNVQAAQQGIVYIDEVDKITKK-------AESLNISRDVSGEGVQQALLK  1030
             ILYKLL VA++NV+AAQ+GIVYIDEVDKIT K       A S +I RDVSGEGVQQALLK
Sbjct  293   ILYKLLVVAEFNVEAAQRGIVYIDEVDKITMKVYDFCVQAGSSSIGRDVSGEGVQQALLK  352

Query  1029  MLEGTIVNVP--EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGA  856
             MLEGT++NVP  +KG  KHPRGD IQ+DTKDILFICGGAF++LEKTISERRQD+SIGFGA
Sbjct  353   MLEGTVINVPVPDKGPGKHPRGDTIQVDTKDILFICGGAFVNLEKTISERRQDASIGFGA  412

Query  855   PVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVL  676
             PVR NMR G +T+A+VTSSLLE+VES DL++YGLIPEFVGRFP+L SL AL E+QLVQVL
Sbjct  413   PVRANMRAGAITNAMVTSSLLESVESGDLVAYGLIPEFVGRFPVLASLLALNEDQLVQVL  472

Query  675   TEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYE  496
              EPKNALGKQYKK+F MNNV LHFT +ALR IA+KA+ KNTGARGLR+ILE+IL +AM+E
Sbjct  473   MEPKNALGKQYKKIFNMNNVNLHFTGNALRLIAKKAMAKNTGARGLRAILENILTEAMFE  532

Query  495   IPDVRSGdnvidavivddeaVG-HEGRGCGAKILYGKGALDCYLSGNEQKE  346
              P+ +S  N I AV+VD+EAVG  +  G GAKI++G  AL+  L   E+KE
Sbjct  533   TPENKSQSNCITAVLVDEEAVGLMDTPGRGAKIIHGDSALEHKL--QERKE  581


 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  1546  LGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             L    PTPKEICKGLD+FVIGQ++AKKVLSVAVYNHYKRIY+ S QK
Sbjct  168   LERELPTPKEICKGLDEFVIGQDKAKKVLSVAVYNHYKRIYHASKQK  214



>ref|XP_010912711.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Elaeis guineensis]
Length=315

 Score =   464 bits (1194),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 251/345 (73%), Positives = 280/345 (81%), Gaps = 36/345 (10%)
 Frame = -2

Query  1317  MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLTVADYNVQAAQ  1138
             MGPTGSGKTLLAKTLAR VNVP VIADATTLTQAGYVGEDVESILYKLL VA++NVQAAQ
Sbjct  1     MGPTGSGKTLLAKTLARFVNVPIVIADATTLTQAGYVGEDVESILYKLLMVAEFNVQAAQ  60

Query  1137  QGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQ  958
             QGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQ
Sbjct  61    QGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQ  120

Query  957   IDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVES  778
             IDTKDILFICGGAFIDLEKTISERRQDSS+GFGAPVR NMRTGG+T+AVVTSSLLE+   
Sbjct  121   IDTKDILFICGGAFIDLEKTISERRQDSSMGFGAPVRANMRTGGLTNAVVTSSLLES---  177

Query  777   SDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTE  598
                                             VL EPKNA+GKQ+KK+F MN+VKLHFT+
Sbjct  178   --------------------------------VLMEPKNAVGKQFKKLFSMNSVKLHFTD  205

Query  597   DALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidavivddeaVGHEGR  418
              ALR IA+KA+ KNTGARGLR+ILE+IL+DAMYEIPD+++GD  IDAV+VD+EAVG   R
Sbjct  206   TALRLIAKKALAKNTGARGLRAILENILIDAMYEIPDLKTGDERIDAVVVDEEAVGSVDR  265

Query  417   -GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPS  286
              GCGAKIL G GAL+ YL  N+ K+   + +GS  ++E E +L S
Sbjct  266   PGCGAKILRGDGALEHYLKENKIKDRTAMTDGSGGELEGESELSS  310



>ref|XP_010478757.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Camelina sativa]
Length=640

 Score =   476 bits (1224),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 251/339 (74%), Positives = 286/339 (84%), Gaps = 22/339 (6%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VEL+KSN+L+MGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVG+DVESIL+
Sbjct  309   DDDNVELDKSNVLLMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGDDVESILH  368

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVA++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLK+LEGTIVNVP
Sbjct  369   KLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKLLEGTIVNVP  428

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
              KGARKHPRGD+IQIDTKDILFICGGAF+DLEKTI +RRQDSSIGFGAPVR NM T  VT
Sbjct  429   GKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDRRQDSSIGFGAPVRANMATSRVT  488

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             S  +TSSLLE+VES+DL +YGLIPEFVGRFPILVSL+ALTE+QL++              
Sbjct  489   SGAITSSLLESVESADLTAYGLIPEFVGRFPILVSLSALTEDQLIR--------------  534

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvid  460
                    VKLHFTE AL  I+++A+ KNTGARGLR++LESIL +AM+EIPD + GD  ID
Sbjct  535   -------VKLHFTEKALEIISKQAMVKNTGARGLRALLESILTEAMFEIPDDKKGDERID  587

Query  459   avivddeaVGHE-GRGCGAKILYGKGALDCYLSGNEQKE  346
             AVIVD+E  G E  RGC AK+L G GA + YLS N+ K+
Sbjct  588   AVIVDEELTGSEVSRGCTAKVLKGDGAFERYLSENKSKD  626


 Score = 92.0 bits (227),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             WGG++LG +FPTPKEICK LDKFVIGQ RAKKVLSVAVYNHYKRIY+ S +K
Sbjct  249   WGGASLGRDFPTPKEICKWLDKFVIGQSRAKKVLSVAVYNHYKRIYHTSMKK  300



>gb|KDO54247.1| hypothetical protein CISIN_1g005637mg [Citrus sinensis]
Length=575

 Score =   473 bits (1216),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 241/307 (79%), Positives = 266/307 (87%), Gaps = 3/307 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  S+ +Y   +R    +  K  R+  ++ S   +G +
Sbjct  265   FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNESSQK--RSAGESSSCTTDGVD  322

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  323   DDTVELEKSNILLMGPTGSGKTLLAKTLARYVNVPFVIADATTLTQAGYVGEDVESILYK  382

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTV+DYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  383   LLTVSDYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPE  442

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERRQDSSIGFGAPVR NMR GGVT 
Sbjct  443   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRQDSSIGFGAPVRANMRAGGVTD  502

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             AVVTSSL+ETVESSDLI+YGLIPEFVGRFP+LVSL ALTENQLVQVLTEPKNALGKQY+K
Sbjct  503   AVVTSSLMETVESSDLIAYGLIPEFVGRFPVLVSLLALTENQLVQVLTEPKNALGKQYRK  562

Query  636   MFQMNNV  616
             MFQMN V
Sbjct  563   MFQMNGV  569


 Score =   180 bits (456),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 127/184 (69%), Gaps = 10/184 (5%)
 Frame = -1

Query  1939  TASATASHLRYFILNHMQAGRLGNLGWNS-RIKSKNYFTNSRHSFSLFKPVSVRGEFVDR  1763
             T S T S  RY +L++M AGR+ +    + R K  ++  N+ + F+ F+PVS+RGE V++
Sbjct  128   TTSLTVSQFRYLMLSYMHAGRVASSSRCAHRSKWDDHVINTPYHFTSFRPVSLRGELVEK  187

Query  1762  GYDNSRNLSSCGKIDISSS-----YGDPPEVWQPPGDGIVVRPGVKFVQVGEVDgpssgs  1598
             G     + + C K+   SS     YGDPPEVWQPPGDGI VR   +    G       GS
Sbjct  188   GSQLCTDNAKCQKLTGGSSSITSSYGDPPEVWQPPGDGIAVRVNGQ----GPNLVRGGGS  243

Query  1597  gggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYND  1418
             G GFGSG+KDGCWGGSNLG  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHY RIYN+
Sbjct  244   GSGFGSGSKDGCWGGSNLGNKFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNE  303

Query  1417  SAQK  1406
             S+QK
Sbjct  304   SSQK  307



>ref|XP_003602256.1| LCR [Medicago truncatula]
Length=335

 Score =   463 bits (1192),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 252/314 (80%), Positives = 279/314 (89%), Gaps = 2/314 (1%)
 Frame = -2

Query  1218  AGYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQA  1039
             AGYVGEDVESILYKLL  ADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQA
Sbjct  22    AGYVGEDVESILYKLLAAADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQA  81

Query  1038  LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFG  859
             LLKMLEGTIVNVPEKGARKHPRGDNIQIDTK+ILFICGGAFIDLEKTISERRQDSSIGFG
Sbjct  82    LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKNILFICGGAFIDLEKTISERRQDSSIGFG  141

Query  858   APVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQV  679
             APVR  M+ G VT A + SSLL TVESSDLI+YGLIPEFVGRFPILVSL+ALTENQL+QV
Sbjct  142   APVRAKMKAGSVTEASIASSLLGTVESSDLIAYGLIPEFVGRFPILVSLSALTENQLIQV  201

Query  678   LTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMY  499
             LTEPK+AL KQYKK FQ+N VKLHFTE A +SIAR+A++KNTGARGLR+I+ESIL+DAMY
Sbjct  202   LTEPKSALEKQYKKTFQINGVKLHFTESARKSIARQAMSKNTGARGLRAIIESILVDAMY  261

Query  498   EIPDVRSGdnvidavivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSE  319
             EIPD+R+GD+VIDAV+VD+++VG EG   GAKILYG+GA D YLS  ++K   +  E S 
Sbjct  262   EIPDIRTGDDVIDAVVVDEDSVGGEGSVRGAKILYGRGAFDRYLS--KEKNDSETTEVSG  319

Query  318   ADIEVERDLPSIVA  277
              D E E +LPSIVA
Sbjct  320   GDQEAETELPSIVA  333



>gb|KDO54246.1| hypothetical protein CISIN_1g005637mg [Citrus sinensis]
Length=581

 Score =   471 bits (1211),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 240/305 (79%), Positives = 265/305 (87%), Gaps = 3/305 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  S+ +Y   +R    +  K  R+  ++ S   +G +
Sbjct  265   FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNESSQK--RSAGESSSCTTDGVD  322

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  323   DDTVELEKSNILLMGPTGSGKTLLAKTLARYVNVPFVIADATTLTQAGYVGEDVESILYK  382

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTV+DYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  383   LLTVSDYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPE  442

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERRQDSSIGFGAPVR NMR GGVT 
Sbjct  443   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRQDSSIGFGAPVRANMRAGGVTD  502

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             AVVTSSL+ETVESSDLI+YGLIPEFVGRFP+LVSL ALTENQLVQVLTEPKNALGKQY+K
Sbjct  503   AVVTSSLMETVESSDLIAYGLIPEFVGRFPVLVSLLALTENQLVQVLTEPKNALGKQYRK  562

Query  636   MFQMN  622
             MFQMN
Sbjct  563   MFQMN  567


 Score =   179 bits (455),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 127/184 (69%), Gaps = 10/184 (5%)
 Frame = -1

Query  1939  TASATASHLRYFILNHMQAGRLGNLGWNS-RIKSKNYFTNSRHSFSLFKPVSVRGEFVDR  1763
             T S T S  RY +L++M AGR+ +    + R K  ++  N+ + F+ F+PVS+RGE V++
Sbjct  128   TTSLTVSQFRYLMLSYMHAGRVASSSRCAHRSKWDDHVINTPYHFTSFRPVSLRGELVEK  187

Query  1762  GYDNSRNLSSCGKIDISSS-----YGDPPEVWQPPGDGIVVRPGVKFVQVGEVDgpssgs  1598
             G     + + C K+   SS     YGDPPEVWQPPGDGI VR   +    G       GS
Sbjct  188   GSQLCTDNAKCQKLTGGSSSITSSYGDPPEVWQPPGDGIAVRVNGQ----GPNLVRGGGS  243

Query  1597  gggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYND  1418
             G GFGSG+KDGCWGGSNLG  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHY RIYN+
Sbjct  244   GSGFGSGSKDGCWGGSNLGNKFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNE  303

Query  1417  SAQK  1406
             S+QK
Sbjct  304   SSQK  307



>ref|XP_006279597.1| hypothetical protein CARUB_v10026110mg [Capsella rubella]
 gb|EOA12495.1| hypothetical protein CARUB_v10026110mg [Capsella rubella]
Length=604

 Score =   471 bits (1213),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 248/350 (71%), Positives = 294/350 (84%), Gaps = 4/350 (1%)
 Frame = -2

Query  1353  EAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKL  1174
             + VEL+KSN+L++GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQA YVGEDVESILYKL
Sbjct  252   DHVELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFAIADATSLTQASYVGEDVESILYKL  311

Query  1173  LTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP--  1000
                A  +V+ AQ+GIVYIDEVDK+T K+ S N  RDVSGEGVQQ+LLK+LEGT+V+VP  
Sbjct  312   YVEAGCSVEEAQRGIVYIDEVDKMTMKSHSSNGGRDVSGEGVQQSLLKLLEGTVVSVPIP  371

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKG R+ PRGD+IQ+DTKDILFICGGAFIDLEKT+SER+ D+SIGFGA VRTNM T G +
Sbjct  372   EKGLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSERQHDASIGFGASVRTNMNTSGFS  431

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             SA VTSSLLE+++S DL++YGLIPEFVGR PILVSL+AL E+QLVQVLTEPK+ALGKQYK
Sbjct  432   SATVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLSALNEDQLVQVLTEPKSALGKQYK  491

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPD-VRSGdnvi  463
             K+F+MN+V+LHFTE A R IARKA++KNTGARGLRSILESIL +AMYE+PD +  G   I
Sbjct  492   KLFRMNDVQLHFTEGATRLIARKAMSKNTGARGLRSILESILTEAMYEVPDSMTEGSQSI  551

Query  462   davivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEA  316
              AV+VD+EAVG  G +GCGAKIL G   L  ++   E KE +K VE   A
Sbjct  552   KAVLVDEEAVGSVGTQGCGAKILKGDDVLQQFVEETESKEKRKEVEAERA  601


 Score = 79.0 bits (193),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -1

Query  1534  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              PTPKEIC+GLD+FVIGQE+AKKVLSVAVYNHYKRIY+ S +K
Sbjct  193   LPTPKEICQGLDEFVIGQEKAKKVLSVAVYNHYKRIYHASRKK  235



>ref|XP_006412459.1| hypothetical protein EUTSA_v10024710mg [Eutrema salsugineum]
 gb|ESQ53912.1| hypothetical protein EUTSA_v10024710mg [Eutrema salsugineum]
Length=604

 Score =   471 bits (1213),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 246/354 (69%), Positives = 296/354 (84%), Gaps = 4/354 (1%)
 Frame = -2

Query  1386  NDSDKVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYV  1207
             +D+  +E    + VEL+KSN+L++GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQAGYV
Sbjct  241   SDNLDMEDDSIDHVELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFTIADATSLTQAGYV  300

Query  1206  GEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKM  1027
             GEDVESILYKL   A  NV+ AQ+GIVYIDEVDK++ K+ S N  RDVSGEGVQQ+LLK+
Sbjct  301   GEDVESILYKLYVEAGCNVEEAQRGIVYIDEVDKMSMKSHSSNGGRDVSGEGVQQSLLKL  360

Query  1026  LEGTIVNVP--EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAP  853
             LEGT+V+VP  EKG R+ PRGD+IQ+DTKDILFICGGAFIDLEKT+SER+ D+SIGFGA 
Sbjct  361   LEGTVVSVPIPEKGLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSERQHDASIGFGAS  420

Query  852   VRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLT  673
             VRTNM T G +SA VTSSLLE+++S DL++YGLIPEFVGR PILVSL+AL E+QLVQVLT
Sbjct  421   VRTNMSTSGFSSAAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLSALNEDQLVQVLT  480

Query  672   EPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEI  493
             EPK+ALGKQYKK+F+MNNV+LHFTE A R IARKA++KNTGARGLRSILESIL +AM+E+
Sbjct  481   EPKSALGKQYKKLFRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSILESILTEAMFEV  540

Query  492   PD-VRSGdnvidavivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKK  337
             PD +  G   I AV+VD+E+VG  G  GCGAKIL G   +  +L   E +E +K
Sbjct  541   PDSITEGSQGIKAVLVDEESVGSVGTPGCGAKILKGDDVMQPFLEETESQEKRK  594


 Score = 77.8 bits (190),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -1

Query  1534  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              PTPKEIC+GLD+FVIGQE+AKKVL+VAVYNHYKRIY+ S +K
Sbjct  193   LPTPKEICQGLDEFVIGQEKAKKVLAVAVYNHYKRIYHASRKK  235



>emb|CDP11543.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   460 bits (1183),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 246/313 (79%), Positives = 281/313 (90%), Gaps = 2/313 (1%)
 Frame = -2

Query  1218  AGYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQA  1039
             AGYVGEDVESIL+KLLTVA++NVQAAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQA
Sbjct  22    AGYVGEDVESILHKLLTVAEFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQA  81

Query  1038  LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFG  859
             LLKMLEGTIVNVPEKGARKHPRGD+IQIDTK+ILFICGGAFIDLEKTISERRQDSSIGFG
Sbjct  82    LLKMLEGTIVNVPEKGARKHPRGDHIQIDTKNILFICGGAFIDLEKTISERRQDSSIGFG  141

Query  858   APVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQV  679
             APVR N+RTGG+T+A VTSSLLE+VESSDLI+YGLIPEFVGRFPILV+L+ALTE+QLVQV
Sbjct  142   APVRANLRTGGITNATVTSSLLESVESSDLIAYGLIPEFVGRFPILVNLSALTEDQLVQV  201

Query  678   LTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMY  499
             L EPKNALGKQY+K+F MNNVKLHFTE AL  IA+KA+ KNTGARGLR+ILE IL DAMY
Sbjct  202   LAEPKNALGKQYQKLFNMNNVKLHFTEKALGLIAKKAMAKNTGARGLRAILEGILTDAMY  261

Query  498   EIPDVRSGdnvidavivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGS  322
             EIPD+R G + +DAV+VD+E+VG  +  GCG KIL G GAL+CYL+  + K+  +    S
Sbjct  262   EIPDIRGGMDRVDAVVVDEESVGTIDAAGCGGKILRGDGALECYLAKTKLKDQVENAAAS  321

Query  321   EADIE-VERDLPS  286
             EAD++ VE ++ S
Sbjct  322   EADLQGVESEVSS  334



>gb|KHG18904.1| clpX [Gossypium arboreum]
Length=2024

 Score =   501 bits (1290),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 286/420 (68%), Positives = 327/420 (78%), Gaps = 35/420 (8%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + +++ K+  S+ +Y   +R    +  K  R+   + SD     +
Sbjct  1637  FPTPKEICKGLDKFVIGQEKAKKVLSVAVYNHYMRIYHESSQK--RSAGDSGSDIAYVLD  1694

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSG                            YVGEDVESILYK
Sbjct  1695  DDIVELEKSNILLMGPTGSG----------------------------YVGEDVESILYK  1726

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LL VADYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE
Sbjct  1727  LLVVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  1786

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRG+NIQIDTKDILFICGGAFID+EKTISER QDSSIGFGAPVR NMR GGVT+
Sbjct  1787  KGARKHPRGENIQIDTKDILFICGGAFIDIEKTISERLQDSSIGFGAPVRANMRAGGVTN  1846

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKK  637
             A +TSSL+ETVES+DL++YGLIPEFVGRFP+LVSL ALTE QLVQVLT+PKNAL KQYKK
Sbjct  1847  AALTSSLMETVESTDLVAYGLIPEFVGRFPVLVSLLALTEEQLVQVLTKPKNALCKQYKK  1906

Query  636   MFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvida  457
             MFQMN V LH TE AL+SIARKAITKNTGARGLR+ILE+ILMDAMYEIPDVR+GD++IDA
Sbjct  1907  MFQMNGVNLHITEGALKSIARKAITKNTGARGLRAILENILMDAMYEIPDVRTGDDIIDA  1966

Query  456   vivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPSIVA  277
             V+VD+EAVG +G G GAKILYGKGALD YLS   Q++ K +    E ++E E  LPS+VA
Sbjct  1967  VVVDEEAVGLKGCGSGAKILYGKGALDSYLS---QQKLKDLETSGETEVETEL-LPSVVA  2022


 Score =   188 bits (478),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 138/216 (64%), Gaps = 26/216 (12%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSK--NYFTNSRHSFSL  1802
             ++  L+ K   ETAS T S  R+F+ N+M  GR+ +    + I++K  ++F N+ + F+ 
Sbjct  1464  LSTKLKCKPSAETASLTVSQFRHFLSNYMHYGRMASSSHCTTIRNKWDDHFVNTPYHFTS  1523

Query  1801  FKPVSVRGEFVDRG------YDNSRNLSS-----------CGKIDISSSYGDPPEVWQPP  1673
             FKPVS+RGE V++G        NS +LS            C    + SSYGDPPEVWQPP
Sbjct  1524  FKPVSLRGELVEKGSRFLDIRRNSHDLSKDVDRELREKLGCNSFRVLSSYGDPPEVWQPP  1583

Query  1672  GDGIVVR-PGVKFVQVGEVDgpssgsgggfgsGA------KDGCWGGSNLGPNFPTPKEI  1514
             GDGI +R  GV   + G   G   G G   GSG       KDGCWGGSNLG NFPTPKEI
Sbjct  1584  GDGIAIRVSGVNLGRGGGGGGAGGGGGPTAGSGGGFGSDSKDGCWGGSNLGHNFPTPKEI  1643

Query  1513  CKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             CKGLDKFVIGQE+AKKVLSVAVYNHY RIY++S+QK
Sbjct  1644  CKGLDKFVIGQEKAKKVLSVAVYNHYMRIYHESSQK  1679



>dbj|BAA98151.1| CLP protease regulatory subunit CLPX-like [Arabidopsis thaliana]
Length=608

 Score =   469 bits (1207),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 248/350 (71%), Positives = 292/350 (83%), Gaps = 4/350 (1%)
 Frame = -2

Query  1353  EAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKL  1174
             + VEL+KSN+L++GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQAGYVGEDVESILYKL
Sbjct  256   DHVELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFAIADATSLTQAGYVGEDVESILYKL  315

Query  1173  LTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP--  1000
                A  NV+ AQ+GIVYIDEVDK+T K+ S N  RDVSGEGVQQ+LLK+LEGT+V+VP  
Sbjct  316   YVEAGCNVEEAQRGIVYIDEVDKMTMKSHSSNGGRDVSGEGVQQSLLKLLEGTVVSVPIP  375

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKG R+ PRGD+IQ+DTKDILFICGGAFIDLEKT+SER+ D+SIGFGA VRTNM T G++
Sbjct  376   EKGLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSERQHDASIGFGASVRTNMSTSGLS  435

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             SA VTSSLLE+++S DL++YGLIPEFVGR PILVSL+AL E+QLVQVLTEPK+ALGKQYK
Sbjct  436   SAAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLSALNEDQLVQVLTEPKSALGKQYK  495

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPD-VRSGdnvi  463
             K+F+MNNV+L FTE A R IARKA++KNTGARGLRSILESIL +AM+E+PD +  G   I
Sbjct  496   KLFRMNNVQLQFTEGATRLIARKAMSKNTGARGLRSILESILTEAMFEVPDSITEGSQSI  555

Query  462   davivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEA  316
              AV+VD+EAVG  G  GCGAKIL G   L  ++   E KE  K  E   A
Sbjct  556   KAVLVDEEAVGSVGSPGCGAKILKGDNVLQQFVEEAESKEKSKEDEAKRA  605


 Score = 79.0 bits (193),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -1

Query  1534  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              PTPKEIC+GLD+FVIGQE+AKKVLSVAVYNHYKRIY+ S +K
Sbjct  197   LPTPKEICQGLDEFVIGQEKAKKVLSVAVYNHYKRIYHASRKK  239



>ref|XP_010482282.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Camelina sativa]
Length=609

 Score =   469 bits (1207),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 249/350 (71%), Positives = 292/350 (83%), Gaps = 4/350 (1%)
 Frame = -2

Query  1353  EAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKL  1174
             + VEL+KSN+L++GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQAGYVGEDVESILYKL
Sbjct  257   DHVELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFAIADATSLTQAGYVGEDVESILYKL  316

Query  1173  LTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP--  1000
                A  NV+ AQ+GIVYIDEVDK+T K+ S N  RDVSGEGVQQ+LLK+LEGT+V+VP  
Sbjct  317   YVEAGCNVEEAQRGIVYIDEVDKMTMKSHSSNGGRDVSGEGVQQSLLKLLEGTVVSVPIP  376

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKG R+ PRGD+IQ+DTKDILFICGGAFIDLEKT+SER+ D+SIGFGA VRTNM T G +
Sbjct  377   EKGLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSERQHDASIGFGASVRTNMNTSGFS  436

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             SA VTSSLLE+++S DL++YGLIPEFVGR PILVSL+AL E+QLVQVLTEPK+ALGKQYK
Sbjct  437   SAAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLSALNEDQLVQVLTEPKSALGKQYK  496

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPD-VRSGdnvi  463
             K+F+MNNV+LHFTE A R IARKA++KNTGARGLRSILESIL +AMYE+PD +  G   I
Sbjct  497   KLFRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSILESILTEAMYEVPDSMTGGSQSI  556

Query  462   davivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEA  316
              AV+VD+EAVG  G +GCGAKIL G      +    E KE +K  E   A
Sbjct  557   KAVLVDEEAVGLVGTQGCGAKILKGDDVSQQFGEETESKEKRKEDEAKRA  606


 Score = 79.0 bits (193),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -1

Query  1534  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              PTPKEIC+GLD+FVIGQE+AKKVLSVAVYNHYKRIY+ S +K
Sbjct  198   LPTPKEICQGLDEFVIGQEKAKKVLSVAVYNHYKRIYHASRKK  240



>gb|KFK32966.1| hypothetical protein AALP_AA6G312500 [Arabis alpina]
Length=555

 Score =   467 bits (1201),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 243/342 (71%), Positives = 290/342 (85%), Gaps = 5/342 (1%)
 Frame = -2

Query  1353  EAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKL  1174
             +++EL+KSN+L++GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQAGYVGEDVESILYKL
Sbjct  206   DSIELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFAIADATSLTQAGYVGEDVESILYKL  265

Query  1173  LTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP--  1000
                A  +V+ AQ+GIVYIDEVDK+T K+ S N  RDVSGEGVQQ+LLK+LEGT+V+VP  
Sbjct  266   YVEAGCDVEEAQRGIVYIDEVDKMTMKSHSSNGGRDVSGEGVQQSLLKLLEGTVVSVPIP  325

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKG R+ PRGD+IQ+DTKDILFICGGAFIDLEKT+SER+ D+SIGFGA VRTNM T G +
Sbjct  326   EKGLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSERQHDASIGFGASVRTNMNTSGFS  385

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             SA VTSSLLE+++S DL++YGLIPEFVGR PILVSL+AL E+QLVQVLTEPK+ALGKQYK
Sbjct  386   SAAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLSALNEDQLVQVLTEPKSALGKQYK  445

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPD-VRSGdnvi  463
             K+F+MNNV+LHFTE A R IARKA++KNTGARGLRSILESIL +AM+E+PD +  G   I
Sbjct  446   KLFRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSILESILTEAMFEVPDSMTEGSQSI  505

Query  462   davivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEPKK  337
              AV+VD+EAVG    GCGAKIL G      ++   E KE +K
Sbjct  506   KAVLVDEEAVGTP--GCGAKILKGDDMFQQFVEDTESKEKRK  545


 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -1

Query  1534  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              PTPKEIC+GLD FVIGQE+AKKVLSVAVYNHYKRIY+ S  K
Sbjct  160   LPTPKEICRGLDDFVIGQEKAKKVLSVAVYNHYKRIYHASRTK  202



>ref|XP_009119914.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Brassica rapa]
Length=579

 Score =   467 bits (1201),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 244/341 (72%), Positives = 288/341 (84%), Gaps = 4/341 (1%)
 Frame = -2

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VEL+KSN+L++GPTGSGKTLLAKTLARLVNVPF IADAT+LTQAGYVGEDVESILYKL  
Sbjct  229   VELDKSNVLLLGPTGSGKTLLAKTLARLVNVPFAIADATSLTQAGYVGEDVESILYKLYV  288

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP--EK  994
              A  NV+ AQ+GIVYIDEVDK++ K+ S N  RDVSGEGVQQ+LLK+LEGT+V+VP  EK
Sbjct  289   EAGCNVEEAQRGIVYIDEVDKMSMKSHSSNGGRDVSGEGVQQSLLKLLEGTVVSVPIPEK  348

Query  993   GARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSA  814
             G R+ PRGD+IQ+DTKDILFICGGAFIDLEKT+SER+ D+SIGFGA VRTNM T G +S+
Sbjct  349   GLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSERQHDASIGFGASVRTNMNTSGFSSS  408

Query  813   VVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKM  634
              VTSSLLE+++S DL++YGLIPEFVGR PILVSL+AL E+QLVQVLTEP++ALGKQYKK+
Sbjct  409   AVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLSALNEDQLVQVLTEPRSALGKQYKKL  468

Query  633   FQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRS-Gdnvida  457
             F+MNNV+LHFTE A R IARKA++KNTGARGLRSILESIL +AM+E+PD +S G   I A
Sbjct  469   FRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSILESILTEAMFEVPDSKSEGSQSIKA  528

Query  456   vivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKK  337
             V+VD+EAVG  G  GCGAKIL G      +    E  E +K
Sbjct  529   VLVDEEAVGSVGSPGCGAKILKGDDVTQQHFEQTESNEKRK  569


 Score = 77.8 bits (190),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  1552  SNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             SN     PTPKEIC+GLD+FVIGQ++AKKVLSVAVYNHYKRIY+ S  K
Sbjct  159   SNGAVKLPTPKEICQGLDQFVIGQDKAKKVLSVAVYNHYKRIYHSSKIK  207



>ref|NP_568714.4| ATP-dependent Clp protease [Arabidopsis thaliana]
 gb|AED95863.1| ATP-dependent Clp protease [Arabidopsis thaliana]
Length=608

 Score =   468 bits (1203),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 247/350 (71%), Positives = 291/350 (83%), Gaps = 4/350 (1%)
 Frame = -2

Query  1353  EAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKL  1174
             + VEL+KSN+L++GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQA YVGEDVESILYKL
Sbjct  256   DHVELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFAIADATSLTQASYVGEDVESILYKL  315

Query  1173  LTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP--  1000
                A  NV+ AQ+GIVYIDEVDK+T K+ S N  RDVSGEGVQQ+LLK+LEGT+V+VP  
Sbjct  316   YVEAGCNVEEAQRGIVYIDEVDKMTMKSHSSNGGRDVSGEGVQQSLLKLLEGTVVSVPIP  375

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKG R+ PRGD+IQ+DTKDILFICGGAFIDLEKT+SER+ D+SIGFGA VRTNM T G++
Sbjct  376   EKGLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSERQHDASIGFGASVRTNMSTSGLS  435

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             SA VTSSLLE+++S DL++YGLIPEFVGR PILVSL+AL E+QLVQVLTEPK+ALGKQYK
Sbjct  436   SAAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLSALNEDQLVQVLTEPKSALGKQYK  495

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPD-VRSGdnvi  463
             K+F+MNNV+L FTE A R IARKA++KNTGARGLRSILESIL +AM+E+PD +  G   I
Sbjct  496   KLFRMNNVQLQFTEGATRLIARKAMSKNTGARGLRSILESILTEAMFEVPDSITEGSQSI  555

Query  462   davivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEA  316
              AV+VD+EAVG  G  GCGAKIL G   L  ++   E KE  K  E   A
Sbjct  556   KAVLVDEEAVGSVGSPGCGAKILKGDNVLQQFVEEAESKEKSKEDEAKRA  605


 Score = 79.0 bits (193),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -1

Query  1534  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              PTPKEIC+GLD+FVIGQE+AKKVLSVAVYNHYKRIY+ S +K
Sbjct  197   LPTPKEICQGLDEFVIGQEKAKKVLSVAVYNHYKRIYHASRKK  239



>ref|XP_010441212.1| PREDICTED: mitochondrial clpX-like chaperone MCX1 isoform X1 
[Camelina sativa]
 ref|XP_010441216.1| PREDICTED: mitochondrial clpX-like chaperone MCX1 isoform X2 
[Camelina sativa]
Length=625

 Score =   467 bits (1202),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 248/350 (71%), Positives = 291/350 (83%), Gaps = 4/350 (1%)
 Frame = -2

Query  1353  EAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKL  1174
             + VEL+KSN+L++GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQAGYVGEDVESILYKL
Sbjct  273   DHVELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFAIADATSLTQAGYVGEDVESILYKL  332

Query  1173  LTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP--  1000
                A  NV+ AQ+GIVYIDEVDK+T K+ S N  RDVSGEGVQQ+LLK+LEGT+V+VP  
Sbjct  333   YVEAGCNVEEAQRGIVYIDEVDKMTMKSHSSNGGRDVSGEGVQQSLLKLLEGTVVSVPIP  392

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKG R+ PRGD+IQ+DTKDILFICGGAFIDLEKT+SER+ D+SIGFGA VRTNM T G +
Sbjct  393   EKGLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSERQHDASIGFGASVRTNMNTSGFS  452

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             SA VTSSLLE+++S DL++YGLIPEFVGR PILVSL+AL E+QLVQVLTEPK+ALGKQYK
Sbjct  453   SAAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLSALNEDQLVQVLTEPKSALGKQYK  512

Query  639   KMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPD-VRSGdnvi  463
             K+F+MNNV+LHFTE A R IARKA++KNTGARGLRSILESIL +AMYE+PD +  G   I
Sbjct  513   KLFRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSILESILTEAMYEVPDSMTGGSQSI  572

Query  462   davivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEA  316
              AV+VD+EAVG  G +GCGAKIL G      +    E KE +   E   A
Sbjct  573   KAVLVDEEAVGLVGTQGCGAKILKGDDVSQHFGEETESKENRNEDEAKRA  622


 Score = 79.0 bits (193),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -1

Query  1534  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              PTPKEIC+GLD+FVIGQE+AKKVLSVAVYNHYKRIY+ S +K
Sbjct  214   LPTPKEICQGLDEFVIGQEKAKKVLSVAVYNHYKRIYHASRKK  256



>emb|CDY14359.1| BnaA10g06960D [Brassica napus]
Length=580

 Score =   465 bits (1196),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 242/341 (71%), Positives = 287/341 (84%), Gaps = 4/341 (1%)
 Frame = -2

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VEL+KSN+L++GPTGSGKTLLAKTLARLVNVPF IADAT+LTQA YVGEDVESILYKL  
Sbjct  230   VELDKSNVLLLGPTGSGKTLLAKTLARLVNVPFAIADATSLTQASYVGEDVESILYKLYV  289

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP--EK  994
              A  NV+ AQ+GIVYIDEVDK++ K+ S N  RDVSGEGVQQ+LLK+LEGT+V+VP  EK
Sbjct  290   EAGCNVEEAQRGIVYIDEVDKMSMKSHSSNGGRDVSGEGVQQSLLKLLEGTVVSVPIPEK  349

Query  993   GARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSA  814
             G R+ PRGD+IQ+DTKDILFICGGAFIDLEKT+SER+ D+SIGFGA VRTNM T G +S+
Sbjct  350   GLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSERQHDASIGFGASVRTNMNTSGFSSS  409

Query  813   VVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKM  634
              VTSSLLE+++S DL++YGLIPEFVGR PILVSL+AL E+QLVQVLTEP++ALGKQYKK+
Sbjct  410   AVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLSALNEDQLVQVLTEPRSALGKQYKKL  469

Query  633   FQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRS-Gdnvida  457
             F+MNNV+LHFTE A R IAR+A++KNTGARGLRSILESIL +AM+E+PD +S G   I A
Sbjct  470   FRMNNVQLHFTEGATRLIARRAMSKNTGARGLRSILESILTEAMFEVPDSKSEGSQSIKA  529

Query  456   vivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKK  337
             V+VD+EAVG  G  GCGAKIL G      +    E  E +K
Sbjct  530   VLVDEEAVGSVGSPGCGAKILKGDDVTQQHFEQTESNEKRK  570


 Score = 78.2 bits (191),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  1552  SNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             SN     PTPKEIC+GLD+FVIGQ++AKKVLSVAVYNHYKRIY+ S  K
Sbjct  159   SNGAVKLPTPKEICQGLDQFVIGQDKAKKVLSVAVYNHYKRIYHSSKIK  207



>ref|XP_009119913.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Brassica rapa]
Length=580

 Score =   464 bits (1194),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 241/323 (75%), Positives = 283/323 (88%), Gaps = 4/323 (1%)
 Frame = -2

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VEL+KSN+L++GPTGSGKTLLAKTLARLVNVPF IADAT+LTQAGYVGEDVESILYKL  
Sbjct  229   VELDKSNVLLLGPTGSGKTLLAKTLARLVNVPFAIADATSLTQAGYVGEDVESILYKLYV  288

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP--EK  994
              A  NV+ AQ+GIVYIDEVDK++ K+ S N  RDVSGEGVQQ+LLK+LEGT+V+VP  EK
Sbjct  289   EAGCNVEEAQRGIVYIDEVDKMSMKSHSSNGGRDVSGEGVQQSLLKLLEGTVVSVPIPEK  348

Query  993   GARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSA  814
             G R+ PRGD+IQ+DTKDILFICGGAFIDLEKT+SER+ D+SIGFGA VRTNM T G +S+
Sbjct  349   GLRRDPRGDSIQMDTKDILFICGGAFIDLEKTVSERQHDASIGFGASVRTNMNTSGFSSS  408

Query  813   VVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKM  634
              VTSSLLE+++S DL++YGLIPEFVGR PILVSL+AL E+QLVQVLTEP++ALGKQYKK+
Sbjct  409   AVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLSALNEDQLVQVLTEPRSALGKQYKKL  468

Query  633   FQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRS-Gdnvida  457
             F+MNNV+LHFTE A R IARKA++KNTGARGLRSILESIL +AM+E+PD +S G   I A
Sbjct  469   FRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSILESILTEAMFEVPDSKSEGSQSIKA  528

Query  456   vivddeaVGHEGR-GCGAKILYG  391
             V+VD+EAVG  G  GCGAKIL G
Sbjct  529   VLVDEEAVGSVGSPGCGAKILKG  551


 Score = 77.8 bits (190),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  1552  SNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             SN     PTPKEIC+GLD+FVIGQ++AKKVLSVAVYNHYKRIY+ S  K
Sbjct  159   SNGAVKLPTPKEICQGLDQFVIGQDKAKKVLSVAVYNHYKRIYHSSKIK  207



>ref|XP_010442456.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Camelina sativa]
Length=604

 Score =   465 bits (1196),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 247/356 (69%), Positives = 294/356 (83%), Gaps = 4/356 (1%)
 Frame = -2

Query  1371  VEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVE  1192
             +E    + VEL+KSN+L++GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQAGYVGEDVE
Sbjct  246   IEDDSIDHVELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFAIADATSLTQAGYVGEDVE  305

Query  1191  SILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTI  1012
             SILYKL   A  NV+ AQ+GIVYIDEVDK+T K++S N  RDVS EGVQQ+LLK+LEGT+
Sbjct  306   SILYKLYVEARCNVEEAQRGIVYIDEVDKMTMKSQSSNGGRDVSREGVQQSLLKLLEGTV  365

Query  1011  VNVP--EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNM  838
             V+VP  EKG ++ PRGD+IQ+DTKDILFICGGAFIDLEKT+SER+ D+SIGFGA VRTNM
Sbjct  366   VSVPIPEKGLQRDPRGDSIQMDTKDILFICGGAFIDLEKTVSERQHDASIGFGASVRTNM  425

Query  837   RTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNA  658
              T G +SA VTSSLLE+++S DL++YGLIPEFVGR PILVSL+AL E+QLVQVLTEPK+A
Sbjct  426   NTSGFSSAAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLSALNEDQLVQVLTEPKSA  485

Query  657   LGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPD-VR  481
             LGKQYKK+F+MNNV+LHFTE A R IARKA++KNTGARGLRSILESIL +AMYE+PD + 
Sbjct  486   LGKQYKKLFRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSILESILTEAMYEVPDSMT  545

Query  480   SGdnvidavivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEA  316
              G   I AV+VD+EA+G  G +GCGAKIL G      +    E KE +K  E   A
Sbjct  546   GGSQSIKAVLVDEEAIGLVGTQGCGAKILKGDDVSQQFGEETESKEKRKEDEAKRA  601


 Score = 78.6 bits (192),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -1

Query  1534  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              PTPKEIC+GLD+FVIGQE+AKKVLSVAVYNHYKRIY+ S +K
Sbjct  193   LPTPKEICQGLDEFVIGQEKAKKVLSVAVYNHYKRIYHASRKK  235



>ref|XP_010267612.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Nelumbo nucifera]
Length=468

 Score =   456 bits (1174),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 239/339 (71%), Positives = 274/339 (81%), Gaps = 9/339 (3%)
 Frame = -2

Query  1617  MVRARALVVGSGQGLKMGAG-EAPIWV-----QIFRPPRKFAKGLISL*LVRKEPKRS-S  1459
             +VR   +  GSG G   G+  E   W        F  P++  K L    + ++  K+  S
Sbjct  128   LVRGGGVTPGSGSGAAFGSSLEDGCWGGANFGDHFPTPKEICKRLDKFVIGQERAKKVLS  187

Query  1458  L*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTEHEAVELEKSNILVMGPTGSGKTLLAK  1279
             + +Y    R    +L K     E  D+ + +  + ++VELEKSNIL+MGPTGSGKTLLAK
Sbjct  188   VAVYNHYKRIYYESLRKWP--TEDLDNGERDEMDSDSVELEKSNILLMGPTGSGKTLLAK  245

Query  1278  TLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKIT  1099
             TLARLVNVPFVIADATTLTQAGYVGEDVESILYKLL VAD+NV AAQQGIVYIDEVDKIT
Sbjct  246   TLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLAVADFNVTAAQQGIVYIDEVDKIT  305

Query  1098  KKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGA  919
             KKAESLN+SRDVSGEGVQQALLKMLEGT+VNVPEKGARKHPRGDNIQIDTKDILFICGGA
Sbjct  306   KKAESLNLSRDVSGEGVQQALLKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGA  365

Query  918   FIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFV  739
             F+DLEKTISERRQDSSIGFGAP+R NMRT G+T+A+V S+LLE VESSDLI+YGLIPEF+
Sbjct  366   FVDLEKTISERRQDSSIGFGAPIRANMRTSGLTNAIVASNLLENVESSDLIAYGLIPEFI  425

Query  738   GRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQMN  622
             GRFPILVSL+ALTE+QLV+VL EPKNALGKQY+K+FQMN
Sbjct  426   GRFPILVSLSALTEDQLVKVLIEPKNALGKQYRKLFQMN  464


 Score =   171 bits (433),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 128/205 (62%), Gaps = 16/205 (8%)
 Frame = -1

Query  1975  MAAALRSKSCRETASATASHLRYFILNHMQAGRLGNLGWNSRIKSKNYFTNSRHSFSLFK  1796
             MAAA RSKS +E    T S  RY +LNHM  GR+ N     R K  ++ T + + F  FK
Sbjct  1     MAAAFRSKSLKEAVFRTVSQSRYLVLNHMHVGRIFNTHCKYRRKWDDFPTKTPYRFCSFK  60

Query  1795  PVSVRGEFVDRGY---DNSRNLSSCGKI---------DISSSYGDPPEVWQPPGDGIVVR  1652
              VS++G+FV+      DN + +S   K          D   SYG+PPE WQP GDG+ VR
Sbjct  61    LVSIQGDFVNMSTVRSDNRQIVSDFSKERCKESSSLPDSLRSYGEPPEYWQPSGDGLTVR  120

Query  1651  P---GVKFVQVGEVDgpssgsgggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQ  1481
                     V+ G V  P SGSG  FGS  +DGCWGG+N G +FPTPKEICK LDKFVIGQ
Sbjct  121   SVPQNTNLVRGGGV-TPGSGSGAAFGSSLEDGCWGGANFGDHFPTPKEICKRLDKFVIGQ  179

Query  1480  ERAKKVLSVAVYNHYKRIYNDSAQK  1406
             ERAKKVLSVAVYNHYKRIY +S +K
Sbjct  180   ERAKKVLSVAVYNHYKRIYYESLRK  204



>ref|XP_010442455.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Camelina sativa]
Length=606

 Score =   460 bits (1184),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 247/358 (69%), Positives = 294/358 (82%), Gaps = 6/358 (2%)
 Frame = -2

Query  1371  VEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVE  1192
             +E    + VEL+KSN+L++GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQAGYVGEDVE
Sbjct  246   IEDDSIDHVELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFAIADATSLTQAGYVGEDVE  305

Query  1191  SILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTI  1012
             SILYKL   A  NV+ AQ+GIVYIDEVDK+T K++S N  RDVS EGVQQ+LLK+LEGT+
Sbjct  306   SILYKLYVEARCNVEEAQRGIVYIDEVDKMTMKSQSSNGGRDVSREGVQQSLLKLLEGTV  365

Query  1011  VNVP--EKGARKHPRGDNIQI--DTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRT  844
             V+VP  EKG ++ PRGD+IQ+  DTKDILFICGGAFIDLEKT+SER+ D+SIGFGA VRT
Sbjct  366   VSVPIPEKGLQRDPRGDSIQVNMDTKDILFICGGAFIDLEKTVSERQHDASIGFGASVRT  425

Query  843   NMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPK  664
             NM T G +SA VTSSLLE+++S DL++YGLIPEFVGR PILVSL+AL E+QLVQVLTEPK
Sbjct  426   NMNTSGFSSAAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLSALNEDQLVQVLTEPK  485

Query  663   NALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPD-  487
             +ALGKQYKK+F+MNNV+LHFTE A R IARKA++KNTGARGLRSILESIL +AMYE+PD 
Sbjct  486   SALGKQYKKLFRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSILESILTEAMYEVPDS  545

Query  486   VRSGdnvidavivddeaVGHEG-RGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEA  316
             +  G   I AV+VD+EA+G  G +GCGAKIL G      +    E KE +K  E   A
Sbjct  546   MTGGSQSIKAVLVDEEAIGLVGTQGCGAKILKGDDVSQQFGEETESKEKRKEDEAKRA  603


 Score = 78.6 bits (192),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -1

Query  1534  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              PTPKEIC+GLD+FVIGQE+AKKVLSVAVYNHYKRIY+ S +K
Sbjct  193   LPTPKEICQGLDEFVIGQEKAKKVLSVAVYNHYKRIYHASRKK  235



>gb|KCW71001.1| hypothetical protein EUGRSUZ_F04107 [Eucalyptus grandis]
Length=621

 Score =   460 bits (1184),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 222/248 (90%), Positives = 241/248 (97%), Gaps = 0/248 (0%)
 Frame = -2

Query  1359  EHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILY  1180
             + + VELEKSN+L+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILY
Sbjct  360   DDDNVELEKSNVLLMGPTGSGKTLLAKTLARFVNVPFVIADATTLTQAGYVGEDVESILY  419

Query  1179  KLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  1000
             KLLTVA++NVQAAQQG+VYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP
Sbjct  420   KLLTVAEFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVP  479

Query  999   EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVT  820
             EKGARKHPRGDNIQ+DTKDILF+CGGAF+DLEKTISERRQDSSIGFGAPVR NMR GGVT
Sbjct  480   EKGARKHPRGDNIQMDTKDILFVCGGAFVDLEKTISERRQDSSIGFGAPVRANMRAGGVT  539

Query  819   SAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYK  640
             +A VTSSLLE+VES+DLI+YGLIPEF+GRFPILVSL+ALTE+QLVQVLTEP+NALGKQYK
Sbjct  540   NAAVTSSLLESVESADLIAYGLIPEFIGRFPILVSLSALTEDQLVQVLTEPRNALGKQYK  599

Query  639   KMFQMNNV  616
             K+F MNNV
Sbjct  600   KLFSMNNV  607


 Score = 82.4 bits (202),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 69/117 (59%), Gaps = 22/117 (19%)
 Frame = -1

Query  1717  ISSSYGDPPE---------------VWQPPGDGIVVRPGVKFVQVGEVDgpssgsgggfg  1583
             + S  GDPPE               V  PPG      PGV  ++     G  SG   G  
Sbjct  228   LRSYSGDPPENWPPPPGPPAGNGLAVHSPPGPPFA--PGVNVIRAAGPGGGGSGGSSGGA  285

Query  1582  sGA----KDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIY  1424
             +G     K+G WGG+NLG + PTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIY
Sbjct  286   AGGNGGEKNG-WGGANLGKDLPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIY  341



>emb|CDY20236.1| BnaC09g30030D [Brassica napus]
Length=588

 Score =   459 bits (1180),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 241/355 (68%), Positives = 292/355 (82%), Gaps = 9/355 (3%)
 Frame = -2

Query  1389  KNDSDKVEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGY  1210
             ++D D ++      VEL+KSN+L++GPTGSGKTLLAKTLAR+V+VPF IADAT+LTQA Y
Sbjct  229   EDDDDSID-----LVELDKSNVLLLGPTGSGKTLLAKTLARIVSVPFAIADATSLTQASY  283

Query  1209  VGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLK  1030
             VGEDVESILYKL   A  NV+ AQ+GIVYIDEVDK++ K+ S N  RDVSGEGVQQ+LLK
Sbjct  284   VGEDVESILYKLYVEAGCNVEEAQRGIVYIDEVDKMSMKSHSSNGGRDVSGEGVQQSLLK  343

Query  1029  MLEGTIVNVP--EKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGA  856
             +LEGT+V+VP  EKG R+ PRGD+IQ+DTKDILFICGGAF+DLEKT+SER+ D+SIGFGA
Sbjct  344   LLEGTVVSVPIPEKGLRRDPRGDSIQMDTKDILFICGGAFVDLEKTVSERQHDASIGFGA  403

Query  855   PVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVL  676
              VRTNM T G +S+ VTSSLLE+++S DL++YGLIPEFVGR PI VSL+AL E+QLVQVL
Sbjct  404   SVRTNMNTSGFSSSAVTSSLLESLQSEDLVAYGLIPEFVGRLPIFVSLSALNEDQLVQVL  463

Query  675   TEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYE  496
             TEP++ALGKQYKK+F+MNNV+LHFTE A R IARKA++KNTGARGLRSILESIL +AM+E
Sbjct  464   TEPRSALGKQYKKLFRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSILESILTEAMFE  523

Query  495   IPDVRS-GdnvidavivddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKK  337
             +PD +S G   I AV+VD+EAVG  G  GCGAKIL G      +    E  E +K
Sbjct  524   VPDGKSEGSQSIKAVLVDEEAVGSVGSPGCGAKILRGDDVPQQHFEQTESNEKRK  578


 Score = 76.6 bits (187),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -1

Query  1534  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              PTPKEIC+GLD+FVIGQ++AKKVLSVAVYNHYKRIY+ S  K
Sbjct  175   LPTPKEICQGLDQFVIGQDKAKKVLSVAVYNHYKRIYHASKLK  217



>ref|XP_010442457.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X3 [Camelina sativa]
Length=593

 Score =   457 bits (1175),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 241/333 (72%), Positives = 286/333 (86%), Gaps = 6/333 (2%)
 Frame = -2

Query  1371  VEGTEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVE  1192
             +E    + VEL+KSN+L++GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQAGYVGEDVE
Sbjct  246   IEDDSIDHVELDKSNVLLLGPTGSGKTLLAKTLARIVNVPFAIADATSLTQAGYVGEDVE  305

Query  1191  SILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTI  1012
             SILYKL   A  NV+ AQ+GIVYIDEVDK+T K++S N  RDVS EGVQQ+LLK+LEGT+
Sbjct  306   SILYKLYVEARCNVEEAQRGIVYIDEVDKMTMKSQSSNGGRDVSREGVQQSLLKLLEGTV  365

Query  1011  VNVP--EKGARKHPRGDNIQI--DTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRT  844
             V+VP  EKG ++ PRGD+IQ+  DTKDILFICGGAFIDLEKT+SER+ D+SIGFGA VRT
Sbjct  366   VSVPIPEKGLQRDPRGDSIQVNMDTKDILFICGGAFIDLEKTVSERQHDASIGFGASVRT  425

Query  843   NMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPK  664
             NM T G +SA VTSSLLE+++S DL++YGLIPEFVGR PILVSL+AL E+QLVQVLTEPK
Sbjct  426   NMNTSGFSSAAVTSSLLESLQSEDLVAYGLIPEFVGRLPILVSLSALNEDQLVQVLTEPK  485

Query  663   NALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPD-  487
             +ALGKQYKK+F+MNNV+LHFTE A R IARKA++KNTGARGLRSILESIL +AMYE+PD 
Sbjct  486   SALGKQYKKLFRMNNVQLHFTEGATRLIARKAMSKNTGARGLRSILESILTEAMYEVPDS  545

Query  486   VRSGdnvidavivddeaVGHEG-RGCGAKILYG  391
             +  G   I AV+VD+EA+G  G +GCGAKIL G
Sbjct  546   MTGGSQSIKAVLVDEEAIGLVGTQGCGAKILKG  578


 Score = 78.6 bits (192),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -1

Query  1534  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              PTPKEIC+GLD+FVIGQE+AKKVLSVAVYNHYKRIY+ S +K
Sbjct  193   LPTPKEICQGLDEFVIGQEKAKKVLSVAVYNHYKRIYHASRKK  235



>ref|XP_010521411.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X2 [Tarenaya hassleriana]
Length=613

 Score =   454 bits (1168),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 241/338 (71%), Positives = 288/338 (85%), Gaps = 5/338 (1%)
 Frame = -2

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VEL+KSN+L++GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQAGYVGEDVESILYKLL 
Sbjct  261   VELDKSNVLLIGPTGSGKTLLAKTLARIVNVPFAIADATSLTQAGYVGEDVESILYKLLV  320

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVN--VPEK  994
              A +NV AAQ+GIVYIDEVDKITKK+ S N  RDVSGEGVQQALLK+LEGT+V+  VP+K
Sbjct  321   EAGFNVDAAQRGIVYIDEVDKITKKSHSSNGGRDVSGEGVQQALLKLLEGTVVSVPVPDK  380

Query  993   GARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSA  814
             G R+ PRGD IQ+DTKDILFICGGAF+DLEKT+SER+ D+SIGFGAPVR+NM T   ++A
Sbjct  381   GFRRDPRGDCIQMDTKDILFICGGAFVDLEKTVSERQHDASIGFGAPVRSNMTTSRFSTA  440

Query  813   VVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKM  634
             +V SSLLE VES+DL++YGLIPEFVGR PILVSL+AL E+QLVQVL EPKNALGKQYKK+
Sbjct  441   IV-SSLLELVESADLVTYGLIPEFVGRVPILVSLSALNEDQLVQVLMEPKNALGKQYKKL  499

Query  633   FQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPD-VRSGdnvida  457
             F MN+V+L FTE A R IA+KA++KNTGARGLRS+LESIL +AM+E+PD +  G + I A
Sbjct  500   FSMNSVQLLFTEGATRMIAKKAMSKNTGARGLRSLLESILTEAMFEVPDSITEGSHGIRA  559

Query  456   vivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKE  346
             V+VD+EAVG  E  GCGAKI+ G    + ++   E K+
Sbjct  560   VLVDEEAVGSVETPGCGAKIIKGNVEPEHFVQETESKD  597


 Score = 72.4 bits (176),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -1

Query  1534  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              PTPKEIC+ LD+FVIGQ++AKKVLSVAVYNHYKR+Y+ S +K
Sbjct  199   LPTPKEICQKLDEFVIGQQKAKKVLSVAVYNHYKRVYHASWRK  241



>ref|XP_010521410.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X1 [Tarenaya hassleriana]
Length=619

 Score =   454 bits (1168),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 241/338 (71%), Positives = 288/338 (85%), Gaps = 5/338 (1%)
 Frame = -2

Query  1347  VELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYKLLT  1168
             VEL+KSN+L++GPTGSGKTLLAKTLAR+VNVPF IADAT+LTQAGYVGEDVESILYKLL 
Sbjct  261   VELDKSNVLLIGPTGSGKTLLAKTLARIVNVPFAIADATSLTQAGYVGEDVESILYKLLV  320

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVN--VPEK  994
              A +NV AAQ+GIVYIDEVDKITKK+ S N  RDVSGEGVQQALLK+LEGT+V+  VP+K
Sbjct  321   EAGFNVDAAQRGIVYIDEVDKITKKSHSSNGGRDVSGEGVQQALLKLLEGTVVSVPVPDK  380

Query  993   GARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSA  814
             G R+ PRGD IQ+DTKDILFICGGAF+DLEKT+SER+ D+SIGFGAPVR+NM T   ++A
Sbjct  381   GFRRDPRGDCIQMDTKDILFICGGAFVDLEKTVSERQHDASIGFGAPVRSNMTTSRFSTA  440

Query  813   VVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKM  634
             +V SSLLE VES+DL++YGLIPEFVGR PILVSL+AL E+QLVQVL EPKNALGKQYKK+
Sbjct  441   IV-SSLLELVESADLVTYGLIPEFVGRVPILVSLSALNEDQLVQVLMEPKNALGKQYKKL  499

Query  633   FQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPD-VRSGdnvida  457
             F MN+V+L FTE A R IA+KA++KNTGARGLRS+LESIL +AM+E+PD +  G + I A
Sbjct  500   FSMNSVQLLFTEGATRMIAKKAMSKNTGARGLRSLLESILTEAMFEVPDSITEGSHGIRA  559

Query  456   vivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKE  346
             V+VD+EAVG  E  GCGAKI+ G    + ++   E K+
Sbjct  560   VLVDEEAVGSVETPGCGAKIIKGNVEPEHFVQETESKD  597


 Score = 72.4 bits (176),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -1

Query  1534  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
              PTPKEIC+ LD+FVIGQ++AKKVLSVAVYNHYKR+Y+ S +K
Sbjct  199   LPTPKEICQKLDEFVIGQQKAKKVLSVAVYNHYKRVYHASWRK  241



>ref|XP_010099789.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Morus notabilis]
 gb|EXB80407.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Morus notabilis]
Length=379

 Score =   442 bits (1136),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 229/313 (73%), Positives = 270/313 (86%), Gaps = 3/313 (1%)
 Frame = -2

Query  1218  AGYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQA  1039
             AGYVGEDVESILYKLL  AD+NV+AAQ+GIVYIDEVDKITKK ES+NI RDVSGEGVQQA
Sbjct  69    AGYVGEDVESILYKLLVEADFNVEAAQRGIVYIDEVDKITKKGESINIGRDVSGEGVQQA  128

Query  1038  LLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFG  859
             LLKMLEGT+VNVP+KGARKHPRGD IQIDTK+ILFICGGAFI+LEKTISERRQDSSIGFG
Sbjct  129   LLKMLEGTVVNVPDKGARKHPRGDTIQIDTKNILFICGGAFINLEKTISERRQDSSIGFG  188

Query  858   APVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQV  679
             APVR NM++  VT A+VTSSLLE+VES DLI+YG+IPEFVGR PILV L+AL E+QLVQV
Sbjct  189   APVRMNMQSNRVTDALVTSSLLESVESGDLIAYGMIPEFVGRLPILVCLSALNEDQLVQV  248

Query  678   LTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMY  499
             LT+PKNALGKQYKKMF +NNVKLH TE+ALR IA+KA+ KNTGARGLRSILE++LM+AM+
Sbjct  249   LTQPKNALGKQYKKMFSLNNVKLHVTENALRLIAKKAMAKNTGARGLRSILENVLMEAMF  308

Query  498   EIPDVRSGdnvidavivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGS  322
             E+PD + G ++IDAV+VD+EAVG  +  GCGAK+L G GA + +L   E ++P  +VE  
Sbjct  309   EVPDSKKGIDIIDAVLVDEEAVGSVDYSGCGAKLLRGHGAFEQFLHEMETEKP--MVEHE  366

Query  321   EADIEVERDLPSI  283
             +   E++    SI
Sbjct  367   QGKSEIQSRAASI  379



>gb|EMT28446.1| ATP-dependent Clp protease ATP-binding subunit clpX [Aegilops 
tauschii]
Length=588

 Score =   449 bits (1154),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 236/350 (67%), Positives = 283/350 (81%), Gaps = 15/350 (4%)
 Frame = -2

Query  1362  TEHEAVELEKSNILVMGPTGSGKTL--LAKTLARLVNVPFVIADATTLTQ----------  1219
              +H+ VE++KSN+L+MGPTGS  TL  +   L   +   F ++  +   +          
Sbjct  51    ADHDNVEIDKSNVLLMGPTGSEFTLQPILPYLIICLTFEFRVSPLSIFVKSLYRSRFLHS  110

Query  1218  --AGYVGEDVESILYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQ  1045
               AGYVGEDVESIL KLL  A+YNVQAAQQGIVYIDEVDKITKKAES N+SRDVSGEGVQ
Sbjct  111   ELAGYVGEDVESILQKLLVEAEYNVQAAQQGIVYIDEVDKITKKAESANVSRDVSGEGVQ  170

Query  1044  QALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIG  865
             QALLK+LEGT+V +PEKG+RK+ R D+IQIDTKDILFICGGAF+DLEKTISERRQDSSIG
Sbjct  171   QALLKILEGTVVTIPEKGSRKNSRNDSIQIDTKDILFICGGAFVDLEKTISERRQDSSIG  230

Query  864   FGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLV  685
             FGAP+RTNMR+ GVTS  VTSSLLE+VES DL  +GLIPEF+GR PILVSL AL E+QLV
Sbjct  231   FGAPIRTNMRSSGVTSPTVTSSLLESVESGDLAKFGLIPEFIGRLPILVSLAALDEDQLV  290

Query  684   QVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDA  505
             QVLTEPKN+L +QY+KMF +NNVKLHFT+ ALR +A+KAI KNTGARGLR++LE+IL++A
Sbjct  291   QVLTEPKNSLSRQYRKMFSLNNVKLHFTDGALRIVAKKAIVKNTGARGLRALLETILLEA  350

Query  504   MYEIPDVRSGdnvidavivddeaVGHEGR-GCGAKILYGKGALDCYLSGN  358
             MYEIPD ++G+  +DAV+VD+EA+G   R GCGAKIL G GAL  Y+  N
Sbjct  351   MYEIPDEKAGNERVDAVVVDEEAIGSVDRPGCGAKILRGDGALAQYIIRN  400


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  1516  ICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             +C+ LD+FVIGQ +AKKVLSVAVYNHYKR+YN + QK
Sbjct  1     MCRRLDEFVIGQGKAKKVLSVAVYNHYKRVYNATVQK  37



>ref|XP_010677235.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X3 [Beta vulgaris subsp. vulgaris]
Length=546

 Score =   445 bits (1145),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 212/251 (84%), Positives = 239/251 (95%), Gaps = 0/251 (0%)
 Frame = -2

Query  1362  TEHEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESIL  1183
              E++ VELEKSN+++MGPTGSGKTLLAKTLAR VNVPFV+ADATTLTQAGYVGEDVESIL
Sbjct  296   AENDDVELEKSNVILMGPTGSGKTLLAKTLARFVNVPFVVADATTLTQAGYVGEDVESIL  355

Query  1182  YKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNV  1003
             YKLLT ADYNVQAAQQGIVYIDE+DKITKKAE+ N+SRDVSGEGVQQALLK+LEG+IVNV
Sbjct  356   YKLLTAADYNVQAAQQGIVYIDEIDKITKKAENFNVSRDVSGEGVQQALLKILEGSIVNV  415

Query  1002  PEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGV  823
             PEKG RK PRG+++QIDTKDILFICGGAF+DL+KTISERRQD+SIGFGAPVR N+R+ GV
Sbjct  416   PEKGGRKPPRGEHVQIDTKDILFICGGAFVDLDKTISERRQDASIGFGAPVRENLRSAGV  475

Query  822   TSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQY  643
              SAVVTS+LLETVESSDLI+YGLIPEF+GRFPILVSL++LTE+QLVQVLTEPKNALGKQY
Sbjct  476   ASAVVTSALLETVESSDLIAYGLIPEFIGRFPILVSLSSLTEDQLVQVLTEPKNALGKQY  535

Query  642   KKMFQMNNVKL  610
             KK+F MNN +L
Sbjct  536   KKLFSMNNKRL  546


 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  1561  WGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDS  1415
             WGG+ LG + PTPKEICKGLDKFVIGQ  AKKVLSVAV+NHYKRI + S
Sbjct  235   WGGAQLGKDLPTPKEICKGLDKFVIGQHHAKKVLSVAVHNHYKRIQHAS  283



>ref|XP_010912712.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X3 [Elaeis guineensis]
 ref|XP_010912714.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X3 [Elaeis guineensis]
 ref|XP_010912715.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X3 [Elaeis guineensis]
 ref|XP_010912716.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X3 [Elaeis guineensis]
 ref|XP_010912717.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpX-like, 
mitochondrial isoform X3 [Elaeis guineensis]
Length=301

 Score =   431 bits (1109),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 232/295 (79%), Positives = 268/295 (91%), Gaps = 1/295 (0%)
 Frame = -2

Query  1167  VADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  988
             VA++NVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA
Sbjct  2     VAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPEKGA  61

Query  987   RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTSAVV  808
             RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSS+GFGAPVR NMRTGG+T+AVV
Sbjct  62    RKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSMGFGAPVRANMRTGGLTNAVV  121

Query  807   TSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQYKKMFQ  628
             TSSLLE+VESSDLI+YGLIPEF+GRFP+LVSL+AL+E+QLV+VL EPKNA+GKQ+KK+F 
Sbjct  122   TSSLLESVESSDLIAYGLIPEFIGRFPVLVSLSALSEDQLVRVLMEPKNAVGKQFKKLFS  181

Query  627   MNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnvidaviv  448
             MN+VKLHFT+ ALR IA+KA+ KNTGARGLR+ILE+IL+DAMYEIPD+++GD  IDAV+V
Sbjct  182   MNSVKLHFTDTALRLIAKKALAKNTGARGLRAILENILIDAMYEIPDLKTGDERIDAVVV  241

Query  447   ddeaVGHEGR-GCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLPS  286
             D+EAVG   R GCGAKIL G GAL+ YL  N+ K+   + +GS  ++E E +L S
Sbjct  242   DEEAVGSVDRPGCGAKILRGDGALEHYLKENKIKDRTAMTDGSGGELEGESELSS  296



>gb|EYU35038.1| hypothetical protein MIMGU_mgv1a019263mg, partial [Erythranthe 
guttata]
Length=551

 Score =   438 bits (1127),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 245/362 (68%), Positives = 281/362 (78%), Gaps = 34/362 (9%)
 Frame = -2

Query  1353  EAVELEKSNILVMGPTGSG----KTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESI  1186
             + VELEKSN+L++GPTGSG    KTLLAKTLAR+VNVPFVIADAT+LTQAGYVGEDVESI
Sbjct  217   DVVELEKSNVLLIGPTGSGMISRKTLLAKTLARVVNVPFVIADATSLTQAGYVGEDVESI  276

Query  1185  LYKLLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVN  1006
             LYKLL VAD++V+AAQ+GIVYIDEVDKITKK ESLN+ RDVSGEGVQQALLKMLEGT   
Sbjct  277   LYKLLMVADFDVEAAQRGIVYIDEVDKITKKTESLNVGRDVSGEGVQQALLKMLEGT---  333

Query  1005  VPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGG  826
                             IDTKDILFICGGAF+DLEK ISERRQDSSIGFGAPVRTNMR GG
Sbjct  334   ----------------IDTKDILFICGGAFVDLEKRISERRQDSSIGFGAPVRTNMRVGG  377

Query  825   VTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPKNALGKQ  646
             +  A   SSLLE VE  DL +YGLIPEFVGRFP++VSL+AL E+QLVQVLTEPKNAL KQ
Sbjct  378   LNIA-SASSLLEHVEGGDLTAYGLIPEFVGRFPVVVSLSALDEDQLVQVLTEPKNALCKQ  436

Query  645   YKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESILMDAMYEIPDVRSGdnv  466
             YK+MF MNNVKL FT+ A+R IA+KA  +NTGARGLR+ILE+IL +AM+E+PD  SG N 
Sbjct  437   YKRMFSMNNVKLQFTDGAMRLIAKKATARNTGARGLRAILENILTEAMFEVPDATSGVNY  496

Query  465   idavivddeaVGH-EGRGCGAKILYGKGALDCYLSGNEQKEPKKIVEGSEADIEVERDLP  289
              D V+VDDEAVG  +  GCGAK+L+    L       EQ+E   +      D+  E  LP
Sbjct  497   ADTVLVDDEAVGSPDTPGCGAKLLWSSRGL-------EQEEGAPVKRRLHEDL--EDSLP  547

Query  288   SI  283
             +I
Sbjct  548   AI  549


 Score = 74.7 bits (182),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  1546  LGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYNDSAQK  1406
             LG + PTPKEICK L++FVIGQE+AKKVLSVAVYNHYKRI +   QK
Sbjct  152   LGKDLPTPKEICKVLNEFVIGQEKAKKVLSVAVYNHYKRINHSMFQK  198



>emb|CAN80513.1| hypothetical protein VITISV_026067 [Vitis vinifera]
Length=469

 Score =   433 bits (1113),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 218/299 (73%), Positives = 251/299 (84%), Gaps = 2/299 (1%)
 Frame = -2

Query  1233  TTLTQAGYVGEDVESILYKLL-TVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSG  1057
              T  + G   ++  S++ KLL  VA++NV+AAQQGIVYIDEVDKITKKAES N  RDVSG
Sbjct  147   NTSKKKGSSAQESASLVKKLLGLVAEFNVEAAQQGIVYIDEVDKITKKAESSNTGRDVSG  206

Query  1056  EGVQQALLKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQD  877
             EGVQQALLKMLEGTIVNVP+KG RKHPRGDNIQIDTKDILFICGGAF+DLEKTISERRQD
Sbjct  207   EGVQQALLKMLEGTIVNVPDKGGRKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQD  266

Query  876   SSIGFGAPVRTNMRTGGVTSAVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTE  697
             SSIGFGAPVR NMRTGG+T AVVTSSLLE+VES DLI+YGLIPEF+GRFPILVSL+AL E
Sbjct  267   SSIGFGAPVRANMRTGGLTDAVVTSSLLESVESGDLIAYGLIPEFIGRFPILVSLSALNE  326

Query  696   NQLVQVLTEPKNALGKQYKKMFQMNNVKLHFTEDALRSIARKAITKNTGARGLRSILESI  517
             +QLVQVLTEPKNALGKQYKKM  MNNVKLHFTE+ALR IA+KAI KNTGAR LR+ILE I
Sbjct  327   DQLVQVLTEPKNALGKQYKKMLSMNNVKLHFTENALRLIAKKAIAKNTGARSLRAILEKI  386

Query  516   LMDAMYEIPDVRSGd-nvidavivddeaVGHEGRGCGAKILYGKGALDCYLSGNEQKEP  343
             L +AM+EIPDV++G   V   ++ ++     E +GCGAK+L G+GAL+ +L   +   P
Sbjct  387   LTEAMFEIPDVKTGTDMVDAVLVDEEAVESIEEQGCGAKVLRGEGALEQFLHETKSSNP  445



>gb|KDO54248.1| hypothetical protein CISIN_1g005637mg [Citrus sinensis]
Length=570

 Score =   431 bits (1107),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 222/291 (76%), Positives = 247/291 (85%), Gaps = 3/291 (1%)
 Frame = -2

Query  1533  FRPPRKFAKGLISL*LVRKEPKRS-SL*LYiiiIRESTMTLLKSDRNPEKNDSDKVEGTE  1357
             F  P++  KGL    + ++  K+  S+ +Y   +R    +  K  R+  ++ S   +G +
Sbjct  265   FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNESSQK--RSAGESSSCTTDGVD  322

Query  1356  HEAVELEKSNILVMGPTGSGKTLLAKTLARLVNVPFVIADATTLTQAGYVGEDVESILYK  1177
              + VELEKSNIL+MGPTGSGKTLLAKTLAR VNVPFVIADATTLTQAGYVGEDVESILYK
Sbjct  323   DDTVELEKSNILLMGPTGSGKTLLAKTLARYVNVPFVIADATTLTQAGYVGEDVESILYK  382

Query  1176  LLTVADYNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTIVNVPE  997
             LLTV+DYNV AAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGT+VNVPE
Sbjct  383   LLTVSDYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQALLKMLEGTVVNVPE  442

Query  996   KGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFGAPVRTNMRTGGVTS  817
             KGARKHPRGDNIQIDTKDILFICGGAF+D+EKTISERRQDSSIGFGAPVR NMR GGVT 
Sbjct  443   KGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRQDSSIGFGAPVRANMRAGGVTD  502

Query  816   AVVTSSLLETVESSDLISYGLIPEFVGRFPILVSLTALTENQLVQVLTEPK  664
             AVVTSSL+ETVESSDLI+YGLIPEFVGRFP+LVSL ALTENQLVQ    P+
Sbjct  503   AVVTSSLMETVESSDLIAYGLIPEFVGRFPVLVSLLALTENQLVQKCHFPR  553


 Score =   179 bits (455),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 127/184 (69%), Gaps = 10/184 (5%)
 Frame = -1

Query  1939  TASATASHLRYFILNHMQAGRLGNLGWNS-RIKSKNYFTNSRHSFSLFKPVSVRGEFVDR  1763
             T S T S  RY +L++M AGR+ +    + R K  ++  N+ + F+ F+PVS+RGE V++
Sbjct  128   TTSLTVSQFRYLMLSYMHAGRVASSSRCAHRSKWDDHVINTPYHFTSFRPVSLRGELVEK  187

Query  1762  GYDNSRNLSSCGKIDISSS-----YGDPPEVWQPPGDGIVVRPGVKFVQVGEVDgpssgs  1598
             G     + + C K+   SS     YGDPPEVWQPPGDGI VR   +    G       GS
Sbjct  188   GSQLCTDNAKCQKLTGGSSSITSSYGDPPEVWQPPGDGIAVRVNGQ----GPNLVRGGGS  243

Query  1597  gggfgsGAKDGCWGGSNLGPNFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYKRIYND  1418
             G GFGSG+KDGCWGGSNLG  FPTPKEICKGLDKFVIGQERAKKVLSVAVYNHY RIYN+
Sbjct  244   GSGFGSGSKDGCWGGSNLGNKFPTPKEICKGLDKFVIGQERAKKVLSVAVYNHYMRIYNE  303

Query  1417  SAQK  1406
             S+QK
Sbjct  304   SSQK  307



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6971120795132