BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18446_g1_i3 len=1111 path=[1:0-286 288:287-293 295:294-439
441:440-528 530:529-1110]

Length=1111
                                                                      Score     E

ref|XP_009626479.1|  PREDICTED: F-box protein At5g52880                 301   2e-96   
ref|XP_006366649.1|  PREDICTED: F-box protein At5g52880-like            298   1e-95   
ref|XP_009765574.1|  PREDICTED: F-box protein At5g52880                 295   6e-94   
ref|XP_004234205.1|  PREDICTED: F-box protein At5g52880                 291   1e-92   
emb|CAN77760.1|  hypothetical protein VITISV_034908                     276   6e-87   Vitis vinifera
ref|XP_002275544.2|  PREDICTED: F-box protein At5g52880 isoform X2      276   7e-87   Vitis vinifera
gb|KHF99855.1|  hypothetical protein F383_19059                         270   2e-84   
ref|XP_010662654.1|  PREDICTED: F-box protein At5g52880 isoform X1      270   3e-84   
ref|XP_010261415.1|  PREDICTED: F-box protein At5g52880                 265   3e-82   
ref|XP_011076080.1|  PREDICTED: F-box protein At5g52880                 263   6e-82   
ref|XP_009375557.1|  PREDICTED: F-box protein At5g52880                 258   9e-80   
ref|XP_002513624.1|  conserved hypothetical protein                     256   6e-79   Ricinus communis
ref|XP_006422075.1|  hypothetical protein CICLE_v10005526mg             254   3e-78   
ref|XP_006490604.1|  PREDICTED: F-box protein At5g52880-like            253   1e-77   
ref|NP_001276236.1|  uncharacterized protein LOC100789652               252   2e-77   
gb|KDO56846.1|  hypothetical protein CISIN_1g022368mg                   252   2e-77   
ref|XP_008234813.1|  PREDICTED: F-box protein At5g52880 isoform X2      251   4e-77   
ref|XP_004309171.1|  PREDICTED: F-box protein At5g52880-like            250   1e-76   
gb|KHN21800.1|  F-box protein                                           249   3e-76   
ref|XP_007218759.1|  hypothetical protein PRUPE_ppa009435mg             246   2e-75   
ref|XP_007143487.1|  hypothetical protein PHAVU_007G076000g             246   3e-75   
ref|XP_008234812.1|  PREDICTED: F-box protein At5g52880 isoform X1      246   3e-75   
emb|CDP05123.1|  unnamed protein product                                245   6e-75   
ref|XP_010105715.1|  F-box protein                                      245   9e-75   
ref|XP_004496509.1|  PREDICTED: F-box protein At5g52880-like            244   2e-74   
gb|KDP22200.1|  hypothetical protein JCGZ_26031                         242   2e-73   
ref|XP_002318351.1|  hypothetical protein POPTR_0012s00990g             240   8e-73   Populus trichocarpa [western balsam poplar]
ref|XP_011003672.1|  PREDICTED: F-box protein At5g52880                 238   4e-72   
gb|EYU25171.1|  hypothetical protein MIMGU_mgv1a010888mg                237   2e-71   
ref|XP_010917001.1|  PREDICTED: F-box protein At5g52880                 234   3e-70   
ref|XP_010671576.1|  PREDICTED: F-box protein At5g52880 isoform X1      233   3e-70   
ref|XP_010035180.1|  PREDICTED: F-box protein At5g52880                 230   6e-69   
ref|XP_010671577.1|  PREDICTED: F-box protein At5g52880 isoform X2      228   2e-68   
ref|XP_008810934.1|  PREDICTED: F-box protein At5g52880                 227   1e-67   
ref|XP_006842929.1|  hypothetical protein AMTR_s00075p00154970          226   2e-67   
ref|XP_008437544.1|  PREDICTED: F-box protein At5g52880 isoform X1      221   2e-65   
ref|XP_008437545.1|  PREDICTED: F-box protein At5g52880 isoform X2      218   8e-65   
ref|XP_004145977.1|  PREDICTED: F-box protein At5g52880-like            219   1e-64   
ref|XP_006422076.1|  hypothetical protein CICLE_v10005526mg             213   1e-63   
gb|KEH43667.1|  F-box-like protein                                      214   2e-62   
ref|XP_003592172.1|  F-box protein                                      214   4e-62   
gb|KEH43668.1|  F-box-like protein                                      213   5e-62   
ref|XP_006376610.1|  hypothetical protein POPTR_0012s00990g             211   7e-62   
ref|NP_001132570.1|  uncharacterized LOC100194037                       210   3e-61   Zea mays [maize]
ref|XP_004961432.1|  PREDICTED: F-box protein At5g52880-like isof...    209   6e-61   
gb|AAU44061.1|  unknown protein                                         209   8e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008647429.1|  PREDICTED: uncharacterized LOC100194037 isof...    206   1e-59   
ref|XP_006280963.1|  hypothetical protein CARUB_v10026964mg             203   4e-59   
ref|XP_007038875.1|  F-box family protein, putative                     201   6e-59   
ref|XP_010442833.1|  PREDICTED: F-box protein At5g52880-like            203   7e-59   
ref|XP_009386005.1|  PREDICTED: F-box protein At5g52880                 202   4e-58   
ref|XP_010445323.1|  PREDICTED: F-box protein At5g52880-like isof...    201   4e-58   
ref|XP_010482664.1|  PREDICTED: F-box protein At5g52880-like            200   6e-58   
ref|XP_002865935.1|  F-box family protein                               200   8e-58   
ref|XP_008647428.1|  PREDICTED: uncharacterized LOC100194037 isof...    200   4e-57   
ref|XP_002440114.1|  hypothetical protein SORBIDRAFT_09g026200          198   9e-57   Sorghum bicolor [broomcorn]
ref|XP_010555698.1|  PREDICTED: F-box protein At5g52880 isoform X1      196   3e-56   
ref|XP_006654675.1|  PREDICTED: LOW QUALITY PROTEIN: F-box protei...    197   3e-56   
ref|XP_008647430.1|  PREDICTED: uncharacterized LOC100194037 isof...    196   9e-56   
ref|XP_008647427.1|  PREDICTED: uncharacterized LOC100194037 isof...    197   1e-55   
ref|NP_568779.1|  F-box protein                                         190   6e-54   Arabidopsis thaliana [mouse-ear cress]
gb|EEC79561.1|  hypothetical protein OsI_20690                          189   1e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_003568064.1|  PREDICTED: F-box protein At5g52880 isoform X2      188   1e-52   
ref|XP_010445317.1|  PREDICTED: F-box protein At5g52880-like isof...    187   1e-52   
gb|AFW78800.1|  hypothetical protein ZEAMMB73_046522                    182   2e-51   
gb|KHN12925.1|  F-box protein                                           172   4e-48   
ref|XP_004961433.1|  PREDICTED: F-box protein At5g52880-like isof...    174   7e-48   
ref|XP_010231135.1|  PREDICTED: F-box protein At5g52880 isoform X1      176   8e-48   
ref|XP_009119820.1|  PREDICTED: F-box protein At5g52880-like            174   2e-47   
ref|XP_008647431.1|  PREDICTED: uncharacterized LOC100194037 isof...    172   3e-47   
gb|KFK26879.1|  hypothetical protein AALP_AA8G305200                    172   3e-47   
gb|EEE64428.1|  hypothetical protein OsJ_19272                          169   1e-45   Oryza sativa Japonica Group [Japonica rice]
gb|EPS65765.1|  hypothetical protein M569_09012                         169   2e-45   
ref|XP_009119819.1|  PREDICTED: F-box protein At5g52880                 167   3e-45   
ref|XP_008437546.1|  PREDICTED: F-box protein At5g52880 isoform X3      161   2e-43   
dbj|BAJ95216.1|  predicted protein                                      158   3e-41   
gb|AFW78802.1|  hypothetical protein ZEAMMB73_046522                    149   6e-40   
ref|XP_010231136.1|  PREDICTED: F-box protein At5g52880 isoform X3      151   4e-39   
ref|XP_010555699.1|  PREDICTED: F-box protein At5g52880 isoform X2      143   8e-37   
ref|XP_006401768.1|  hypothetical protein EUTSA_v10014697mg             116   4e-27   
ref|XP_001754423.1|  predicted protein                                  104   2e-23   
ref|XP_001756940.1|  predicted protein                                  107   6e-23   
ref|XP_007220158.1|  hypothetical protein PRUPE_ppa018659mg           79.0    1e-14   
ref|XP_007219857.1|  hypothetical protein PRUPE_ppa027224mg           74.3    3e-13   
ref|XP_005843251.1|  hypothetical protein CHLNCDRAFT_141366           72.0    1e-10   
ref|XP_002508069.1|  cyclin like protein                              71.2    2e-10   Micromonas commoda
ref|NP_001174497.1|  Os05g0526300                                     67.8    4e-10   
gb|ADM75674.1|  SKP1-interacting-like protein                         65.9    3e-09   
gb|ADM75673.1|  SKP1-interacting-like protein                         65.9    3e-09   
gb|ADM75684.1|  SKP1-interacting-like protein                         64.7    5e-09   
gb|ADM75703.1|  SKP1-interacting-like protein                         64.3    7e-09   
ref|XP_002994646.1|  hypothetical protein SELMODRAFT_432551           65.5    1e-08   
dbj|BAH57056.1|  AT5G52880                                            61.2    3e-08   Arabidopsis thaliana [mouse-ear cress]
gb|ADN33778.1|  ATP binding protein                                   64.3    7e-08   
ref|XP_002491088.1|  F-box receptor protein, subunit of the Skp1-...  52.4    5e-04   Komagataella phaffii GS115
emb|CDP01257.1|  unnamed protein product                              49.7    6e-04   
ref|XP_001819893.1|  F-box and WD40 domain protein                    51.2    0.001   Aspergillus oryzae RIB40
ref|XP_002374577.1|  F-box and WD40 domain protein, putative          51.2    0.001   Aspergillus flavus NRRL3357



>ref|XP_009626479.1| PREDICTED: F-box protein At5g52880 [Nicotiana tomentosiformis]
Length=301

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 161/301 (53%), Positives = 210/301 (70%), Gaps = 10/301 (3%)
 Frame = +1

Query  121   RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
             RY  LGL+++L+R YHY I C ELS ILRNAYS++ KNLQ+LIF D L AFRLLP+MQTQ
Sbjct  8     RYEKLGLKESLSRAYHYPIACEELSCILRNAYSKIPKNLQTLIFQDSLAAFRLLPQMQTQ  67

Query  301   ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
             A+ISAAN L+ S+EA LPKQK+ +A  EFK A++A +RR K     +G   LPQDV+ H+
Sbjct  68    AAISAANGLLHSIEAALPKQKKVLAASEFKQAMVAQRRRRKVQPMVEGRSQLPQDVLVHI  127

Query  481   FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
             F FLD+ +L+ A+LVCRSWS AASDNHLWQL++ NFFG  P ++ N +  +       V+
Sbjct  128   FGFLDLTSLVTASLVCRSWSVAASDNHLWQLMHINFFG-RPSDNPNIIRLT-----YGVE  181

Query  661   DICREETSTST-SVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTS  837
              +     +T+T SVDW++AFKRAY+ +S K  +TSQRG+C  C S+VWL N KCSNE   
Sbjct  182   RVTFTPGNTTTASVDWRDAFKRAYRGISRK--ITSQRGFCKQCNSIVWLSNSKCSNECFG  239

Query  838   HGGKNHSVKPLSVEQIVDYITSNTLPGsyssdsdledsdyeslFKLWAYPKRIAKS*AQL  1017
                  H + P+S++QIVDY+   ++P S  SDSD +DS   SLFKLWAYP R  +  A  
Sbjct  240   KISDEHQIMPVSIKQIVDYVIEESIP-SSDSDSDSDDSVDGSLFKLWAYPTRFGEPHAGC  298

Query  1018  G  1020
             G
Sbjct  299   G  299



>ref|XP_006366649.1| PREDICTED: F-box protein At5g52880-like [Solanum tuberosum]
Length=296

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 158/303 (52%), Positives = 209/303 (69%), Gaps = 18/303 (6%)
 Frame = +1

Query  109   SQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPE  288
             S   RY+ LGL+++LN+ Y Y I C+ELSLILRNAYSR+ KNLQSLIF D L AF LLPE
Sbjct  4     SMMERYQKLGLKESLNQPYRYPIACDELSLILRNAYSRIPKNLQSLIFQDSLAAFGLLPE  63

Query  289   MQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDV  468
             MQTQA+ISAA+ L+QS+EA LPKQK+ +A  EFK A++ H+RR K     +G   LP+DV
Sbjct  64    MQTQAAISAAHGLLQSMEAALPKQKKALAASEFKQAMVTHRRRRKVRPVLEGRSQLPEDV  123

Query  469   IAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSP-----LNSSNDVECS  633
             + H+F FLD+++L+ A+ VCRSWS AASDNHLWQ I+ +FFG S      +  +N VE  
Sbjct  124   LVHVFGFLDLKSLVTASSVCRSWSVAASDNHLWQSIHISFFGKSSDIPNIIRFTNGVERI  183

Query  634   RCTSAQNVQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNG  813
               T      D          +VDWK+AFKR Y+ +S+K  ++SQRG+C  C S+VWL N 
Sbjct  184   SFTPGNTAAD----------NVDWKDAFKRGYRGISNK--VSSQRGFCKQCNSIVWLSNS  231

Query  814   KCSNEHTSHGGKNHSVKPLSVEQIVDYITSNTLPGsyssdsdledsdyeslFKLWAYPKR  993
             KCSNE+       H + P+S+EQIVDY+   ++P S  SDSD +DS   S+FKLWAYP+R
Sbjct  232   KCSNEYDGKISDEHQIMPVSLEQIVDYVIEESIP-SSDSDSDSDDSVDGSVFKLWAYPRR  290

Query  994   IAK  1002
             +++
Sbjct  291   VSE  293



>ref|XP_009765574.1| PREDICTED: F-box protein At5g52880 [Nicotiana sylvestris]
Length=312

 Score =   295 bits (755),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 158/297 (53%), Positives = 204/297 (69%), Gaps = 12/297 (4%)
 Frame = +1

Query  115  TSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQ  294
              RY  LGL+++L+R YHY I C ELS ILRNAYS++ KNLQSLIF D   AFRLLP+MQ
Sbjct  6    VERYEKLGLKESLSRAYHYPIACEELSCILRNAYSKVPKNLQSLIFQDSFAAFRLLPQMQ  65

Query  295  TQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIA  474
            TQA+ISAAN L+ S+EA LPKQK+ +A  EFK A++A +RR K     +G   LPQDV+ 
Sbjct  66   TQAAISAANGLLHSIEAALPKQKKVLAASEFKQAMVAQRRRRKVQPMVEGRSQLPQDVLV  125

Query  475  HMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQN  654
            H+F FLD+ +L+ A+LVCRSWS AASDNHLWQ ++ NFFG  P ++ N +  +       
Sbjct  126  HIFGFLDLTSLITASLVCRSWSVAASDNHLWQSMHINFFG-RPSDNPNIIRLT-----YG  179

Query  655  VQDICREETSTST-SVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEH  831
            V+ I     +T+T SVDW++AFKRAY+ +S K  +TSQRG+C  C S+VWL N KCSNE 
Sbjct  180  VERITFTPGNTTTASVDWRDAFKRAYRGISRK--VTSQRGFCKQCNSIVWLSNSKCSNEC  237

Query  832  TSHGGKNHSVKPLSVEQIVDYITSNTLP---GsyssdsdledsdyeslFKLWAYPKR  993
                   H + P+S++QIVDY+   ++P       SDSD +DS   SLFKLWAYP R
Sbjct  238  FGKISDEHQIMPVSIKQIVDYVIEESIPSSDSDSDSDSDSDDSVDGSLFKLWAYPMR  294



>ref|XP_004234205.1| PREDICTED: F-box protein At5g52880 [Solanum lycopersicum]
Length=293

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 160/303 (53%), Positives = 208/303 (69%), Gaps = 21/303 (7%)
 Frame = +1

Query  109   SQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPE  288
             S   RY+ LGL+++LN+ Y Y I C+ELSLILRNAYS++ K LQSLIF + L AF LLPE
Sbjct  4     SMMERYQKLGLKESLNQPYRYPIACDELSLILRNAYSKIPKKLQSLIFRESLTAFGLLPE  63

Query  289   MQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDV  468
             MQTQA+ISAA+ L+QS+EA LPKQK+ +A  EFK A++ H+RR K     +G   LPQDV
Sbjct  64    MQTQAAISAAHGLLQSMEAALPKQKKALAASEFKQAMVTHRRRRKVQPVLEGRSQLPQDV  123

Query  469   IAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSP-----LNSSNDVECS  633
             + H+F FLD+++L+ A+ VCRSWS AASDNHLWQ I+ +FFG S      +  +N VE  
Sbjct  124   LVHIFGFLDLKSLVTASSVCRSWSVAASDNHLWQSIHISFFGKSNEIPNIIRFTNGVERI  183

Query  634   RCTSAQNVQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNG  813
               T      D          +VDWK+AFKRAY+ +S K  +TSQRG+C  C S+VWL+N 
Sbjct  184   SFTLGNTGAD----------NVDWKDAFKRAYRGISKK--VTSQRGFCKQCNSIVWLNNS  231

Query  814   KCSNEHTSHGGKNHSVKPLSVEQIVDYITSNTLPGsyssdsdledsdyeslFKLWAYPKR  993
             KCSN   S     H + P+S+EQIVDY+   ++P S  SDSD +DS   SLFKLWAYPKR
Sbjct  232   KCSNGEIS---DEHQIMPVSLEQIVDYVIEESIP-SSDSDSDSDDSVDGSLFKLWAYPKR  287

Query  994   IAK  1002
             +++
Sbjct  288   VSE  290



>emb|CAN77760.1| hypothetical protein VITISV_034908 [Vitis vinifera]
Length=299

 Score =   276 bits (707),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 153/297 (52%), Positives = 193/297 (65%), Gaps = 10/297 (3%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ LGLRD+L R Y Y  VC ELS ILR AY++L KNLQSL+F D L AFRLLP+MQTQ
Sbjct  7    RYQKLGLRDSLXRIYQYPFVCKELSFILRGAYNKLPKNLQSLVFQDTLAAFRLLPQMQTQ  66

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
            +++SAAN L+QS EA LPKQKR  A  EFKHA +A KRR+KA  EE+G  HLPQDV+ H+
Sbjct  67   SAVSAANLLLQSAEAVLPKQKRTQAVTEFKHAKVACKRRSKARQEEEGLAHLPQDVLVHI  126

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
            F FLD+Q+LL   L C SW+ AASDN LWQL Y   FG    NS +  +       + V+
Sbjct  127  FSFLDMQSLLSVGLACWSWNSAASDNCLWQLQYAICFG----NSEDISKMKGRRDGELVE  182

Query  661  D----ICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNE  828
            D      +E+ +T T VDW++AFKR YK   +K   TS RGYC  C ++VWL N KC   
Sbjct  183  DKEETXLKEDIATRTGVDWRDAFKRKYKGKRAKRX-TSNRGYCGVCHTIVWLSNMKCPKR  241

Query  829  HTSHGGKNHSVKPLSVEQIVDYITSNTLPGsyssdsdledsdyeslFKLWAYPKRIA  999
            H     +N  +KP+S +QIV+YI  ++L  + SSDSD +        KLW YP+ I 
Sbjct  242  HPGVKSENQQIKPVSPQQIVEYILDDSLSMTSSSDSDSDSEGGLLS-KLWTYPRYIG  297



>ref|XP_002275544.2| PREDICTED: F-box protein At5g52880 isoform X2 [Vitis vinifera]
 emb|CBI22607.3| unnamed protein product [Vitis vinifera]
Length=299

 Score =   276 bits (707),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 153/297 (52%), Positives = 193/297 (65%), Gaps = 10/297 (3%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ LGLRD+L R Y Y  VC ELS ILR AY++L KNLQSL+F D L AFRLLP+MQTQ
Sbjct  7    RYQKLGLRDSLPRIYQYPFVCKELSFILRGAYNKLPKNLQSLVFQDTLAAFRLLPQMQTQ  66

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
            +++SAAN L+QS EA LPKQKR  A  EFKHA +A KRR+KA  EE+G  HLPQDV+ H+
Sbjct  67   SAVSAANLLLQSAEAVLPKQKRTQAVTEFKHAKVACKRRSKARQEEEGLAHLPQDVLVHI  126

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
            F FLD+Q+LL   L C SW+ AASDN LWQL Y   FG    NS +  +       + V+
Sbjct  127  FSFLDMQSLLSVGLACWSWNSAASDNCLWQLQYAICFG----NSEDISKMKGRRDGELVE  182

Query  661  D----ICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNE  828
            D      +E+ +T T VDW++AFKR YK   +K   TS RGYC  C ++VWL N KC   
Sbjct  183  DKEETKLKEDIATRTGVDWRDAFKRKYKGKRAKR-FTSNRGYCGVCHTIVWLSNMKCPKR  241

Query  829  HTSHGGKNHSVKPLSVEQIVDYITSNTLPGsyssdsdledsdyeslFKLWAYPKRIA  999
            H     +N  +KP+S +QIV+YI  ++L  + SSDSD +        KLW YP+ I 
Sbjct  242  HPGVKSENQQIKPVSPQQIVEYILDDSLSMTSSSDSDSDSEGGLLS-KLWTYPRYIG  297



>gb|KHF99855.1| hypothetical protein F383_19059 [Gossypium arboreum]
Length=304

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/298 (49%), Positives = 192/298 (64%), Gaps = 3/298 (1%)
 Frame = +1

Query  109   SQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPE  288
             ++T RY+ L L ++L+R Y Y I C ELS ILR AY+ L K LQSL+F   L A RLLPE
Sbjct  3     NRTERYQKLCLEESLSRIYQYPIACKELSFILRGAYANLPKPLQSLVFQHTLTAIRLLPE  62

Query  289   MQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDV  468
             MQT ++++AA+ L+QS EA  PKQK+ +   EFK A +AHKRR+KA+ EE+GP  LPQDV
Sbjct  63    MQTSSAVAAAHFLLQSAEAAFPKQKKSLVVTEFKQAKVAHKRRSKAHREEKGPSQLPQDV  122

Query  469   IAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSA  648
             + H+F  LD+Q+L+ A LVCRSW+ AA+DNHLW+L YT FFG S  +S    + S   S 
Sbjct  123   LVHIFCLLDLQSLISAGLVCRSWTLAANDNHLWELQYTIFFGRSNNSSRTKTQWS-GKSV  181

Query  649   QNVQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNE  828
                     E   T T +DWK  FKRAYK   SK +++S RGYC YC ++VWL N KCSN 
Sbjct  182   NKDYTFWEENVITRTDIDWKETFKRAYKGTYSKKLMSS-RGYCGYCDTIVWLKNLKCSNR  240

Query  829   HTSHGGKNHSVKPLSVEQIVDYITSNTLPGsyssdsdledsdyeslFKLWAYPKRIAK  1002
                   +N  +KP+S  QIVDY+  +      SS     +SD E + +LWAYPK I +
Sbjct  241   QCDPKHENAQIKPISPHQIVDYLM-DGYTSMISSSDSDSESDEEPVSRLWAYPKDIRR  297



>ref|XP_010662654.1| PREDICTED: F-box protein At5g52880 isoform X1 [Vitis vinifera]
 ref|XP_010662655.1| PREDICTED: F-box protein At5g52880 isoform X1 [Vitis vinifera]
Length=305

 Score =   270 bits (690),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 153/303 (50%), Positives = 193/303 (64%), Gaps = 16/303 (5%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ LGLRD+L R Y Y  VC ELS ILR AY++L KNLQSL+F D L AFRLLP+MQTQ
Sbjct  7    RYQKLGLRDSLPRIYQYPFVCKELSFILRGAYNKLPKNLQSLVFQDTLAAFRLLPQMQTQ  66

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
            +++SAAN L+QS EA LPKQKR  A  EFKHA +A KRR+KA  EE+G  HLPQDV+ H+
Sbjct  67   SAVSAANLLLQSAEAVLPKQKRTQAVTEFKHAKVACKRRSKARQEEEGLAHLPQDVLVHI  126

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
            F FLD+Q+LL   L C SW+ AASDN LWQL Y   FG    NS +  +       + V+
Sbjct  127  FSFLDMQSLLSVGLACWSWNSAASDNCLWQLQYAICFG----NSEDISKMKGRRDGELVE  182

Query  661  D----ICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNE  828
            D      +E+ +T T VDW++AFKR YK   +K   TS RGYC  C ++VWL N KC   
Sbjct  183  DKEETKLKEDIATRTGVDWRDAFKRKYKGKRAKR-FTSNRGYCGVCHTIVWLSNMKCPKR  241

Query  829  HTSHGGKNHSVKPLSVEQ------IVDYITSNTLPGsyssdsdledsdyeslFKLWAYPK  990
            H     +N  +KP+S +Q      IV+YI  ++L  + SSDSD +        KLW YP+
Sbjct  242  HPGVKSENQQIKPVSPQQVIFVFVIVEYILDDSLSMTSSSDSDSDSEGGLLS-KLWTYPR  300

Query  991  RIA  999
             I 
Sbjct  301  YIG  303



>ref|XP_010261415.1| PREDICTED: F-box protein At5g52880 [Nelumbo nucifera]
 ref|XP_010261416.1| PREDICTED: F-box protein At5g52880 [Nelumbo nucifera]
Length=307

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/295 (48%), Positives = 195/295 (66%), Gaps = 7/295 (2%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ LGL+++LNR Y Y + CNELS ILR AYS++SKNLQ+L+F+  L AFR LPE+QT+
Sbjct  7    RYQKLGLKESLNRIYDYPLACNELSFILRGAYSKVSKNLQALMFEGTLAAFRRLPEVQTR  66

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
             ++SAAN L+Q+ E  LPKQK+ +A  EFKHA++AHKRR+K+  +E+G   LPQDV+ H+
Sbjct  67   QAVSAANLLLQAAEVALPKQKKVLAVAEFKHAVVAHKRRSKSRQDEEGTAQLPQDVLVHI  126

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
            F FLD+++L+   LVC SWS AASDN LW   Y  +FG S  N  ++ +       Q   
Sbjct  127  FSFLDMRSLVAVGLVCWSWSLAASDNRLWHSQYVLYFGNS--NGCSETKEHIAKPVQEKG  184

Query  661  DICREETSTS---TSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEH  831
            D    +  ++   T +DWK AFK AY   S +  + S RGYC +C S+VWL+N KCSN H
Sbjct  185  DTILHQKKSADPLTILDWKEAFKGAYIGNSIRRSM-SNRGYCWHCKSIVWLNNMKCSNMH  243

Query  832  TSHGGKNHSVKPLSVEQIVDYITSNTLPGsyssdsdledsdyeslFKLWAYPKRI  996
                 KN  +KP+S +QI+DYI  ++L    SSDS+ +  +     KLWAYPK I
Sbjct  244  HVLQQKNQKIKPVSPQQIIDYILEDSLSTISSSDSEGDSDEESLS-KLWAYPKHI  297



>ref|XP_011076080.1| PREDICTED: F-box protein At5g52880 [Sesamum indicum]
Length=286

 Score =   263 bits (673),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 140/293 (48%), Positives = 188/293 (64%), Gaps = 21/293 (7%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ L L+++L+  + Y + C ELS IL+NAYS+  KNLQSLIF D L AF LLPEMQTQ
Sbjct  15   RYQTLRLKESLSTPFQYILACKELSFILKNAYSKFPKNLQSLIFLDTLFAFSLLPEMQTQ  74

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
            ++ISAAN+L+QS E  LPKQKR  A  E K A++A KR+ KA  EE+G I LPQDV+ H+
Sbjct  75   SAISAANSLLQSAEFALPKQKRATAVTEHKQAVVASKRKIKAKQEEEGIIPLPQDVLIHI  134

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
            F FLD+Q+L+ A+ VCRSW+ AASD+HLW+ +Y  ++               C S     
Sbjct  135  FSFLDMQSLVSASAVCRSWNVAASDDHLWEFLYAIYY---------------CGSG----  175

Query  661  DICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTSH  840
            ++C    +T   +DW+ AFK AYK    +    S RGYCS CCSVVWL + +C+N+    
Sbjct  176  NVCPNGMATGVGIDWRCAFKIAYKGTCYR-KFKSYRGYCSSCCSVVWLSSNRCANKSNIK  234

Query  841  GGKNHSVKPLSVEQIVDYITSNTLPGsyssdsdledsdyeslFKLWAYPKRIA  999
             G NH +KP+S +QIV++I    L  S SS     D +  S+ KLWAYP++I 
Sbjct  235  DGSNHQIKPISRQQIVEFILDGFL-VSESSSDSDSDPEDVSMLKLWAYPRKIG  286



>ref|XP_009375557.1| PREDICTED: F-box protein At5g52880 [Pyrus x bretschneideri]
Length=293

 Score =   258 bits (659),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 136/262 (52%), Positives = 178/262 (68%), Gaps = 14/262 (5%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ L L+++L + + Y   C ELSLILR AY +  KNLQ+LIF D L AFRLLPEMQT+
Sbjct  7    RYQKLVLKESLPKIHRYPFACRELSLILRGAYKKFPKNLQALIFQDTLTAFRLLPEMQTR  66

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQ--GPIHLPQDVIA  474
             ++ AA+ L+QS EATLPKQK+ +A  E+K+A++AHKRR KA  EE+  G   LPQDV+ 
Sbjct  67   NAVLAAHLLLQSAEATLPKQKKNLAVAEYKNAMVAHKRRTKARQEEKVSGSTQLPQDVLV  126

Query  475  HMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSND-VECSRCTSAQ  651
            H+F FLD+Q+L    +VC SW+ AASDNHLW+  YT FFG    NS +D +  +R  S +
Sbjct  127  HIFGFLDMQSLASVGVVCWSWNIAASDNHLWETQYTTFFG----NSEDDKLIKARKISGR  182

Query  652  NVQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEH  831
             V+D   EE  T   + WK AFKRAY   SS+  L S RGYC  C ++VWLDN KCSNEH
Sbjct  183  QVED---EEGYT---LFWKEAFKRAYLGSSSR-KLKSGRGYCRDCNTIVWLDNRKCSNEH  235

Query  832  TSHGGKNHSVKPLSVEQIVDYI  897
                 +N  +KP+S  Q+V+Y+
Sbjct  236  RGQNSENQQIKPVSPNQVVEYL  257



>ref|XP_002513624.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49027.1| conserved hypothetical protein [Ricinus communis]
Length=302

 Score =   256 bits (654),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 143/299 (48%), Positives = 193/299 (65%), Gaps = 8/299 (3%)
 Frame = +1

Query  121   RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
             RY+ LG + A++R +HY I C +LSLIL  AY+ L KNLQS++F D L AFRLLP+MQT+
Sbjct  3     RYQKLGFKQAMSRIHHYPIACKDLSLILGEAYNELPKNLQSIVFQDTLSAFRLLPQMQTR  62

Query  301   ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
              ++SAA+ L+QS EA LPKQKR +A KEFKHA IAHKRR KA+ EE   I LPQDV+ H+
Sbjct  63    GAVSAAHLLLQSAEAVLPKQKRNLAVKEFKHAKIAHKRRCKAHHEEDSTIELPQDVLLHI  122

Query  481   FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
             F FLD+++L+   LVC SW+ AAS+N LW+  Y  FF   P  +S+ +   R +     +
Sbjct  123   FSFLDMKSLVSVELVCWSWNFAASNNQLWESQYAIFFSKKP--ASSKIRGLRNSRQDKDK  180

Query  661   D--ICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHT  834
             +  + +E T + TS+DWK AFKRAY   SSK  L S RGYC  C ++VWLDN KC N   
Sbjct  181   EFALLQENTVSRTSIDWKEAFKRAYVGNSSKR-LASNRGYCMQCETIVWLDNMKCCNGDH  239

Query  835   SHGGKNHSVKPLSVEQIVDYITSNTLPGsyssdsdledsdyeslF---KLWAYPKRIAK  1002
                  N  + P+S  Q+V+Y+ + +    YSS+SD +           +LWAYP+ I +
Sbjct  240   GLESGNQLIVPVSPLQVVEYLLNGSSSIIYSSESDSDSDSESDEGFIPRLWAYPRHIGR  298



>ref|XP_006422075.1| hypothetical protein CICLE_v10005526mg [Citrus clementina]
 gb|ESR35315.1| hypothetical protein CICLE_v10005526mg [Citrus clementina]
Length=298

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 174/264 (66%), Gaps = 9/264 (3%)
 Frame = +1

Query  115  TSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQ  294
            T RY+ LGL++AL R Y Y I C ELS I R AYS+L KN+QSLIF D L AFRLLPEMQ
Sbjct  5    TERYQKLGLKEALTRIYRYPIACKELSFIFRGAYSKLPKNVQSLIFQDSLAAFRLLPEMQ  64

Query  295  TQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIA  474
            T +++SAA+ L QS EA LPKQK+ +A  E+K A +A KR  KA  EEQG + LPQDV+ 
Sbjct  65   TSSAVSAAHLLFQSAEAVLPKQKKNLAITEYKQAKVALKRHRKARQEEQGSVQLPQDVLV  124

Query  475  HMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQN  654
            H+F+FLD+Q+L+    VC SW+ AASDNHLWQL Y  +F     NS N ++     S + 
Sbjct  125  HIFRFLDLQSLVSVGQVCWSWNLAASDNHLWQLQYAIYFS----NSDNCLKTKVQQSGRV  180

Query  655  VQD----ICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCS  822
            ++D    + ++  ++  SVDW+  FK AY   S K  LTS RG+C +C +VVWL+N KCS
Sbjct  181  IEDKMNTLLQDNMASQPSVDWRETFKGAYIGNSLK-KLTSNRGFCGHCNAVVWLNNLKCS  239

Query  823  NEHTSHGGKNHSVKPLSVEQIVDY  894
            NE      KN  +K LS  Q+V Y
Sbjct  240  NERCGLKFKNQQIKLLSPCQVVKY  263



>ref|XP_006490604.1| PREDICTED: F-box protein At5g52880-like [Citrus sinensis]
Length=298

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/264 (51%), Positives = 173/264 (66%), Gaps = 9/264 (3%)
 Frame = +1

Query  115  TSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQ  294
            T RY+ LGL++AL R Y Y I C ELS I R AYS+L KN+QS IF D L AFRLLPEMQ
Sbjct  5    TERYQKLGLKEALTRIYRYPIACKELSFIFRGAYSKLPKNVQSFIFQDSLAAFRLLPEMQ  64

Query  295  TQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIA  474
            T +++SAA+ L QS EA LPKQK+ +A  E+K A +A KR  KA  EEQG + LPQDV+ 
Sbjct  65   TSSAVSAAHLLFQSAEAVLPKQKKNLAITEYKQAKVALKRHCKARQEEQGSVQLPQDVLV  124

Query  475  HMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQN  654
            H+F+FLD+Q+L+    VC SW+ AASDNHLWQL Y  +F     NS N ++     S + 
Sbjct  125  HIFRFLDLQSLVSVGQVCWSWNLAASDNHLWQLQYAIYFS----NSDNCLKTKVQQSGRV  180

Query  655  VQD----ICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCS  822
            ++D    + ++  ++  SVDW+  FK AY   S K  LTS RG+C +C +VVWL+N KCS
Sbjct  181  IEDKMNTLLQDNMASQPSVDWRETFKVAYIGNSLK-KLTSNRGFCGHCNAVVWLNNLKCS  239

Query  823  NEHTSHGGKNHSVKPLSVEQIVDY  894
            NE      KN  +K LS  Q+V Y
Sbjct  240  NERCGLKFKNQQIKLLSPCQVVKY  263



>ref|NP_001276236.1| uncharacterized protein LOC100789652 [Glycine max]
 gb|ACU18198.1| unknown [Glycine max]
Length=286

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/294 (46%), Positives = 189/294 (64%), Gaps = 14/294 (5%)
 Frame = +1

Query  121   RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
             RY+ LGL ++L + Y Y I C ELS ILR A+ +  KNLQS++F D L AFRLLPE+QTQ
Sbjct  7     RYQKLGLSESLPKTYRYPIACRELSFILREAFHQFPKNLQSIVFQDTLSAFRLLPEIQTQ  66

Query  301   ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
             +++SA + L+QSVEA LPKQK+ +A  EFKHA++AHKRR KA+  E+G + LPQD++  +
Sbjct  67    SAVSAVHFLLQSVEAALPKQKKNVAVTEFKHAMVAHKRRCKAHQVEKGSLPLPQDILVLI  126

Query  481   FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
             F FLD+++L+   LVCRSW+ AA+DNHLW++ Y   FG            ++    +N  
Sbjct  127   FSFLDMKSLVSVGLVCRSWNIAANDNHLWEMQYVALFGGR----------AKLVEGKN-N  175

Query  661   DICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTSH  840
              +  E   T    DWK A K AY    S+ +LT+ RGYC +C SVVWL+N KC N H S 
Sbjct  176   RLLLEPIDTRIITDWKEAVKGAYTGALSR-ILTTSRGYCGHCKSVVWLNNSKCPNVH-SG  233

Query  841   GGKNHSVKPLSVEQIVDYITSNTLPGsyssdsdledsdyeslFKLWAYPKRIAK  1002
               +   +KP++  Q V+Y+  ++L    SS     DS+  ++F+LWAYPK I K
Sbjct  234   ISEIQDIKPVTAFQAVEYVLEDSL-SVTSSSDSDSDSEGGTVFRLWAYPKHIRK  286



>gb|KDO56846.1| hypothetical protein CISIN_1g022368mg [Citrus sinensis]
Length=298

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/264 (51%), Positives = 173/264 (66%), Gaps = 9/264 (3%)
 Frame = +1

Query  115  TSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQ  294
            T RY+ LGL++AL R Y Y I C ELS I R AYS+L KN+QSLIF D L AFRLLPEMQ
Sbjct  5    TERYQKLGLKEALTRIYRYPIACKELSFIFRGAYSKLPKNVQSLIFQDSLAAFRLLPEMQ  64

Query  295  TQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIA  474
            T +++SAA+ L QS EA LPKQK+ +A  E+K A +A KR  KA  EEQG + LPQDV+ 
Sbjct  65   TSSAVSAAHLLFQSAEAVLPKQKKNLAITEYKQAKVALKRHCKARQEEQGSVQLPQDVLV  124

Query  475  HMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQN  654
            H+F+FLD+Q+L+    +C SW+ AASDNHLWQL Y  +F     NS N ++     S + 
Sbjct  125  HIFRFLDLQSLVSVGQICWSWNLAASDNHLWQLQYAIYFS----NSDNCLKTKVQQSGRV  180

Query  655  VQD----ICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCS  822
            ++D    + ++  ++  SVDW   FK AY   S K  LTS RG+C +C +VVWL+N KCS
Sbjct  181  IEDKMNTLLQDNMASQPSVDWLETFKGAYIGNSLK-KLTSNRGFCGHCNAVVWLNNLKCS  239

Query  823  NEHTSHGGKNHSVKPLSVEQIVDY  894
            NE      KN  +K LS  Q+V Y
Sbjct  240  NERCGLKFKNQQIKLLSPCQVVKY  263



>ref|XP_008234813.1| PREDICTED: F-box protein At5g52880 isoform X2 [Prunus mume]
Length=290

 Score =   251 bits (641),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 135/259 (52%), Positives = 173/259 (67%), Gaps = 11/259 (4%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ LGL+++L R + Y + C ELSLILR AY ++ KNLQSLIF D L AFRLLP MQT+
Sbjct  7    RYQKLGLKESLPRIHRYPLACKELSLILRGAYKKIPKNLQSLIFQDTLTAFRLLPRMQTR  66

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
             ++ AA+ L+QSVEATLPKQK+  A  E+K+A++AHKRR KA  EE G   LPQDV+ H+
Sbjct  67   NAVLAAHLLLQSVEATLPKQKKNAAVTEYKNAMVAHKRRTKARQEENGSTQLPQDVLVHI  126

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
            F FLD+Q+L+   LVC  W+  AS+N+LW+  YT FFG    NS ND         + V+
Sbjct  127  FSFLDMQSLVSVGLVCWLWNITASENNLWRAQYTTFFG----NSDNDAMIKGRQIGRLVE  182

Query  661  DICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTSH  840
            D   EE  T   + W+ AFKRAY   SSK  L S RGYC  C ++VWLDN KCSNEHT  
Sbjct  183  D---EEGYT---LFWREAFKRAYLGSSSK-KLKSSRGYCRDCNTIVWLDNMKCSNEHTGL  235

Query  841  GGKNHSVKPLSVEQIVDYI  897
              +N  +KP+   Q+V Y+
Sbjct  236  NSENQQIKPVLPSQVVGYL  254



>ref|XP_004309171.1| PREDICTED: F-box protein At5g52880-like [Fragaria vesca subsp. 
vesca]
Length=299

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/259 (50%), Positives = 172/259 (66%), Gaps = 12/259 (5%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ L L++ L   + Y +VC ELSLILR AY ++ KNLQSLIF D L AFRLLPEM+T 
Sbjct  7    RYQKLALKECLGSIHRYPLVCKELSLILRGAYRKVPKNLQSLIFQDTLTAFRLLPEMKTG  66

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
            +++SAA+ L+QSVEATLPKQK+ +A  E+K+A++ HKRR KA+ +E+   HLPQDV+ H+
Sbjct  67   SAVSAAHLLLQSVEATLPKQKKNLAVAEYKNAMVVHKRRTKAH-QEENLAHLPQDVLVHV  125

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
            F FLD Q+L+   LVC SW+ AASDN LWQ  Y  FF     +S ND+      +++ VQ
Sbjct  126  FSFLDFQSLVSVGLVCWSWNFAASDNRLWQRQYATFFR----DSYNDLNIKEQHTSRQVQ  181

Query  661  DICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTSH  840
            D        S ++ W+ AFK AYK  SS   L S RGYC +C ++VWLDN KC NEH   
Sbjct  182  D-------KSDTLFWRKAFKIAYKGNSSSEKLKSSRGYCRHCKTIVWLDNMKCFNEHIGL  234

Query  841  GGKNHSVKPLSVEQIVDYI  897
              +   + P+   Q+VDY+
Sbjct  235  NTEIQKIDPVLPSQVVDYL  253



>gb|KHN21800.1| F-box protein [Glycine soja]
Length=286

 Score =   249 bits (635),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 136/294 (46%), Positives = 188/294 (64%), Gaps = 14/294 (5%)
 Frame = +1

Query  121   RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
             RY+ LGL ++L + Y Y I C ELS ILR A+ +  KNLQS++F D L AFRLLPE+QTQ
Sbjct  7     RYQKLGLSESLPKTYRYPIACRELSFILREAFHQFPKNLQSIVFQDTLSAFRLLPEIQTQ  66

Query  301   ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
             +++SA + L+QSVEA LPKQK+ +A  EFKHA++AHKRR KA+  E+G + LPQD++  +
Sbjct  67    SAVSAVHFLLQSVEAALPKQKKNVAVTEFKHAMVAHKRRCKAHQVEKGSLPLPQDILVLI  126

Query  481   FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
             F FLD+++L+   LVCRSW+ AA+DNHLW++ Y   FG            ++    +N  
Sbjct  127   FSFLDMKSLVSVGLVCRSWNIAANDNHLWEMQYVALFGGR----------AKLVEGKN-N  175

Query  661   DICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTSH  840
              +  E   T    DWK A K AY    S+ +LT+ RGYC +C SVVWL+N KC N H S 
Sbjct  176   RLLLEPIDTRIITDWKEAVKGAYTGALSR-ILTTSRGYCGHCKSVVWLNNSKCPNVH-SG  233

Query  841   GGKNHSVKPLSVEQIVDYITSNTLPGsyssdsdledsdyeslFKLWAYPKRIAK  1002
               +   +KP++  Q V+Y+  ++L  + SSDSD +        +LWAYPK I K
Sbjct  234   ISEIQDIKPVTAFQAVEYVLEDSLSVTSSSDSDSDSEGGTVS-RLWAYPKHIRK  286



>ref|XP_007218759.1| hypothetical protein PRUPE_ppa009435mg [Prunus persica]
 gb|EMJ19958.1| hypothetical protein PRUPE_ppa009435mg [Prunus persica]
Length=292

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/261 (51%), Positives = 171/261 (66%), Gaps = 13/261 (5%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ LGL+++L R + Y + C ELS ILR AY ++ KNLQSLIF D L AFRLLPEMQT+
Sbjct  7    RYQKLGLKESLPRIHRYPLACKELSFILRGAYKKIPKNLQSLIFQDTLTAFRLLPEMQTR  66

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQ--GPIHLPQDVIA  474
             ++ AA+ L+QSVEATLPKQK+  A  E+K+A++AHKRR KA  EE   G   LPQDV+ 
Sbjct  67   NAVLAAHLLLQSVEATLPKQKKNAAVTEYKNAMVAHKRRTKARQEENVSGSTQLPQDVLV  126

Query  475  HMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQN  654
            H+F FLD+Q+L+    VC  W+ AAS+N+LWQ  YT FFG    NS ND         + 
Sbjct  127  HIFSFLDMQSLVSVGRVCWLWNIAASENNLWQAQYTTFFG----NSDNDAMIKGRQIGRL  182

Query  655  VQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHT  834
            V+D          ++ W+ AFKRAY   SSK  L S RGYC  C ++VWLDN KCSNEHT
Sbjct  183  VED------EGGYTLFWREAFKRAYLGSSSK-KLKSSRGYCRDCNTIVWLDNMKCSNEHT  235

Query  835  SHGGKNHSVKPLSVEQIVDYI  897
                +N  +KP+   Q+V Y+
Sbjct  236  GLNSENQQIKPVLPSQVVGYL  256



>ref|XP_007143487.1| hypothetical protein PHAVU_007G076000g [Phaseolus vulgaris]
 gb|ESW15481.1| hypothetical protein PHAVU_007G076000g [Phaseolus vulgaris]
Length=290

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 178/263 (68%), Gaps = 8/263 (3%)
 Frame = +1

Query  109  SQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPE  288
            S   RY+ LGLRD+L ++Y Y I C ELS ILR A+ ++ K+LQS+IF D LLAFRLLPE
Sbjct  3    SALERYQKLGLRDSLPKYYRYPIACKELSFILREAFHQIPKSLQSIIFQDTLLAFRLLPE  62

Query  289  MQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDV  468
            ++T+ ++SAA  L+Q+VEATLP +K+ +A  EFKHA+++HKRR+KA+  E+G + LPQD+
Sbjct  63   IETKNAVSAAQFLLQNVEATLPNRKKNVAVTEFKHAMVSHKRRSKAHLVEKGSLQLPQDI  122

Query  469  IAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSA  648
            + H+F FLD+++L+ A LV RSW+ AA+DNHLWQ+ Y   F     ++   ++  +    
Sbjct  123  LVHVFSFLDMKSLVSAGLVSRSWNIAANDNHLWQMQYVVLF-----DNGAKLKHVKPVEG  177

Query  649  QNVQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNE  828
            +N + + +E        +WK + K AY    S  +LT+ RGYC +C SVVWL+N KC N 
Sbjct  178  KNYR-LLQETVDNRLITNWKESVKGAYTGALSS-ILTTNRGYCGHCKSVVWLNNVKCPNV  235

Query  829  HTSHGGKNHSVKPLSVEQIVDYI  897
            H S   K   +KP++  Q+V+Y+
Sbjct  236  H-SGISKIQDIKPVTAFQVVEYL  257



>ref|XP_008234812.1| PREDICTED: F-box protein At5g52880 isoform X1 [Prunus mume]
Length=292

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 135/261 (52%), Positives = 173/261 (66%), Gaps = 13/261 (5%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ LGL+++L R + Y + C ELSLILR AY ++ KNLQSLIF D L AFRLLP MQT+
Sbjct  7    RYQKLGLKESLPRIHRYPLACKELSLILRGAYKKIPKNLQSLIFQDTLTAFRLLPRMQTR  66

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQ--GPIHLPQDVIA  474
             ++ AA+ L+QSVEATLPKQK+  A  E+K+A++AHKRR KA  EE   G   LPQDV+ 
Sbjct  67   NAVLAAHLLLQSVEATLPKQKKNAAVTEYKNAMVAHKRRTKARQEENVSGSTQLPQDVLV  126

Query  475  HMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQN  654
            H+F FLD+Q+L+   LVC  W+  AS+N+LW+  YT FFG    NS ND         + 
Sbjct  127  HIFSFLDMQSLVSVGLVCWLWNITASENNLWRAQYTTFFG----NSDNDAMIKGRQIGRL  182

Query  655  VQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHT  834
            V+D   EE  T   + W+ AFKRAY   SSK  L S RGYC  C ++VWLDN KCSNEHT
Sbjct  183  VED---EEGYT---LFWREAFKRAYLGSSSK-KLKSSRGYCRDCNTIVWLDNMKCSNEHT  235

Query  835  SHGGKNHSVKPLSVEQIVDYI  897
                +N  +KP+   Q+V Y+
Sbjct  236  GLNSENQQIKPVLPSQVVGYL  256



>emb|CDP05123.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   245 bits (625),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 138/293 (47%), Positives = 182/293 (62%), Gaps = 24/293 (8%)
 Frame = +1

Query  118  SRYRWLGLRDALNRHY--HYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEM  291
             RY  L L ++L       Y + C EL+ ILR AYS+  KNLQSL+F D L AFRLLP++
Sbjct  6    GRYEELKLHESLTNQSCSRYPLACKELAFILRKAYSKAPKNLQSLLFQDTLDAFRLLPQV  65

Query  292  QTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVI  471
            Q+Q +ISAAN L+Q+ E+TLPKQK+ +A  EFKHAI++ KRR KA  EE+GP   P+D++
Sbjct  66   QSQNAISAANLLLQNAESTLPKQKKVLAVTEFKHAIVSSKRRNKAQQEEEGPCQFPEDIL  125

Query  472  AHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQ  651
             H+F +LD+Q+L+ AA+VCRSWS AA DNHLW+ +Y NFFG S           + T   
Sbjct  126  IHVFSYLDLQSLVSAAMVCRSWSSAAGDNHLWESLYVNFFGGS----------DKYTDTV  175

Query  652  NVQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEH  831
               DIC  E            FKR Y+++SSK V    RGYC +C S+VWL + +C N H
Sbjct  176  TGSDICIREN-----------FKRVYQEVSSKKV-APYRGYCWHCSSIVWLTDTRCYNTH  223

Query  832  TSHGGKNHSVKPLSVEQIVDYITSNTLPGsyssdsdledsdyeslFKLWAYPK  990
                  N  V P+S+ QIVDY+  ++LP   SSDS   D D   + K+WAY K
Sbjct  224  IGRDCTNPKVIPVSMAQIVDYVLYDSLPSESSSDSSDSDIDDLCVLKMWAYAK  276



>ref|XP_010105715.1| F-box protein [Morus notabilis]
 gb|EXC05935.1| F-box protein [Morus notabilis]
Length=294

 Score =   245 bits (625),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 125/266 (47%), Positives = 173/266 (65%), Gaps = 14/266 (5%)
 Frame = +1

Query  115  TSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQ  294
              RY+ LG +++  + + Y + C EL  ILR AY+   KNLQ+LI  D + AFRLLP MQ
Sbjct  5    VERYQKLGFKESFVKIHRYPLACKELGFILRAAYTEFPKNLQALIVQDTITAFRLLPGMQ  64

Query  295  TQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIA  474
            T++++S A+ L+QS EA+LPKQK+ +   EFK A++AHKRR KA  EE+G  HLPQD++ 
Sbjct  65   TRSAVSGAHVLLQSAEASLPKQKKNLVVAEFKQAMVAHKRRCKARKEEKGSAHLPQDILV  124

Query  475  HMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQN  654
            H+F FLD+Q+L+ A LVC SW+ AASDN LW   Y   FG    NS N+++ S    ++ 
Sbjct  125  HVFSFLDMQSLVSAELVCWSWNLAASDNQLWHAQYAMLFG----NSDNNLKISGSQRSKE  180

Query  655  VQD----ICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCS  822
            +        REE    TS+DWK AFKR  +   SK +  S RGYC  C ++VW+DN KCS
Sbjct  181  IGSNEYVSLREEVVIGTSIDWKEAFKRECRGTLSKKLRYS-RGYCENCKTIVWVDNLKCS  239

Query  823  NEHTSHGGKNHS-VKPLSVEQIVDYI  897
            NEH     ++HS VKP++  ++V+YI
Sbjct  240  NEHC----RSHSEVKPVTASEVVEYI  261



>ref|XP_004496509.1| PREDICTED: F-box protein At5g52880-like [Cicer arietinum]
Length=294

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/292 (44%), Positives = 193/292 (66%), Gaps = 8/292 (3%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ L + D+L+++Y Y I C ELS ILR A+++  K LQS++F D L AFRLLP+MQTQ
Sbjct  8    RYQKLAITDSLSKNYRYPIACKELSFILREAFNQFPKILQSIVFQDTLSAFRLLPQMQTQ  67

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
            +++SA + L+QSVEA LPKQKR +A  EFK A++AHKRR+KA+  ++G + +PQD++ H+
Sbjct  68   SAVSAVHLLLQSVEAALPKQKRNMAVTEFKQAMVAHKRRSKAHQVQKGSLQMPQDILIHV  127

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
            F FLD+Q+L+ A +VC SW+ AA+DN LW+L Y   +     + ++  +  R    +N  
Sbjct  128  FSFLDMQSLVSAGIVCWSWNMAANDNRLWELQYVVLY-----SGADKQQPMRLDEDRN-N  181

Query  661  DICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTSH  840
            ++ ++   T T  DWK A K AY    SK  LT+ RGYC +C ++VWL+N KC N H   
Sbjct  182  NLLQKPVDTRTVTDWKEAVKGAYTGALSK-KLTTNRGYCEHCKAIVWLNNSKCLNVHGRM  240

Query  841  GGKNHSVKPLSVEQIVDYITSNTLPGsyssdsdledsdyeslFKLWAYPKRI  996
              + H +KP++  Q+V+Y+  ++L  + SSDSD +        +LWAYPK +
Sbjct  241  ISEIHDIKPVTSFQVVEYLLDDSLSITSSSDSDSDSEGGSVS-RLWAYPKHL  291



>gb|KDP22200.1| hypothetical protein JCGZ_26031 [Jatropha curcas]
Length=300

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/294 (45%), Positives = 188/294 (64%), Gaps = 7/294 (2%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ L  ++AL+  +HY I C +LSLI+R AY++L KNLQ ++F D L AFRLLP MQT+
Sbjct  7    RYQKLAFKEALSTTHHYPIACKDLSLIIRQAYNKLPKNLQFVLFQDTLAAFRLLPGMQTR  66

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
             ++SAA+ L+QS EA  PKQ++ +A  EFKHA +AHKRR KA+ EE+    LPQDV+ H+
Sbjct  67   NAVSAAHLLLQSAEAVFPKQRKNLAVAEFKHAKVAHKRRHKAHQEEESTTELPQDVLLHI  126

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
            F FLDI +L+  +LVC SW+ AA +N LWQ  Y  FFG+   +SS   + +         
Sbjct  127  FSFLDIHSLVSVSLVCWSWNFAAGNNQLWQSQYATFFGSKRGSSSTREQQNDRREKNKEL  186

Query  661  DICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTSH  840
             + ++   T+TS+DW+ AFK  Y   SSK  LT+ RGYC  C ++VWLD  KC N  +  
Sbjct  187  TLLQKNKITTTSIDWREAFKEMYIGNSSKR-LTANRGYCGQCETIVWLDAMKCCNGDSG-  244

Query  841  GGKNHSVKPLSVEQIVDYITSNTLPGsyssdsdledsdyeslF--KLWAYPKRI  996
               N  + P+S  Q+V+Y+ + +     SSDS+  DS+ +  +  +LWAYPK I
Sbjct  245  ---NQRIIPVSSHQVVEYLLNGSSSIMSSSDSEDSDSEPDEGYIPRLWAYPKNI  295



>ref|XP_002318351.1| hypothetical protein POPTR_0012s00990g [Populus trichocarpa]
 gb|EEE96571.1| hypothetical protein POPTR_0012s00990g [Populus trichocarpa]
Length=294

 Score =   240 bits (613),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 131/263 (50%), Positives = 173/263 (66%), Gaps = 12/263 (5%)
 Frame = +1

Query  112  QTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEM  291
            Q  RY+ LG ++AL R +HY + C ELSLILR AYS+L KNLQSL+F D L +F+LLP+M
Sbjct  4    QVERYQILGYKEALTRTHHYPVACKELSLILREAYSKLPKNLQSLVFQDTLSSFKLLPQM  63

Query  292  QTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVI  471
             T  ++SAA+ LVQS EATLPKQK+ +ATKEFK A++A KRR KA   ++    L QDV+
Sbjct  64   WTNNAVSAAHLLVQSAEATLPKQKKNVATKEFKQAMVASKRRGKACRMQECHTELTQDVL  123

Query  472  AHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQ  651
              +F  LD ++L+ A+LV RSW+ AA +NHLWQ +Y   F  S  NSSN         A+
Sbjct  124  VDIFSLLDTRSLVSASLVSRSWNAAACNNHLWQSLYATIFA-SDHNSSN---------AK  173

Query  652  NVQDICR-EETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNE  828
            ++ +  R E+   + SVDW+ AFKRAY D SSK  LT+ RGYC YC  +VWLD  KC + 
Sbjct  174  DLLNGRRGEDNKDNNSVDWREAFKRAYIDNSSKR-LTTSRGYCLYCDMIVWLDGLKCGSG  232

Query  829  HTSHGGKNHSVKPLSVEQIVDYI  897
                  K   + P S EQ+V+Y+
Sbjct  233  KCGPQPKMQPIVPKSSEQVVEYL  255



>ref|XP_011003672.1| PREDICTED: F-box protein At5g52880 [Populus euphratica]
Length=294

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 173/263 (66%), Gaps = 12/263 (5%)
 Frame = +1

Query  112  QTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEM  291
            Q  RY+ LG ++AL R +HY + C ELSLILR AY++L KNLQSL+F D L +F+LLP+M
Sbjct  4    QVERYQILGYKEALTRTHHYPVACKELSLILREAYNKLPKNLQSLVFQDTLSSFKLLPQM  63

Query  292  QTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVI  471
             T  ++SAA+ LVQS EATLPKQK+ +ATKEFK A++A KRR KA   ++    L QDV+
Sbjct  64   WTNNAVSAAHLLVQSAEATLPKQKKNVATKEFKQAMVASKRRGKACRMQECHTELTQDVL  123

Query  472  AHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQ  651
              +F  LD ++L+ A+LV RSW+ AA +NHLWQ +Y   F  S  NSSN         A+
Sbjct  124  VDIFSLLDTRSLVSASLVSRSWNAAACNNHLWQSLYATIFA-SDHNSSN---------AK  173

Query  652  NVQDICR-EETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNE  828
            ++ +  R E+   + SVDW+ AFKRAY D SSK  LT+ RGYC YC  +VWLD  KC + 
Sbjct  174  DLLNGRRGEDNKDNNSVDWREAFKRAYIDNSSKR-LTNSRGYCLYCDMIVWLDGLKCGSG  232

Query  829  HTSHGGKNHSVKPLSVEQIVDYI  897
                  K   + P S EQ+V+Y+
Sbjct  233  KCGPQPKMQPIVPKSSEQVVEYL  255



>gb|EYU25171.1| hypothetical protein MIMGU_mgv1a010888mg [Erythranthe guttata]
Length=298

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/294 (43%), Positives = 187/294 (64%), Gaps = 14/294 (5%)
 Frame = +1

Query  124  YRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQA  303
            YR L ++++L++ + Y + C ELS +L+N YS+  K LQSL+F D + AF LLPEM TQ+
Sbjct  16   YRILKVKESLSKPFQYVLACKELSFLLKNGYSQFPKYLQSLLFHDTVFAFTLLPEMPTQS  75

Query  304  SISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHMF  483
            +ISAAN+L+QS E  LPKQKR IA KE+KHAI+A KR+++ N  ++     PQDV+ H+F
Sbjct  76   AISAANSLLQSAEYALPKQKRAIAVKEYKHAIVASKRKSRTNQHDEDLTLPPQDVLVHIF  135

Query  484  QFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQD  663
             FLD+Q+L  A+ VCRSW+ AA +NHLW+ +Y  +F      S++DV     T    V++
Sbjct  136  SFLDVQSLASASEVCRSWNSAACENHLWKSLYVIYF------SNSDV----VTKGGGVKN  185

Query  664  --ICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTS  837
              + + E ++   +DW+ AFK +YK+ + +    S RG C  C S+VW+ + +C N+   
Sbjct  186  HRVTKNEDNSGIGIDWRRAFKSSYKE-TCRRKFKSHRGCCYRCRSIVWISSNQCCNKLDL  244

Query  838  HGGKNHSVKPLSVEQIVDYITSNTLPGsyssdsdledsdyeslFKLWAYPKRIA  999
              G  H +K LS  QIVDYI    +P   SS     D + +S  KLWA+P++I+
Sbjct  245  KDGSRHQIKLLSAPQIVDYIFGG-MPVQESSSDSDSDIEDDSFLKLWAFPRQIS  297



>ref|XP_010917001.1| PREDICTED: F-box protein At5g52880 [Elaeis guineensis]
Length=310

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 137/318 (43%), Positives = 191/318 (60%), Gaps = 23/318 (7%)
 Frame = +1

Query  97    MEELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFR  276
             M   + + RY  LGL +AL+R Y Y   C EL LILR AY +LSK LQS++F D L AFR
Sbjct  1     MGGATPSERYEELGLAEALSRPYDYPTACRELGLILRLAYGKLSKGLQSIVFRDTLSAFR  60

Query  277   LLPEMQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHL  456
             LLP++QT   IS+AN L+Q+ E  LPKQK+ +A  EFKHA++AHKRR++A+ E+ G + L
Sbjct  61    LLPQVQTGNGISSANILLQAAEVVLPKQKKALAVSEFKHAVVAHKRRSRAH-EDGGSMQL  119

Query  457   PQDVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSR  636
             P DV+ H+F FLD+++L+ A+ VC +W+ AASD  LWQL Y+  FG        DV C +
Sbjct  120   PHDVLVHIFSFLDMRSLVTASSVCWAWNSAASDGTLWQLQYSLLFG------EYDVSCLQ  173

Query  637   CTSAQNVQDI-------CREETSTS-TSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCS  792
                   V+D+       C + T  + T+++WK A++R Y   SS L  TS R  C  C S
Sbjct  174   TGKLVQVKDVVFHQGIECVDATFYAMTNLNWKEAYRRKYLGNSS-LRFTSNRASCVRCKS  232

Query  793   VVWLDNGKCSNEHTSHGGKNHSVK--PLSVEQIVDYITSNT-----LPGsyssdsdleds  951
             ++WL N  C+  H  H  KN  VK  P+S  ++V+Y+   T        S  SD+D   +
Sbjct  233   IIWLSNMTCARSHHCHKLKNQRVKIRPVSPNKVVNYLLGETELTMSSSESDDSDTDELSN  292

Query  952   dyeslFKLWAYPKRIAKS  1005
               + L KLWAYP+  + S
Sbjct  293   HGQRLMKLWAYPRLTSTS  310



>ref|XP_010671576.1| PREDICTED: F-box protein At5g52880 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=299

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/270 (44%), Positives = 170/270 (63%), Gaps = 15/270 (6%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            +Y  L LRD+ +  Y Y + C EL LILR AYSR  K+LQSL+ +D + AFR+LP+MQT+
Sbjct  7    KYENLRLRDSFSLSYRYPMACRELGLILRLAYSRFPKSLQSLLLEDTIAAFRILPQMQTE  66

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGP---IHLPQDVI  471
             ++SAAN L Q+ EA LPKQKR +A  EFK+A +A+KRRAK    EQ     + +PQDV+
Sbjct  67   GAVSAANFLSQNAEAALPKQKRGLAATEFKNAKVAYKRRAKRPTPEQEDRDFVQIPQDVL  126

Query  472  AHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQ  651
             H+F FLD+Q+L+ A +VC SW+ AA D +LW+  Y  +FG    +S + ++        
Sbjct  127  VHVFSFLDMQSLISAGMVCWSWNTAADDKYLWKYHYNTYFG----DSDSIMKLEELQGHN  182

Query  652  NVQDICREETSTSTSVD-----WKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGK  816
            N QD  R++T+++   D     WK+ F+RAY  + S       RGYC +C S+VWLDN +
Sbjct  183  NAQD--RQQTASNGVCDDVNYEWKDGFRRAYLGLPS-WRYKYNRGYCGHCNSIVWLDNLR  239

Query  817  CSNEHTSHGGKNHSVKPLSVEQIVDYITSN  906
            C N+H+    +N  + P+S  QIV YI  +
Sbjct  240  CPNKHSRQESRNQQLMPVSPNQIVGYIIDD  269



>ref|XP_010035180.1| PREDICTED: F-box protein At5g52880 [Eucalyptus grandis]
 gb|KCW46477.1| hypothetical protein EUGRSUZ_K00302 [Eucalyptus grandis]
Length=305

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 134/293 (46%), Positives = 179/293 (61%), Gaps = 11/293 (4%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RYR LGLR +L   + Y I C ELS ILR AY  L KNL+S++ DD L AFRLLPEM+TQ
Sbjct  17   RYRKLGLRGSLATVHRYPIACKELSFILRAAYHELPKNLKSVVLDDALAAFRLLPEMKTQ  76

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
            +++S+A  L Q+ +A LPKQK+ +   EFKHA IAHK++ K   E+     LPQDV+ H+
Sbjct  77   SAVSSATMLAQAADAALPKQKKNMVLTEFKHAKIAHKKQRKTRQEDIDSSQLPQDVLLHI  136

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
            F FLD  +L+ A LVC SW+ AASDN LWQ  YT  F  +  NS         +   + Q
Sbjct  137  FSFLDFPSLIAAMLVCWSWNYAASDNSLWQTYYTRVFPRAD-NSLKIKHQQNRSLFDDEQ  195

Query  661  DICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTSH  840
            D    E +    +DW+ AFKR Y   S + ++   RGYC +C ++VWL+   CSN    H
Sbjct  196  DTPTPEETAMPYIDWREAFKRLYIANSRRKIIFD-RGYCRHCKTIVWLNGINCSN----H  250

Query  841  GG---KNHSVKPLSVEQIVDYITSNTLPGsyssdsdledsdyeslFKLWAYPK  990
            GG    N+ +KP+S +Q+VDY+  +    S  SD    DSD +S+ +LWAYPK
Sbjct  251  GGAKSSNNEIKPVSPQQVVDYLLGDFC--SSDSDDGDSDSDDQSVSRLWAYPK  301



>ref|XP_010671577.1| PREDICTED: F-box protein At5g52880 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=284

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/271 (43%), Positives = 169/271 (62%), Gaps = 15/271 (6%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            +Y  L LRD+ +  Y Y + C EL LILR AYSR  K+LQSL+ +D + AFR+LP+MQT+
Sbjct  7    KYENLRLRDSFSLSYRYPMACRELGLILRLAYSRFPKSLQSLLLEDTIAAFRILPQMQTE  66

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGP---IHLPQDVI  471
             ++SAAN L Q+ EA LPKQKR +A  EFK+A +A+KRRAK    EQ     + +PQDV+
Sbjct  67   GAVSAANFLSQNAEAALPKQKRGLAATEFKNAKVAYKRRAKRPTPEQEDRDFVQIPQDVL  126

Query  472  AHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQ  651
             H+F FLD+Q+L+ A +VC SW+ AA D +LW+  Y  +FG    +S + ++        
Sbjct  127  VHVFSFLDMQSLISAGMVCWSWNTAADDKYLWKYHYNTYFG----DSDSIMKLEELQGHN  182

Query  652  NVQDICREETSTSTSVD-----WKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGK  816
            N QD  R++T+++   D     WK+ F+RAY  + S       RGYC +C S+VWLDN +
Sbjct  183  NAQD--RQQTASNGVCDDVNYEWKDGFRRAYLGLPS-WRYKYNRGYCGHCNSIVWLDNLR  239

Query  817  CSNEHTSHGGKNHSVKPLSVEQIVDYITSNT  909
            C N+H+    +N  + P+S  Q+   I + T
Sbjct  240  CPNKHSRQESRNQQLMPVSPNQVAIVIANQT  270



>ref|XP_008810934.1| PREDICTED: F-box protein At5g52880 [Phoenix dactylifera]
Length=307

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 134/314 (43%), Positives = 187/314 (60%), Gaps = 18/314 (6%)
 Frame = +1

Query  97    MEELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFR  276
             M   + + RY  LGL +AL+R Y Y   C EL LILR AY++L K LQSL+F D L AFR
Sbjct  1     MGRATASERYEELGLAEALSRPYDYPTACRELGLILRLAYAKLPKGLQSLVFRDTLSAFR  60

Query  277   LLPEMQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHL  456
              LP++QT   IS+AN L+Q+ E  LPKQK+ +A  EFKHA +AHKR ++A+ E+ G + L
Sbjct  61    RLPQVQTGYGISSANILLQAAEVVLPKQKKALAVSEFKHAAVAHKRHSRAH-EDGGSMQL  119

Query  457   PQDVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFG---TSPLNSSNDVE  627
             P DV+ H+F FLD+++L+ A+ VC +W+ AASD+ LWQL Y+  FG    S L +   V+
Sbjct  120   PHDVLVHIFSFLDMRSLVTASSVCWAWNSAASDDTLWQLQYSLLFGEYDISRLRTGKLVQ  179

Query  628   CSRCTSAQNVQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLD  807
                    Q +     E     T+++WK A++R Y   SS L  TS R  C +C S++WL 
Sbjct  180   VKDMVFHQGI-----ERVDAMTNLNWKEAYRRKYIGNSS-LRFTSNRALCVHCDSIIWLS  233

Query  808   NGKCSNEHTSHGGKNHSVK--PLSVEQIVDYITSNT------LPGsyssdsdledsdyes  963
             +  C+  H  H  +N  VK  PLS  ++V+Y+   T         S SSD+D   +  + 
Sbjct  234   HMTCARPHHCHKLENQRVKIRPLSPNKVVNYLVGETELTLSSSDESDSSDTDELSNHGQR  293

Query  964   lFKLWAYPKRIAKS  1005
             L KLWAYPK  + S
Sbjct  294   LLKLWAYPKLTSTS  307



>ref|XP_006842929.1| hypothetical protein AMTR_s00075p00154970 [Amborella trichopoda]
 gb|ERN04604.1| hypothetical protein AMTR_s00075p00154970 [Amborella trichopoda]
Length=312

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 135/307 (44%), Positives = 178/307 (58%), Gaps = 26/307 (8%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ L LR AL+R Y Y   C EL+ ILR  Y+   KNLQ+L+F D LLAF+LLPE+QT 
Sbjct  4    RYQKLELRKALSRRYDYPSACKELAFILRGLYTNAPKNLQALMFQDTLLAFQLLPEVQTS  63

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
               SAAN L+Q+ EATLPKQKR +A  EFKHAI+++KR  K   ++     LPQDV+ H+
Sbjct  64   WGTSAANLLLQAAEATLPKQKRAMAVSEFKHAIVSYKRHCKTRQDKHDATQLPQDVLIHI  123

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
            F FLD ++L+ A LVC  W+ AASDN LW+  YT  F        ND+E   C      Q
Sbjct  124  FSFLDGRSLVSAGLVCWLWNSAASDNKLWRSQYTRLF--------NDIEL-YCAEEGKRQ  174

Query  661  DICREETS----------TSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDN  810
            D   E+ +          +S ++ WK AF+  Y   SS+    S RGYC  C SV+WL++
Sbjct  175  DPNSEKPTNTFKEEKNVDSSANISWKEAFRSKYVGKSSR-SFASNRGYCCNCRSVIWLND  233

Query  811  GKCSNEH--TSHGGKNHSVKPLSVEQIVDYITSNTLPGs----yssdsdledsdyeslFK  972
             KCSN H  +  G     VKP+S  ++V ++  +T  G+      SDSD      + L K
Sbjct  234  MKCSNLHGISKDGDAQWKVKPISPSEVVQFLLGDTHSGTSSSDSDSDSDEALLVQQMLPK  293

Query  973  LWAYPKR  993
            LWAYP R
Sbjct  294  LWAYPTR  300



>ref|XP_008437544.1| PREDICTED: F-box protein At5g52880 isoform X1 [Cucumis melo]
Length=291

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/264 (47%), Positives = 170/264 (64%), Gaps = 14/264 (5%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY  L L D+L + Y Y + C ELS ++R A+ +L KNLQSLI+  I+ AF LLPEMQT 
Sbjct  7    RYHKLSLIDSLGKSYSYPLACKELSFLIRGAFIKLPKNLQSLIYQHIITAFHLLPEMQTS  66

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
            ++ SAA  L Q+VEA LPKQKR     E+K A++ HKRR+KA+ EE+G   LPQDV+ H+
Sbjct  67   SAASAARLLAQAVEAALPKQKRNSVIVEYKKAMVVHKRRSKAHQEEKGSCQLPQDVLLHI  126

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
            F+FLD+Q+L  A LVCRSW+ AA D +LWQL YT FFG  P ++S  +         N +
Sbjct  127  FRFLDVQSLGSAGLVCRSWNVAADDEYLWQLQYTTFFGC-PDDNSKPI---------NDK  176

Query  661  DICREETSTSTS-VDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTS  837
            D   +  S+ST  VDWK  FK+AY   S     T  RGYC +C ++V     +C+N+H  
Sbjct  177  DSEDDFASSSTPHVDWKEEFKKAYVGNSLGRN-TCGRGYCKHCDTIVSFSTLRCTNDHGR  235

Query  838  HGGKNHSVKPLSVEQIVDYITSNT  909
            +  KN  +KPLS+ Q+V+Y+ + +
Sbjct  236  N--KNKQIKPLSINQVVEYVLNGS  257



>ref|XP_008437545.1| PREDICTED: F-box protein At5g52880 isoform X2 [Cucumis melo]
Length=257

 Score =   218 bits (556),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 126/264 (48%), Positives = 167/264 (63%), Gaps = 14/264 (5%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY  L L D+L + Y Y + C ELS ++R A+ +L KNLQSLI+  I+ AF LLPEMQT 
Sbjct  7    RYHKLSLIDSLGKSYSYPLACKELSFLIRGAFIKLPKNLQSLIYQHIITAFHLLPEMQTS  66

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
            ++ SAA  L Q+VEA LPKQKR     E+K A++ HKRR+KA+ EE+G   LPQDV+ H+
Sbjct  67   SAASAARLLAQAVEAALPKQKRNSVIVEYKKAMVVHKRRSKAHQEEKGSCQLPQDVLLHI  126

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
            F+FLD+Q+L  A LVCRSW+ AA D +LWQL YT FFG  P ++S  +         N +
Sbjct  127  FRFLDVQSLGSAGLVCRSWNVAADDEYLWQLQYTTFFGC-PDDNSKPI---------NDK  176

Query  661  DICREETSTSTS-VDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTS  837
            D   +  S+ST  VDWK  FK+AY   S     T  RGYC +C ++V     +C+N+H  
Sbjct  177  DSEDDFASSSTPHVDWKEEFKKAYVGNSLGRN-TCGRGYCKHCDTIVSFSTLRCTNDHGR  235

Query  838  HGGKNHSVKPLSVEQIVDYITSNT  909
            +  KN  +KPLS+ QIV  I   T
Sbjct  236  N--KNKQIKPLSINQIVKLIQMKT  257



>ref|XP_004145977.1| PREDICTED: F-box protein At5g52880-like [Cucumis sativus]
 ref|XP_004160402.1| PREDICTED: F-box protein At5g52880-like [Cucumis sativus]
 gb|KGN49912.1| hypothetical protein Csa_5G139890 [Cucumis sativus]
Length=291

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/298 (44%), Positives = 180/298 (60%), Gaps = 19/298 (6%)
 Frame = +1

Query  121   RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
             RY  L L D L + Y Y + C ELS ++R A+ +L KNLQSLI++ I+ AF LLPEMQT 
Sbjct  7     RYHKLCLMDFLAKSYSYPLACKELSFLIRGAFIKLPKNLQSLIYEHIITAFHLLPEMQTS  66

Query  301   ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
             ++ SAA  L ++VEA LPKQKR     EFK A++ HKRR KA+ EE+G   LPQDV+ H+
Sbjct  67    SAASAARLLARAVEAALPKQKRNSVIVEFKKAMVVHKRRTKAHQEEKGSCQLPQDVLLHI  126

Query  481   FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
             F+F+D+Q+L+ A LVCRSW+ AA D +LWQL YT FF  S  NS            +++ 
Sbjct  127   FRFIDVQSLVSAGLVCRSWNVAAEDEYLWQLQYTTFFVCSDDNS------------KSIN  174

Query  661   DICREE---TSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEH  831
             D   E+   +S++  VDWK  FK+AY   S     T  RGYC +C ++V     +C N+H
Sbjct  175   DKDSEDGFASSSTPRVDWKEEFKKAYVGNSLGRN-TYGRGYCKHCDTIVSFSTLRCPNDH  233

Query  832   TSHGGKNHSVKPLSVEQIVDYITSNTLPGsyssdsdledsdyeslFKLWAYPKRIAKS  1005
               +  KN  +KPLS+ Q+V+Y+  N       S     DSD + + + WA PK +  S
Sbjct  234   GRN--KNTQIKPLSINQVVEYVL-NGASELIYSSDSETDSDEDVISEFWALPKYLGSS  288



>ref|XP_006422076.1| hypothetical protein CICLE_v10005526mg [Citrus clementina]
 gb|ESR35316.1| hypothetical protein CICLE_v10005526mg [Citrus clementina]
Length=212

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 141/209 (67%), Gaps = 8/209 (4%)
 Frame = +1

Query  115  TSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQ  294
            T RY+ LGL++AL R Y Y I C ELS I R AYS+L KN+QSLIF D L AFRLLPEMQ
Sbjct  5    TERYQKLGLKEALTRIYRYPIACKELSFIFRGAYSKLPKNVQSLIFQDSLAAFRLLPEMQ  64

Query  295  TQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIA  474
            T +++SAA+ L QS EA LPKQK+ +A  E+K A +A KR  KA  EEQG + LPQDV+ 
Sbjct  65   TSSAVSAAHLLFQSAEAVLPKQKKNLAITEYKQAKVALKRHRKARQEEQGSVQLPQDVLV  124

Query  475  HMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQN  654
            H+F+FLD+Q+L+    VC SW+ AASDNHLWQL Y  +F     NS N ++     S + 
Sbjct  125  HIFRFLDLQSLVSVGQVCWSWNLAASDNHLWQLQYAIYFS----NSDNCLKTKVQQSGRV  180

Query  655  VQD----ICREETSTSTSVDWKNAFKRAY  729
            ++D    + ++  ++  SVDW+  FK AY
Sbjct  181  IEDKMNTLLQDNMASQPSVDWRETFKGAY  209



>gb|KEH43667.1| F-box-like protein [Medicago truncatula]
Length=333

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/255 (43%), Positives = 157/255 (62%), Gaps = 17/255 (7%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ L L ++L + Y Y I C ELS ILR A+ +  KNLQ++IF D L AFRLLP+M+TQ
Sbjct  7    RYQKLSLTESLPKSYRYPIACKELSFILREAFHKFPKNLQTIIFQDTLSAFRLLPQMETQ  66

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
            +++SA + L QSVEA LPKQK+ +A  EFK A+IAHKRR+KA+  E+G + LP+D++  +
Sbjct  67   SAVSAVHLLFQSVEAALPKQKKNMAVTEFKQAMIAHKRRSKAHQVEKGSLQLPEDILVQI  126

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTS----PLNSSNDVECSRCTSA  648
            F  LD+++L+ A +V RSW+ AA+DN LW+  Y   +G +    P+    D         
Sbjct  127  FSLLDMRSLVSAGIVSRSWNMAANDNCLWESQYAVLYGDAAKQRPMGPDEDRNDKLLQKP  186

Query  649  QNVQDICREETSTSTSVDWKNAFKRAYKD-MSSKLVLTSQRGYCSYCCSVVWLDNGKCSN  825
            Q+ + I           DWK A K AY   +S KL +   RGYC  C ++VWL+N +C N
Sbjct  187  QDTKMI----------TDWKKAVKGAYTGALSRKLAIN--RGYCECCKTIVWLNNSRCPN  234

Query  826  EHTSHGGKNHSVKPL  870
             H     + H ++P+
Sbjct  235  VHGGMISEIHDIEPV  249



>ref|XP_003592172.1| F-box protein [Medicago truncatula]
 gb|AES62423.1| F-box-like protein [Medicago truncatula]
Length=356

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 109/255 (43%), Positives = 157/255 (62%), Gaps = 17/255 (7%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ L L ++L + Y Y I C ELS ILR A+ +  KNLQ++IF D L AFRLLP+M+TQ
Sbjct  7    RYQKLSLTESLPKSYRYPIACKELSFILREAFHKFPKNLQTIIFQDTLSAFRLLPQMETQ  66

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
            +++SA + L QSVEA LPKQK+ +A  EFK A+IAHKRR+KA+  E+G + LP+D++  +
Sbjct  67   SAVSAVHLLFQSVEAALPKQKKNMAVTEFKQAMIAHKRRSKAHQVEKGSLQLPEDILVQI  126

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTS----PLNSSNDVECSRCTSA  648
            F  LD+++L+ A +V RSW+ AA+DN LW+  Y   +G +    P+    D         
Sbjct  127  FSLLDMRSLVSAGIVSRSWNMAANDNCLWESQYAVLYGDAAKQRPMGPDEDRNDKLLQKP  186

Query  649  QNVQDICREETSTSTSVDWKNAFKRAYKD-MSSKLVLTSQRGYCSYCCSVVWLDNGKCSN  825
            Q+ + I           DWK A K AY   +S KL +   RGYC  C ++VWL+N +C N
Sbjct  187  QDTKMI----------TDWKKAVKGAYTGALSRKLAIN--RGYCECCKTIVWLNNSRCPN  234

Query  826  EHTSHGGKNHSVKPL  870
             H     + H ++P+
Sbjct  235  VHGGMISEIHDIEPV  249



>gb|KEH43668.1| F-box-like protein [Medicago truncatula]
Length=324

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 108/255 (42%), Positives = 157/255 (62%), Gaps = 17/255 (7%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ L L ++L + Y Y I C ELS ILR A+ +  KNLQ++IF D L AFRLLP+M+TQ
Sbjct  7    RYQKLSLTESLPKSYRYPIACKELSFILREAFHKFPKNLQTIIFQDTLSAFRLLPQMETQ  66

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
            +++SA + L QSVEA LPKQK+ +A  EFK A+IAHKRR+KA+  E+G + LP+D++  +
Sbjct  67   SAVSAVHLLFQSVEAALPKQKKNMAVTEFKQAMIAHKRRSKAHQVEKGSLQLPEDILVQI  126

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTS----PLNSSNDVECSRCTSA  648
            F  LD+++L+ A +V RSW+ AA+DN LW+  Y   +G +    P+    D         
Sbjct  127  FSLLDMRSLVSAGIVSRSWNMAANDNCLWESQYAVLYGDAAKQRPMGPDEDRN-------  179

Query  649  QNVQDICREETSTSTSVDWKNAFKRAYKD-MSSKLVLTSQRGYCSYCCSVVWLDNGKCSN  825
                 + ++   T    DWK A K AY   +S KL +   RGYC  C ++VWL+N +C N
Sbjct  180  ---DKLLQKPQDTKMITDWKKAVKGAYTGALSRKLAIN--RGYCECCKTIVWLNNSRCPN  234

Query  826  EHTSHGGKNHSVKPL  870
             H     + H ++P+
Sbjct  235  VHGGMISEIHDIEPV  249



>ref|XP_006376610.1| hypothetical protein POPTR_0012s00990g [Populus trichocarpa]
 gb|ERP54407.1| hypothetical protein POPTR_0012s00990g [Populus trichocarpa]
Length=274

 Score =   211 bits (537),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 160/263 (61%), Gaps = 32/263 (12%)
 Frame = +1

Query  112  QTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEM  291
            Q  RY+ LG ++AL R +HY + C ELSLILR AYS+L KNLQSL+F D L +F+LLP+M
Sbjct  4    QVERYQILGYKEALTRTHHYPVACKELSLILREAYSKLPKNLQSLVFQDTLSSFKLLPQM  63

Query  292  QTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVI  471
             T  ++SAA+ LVQS EATLPKQK+ +ATKEFK A++A KRR KA   ++    L QDV+
Sbjct  64   WTNNAVSAAHLLVQSAEATLPKQKKNVATKEFKQAMVASKRRGKACRMQECHTELTQDVL  123

Query  472  AHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQ  651
              +F  LD ++L+ A+LV RSW+ AA +NHLWQ +Y   F  S  NSSN         A+
Sbjct  124  VDIFSLLDTRSLVSASLVSRSWNAAACNNHLWQSLYATIFA-SDHNSSN---------AK  173

Query  652  NVQDICR-EETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNE  828
            ++ +  R E+   + SVDW+ AFKRAY                     +VWLD  KC + 
Sbjct  174  DLLNGRRGEDNKDNNSVDWREAFKRAY---------------------IVWLDGLKCGSG  212

Query  829  HTSHGGKNHSVKPLSVEQIVDYI  897
                  K   + P S EQ+V+Y+
Sbjct  213  KCGPQPKMQPIVPKSSEQVVEYL  235



>ref|NP_001132570.1| uncharacterized LOC100194037 [Zea mays]
 gb|ACF81465.1| unknown [Zea mays]
 gb|ACG46489.1| F-box domain containing protein [Zea mays]
 gb|AFW78801.1| F-box domain containing protein [Zea mays]
Length=299

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 111/267 (42%), Positives = 159/267 (60%), Gaps = 12/267 (4%)
 Frame = +1

Query  103  ELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLL  282
            E     RYR +G+  AL+R + Y   C EL+ +LR  Y+ L K  Q+L+  D+LLAFRLL
Sbjct  12   ETGAAERYREMGIGAALSRPWDYPTACGELAALLRLGYADLPKAAQALVASDVLLAFRLL  71

Query  283  PEMQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQ  462
            P++QT  ++S AN L+Q+VE  LPKQK+  A  EFKH+IIAHKRRA+   +  G  H+PQ
Sbjct  72   PDVQTGYAVSTANVLLQAVEVALPKQKKAQAVSEFKHSIIAHKRRARVQ-QISGSPHIPQ  130

Query  463  DVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCT  642
            D++ H+F FLD+ +L+ A LVC SW+ AA+DN LW++ Y+ FFG S L S N++  S   
Sbjct  131  DILVHIFSFLDMHSLVAAGLVCWSWNSAANDNKLWKMNYSIFFGLSHL-SCNNIPVSGVQ  189

Query  643  SAQNVQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCS  822
             + N             +  WK +F   Y + +S     S R  C++C SV+WL N  C+
Sbjct  190  YSTN-------SVPNYPNFSWKESFHTKYAECAS-WKFVSNRALCAHCRSVIWLSNLTCA  241

Query  823  NEHTSHGGKNHSVK--PLSVEQIVDYI  897
            + H     ++H VK  PL  + +  YI
Sbjct  242  SPHHCPKNRHHEVKLRPLLPDTVAKYI  268



>ref|XP_004961432.1| PREDICTED: F-box protein At5g52880-like isoform X1 [Setaria italica]
Length=306

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 160/270 (59%), Gaps = 5/270 (2%)
 Frame = +1

Query  103  ELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLL  282
            E     RYR +G+  AL+R + Y   C EL+ +LR  Y  L K  Q+L+  D+LLAFRLL
Sbjct  12   ETGAAERYREMGIAAALSRPWDYPTACGELAALLRLGYVDLPKAAQALVASDVLLAFRLL  71

Query  283  PEMQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQ  462
            P++QT  ++SAANAL+Q+VE  LPKQK+  A  EFKH++IAHKRRA+   +  G  H+P 
Sbjct  72   PDVQTGYALSAANALLQAVEVALPKQKKAQAVSEFKHSVIAHKRRARVQ-QNSGLPHIPH  130

Query  463  DVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCT  642
            DV+ H+F FLD+ +L+ A LVC  W+ AA+DN LW++ Y+ FFG   L S N +  S   
Sbjct  131  DVLVHIFSFLDMHSLVAAGLVCWYWNSAANDNDLWKMNYSVFFGICHL-SCNSIPVSGVQ  189

Query  643  SAQNVQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCS  822
            +++++     +  S   S  WK +F   Y + +S     S R  C +C SV+WL N  C+
Sbjct  190  NSRDLVQSSMDLVSIGPSFRWKESFHSKYTECAS-WKFASNRALCGHCRSVIWLSNLTCT  248

Query  823  NEH--TSHGGKNHSVKPLSVEQIVDYITSN  906
            + H    +G     ++PL  + +  YI  N
Sbjct  249  SPHHCPKNGRDEIKLQPLLPDTVAKYILHN  278



>gb|AAU44061.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG94127.1| unnamed protein product [Oryza sativa Japonica Group]
Length=308

 Score =   209 bits (533),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 107/273 (39%), Positives = 160/273 (59%), Gaps = 16/273 (6%)
 Frame = +1

Query  103  ELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLL  282
            E     RYR +G+  AL+R + Y   C E++ +LR  Y  L K  Q+L+  D+LLAFRLL
Sbjct  12   ETGAAERYREMGISAALSRPWDYPTACGEIAALLRIGYGDLPKAAQALVAGDVLLAFRLL  71

Query  283  PEMQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQ  462
            P++QT  ++SAAN L+Q+V+ +LPKQK+  A  EFK +++AHKRRA+   ++ G  H+P 
Sbjct  72   PDVQTGYALSAANGLLQAVDGSLPKQKKAQAVSEFKRSVVAHKRRARVQ-QDPGVPHIPY  130

Query  463  DVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCT  642
            DV+ H+F FLD+++L+ A LVC  W+ AA+DNHLW++ Y+ FFG   +N      C+   
Sbjct  131  DVLVHIFSFLDMRSLVAAGLVCWPWNSAANDNHLWEMNYSLFFGICHIN------CNSTP  184

Query  643  SAQNVQDICRE------ETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWL  804
            +A NVQ+          + S     +WK AF + Y +  +     S R  C YC SV+WL
Sbjct  185  TAGNVQNTDYHVQNSIYQVSPDPGFNWKEAFHKKYAEQET-WSSASNRALCGYCRSVIWL  243

Query  805  DNGKCSNEH--TSHGGKNHSVKPLSVEQIVDYI  897
             +  C+  H   ++G     + PL    + DYI
Sbjct  244  CDLTCATPHYCLNNGKDGVKLGPLLPHTVADYI  276



>ref|XP_008647429.1| PREDICTED: uncharacterized LOC100194037 isoform X3 [Zea mays]
Length=318

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/254 (42%), Positives = 153/254 (60%), Gaps = 10/254 (4%)
 Frame = +1

Query  103  ELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLL  282
            E     RYR +G+  AL+R + Y   C EL+ +LR  Y+ L K  Q+L+  D+LLAFRLL
Sbjct  12   ETGAAERYREMGIGAALSRPWDYPTACGELAALLRLGYADLPKAAQALVASDVLLAFRLL  71

Query  283  PEMQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQ  462
            P++QT  ++S AN L+Q+VE  LPKQK+  A  EFKH+IIAHKRRA+   +  G  H+PQ
Sbjct  72   PDVQTGYAVSTANVLLQAVEVALPKQKKAQAVSEFKHSIIAHKRRARVQ-QISGSPHIPQ  130

Query  463  DVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCT  642
            D++ H+F FLD+ +L+ A LVC SW+ AA+DN LW++ Y+ FFG S L S N++  S   
Sbjct  131  DILVHIFSFLDMHSLVAAGLVCWSWNSAANDNKLWKMNYSIFFGLSHL-SCNNIPVSGVQ  189

Query  643  SAQNVQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCS  822
             + N             +  WK +F   Y + +S     S R  C++C SV+WL N  C+
Sbjct  190  YSTN-------SVPNYPNFSWKESFHTKYAECAS-WKFVSNRALCAHCRSVIWLSNLTCA  241

Query  823  NEHTSHGGKNHSVK  864
            + H     ++H VK
Sbjct  242  SPHHCPKNRHHEVK  255



>ref|XP_006280963.1| hypothetical protein CARUB_v10026964mg [Capsella rubella]
 gb|EOA13861.1| hypothetical protein CARUB_v10026964mg [Capsella rubella]
Length=264

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/259 (42%), Positives = 158/259 (61%), Gaps = 24/259 (9%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ L + +AL++++ Y  VCNELS +L  AYS+L KN+++LIF D L AFRLLP++ T 
Sbjct  3    RYQNLMVGEALSKNHLYPFVCNELSSVLNLAYSQLPKNVKALIFQDTLSAFRLLPDINTS  62

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
            A++SAAN L++SVEA LPKQK+ +A  EFK A +A  RR+K++ E+     LPQD++ H+
Sbjct  63   AAVSAANILLKSVEAVLPKQKKNLAIVEFKQAKVALTRRSKSHEEDIDIPSLPQDILIHI  122

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
            F FLD+ +LL +A V RSW+QA  D+ LW+ ++   F                       
Sbjct  123  FSFLDVSSLLSSAQVSRSWNQATHDDSLWRSLFEVHF-----------------------  159

Query  661  DICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTSH  840
               +      + +DW+ AFK+AY   +S   L S RGYC+YC S+VW DN +C N+    
Sbjct  160  -YHKRVIRIQSGIDWREAFKKAYFAANSSKALRSGRGYCNYCDSIVWHDNLRCPNKQCRL  218

Query  841  GGKNHSVKPLSVEQIVDYI  897
               N SV  +S  Q+V+Y+
Sbjct  219  KSGNKSVDLISTHQVVNYL  237



>ref|XP_007038875.1| F-box family protein, putative [Theobroma cacao]
 gb|EOY23376.1| F-box family protein, putative [Theobroma cacao]
Length=204

 Score =   201 bits (511),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 134/207 (65%), Gaps = 13/207 (6%)
 Frame = +1

Query  115  TSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQ  294
            T RY+ LGLR++L R Y Y I C ELS ILR AY +L KNLQ+LIF D L AFRLLPEMQ
Sbjct  5    TERYQKLGLRESLTRIYQYPIACKELSSILRGAYGKLPKNLQALIFQDTLTAFRLLPEMQ  64

Query  295  TQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIA  474
            T+++ +AA  L+QS E+ LPKQK+ +   EFK A +A+ RR++A+ EE     LPQDV+ 
Sbjct  65   TRSANAAAQLLLQSAESALPKQKKSLVVTEFKQAKVAYIRRSRAHREETVSAQLPQDVLV  124

Query  475  HMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQN  654
            H+F  LD+Q+L+   LVCRSWS AA+D+HLW+L YT  FG S         CSR    Q+
Sbjct  125  HIFSLLDLQSLISVTLVCRSWSLAANDSHLWELQYTTVFGRSK-------TCSRTKMQQS  177

Query  655  VQDI------CREETSTSTSVDWKNAF  717
             + +       +E   T T + WK +F
Sbjct  178  SRLVKEDYMFLKENGDTKTHIHWKESF  204



>ref|XP_010442833.1| PREDICTED: F-box protein At5g52880-like [Camelina sativa]
Length=264

 Score =   203 bits (516),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 111/259 (43%), Positives = 155/259 (60%), Gaps = 24/259 (9%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY  L + +AL+++  Y   CNELS +L  AYSRL K++++LIF D L AFRLLP++ T 
Sbjct  3    RYENLKVGEALSKNNLYPFACNELSSVLSLAYSRLPKDVKALIFRDTLSAFRLLPDVNTS  62

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
            A++SAAN L++SVEA LPKQK+ +A  EFK A +A KRR+K+  E+     LPQDV+ H+
Sbjct  63   AAVSAANLLLKSVEAVLPKQKKNLAIVEFKQAKVALKRRSKSPEEDLYIPSLPQDVLIHI  122

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
            F FLDI +LL +A V RSW+QA  D+ LWQ ++   F                       
Sbjct  123  FSFLDISSLLSSAQVSRSWNQATHDDSLWQSLFEVHF-----------------------  159

Query  661  DICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTSH  840
               +      +S+DW+ AFK+AY   +S   L S RGYCSYC S+VW DN +C ++    
Sbjct  160  -YHKRVIRIHSSIDWREAFKKAYIAANSSKALRSGRGYCSYCDSIVWHDNLRCPDKQCQL  218

Query  841  GGKNHSVKPLSVEQIVDYI  897
               N  V  +S  Q+V+Y+
Sbjct  219  KSGNKPVDLISTHQVVNYL  237



>ref|XP_009386005.1| PREDICTED: F-box protein At5g52880 [Musa acuminata subsp. malaccensis]
Length=308

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 119/305 (39%), Positives = 180/305 (59%), Gaps = 9/305 (3%)
 Frame = +1

Query  97   MEELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFR  276
            M   +   RY  LGL +AL+R + Y   C+EL LILR AY+ L KNLQS++F + L AFR
Sbjct  1    MGRATVRERYEKLGLAEALSRAHDYPSACHELGLILRLAYADLPKNLQSVVFQETLSAFR  60

Query  277  LLPEMQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHL  456
            LLPE+QT   +S+AN L+Q+ E  LPKQK+ +A  EFKHA +AHKRR++A+  + G + L
Sbjct  61   LLPEVQTGHGLSSANVLLQAAEVALPKQKKALAVSEFKHAAVAHKRRSRAH-HDGGSVVL  119

Query  457  PQDVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSR  636
            P D++ H+F FLD+++L    LVC +W+ AA DN LWQ++Y+N FG     +S + +   
Sbjct  120  PYDLLVHIFSFLDLRSLASVGLVCWAWNTAAIDNGLWQMLYSNLFGNYSTCTSKEQDHKL  179

Query  637  CTSAQNVQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGK  816
                ++V          + +++WK A +R  + +SS   L + R  C +C S++W     
Sbjct  180  VPDGKDVVFHGCMGVDPTININWKEAVRRKCEGVSSWKFLPN-RVVCGHCQSIIWSSGIT  238

Query  817  CSNEH--TSHGGKNHSVKPLSVEQIVDYITSNTLPGsyssdsdledsdyeslF-----KL  975
            C   H  +  G +  +++P+S  ++V+Y+         SSD+D  DSD  S       +L
Sbjct  239  CRTSHECSKIGNQKLNIRPISPCKVVEYLLGEIELAVMSSDTDDSDSDGPSPSTQHLPRL  298

Query  976  WAYPK  990
            WAYPK
Sbjct  299  WAYPK  303



>ref|XP_010445323.1| PREDICTED: F-box protein At5g52880-like isoform X2 [Camelina 
sativa]
Length=264

 Score =   201 bits (511),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 109/259 (42%), Positives = 155/259 (60%), Gaps = 24/259 (9%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY  L + +AL+++  Y   CNELS +L  AYSRL K++++LIF D L AFRLLP + T 
Sbjct  3    RYENLKVGEALSKNNLYPFACNELSSVLSLAYSRLPKDVKALIFRDTLSAFRLLPHVNTS  62

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
            A++SAAN L++SVEA LPKQK+ +A  EFK A +A KRR+K+  E+     LPQD++ H+
Sbjct  63   AAVSAANLLLKSVEAVLPKQKKNLAIVEFKQAKVALKRRSKSPEEDIYIPSLPQDILIHI  122

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
            F FLD+ +LL +A V RSW+QA  D+ LWQ ++   F                       
Sbjct  123  FSFLDVSSLLSSAQVSRSWNQATHDDSLWQSLFEVHFYH---------------------  161

Query  661  DICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTSH  840
               +      +S+DW+ AFK+AY   +S   L S RGYC+YC S+VW DN +C N+    
Sbjct  162  ---KRVIRIQSSIDWREAFKKAYIAANSLKALRSGRGYCNYCNSIVWHDNLRCPNKQCLL  218

Query  841  GGKNHSVKPLSVEQIVDYI  897
               N +V  +S  Q+V+Y+
Sbjct  219  KSGNETVDLISTHQVVNYL  237



>ref|XP_010482664.1| PREDICTED: F-box protein At5g52880-like [Camelina sativa]
Length=264

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 109/259 (42%), Positives = 155/259 (60%), Gaps = 24/259 (9%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY  L + +AL+++  Y   CNELS +L  AYSRL K++++LIF D L AFRLLP++ T 
Sbjct  3    RYENLKVGEALSKNNLYPFACNELSSVLSLAYSRLPKDVKALIFRDTLSAFRLLPDVNTS  62

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
            A++SAAN L++SVEA LPKQK+ +A  EFK A +A KRR+K+  E+     LPQD++ H+
Sbjct  63   AAVSAANLLLKSVEAVLPKQKKNLAIVEFKQAKVALKRRSKSPEEDIYIPSLPQDILIHI  122

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
            F FLD+ +LL +A V RSW+QA  D+ LWQ ++   F                       
Sbjct  123  FSFLDVSSLLSSAQVSRSWNQATHDDSLWQSLFEVHFYH---------------------  161

Query  661  DICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTSH  840
               +      +S+DW+ AFK+AY   +S   L S RGYCSYC S+VW +N +C N+    
Sbjct  162  ---KRVIRIHSSIDWREAFKKAYIAANSLKALRSGRGYCSYCDSIVWHNNLRCPNKQCQL  218

Query  841  GGKNHSVKPLSVEQIVDYI  897
               N  V  +S  Q+V+Y+
Sbjct  219  KSGNKPVDLISTHQVVNYL  237



>ref|XP_002865935.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42194.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=265

 Score =   200 bits (509),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 112/262 (43%), Positives = 157/262 (60%), Gaps = 29/262 (11%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ L + +AL+++  YS  CNELS IL  AY+RL KN+++LIF D L AFRLLP++ T 
Sbjct  3    RYQNLMVGEALSKNRLYSFACNELSSILNLAYARLPKNVKALIFRDTLSAFRLLPDINTS  62

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQG---PIHLPQDVI  471
            A++SAAN L++SVEA LPKQK+ +A  EFK A +A KRR+K+ CEE+    P  LPQD++
Sbjct  63   AAVSAANLLLKSVEAVLPKQKKNLAIVEFKQAKVALKRRSKS-CEEKDIDIP-SLPQDIL  120

Query  472  AHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQ  651
             H+F FLD+ +LL +A V RSW+QA  +N LWQ  +   F    L               
Sbjct  121  IHIFSFLDVSSLLSSAQVSRSWNQATHENSLWQTQFDLHFNQKVL---------------  165

Query  652  NVQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEH  831
                         + +DW+ AFK A+   +S   L S RGYCSYC S+VW D+ +C+N  
Sbjct  166  ---------IRIQSGIDWREAFKNAFIAANSSKALRSGRGYCSYCDSIVWHDDLRCANRQ  216

Query  832  TSHGGKNHSVKPLSVEQIVDYI  897
                  N  +  +S  Q+V+Y+
Sbjct  217  CRLKSGNKPLDLISTHQVVNYL  238



>ref|XP_008647428.1| PREDICTED: uncharacterized LOC100194037 isoform X2 [Zea mays]
Length=328

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 113/295 (38%), Positives = 163/295 (55%), Gaps = 39/295 (13%)
 Frame = +1

Query  103  ELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLL  282
            E     RYR +G+  AL+R + Y   C EL+ +LR  Y+ L K  Q+L+  D+LLAFRLL
Sbjct  12   ETGAAERYREMGIGAALSRPWDYPTACGELAALLRLGYADLPKAAQALVASDVLLAFRLL  71

Query  283  PEMQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAK-----ANCEEQGP  447
            P++QT  ++S AN L+Q+VE  LPKQK+  A  EFKH+IIAHKRRA+     A+ E+ G 
Sbjct  72   PDVQTGYAVSTANVLLQAVEVALPKQKKAQAVSEFKHSIIAHKRRARVQQISASFEDLGG  131

Query  448  I-----------------------HLPQDVIAHMFQFLDIQTLLVAALVCRSWSQAASDN  558
            +                       H+PQD++ H+F FLD+ +L+ A LVC SW+ AA+DN
Sbjct  132  LQALRLTDTRHCDVLFSILLTGSPHIPQDILVHIFSFLDMHSLVAAGLVCWSWNSAANDN  191

Query  559  HLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQDICREETSTSTSVDWKNAFKRAYKDM  738
             LW++ Y+ FFG S L S N++  S    + N             +  WK +F   Y + 
Sbjct  192  KLWKMNYSIFFGLSHL-SCNNIPVSGVQYSTN-------SVPNYPNFSWKESFHTKYAEC  243

Query  739  SSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTSHGGKNHSVK--PLSVEQIVDYI  897
            +S     S R  C++C SV+WL N  C++ H     ++H VK  PL  + +  YI
Sbjct  244  AS-WKFVSNRALCAHCRSVIWLSNLTCASPHHCPKNRHHEVKLRPLLPDTVAKYI  297



>ref|XP_002440114.1| hypothetical protein SORBIDRAFT_09g026200 [Sorghum bicolor]
 gb|EES18544.1| hypothetical protein SORBIDRAFT_09g026200 [Sorghum bicolor]
Length=295

 Score =   198 bits (504),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 155/267 (58%), Gaps = 16/267 (6%)
 Frame = +1

Query  103  ELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLL  282
            E     RYR + +  AL+R + Y   C EL+ +LR  Y+ L K  Q+L+  D+LLAFRLL
Sbjct  12   ETGAAERYREMRIGAALSRPWDYPTACGELAALLRLGYADLPKAAQALVASDVLLAFRLL  71

Query  283  PEMQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQ  462
            P++QT  ++S AN L+Q+VE  LPKQK+  A  EFKH+IIAHKRR++   +  G   +PQ
Sbjct  72   PDVQTGYAVSTANVLLQAVEVALPKQKKAQAVSEFKHSIIAHKRRSRVQ-QNSGSPDIPQ  130

Query  463  DVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCT  642
            D++ H+F FLD+ +L+ A LVC SW+ AA+DN LW++ Y+ FFG S L S N++  S   
Sbjct  131  DILVHIFSFLDMHSLVAAGLVCWSWNSAANDNKLWKMNYSIFFGLSHL-SCNNIPVSGVH  189

Query  643  SAQNVQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCS  822
             + N         S   S  WK +F +      +     S R +C++C SV+WL N  C+
Sbjct  190  YSMN-------SVSDYPSFSWKESFHKC-----ASWKFASNRAFCAHCRSVIWLSNLTCA  237

Query  823  NEHTSHGGKNHSVK--PLSVEQIVDYI  897
            + H     +   VK  PL  + +  YI
Sbjct  238  SPHHCPKNRQDEVKLRPLLPDTVAKYI  264



>ref|XP_010555698.1| PREDICTED: F-box protein At5g52880 isoform X1 [Tarenaya hassleriana]
Length=274

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 118/291 (41%), Positives = 164/291 (56%), Gaps = 27/291 (9%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ L + +AL+  + Y +V  ELS IL+  Y R  KN+Q+LIF D L AFRLLP+MQT 
Sbjct  7    RYKKLFVGEALSEIHRYPLVSQELSSILKLGYRRFPKNVQALIFQDTLTAFRLLPDMQTS  66

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQ-GPIHLPQDVIAH  477
            A++SAA  L++SVEA LPKQKR +A  E KH+ +A KR +K   EE+     LP+DV+ H
Sbjct  67   AAVSAAQLLLKSVEAVLPKQKRNLAIAELKHSKVAMKRHSKTREEEELDSPQLPEDVLRH  126

Query  478  MFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNV  657
            +F FLD+ +L+ AA VCRSW+ AA DN+LWQ  Y   F  S                   
Sbjct  127  IFSFLDVASLVSAAQVCRSWNLAAYDNNLWQKKYDLLFKDSS------------------  168

Query  658  QDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTS  837
                 +  +  T +DW+  FK +Y   +    L S  GYC YC S+VW ++ +C  E   
Sbjct  169  -----QSLTQKTDIDWRETFKNSYIAENLSKALRSTWGYCWYCDSIVWHNSLRCPKEQCR  223

Query  838  HGGKNHSVKPLSVEQIVDYITSNTLPGsyssdsdledsdyeslFKLWAYPK  990
                   V  +S +Q+V+YI         ++ S   +SD ES++ LWAYPK
Sbjct  224  LKSGGKLVDHISTQQVVEYIMGGL---QSNTYSSESESDEESVYGLWAYPK  271



>ref|XP_006654675.1| PREDICTED: LOW QUALITY PROTEIN: F-box protein At5g52880-like 
[Oryza brachyantha]
Length=309

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/274 (39%), Positives = 154/274 (56%), Gaps = 17/274 (6%)
 Frame = +1

Query  103  ELSQTSRYRWLGLRDALNR-HYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRL  279
            E     RY  +G+  AL+R    Y   C E++ +LRN Y+ L K  Q+L+  D+LLAFRL
Sbjct  12   ETGAVERYGEMGISAALSRPGLPYPTACGEIAALLRNGYADLPKAAQALVAADVLLAFRL  71

Query  280  LPEMQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLP  459
            LP++QT  ++SAAN L+Q+VE +LPKQK+  A  EFK +I+AHKR A+   ++ G  H+P
Sbjct  72   LPDVQTGYALSAANGLLQAVEGSLPKQKKAQAISEFKRSIVAHKRHARVQ-QDPGATHIP  130

Query  460  QDVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRC  639
             DV+ H+F FLD+++LL A LVC  W+ AA+DN+LW++ Y+ FF   P+N      C+  
Sbjct  131  YDVLVHIFSFLDMRSLLAAGLVCWPWNSAANDNNLWKMNYSLFFSIYPMN------CNST  184

Query  640  TSAQNVQDI------CREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVW  801
             +  NVQ+            S      WK AF+  Y +  +     S R  C +C SV+W
Sbjct  185  PTPGNVQNSDGHVQNSMYPVSPDPGFSWKEAFQNKYAEQET-WSSASNRALCGFCRSVIW  243

Query  802  LDNGKCSNEH--TSHGGKNHSVKPLSVEQIVDYI  897
            L N   +  H    +G     + PL    + DYI
Sbjct  244  LCNLTSATPHQCPKNGKDGVKLGPLLPLTVADYI  277



>ref|XP_008647430.1| PREDICTED: uncharacterized LOC100194037 isoform X4 [Zea mays]
Length=306

 Score =   196 bits (498),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 111/283 (39%), Positives = 159/283 (56%), Gaps = 39/283 (14%)
 Frame = +1

Query  103  ELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLL  282
            E     RYR +G+  AL+R + Y   C EL+ +LR  Y+ L K  Q+L+  D+LLAFRLL
Sbjct  12   ETGAAERYREMGIGAALSRPWDYPTACGELAALLRLGYADLPKAAQALVASDVLLAFRLL  71

Query  283  PEMQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAK-----ANCEEQGP  447
            P++QT  ++S AN L+Q+VE  LPKQK+  A  EFKH+IIAHKRRA+     A+ E+ G 
Sbjct  72   PDVQTGYAVSTANVLLQAVEVALPKQKKAQAVSEFKHSIIAHKRRARVQQISASFEDLGG  131

Query  448  I-----------------------HLPQDVIAHMFQFLDIQTLLVAALVCRSWSQAASDN  558
            +                       H+PQD++ H+F FLD+ +L+ A LVC SW+ AA+DN
Sbjct  132  LQALRLTDTRHCDVLFSILLTGSPHIPQDILVHIFSFLDMHSLVAAGLVCWSWNSAANDN  191

Query  559  HLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQDICREETSTSTSVDWKNAFKRAYKDM  738
             LW++ Y+ FFG S L S N++  S    + N             +  WK +F   Y + 
Sbjct  192  KLWKMNYSIFFGLSHL-SCNNIPVSGVQYSTN-------SVPNYPNFSWKESFHTKYAEC  243

Query  739  SS-KLVLTSQRGYCSYCCSVVWLDNGKCSNEHTSHGGKNHSVK  864
            +S K V  S R  C++C SV+WL N  C++ H     ++H VK
Sbjct  244  ASWKFV--SNRALCAHCRSVIWLSNLTCASPHHCPKNRHHEVK  284



>ref|XP_008647427.1| PREDICTED: uncharacterized LOC100194037 isoform X1 [Zea mays]
Length=347

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/282 (39%), Positives = 157/282 (56%), Gaps = 37/282 (13%)
 Frame = +1

Query  103  ELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLL  282
            E     RYR +G+  AL+R + Y   C EL+ +LR  Y+ L K  Q+L+  D+LLAFRLL
Sbjct  12   ETGAAERYREMGIGAALSRPWDYPTACGELAALLRLGYADLPKAAQALVASDVLLAFRLL  71

Query  283  PEMQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAK-----ANCEEQGP  447
            P++QT  ++S AN L+Q+VE  LPKQK+  A  EFKH+IIAHKRRA+     A+ E+ G 
Sbjct  72   PDVQTGYAVSTANVLLQAVEVALPKQKKAQAVSEFKHSIIAHKRRARVQQISASFEDLGG  131

Query  448  I-----------------------HLPQDVIAHMFQFLDIQTLLVAALVCRSWSQAASDN  558
            +                       H+PQD++ H+F FLD+ +L+ A LVC SW+ AA+DN
Sbjct  132  LQALRLTDTRHCDVLFSILLTGSPHIPQDILVHIFSFLDMHSLVAAGLVCWSWNSAANDN  191

Query  559  HLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQDICREETSTSTSVDWKNAFKRAYKDM  738
             LW++ Y+ FFG S L S N++  S    + N             +  WK +F   Y + 
Sbjct  192  KLWKMNYSIFFGLSHL-SCNNIPVSGVQYSTN-------SVPNYPNFSWKESFHTKYAEC  243

Query  739  SSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTSHGGKNHSVK  864
            +S     S R  C++C SV+WL N  C++ H     ++H VK
Sbjct  244  AS-WKFVSNRALCAHCRSVIWLSNLTCASPHHCPKNRHHEVK  284



>ref|NP_568779.1| F-box protein [Arabidopsis thaliana]
 sp|Q9FLX3.1|FB293_ARATH RecName: Full=F-box protein At5g52880 [Arabidopsis thaliana]
 dbj|BAB10436.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL06941.1| AT5g52880/MXC20_10 [Arabidopsis thaliana]
 gb|AAM91039.1| AT5g52880/MXC20_10 [Arabidopsis thaliana]
 gb|AED96271.1| F-box protein [Arabidopsis thaliana]
Length=269

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 107/260 (41%), Positives = 151/260 (58%), Gaps = 25/260 (10%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ L + +A +++  Y   CNELS IL  AYS   KN+++LIF D L AFRLLP++ T 
Sbjct  3    RYQNLKVGEAFSKNRIYPFACNELSSILNLAYSLSPKNVKALIFQDTLSAFRLLPDINTS  62

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPI-HLPQDVIAH  477
            A++SAAN L++SVEA LPKQK+ +A  EFK A +A KRR+K   EE   I  LPQD++ H
Sbjct  63   AAVSAANLLLKSVEAVLPKQKKNLAIVEFKQAKVALKRRSKNREEEDIDIPSLPQDILIH  122

Query  478  MFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNV  657
            +F FL+I +L+ +A V RSW+QA  +N LWQ  +   F    L                 
Sbjct  123  IFSFLEISSLVSSAQVSRSWNQATHENSLWQSQFDLHFNHKVL-----------------  165

Query  658  QDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTS  837
                       + +DW+ AFK+AY   +S   L S RGYCSYC S+VW +N +C N+   
Sbjct  166  -------IRMQSDIDWREAFKKAYIAANSSEALRSGRGYCSYCDSIVWHENLRCLNKQCR  218

Query  838  HGGKNHSVKPLSVEQIVDYI  897
                N  +  ++  Q+V+Y+
Sbjct  219  LKSGNKPLDLITTHQVVNYL  238



>gb|EEC79561.1| hypothetical protein OsI_20690 [Oryza sativa Indica Group]
Length=339

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/304 (35%), Positives = 157/304 (52%), Gaps = 47/304 (15%)
 Frame = +1

Query  103  ELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLL  282
            E     RYR +G+  AL+R + Y   C E++ +LR  Y  L K  Q+L+  D+LLAFRLL
Sbjct  12   ETGAAERYREMGISAALSRPWDYPTACGEIAALLRIGYGDLPKAAQALVTGDVLLAFRLL  71

Query  283  PEM-------------------------------QTQASISAANALVQSVEATLPKQKRC  369
            P+                                +T  ++ AAN L+Q+ E +LPKQK+ 
Sbjct  72   PDGTSSSPLATREEALLSYMLTVDLSNYETLFANKTGYALGAANGLLQAAEGSLPKQKKA  131

Query  370  IATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHMFQFLDIQTLLVAALVCRSWSQAA  549
             A  EFK +++AHKRRA+   ++ G  H+P DV+ H+F FLD+++L+ A LVC  W+ AA
Sbjct  132  QAVSEFKRSVVAHKRRARVQ-QDPGVPHIPYDVLVHIFSFLDMRSLVAAGLVCWPWNSAA  190

Query  550  SDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQDICRE------ETSTSTSVDWKN  711
            +DNHLW++ Y+ FFG   +N      C+   +A NVQ+          + S     +WK 
Sbjct  191  NDNHLWEMNYSLFFGICHIN------CNSTPTAGNVQNTDYHVQNSIYQVSPDPGFNWKE  244

Query  712  AFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEH--TSHGGKNHSVKPLSVEQI  885
            AF + Y +  +     S R  C YC SV+WL +  C+  H   ++G     + PL    +
Sbjct  245  AFHKKYAEQET-WSSASNRSLCGYCRSVIWLCDLTCATPHYCLNNGKDGVKLGPLLPHTV  303

Query  886  VDYI  897
             DYI
Sbjct  304  ADYI  307



>ref|XP_003568064.1| PREDICTED: F-box protein At5g52880 isoform X2 [Brachypodium distachyon]
Length=318

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/278 (38%), Positives = 162/278 (58%), Gaps = 18/278 (6%)
 Frame = +1

Query  94   RMEELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAF  273
            R +E     RY+ +G+  AL+R + Y   C EL+ +LR+ Y+ L K  ++L+  D+L AF
Sbjct  15   RRQENGIVKRYKEMGIAAALSRPWDYPTACRELAELLRHGYAGLPKAAKALVASDVLTAF  74

Query  274  RLLPEMQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIH  453
            RLLP++ T  ++ AAN L+Q+VE +LPKQK+  A  EFK +++AHKRRA+   +E GP H
Sbjct  75   RLLPDVHTGYALPAANGLLQAVEVSLPKQKKSQAISEFKCSVVAHKRRARVQ-QEPGPPH  133

Query  454  LPQDVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNS-----SN  618
            +P DV+ H+F FLD+++L+ A LVC SW+ +A+DN LW++ Y+ FF    ++S     S+
Sbjct  134  IPHDVLVHIFSFLDMRSLVAAGLVCWSWNSSANDNQLWKMNYSIFFSICDVSSNSIPVSS  193

Query  619  DVECSRCTSAQNVQDICREETSTSTSVDWKNAF--KRAYKDMSSKLVLTSQRGYCSYCCS  792
             V+ S     QN  D      S  +S++WK  F  KRA   + S     S +  C  C +
Sbjct  194  GVQNSDGLLVQNSTD----PVSGDSSLNWKEVFHNKRAEYILWSS---ASNKAVCRQCQA  246

Query  793  VVWLDNGKCSNEHT-SHGGKNHSVK--PLSVEQIVDYI  897
            ++WL N  C+  H   +  +   VK  PL    +  YI
Sbjct  247  IIWLSNLTCAAPHQCPNKNEKDGVKLTPLLPSTVTGYI  284



>ref|XP_010445317.1| PREDICTED: F-box protein At5g52880-like isoform X1 [Camelina 
sativa]
Length=289

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 109/284 (38%), Positives = 155/284 (55%), Gaps = 49/284 (17%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPE----  288
            RY  L + +AL+++  Y   CNELS +L  AYSRL K++++LIF D L AFRLLP     
Sbjct  3    RYENLKVGEALSKNNLYPFACNELSSVLSLAYSRLPKDVKALIFRDTLSAFRLLPHSILR  62

Query  289  ---------------------MQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIA  405
                                 + T A++SAAN L++SVEA LPKQK+ +A  EFK A +A
Sbjct  63   VNRIEKINKVGNFFKLTMKQSVNTSAAVSAANLLLKSVEAVLPKQKKNLAIVEFKQAKVA  122

Query  406  HKRRAKANCEEQGPIHLPQDVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTN  585
             KRR+K+  E+     LPQD++ H+F FLD+ +LL +A V RSW+QA  D+ LWQ ++  
Sbjct  123  LKRRSKSPEEDIYIPSLPQDILIHIFSFLDVSSLLSSAQVSRSWNQATHDDSLWQSLFEV  182

Query  586  FFGTSPLNSSNDVECSRCTSAQNVQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQ  765
             F                          +      +S+DW+ AFK+AY   +S   L S 
Sbjct  183  HF------------------------YHKRVIRIQSSIDWREAFKKAYIAANSLKALRSG  218

Query  766  RGYCSYCCSVVWLDNGKCSNEHTSHGGKNHSVKPLSVEQIVDYI  897
            RGYC+YC S+VW DN +C N+       N +V  +S  Q+V+Y+
Sbjct  219  RGYCNYCNSIVWHDNLRCPNKQCLLKSGNETVDLISTHQVVNYL  262



>gb|AFW78800.1| hypothetical protein ZEAMMB73_046522 [Zea mays]
Length=214

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 129/209 (62%), Gaps = 9/209 (4%)
 Frame = +1

Query  103  ELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLL  282
            E     RYR +G+  AL+R + Y   C EL+ +LR  Y+ L K  Q+L+  D+LLAFRLL
Sbjct  12   ETGAAERYREMGIGAALSRPWDYPTACGELAALLRLGYADLPKAAQALVASDVLLAFRLL  71

Query  283  PEMQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQ  462
            P++QT  ++S AN L+Q+VE  LPKQK+  A  EFKH+IIAHKRRA+   +  G  H+PQ
Sbjct  72   PDVQTGYAVSTANVLLQAVEVALPKQKKAQAVSEFKHSIIAHKRRARVQ-QISGSPHIPQ  130

Query  463  DVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCT  642
            D++ H+F FLD+ +L+ A LVC SW+ AA+DN LW++ Y+ FFG S L S N++  S   
Sbjct  131  DILVHIFSFLDMHSLVAAGLVCWSWNSAANDNKLWKMNYSIFFGLSHL-SCNNIPVSGVQ  189

Query  643  SAQNVQDICREETSTSTSVDWKNAFKRAY  729
             + N             +  WK +F   Y
Sbjct  190  YSTN-------SVPNYPNFSWKESFHTKY  211



>gb|KHN12925.1| F-box protein, partial [Glycine soja]
Length=193

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 127/197 (64%), Gaps = 14/197 (7%)
 Frame = +1

Query  139  LRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQASISAA  318
            +R++L + Y Y I C ELS ILR A+ +  KNLQS++F D L AFRLLP++QTQ+++SA 
Sbjct  2    IRESLLKTYRYPIACRELSFILREAFHQFPKNLQSIVFQDTLSAFRLLPQIQTQSAVSAV  61

Query  319  NALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHMFQFLDI  498
            ++L+QSVEA LPKQK+ +A  +FKHA++ HKRR    C  Q    LPQD++AH+F FL++
Sbjct  62   HSLLQSVEAALPKQKKNVAVTKFKHAMVVHKRR----CSLQ----LPQDILAHIFSFLEM  113

Query  499  QTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQDICREE  678
            ++L+   LVC SW+ AA+DNHLW+  Y   +G     +    + ++    +N   +  E 
Sbjct  114  KSLVSMGLVCWSWNIAANDNHLWEKQYVALYG-----NRAKPKPAKLIEGKN-DGLLLEP  167

Query  679  TSTSTSVDWKNAFKRAY  729
              T    DWK + K AY
Sbjct  168  VDTRIITDWKESVKGAY  184



>ref|XP_004961433.1| PREDICTED: F-box protein At5g52880-like isoform X2 [Setaria italica]
Length=277

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 99/273 (36%), Positives = 141/273 (52%), Gaps = 40/273 (15%)
 Frame = +1

Query  103  ELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLL  282
            E     RYR +G+  AL+R + Y   C EL+ +LR  Y  L K  Q+L+  D+LLAFRLL
Sbjct  12   ETGAAERYREMGIAAALSRPWDYPTACGELAALLRLGYVDLPKAAQALVASDVLLAFRLL  71

Query  283  PEMQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQ  462
            P++QT  ++SAANAL+Q+VE  LPKQK+  A  EFKH++IAHKRRA+   +  G  H+P 
Sbjct  72   PDVQTGYALSAANALLQAVEVALPKQKKAQAVSEFKHSVIAHKRRARVQ-QNSGLPHIPH  130

Query  463  DVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCT  642
            DV+ H+F FLD+ +L+ A LVC                                 C   +
Sbjct  131  DVLVHIFSFLDMHSLVAAGLVC---------------------------------CIPVS  157

Query  643  SAQNVQDICREE---TSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNG  813
              QN +D+ +      S   S  WK +F   Y + +S     S R  C +C SV+WL N 
Sbjct  158  GVQNSRDLVQSSMDLVSIGPSFRWKESFHSKYTECAS-WKFASNRALCGHCRSVIWLSNL  216

Query  814  KCSNEH--TSHGGKNHSVKPLSVEQIVDYITSN  906
             C++ H    +G     ++PL  + +  YI  N
Sbjct  217  TCTSPHHCPKNGRDEIKLQPLLPDTVAKYILHN  249



>ref|XP_010231135.1| PREDICTED: F-box protein At5g52880 isoform X1 [Brachypodium distachyon]
Length=345

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 107/305 (35%), Positives = 163/305 (53%), Gaps = 45/305 (15%)
 Frame = +1

Query  94   RMEELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAF  273
            R +E     RY+ +G+  AL+R + Y   C EL+ +LR+ Y+ L K  ++L+  D+L AF
Sbjct  15   RRQENGIVKRYKEMGIAAALSRPWDYPTACRELAELLRHGYAGLPKAAKALVASDVLTAF  74

Query  274  RLLPEMQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIH  453
            RLLP++ T  ++ AAN L+Q+VE +LPKQK+  A  EFK +++AHKRRA+   +E GP H
Sbjct  75   RLLPDVHTGYALPAANGLLQAVEVSLPKQKKSQAISEFKCSVVAHKRRARVQ-QEPGPPH  133

Query  454  LPQDVIAHMFQFLDIQTLLVAALVC---------------------------RSWSQAAS  552
            +P DV+ H+F FLD+++L+ A LVC                           RSW+ +A+
Sbjct  134  IPHDVLVHIFSFLDMRSLVAAGLVCWYLFFSLASIYLFTHVLALIHTCIFPRRSWNSSAN  193

Query  553  DNHLWQLIYTNFFGTSPLNS-----SNDVECSRCTSAQNVQDICREETSTSTSVDWKNAF  717
            DN LW++ Y+ FF    ++S     S+ V+ S     QN  D      S  +S++WK  F
Sbjct  194  DNQLWKMNYSIFFSICDVSSNSIPVSSGVQNSDGLLVQNSTD----PVSGDSSLNWKEVF  249

Query  718  --KRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHT-SHGGKNHSVK--PLSVEQ  882
              KRA   + S     S +  C  C +++WL N  C+  H   +  +   VK  PL    
Sbjct  250  HNKRAEYILWSS---ASNKAVCRQCQAIIWLSNLTCAAPHQCPNKNEKDGVKLTPLLPST  306

Query  883  IVDYI  897
            +  YI
Sbjct  307  VTGYI  311



>ref|XP_009119820.1| PREDICTED: F-box protein At5g52880-like [Brassica rapa]
Length=291

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/263 (38%), Positives = 146/263 (56%), Gaps = 24/263 (9%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ L + D L+ H+ Y   CNEL  ++   YSRL K++++ IF D L AFRLLPEM T 
Sbjct  3    RYQNLMVGDGLSDHHRYPFACNELISMIDLGYSRLPKDVKAFIFQDCLSAFRLLPEMNTT  62

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHM  480
            A++SAAN LV+SVE+  PKQK+ +A  +FK A +A KRR K++ E +    LPQDV+ H+
Sbjct  63   AAVSAANLLVKSVESAFPKQKKNLAIVQFKQAKVALKRRTKSHEESRDTPSLPQDVLVHI  122

Query  481  FQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQ  660
            F  LD+ +L+ ++ V RSW+ A  +  LW+ ++        L+ S+DV            
Sbjct  123  FSLLDVSSLISSSQVSRSWNLATHEGSLWRSLFN-------LHFSHDV------------  163

Query  661  DICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTSH  840
                  T      DW+ AFK      +   +L S RGYCSYC ++VW DN +C  +    
Sbjct  164  -----LTHIHPGFDWREAFKNECIVYNLSKMLRSGRGYCSYCDTLVWHDNFRCPKKQCQF  218

Query  841  GGKNHSVKPLSVEQIVDYITSNT  909
                  + P+   Q+V+Y+   T
Sbjct  219  ESGKEQLDPILTHQVVNYLLGIT  241



>ref|XP_008647431.1| PREDICTED: uncharacterized LOC100194037 isoform X5 [Zea mays]
Length=243

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/237 (40%), Positives = 133/237 (56%), Gaps = 36/237 (15%)
 Frame = +1

Query  103  ELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLL  282
            E     RYR +G+  AL+R + Y   C EL+ +LR  Y+ L K  Q+L+  D+LLAFRLL
Sbjct  12   ETGAAERYREMGIGAALSRPWDYPTACGELAALLRLGYADLPKAAQALVASDVLLAFRLL  71

Query  283  PEMQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAK-----ANCEEQGP  447
            P++QT  ++S AN L+Q+VE  LPKQK+  A  EFKH+IIAHKRRA+     A+ E+ G 
Sbjct  72   PDVQTGYAVSTANVLLQAVEVALPKQKKAQAVSEFKHSIIAHKRRARVQQISASFEDLGG  131

Query  448  I-----------------------HLPQDVIAHMFQFLDIQTLLVAALVCRSWSQAASDN  558
            +                       H+PQD++ H+F FLD+ +L+ A LVC SW+ AA+DN
Sbjct  132  LQALRLTDTRHCDVLFSILLTGSPHIPQDILVHIFSFLDMHSLVAAGLVCWSWNSAANDN  191

Query  559  HLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQDICREETSTSTSVDWKNAFKRAY  729
             LW++ Y+ FFG S L S N++  S    + N             +  WK +F   Y
Sbjct  192  KLWKMNYSIFFGLSHL-SCNNIPVSGVQYSTN-------SVPNYPNFSWKESFHTKY  240



>gb|KFK26879.1| hypothetical protein AALP_AA8G305200 [Arabis alpina]
Length=264

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 106/264 (40%), Positives = 157/264 (59%), Gaps = 24/264 (9%)
 Frame = +1

Query  118  SRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQT  297
             +Y+ L + +AL+ ++ Y   CNELS IL   Y RL K +++LIF D L AFRLLP M T
Sbjct  2    GKYQSLMVEEALSNNHLYPFACNELSFILTLCYPRLHKFIKALIFQDTLSAFRLLPLMNT  61

Query  298  QASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAH  477
             A++SAAN L++SVEA LPKQK+ +A  EFK A +A KRR+K++ E+     LPQD++ H
Sbjct  62   SAAVSAANLLLKSVEAVLPKQKKNLAIVEFKQAKVALKRRSKSHEEDIDLPALPQDILIH  121

Query  478  MFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNV  657
            +F FLD+ +L+ ++ V RSW+QA  D+ LW+  +   F                    N 
Sbjct  122  IFSFLDVSSLVSSSQVSRSWNQATYDDSLWRSQFDLHF--------------------NH  161

Query  658  QDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTS  837
            + + R ++ T    D + AFK+AY   +   VL S RG+CS+C S+VW DN +C N+   
Sbjct  162  KVLIRIQSGT----DCREAFKKAYIADNLSKVLRSGRGHCSHCDSIVWHDNFRCPNKQCR  217

Query  838  HGGKNHSVKPLSVEQIVDYITSNT  909
                N +++ LS  Q+V+Y+   T
Sbjct  218  LKSGNKALELLSTHQVVNYLLGIT  241



>gb|EEE64428.1| hypothetical protein OsJ_19272 [Oryza sativa Japonica Group]
Length=293

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/242 (37%), Positives = 133/242 (55%), Gaps = 40/242 (17%)
 Frame = +1

Query  103  ELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLL  282
            E     RYR +G+  AL+R + Y   C E++ +LR  Y  L K  Q+L+  D+LLAFRLL
Sbjct  12   ETGAAERYREMGISAALSRPWDYPTACGEIAALLRIGYGDLPKAAQALVAGDVLLAFRLL  71

Query  283  PEM---------------------------QTQASISAANALVQSVEATLPKQKRCIATK  381
            P+                            +T  ++SAAN L+Q+V+ +LPKQK+  A  
Sbjct  72   PDGTSSSPLATREEALLSYVDLSNYETLFERTGYALSAANGLLQAVDGSLPKQKKAQAVS  131

Query  382  EFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHMFQFLDIQTLLVAALVCRSWSQAASDNH  561
            EFK +++AHKRRA+   ++ G  H+P DV+ H+F FLD+++L+ A LVC  W+ AA+DNH
Sbjct  132  EFKRSVVAHKRRARVQ-QDPGVPHIPYDVLVHIFSFLDMRSLVAAGLVCWPWNSAANDNH  190

Query  562  LWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQDICRE------ETSTSTSVDWKNAFKR  723
            LW++ Y+ FFG   +N      C+   +A NVQ+          + S     +WK AF +
Sbjct  191  LWEMNYSLFFGICHIN------CNSTPTAGNVQNTDYHVQNSIYQVSPDPGFNWKEAFHK  244

Query  724  AY  729
             Y
Sbjct  245  KY  246



>gb|EPS65765.1| hypothetical protein M569_09012, partial [Genlisea aurea]
Length=297

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/268 (34%), Positives = 159/268 (59%), Gaps = 11/268 (4%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY  L L+++ +R   YS  C ELS IL + YSR  KNLQ+L+F+DIL A  +LP+M   
Sbjct  1    RYESLRLKESFSRASLYSYACRELSFILTHGYSRFPKNLQALVFEDILSALAILPQMPVH  60

Query  301  ASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAK-ANCEEQGPIHLPQDVIAH  477
              I++A+ L++SV++ LPK KR +A K++K A+I  KR++K  + E+ G   LP+++++H
Sbjct  61   --IASADPLMRSVKSVLPKYKRAVALKDYKQAMILCKRKSKQKHGEKDGANLLPREILSH  118

Query  478  MFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNV  657
            +F FLD+ +L+ A+ VCRSW++AA++ H+W+ +YT  F          ++          
Sbjct  119  IFLFLDMPSLVSASAVCRSWNEAANEKHIWKSLYTAHFDFFLTFLGLTLDDDYDYDDDYD  178

Query  658  QDICREETSTSTSVDWKNAFKRAYKDM-----SSKLVLTSQRGYCSYCCSVVWL-DNGKC  819
             D   +    + + DW+  F++ +KD+     + + +  S+RG+C  C  +VWL D   C
Sbjct  179  YDYDYDYKEVAAADDWRFKFQQKHKDLRIWISAYRNLFRSKRGFCGGCDCIVWLNDASNC  238

Query  820  SNE--HTSHGGKNHSVKPLSVEQIVDYI  897
             NE  ++   G  H +  ++V  +++Y+
Sbjct  239  WNEPSNSEKDGIKHRISSVTVRGVIEYV  266



>ref|XP_009119819.1| PREDICTED: F-box protein At5g52880 [Brassica rapa]
Length=283

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 105/265 (40%), Positives = 147/265 (55%), Gaps = 24/265 (9%)
 Frame = +1

Query  115  TSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQ  294
            T RY+ L + +AL+ ++ Y   CNELS I+   YS+L K+L++ IF D L AFRLLPEM 
Sbjct  20   TKRYQNLKVAEALSNNHLYPFACNELSSIIDLGYSQLPKDLKAFIFRDCLSAFRLLPEMN  79

Query  295  TQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIA  474
            T A++SAAN LV+SVE+  PKQK+ +A  EFK A +A KRR K++ E      LPQD++ 
Sbjct  80   TSAAVSAANLLVKSVESAFPKQKKNLAIVEFKQAKVALKRRTKSHDEHIDLPSLPQDILV  139

Query  475  HMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQN  654
            H+F FLD+ +LL ++ V RSW+QA S+  LW+ ++   F    L                
Sbjct  140  HIFSFLDLYSLLSSSQVSRSWNQATSEGSLWRSLFDLHFTHKVL----------------  183

Query  655  VQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHT  834
                          +DW+ AFK  Y    S  +L S RGYCSYC SVVW DN +C  +  
Sbjct  184  --------IHIYPGIDWREAFKNEYILYKSSKMLRSGRGYCSYCDSVVWHDNLRCPKKQC  235

Query  835  SHGGKNHSVKPLSVEQIVDYITSNT  909
                    +  +   Q+V+Y+   T
Sbjct  236  RLKSGKKPLDLMLTHQVVNYLLGTT  260



>ref|XP_008437546.1| PREDICTED: F-box protein At5g52880 isoform X3 [Cucumis melo]
Length=229

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 132/208 (63%), Gaps = 14/208 (7%)
 Frame = +1

Query  289  MQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDV  468
            MQT ++ SAA  L Q+VEA LPKQKR     E+K A++ HKRR+KA+ EE+G   LPQDV
Sbjct  1    MQTSSAASAARLLAQAVEAALPKQKRNSVIVEYKKAMVVHKRRSKAHQEEKGSCQLPQDV  60

Query  469  IAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSA  648
            + H+F+FLD+Q+L  A LVCRSW+ AA D +LWQL YT FFG  P ++S  +        
Sbjct  61   LLHIFRFLDVQSLGSAGLVCRSWNVAADDEYLWQLQYTTFFGC-PDDNSKPI--------  111

Query  649  QNVQDICREETSTSTS-VDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSN  825
             N +D   +  S+ST  VDWK  FK+AY   S     T  RGYC +C ++V     +C+N
Sbjct  112  -NDKDSEDDFASSSTPHVDWKEEFKKAYVGNSLGRN-TCGRGYCKHCDTIVSFSTLRCTN  169

Query  826  EHTSHGGKNHSVKPLSVEQIVDYITSNT  909
            +H  +  KN  +KPLS+ Q+V+Y+ + +
Sbjct  170  DHGRN--KNKQIKPLSINQVVEYVLNGS  195



>dbj|BAJ95216.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=310

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 98/251 (39%), Positives = 153/251 (61%), Gaps = 11/251 (4%)
 Frame = +1

Query  94   RMEELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAF  273
            R ++     RY  +G+  AL+R + Y   C EL+ +LR+ Y+ L K  Q+L   D+L+AF
Sbjct  9    RPQDTGVVKRYTEMGIAAALSRPWDYPTACRELAELLRHGYAGLPKAAQALAAADVLVAF  68

Query  274  RLLPEMQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIH  453
            R LP++QT+ +++AAN L+ +VEA+LPKQK+  A  EFK ++I HKRRAK   +E GP H
Sbjct  69   RRLPDVQTEHALAAANGLLLAVEASLPKQKKSQAVSEFKCSVILHKRRAKVQ-QEPGPPH  127

Query  454  LPQDVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNS-----SN  618
            +P DV+ H+F FLD+++L+ A+LVC  W+ +A+DN LW+  Y+ FF  S L+S     S+
Sbjct  128  IPNDVLIHIFSFLDMRSLVAASLVCWPWNSSANDNKLWKTNYSLFFSASHLSSNSTPVSS  187

Query  619  DVECSRCTSAQNVQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVV  798
             ++ S     QN  D   ++     +++WK  F+  + +  S    +S R  C  C S++
Sbjct  188  GIQNSHALLVQNNVDPVFDD----PNLNWKEVFRNKHAECIS-WSASSNRAICQQCRSIL  242

Query  799  WLDNGKCSNEH  831
            WL N  C+  H
Sbjct  243  WLSNLTCAAPH  253



>gb|AFW78802.1| hypothetical protein ZEAMMB73_046522 [Zea mays]
 gb|AFW78803.1| hypothetical protein ZEAMMB73_046522 [Zea mays]
Length=152

 Score =   149 bits (377),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 97/142 (68%), Gaps = 1/142 (1%)
 Frame = +1

Query  103  ELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLL  282
            E     RYR +G+  AL+R + Y   C EL+ +LR  Y+ L K  Q+L+  D+LLAFRLL
Sbjct  12   ETGAAERYREMGIGAALSRPWDYPTACGELAALLRLGYADLPKAAQALVASDVLLAFRLL  71

Query  283  PEMQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQ  462
            P++QT  ++S AN L+Q+VE  LPKQK+  A  EFKH+IIAHKRRA+   +  G  H+PQ
Sbjct  72   PDVQTGYAVSTANVLLQAVEVALPKQKKAQAVSEFKHSIIAHKRRARVQ-QISGSPHIPQ  130

Query  463  DVIAHMFQFLDIQTLLVAALVC  528
            D++ H+F FLD+ +L+ A LVC
Sbjct  131  DILVHIFSFLDMHSLVAAGLVC  152



>ref|XP_010231136.1| PREDICTED: F-box protein At5g52880 isoform X3 [Brachypodium distachyon]
Length=271

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 90/273 (33%), Positives = 137/273 (50%), Gaps = 55/273 (20%)
 Frame = +1

Query  94   RMEELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAF  273
            R +E     RY+ +G+  AL+R + Y   C EL+ +LR+ Y+ L K  ++L+  D+L AF
Sbjct  15   RRQENGIVKRYKEMGIAAALSRPWDYPTACRELAELLRHGYAGLPKAAKALVASDVLTAF  74

Query  274  RLLPEMQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIH  453
            RLLP++ T  ++ AAN L+Q+VE +LPKQK+  A  EFK +++AHKRRA+   +E GP H
Sbjct  75   RLLPDVHTGYALPAANGLLQAVEVSLPKQKKSQAISEFKCSVVAHKRRARVQ-QEPGPPH  133

Query  454  LPQDVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECS  633
            +P DV+ H+F FLD+++L+ A LVC                                   
Sbjct  134  IPHDVLVHIFSFLDMRSLVAAGLVC-----------------------------------  158

Query  634  RCTSAQNVQDICREETSTSTSVDWKNAF--KRAYKDMSSKLVLTSQRGYCSYCCSVVWLD  807
                       C +  S  +S++WK  F  KRA   + S     S +  C  C +++WL 
Sbjct  159  -----------CTDPVSGDSSLNWKEVFHNKRAEYILWSS---ASNKAVCRQCQAIIWLS  204

Query  808  NGKCSNEHT-SHGGKNHSVK--PLSVEQIVDYI  897
            N  C+  H   +  +   VK  PL    +  YI
Sbjct  205  NLTCAAPHQCPNKNEKDGVKLTPLLPSTVTGYI  237



>ref|XP_010555699.1| PREDICTED: F-box protein At5g52880 isoform X2 [Tarenaya hassleriana]
Length=212

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 90/235 (38%), Positives = 126/235 (54%), Gaps = 27/235 (11%)
 Frame = +1

Query  289  MQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQ-GPIHLPQD  465
            MQT A++SAA  L++SVEA LPKQKR +A  E KH+ +A KR +K   EE+     LP+D
Sbjct  1    MQTSAAVSAAQLLLKSVEAVLPKQKRNLAIAELKHSKVAMKRHSKTREEEELDSPQLPED  60

Query  466  VIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTS  645
            V+ H+F FLD+ +L+ AA VCRSW+ AA DN+LWQ  Y   F  S               
Sbjct  61   VLRHIFSFLDVASLVSAAQVCRSWNLAAYDNNLWQKKYDLLFKDSS--------------  106

Query  646  AQNVQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSN  825
                     +  +  T +DW+  FK +Y   +    L S  GYC YC S+VW ++ +C  
Sbjct  107  ---------QSLTQKTDIDWRETFKNSYIAENLSKALRSTWGYCWYCDSIVWHNSLRCPK  157

Query  826  EHTSHGGKNHSVKPLSVEQIVDYITSNTLPGsyssdsdledsdyeslFKLWAYPK  990
            E          V  +S +Q+V+YI         ++ S   +SD ES++ LWAYPK
Sbjct  158  EQCRLKSGGKLVDHISTQQVVEYIMGGL---QSNTYSSESESDEESVYGLWAYPK  209



>ref|XP_006401768.1| hypothetical protein EUTSA_v10014697mg [Eutrema salsugineum]
 gb|ESQ43221.1| hypothetical protein EUTSA_v10014697mg [Eutrema salsugineum]
Length=206

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 112/203 (55%), Gaps = 24/203 (12%)
 Frame = +1

Query  289  MQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDV  468
            M+T A++SAAN L++SVEA LPKQK+ +A  EFK   +A KRR+K++ E+     LPQD+
Sbjct  1    MKTSAAVSAANLLLKSVEAVLPKQKKNLAIVEFKKTKVALKRRSKSHEEDIDLPSLPQDI  60

Query  469  IAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSA  648
            + H+F FLD+ +LL ++ V RSW+QA  ++ LW+L Y   F    L              
Sbjct  61   LIHIFSFLDVSSLLSSSQVSRSWNQATCEDSLWRLQYDIHFNHKAL--------------  106

Query  649  QNVQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNE  828
                          + V W+ AFK AY   +S   L S RGYC YC SVVW +N +C N+
Sbjct  107  ----------IRIQSGVSWREAFKNAYIGDNSSKDLRSGRGYCCYCDSVVWHENLRCPNK  156

Query  829  HTSHGGKNHSVKPLSVEQIVDYI  897
                   N  ++ +S  Q+ +++
Sbjct  157  QCRLKSDNEPLELMSTRQVANFL  179



>ref|XP_001754423.1| predicted protein [Physcomitrella patens]
 gb|EDQ80873.1| predicted protein [Physcomitrella patens]
Length=134

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 83/139 (60%), Gaps = 12/139 (9%)
 Frame = +1

Query  169  YSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQASISAANALVQSVEAT  348
            Y   C EL  IL+  Y    K LQS++++D++ AFR LPEM+ +  + AA  L+Q+VE  
Sbjct  2    YVEACKELQGILKAVYKSAPKPLQSILYEDVVHAFRSLPEMENKQQLEAARLLLQTVEDV  61

Query  349  LPKQKRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQ------DVIAHMFQFLDIQTLL  510
             PKQ+R  A  + K A+I   R+ K       P  LP+      D + H+F++LD Q+L 
Sbjct  62   FPKQRRASAALQHKIAMITWHRQFK------YPEPLPECSQLSGDTLLHVFEYLDPQSLA  115

Query  511  VAALVCRSWSQAASDNHLW  567
            +A+ VCR+W+ AA+DN LW
Sbjct  116  IASAVCRTWNVAATDNALW  134



>ref|XP_001756940.1| predicted protein [Physcomitrella patens]
 gb|EDQ78171.1| predicted protein [Physcomitrella patens]
Length=303

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 83/282 (29%), Positives = 131/282 (46%), Gaps = 30/282 (11%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RYR L L +AL+R   Y+  C EL  ILR  Y     + Q+L+++D+  AF  L + + +
Sbjct  4    RYRSLQLNEALSRRNDYAEACRELRCILRAVYVYAPISFQALLYEDVEHAFHTLSKKEKR  63

Query  301  AS----ISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCEEQGP--IHLPQ  462
                  +  A  L+Q+VE     Q       + K A     R       E  P  +HL  
Sbjct  64   MDDIRHLETAKLLLQTVEQIFSSQNCTEVVAKGKTATKTWHRLYNNRNPEPLPEYLHLSG  123

Query  463  DVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCT  642
            D++ H+F++LD ++L  A+ VCR+W+  A+D  +W+  +   +GTS  N   D+     T
Sbjct  124  DILLHVFEYLDARSLATASAVCRAWNVIATDGKIWRNWFLYVYGTS--NLREDL----MT  177

Query  643  SAQNVQDICRE--------ETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVV  798
            +A+  +DI  +        + S +    W+ AF    K  S  L  T  R YC  C  V+
Sbjct  178  AAEIREDIIPDSNRPTILKKPSNNAVGYWRKAFNLCSKGRSPHLS-TLNRAYCPTCKEVI  236

Query  799  WLDN-------GKCSNEHTSHGGKNHSVKPLSVEQIVDYITS  903
            WL +       G C         + HS +P+SV Q+V ++ S
Sbjct  237  WLRDPPWKPAKGLCVTR--EQVLEYHSPRPISVSQVVRFVVS  276



>ref|XP_007220158.1| hypothetical protein PRUPE_ppa018659mg [Prunus persica]
 gb|EMJ21357.1| hypothetical protein PRUPE_ppa018659mg [Prunus persica]
Length=85

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPEMQTQ  300
            RY+ LGL+++L R + Y + C +LSLILR AY ++ KNLQSLIF D L AFRLLPE  ++
Sbjct  7    RYQKLGLKESLPRIHRYPLACKKLSLILRGAYKKIPKNLQSLIFQDTLTAFRLLPEYYSR  66

Query  301  ASISAANALVQ  333
            +++ A   L Q
Sbjct  67   SALFARRVLFQ  77



>ref|XP_007219857.1| hypothetical protein PRUPE_ppa027224mg [Prunus persica]
 gb|EMJ21056.1| hypothetical protein PRUPE_ppa027224mg [Prunus persica]
Length=67

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  121  RYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLAFRLLPE  288
            RY+ LGL+++L R + Y + C ELSLILR AY ++ KNLQSLIF D L AFRLLP+
Sbjct  7    RYQKLGLKESLPRIHRYPLACKELSLILRGAYKKIPKNLQSLIFQDTLTAFRLLPD  62



>ref|XP_005843251.1| hypothetical protein CHLNCDRAFT_141366 [Chlorella variabilis]
 gb|EFN51149.1| hypothetical protein CHLNCDRAFT_141366 [Chlorella variabilis]
Length=331

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 87/174 (50%), Gaps = 28/174 (16%)
 Frame = +1

Query  124  YRWLGLRDALNRHYHYSIVCNELSLILRNAYS-RLSKNLQSLIFDDILLAFRLL-PEMQT  297
            Y  L L   L R   +++   EL+ I+R+ Y+ R SK +Q+LI  D+ LA       +Q+
Sbjct  32   YLSLQLAAGLRRPADFAVAALELAAIVRHLYAERCSKPVQALILQDVALAIDTCDARLQS  91

Query  298  QASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANCE--------------  435
            +A++++   L+++ E  LP+ KR    + +K + +  +RR +   +              
Sbjct  92   RAALAS---LMEAAERHLPQAKRKDLARRYKRSSMQLRRRERRGPQGSSAAAAGGAGSGD  148

Query  436  ------EQGPI---HLPQDVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQ  570
                  EQ P    HLP DV+AH+ ++LD  TL  AA V R W  AA  + LWQ
Sbjct  149  ESDGPDEQQPATFEHLPLDVMAHVLRYLDPITLARAACVSREWRDAACADALWQ  202



>ref|XP_002508069.1| cyclin like protein [Micromonas sp. RCC299]
 gb|ACO69327.1| cyclin like protein [Micromonas sp. RCC299]
Length=315

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 80/155 (52%), Gaps = 12/155 (8%)
 Frame = +1

Query  121  RYRWLGLRDALNRHY--HYSIVCNELSLILRNAYS--RLSKNLQSLIFDDILLAFRLLPE  288
            +YR L +  A+ R      ++  +EL+++L + +S  R  K+ + LIF+D++ A R +  
Sbjct  28   KYRRLRIGAAIARGQPTEVAVAFSELAVLLDDWWSDWRSEKDARELIFEDLMAAARAMAT  87

Query  289  MQTQASISAANALVQSVEATLPKQKRCIATKEFKHAIIAHKRRAKANC-----EEQGPIH  453
            +  Q  + A + L++S +  L  QK+    KE+K + +A KR  K        +E GP  
Sbjct  88   IGGQRQLDAGSRLLKSAQRVLKAQKKSAVEKEYKRSAVARKRSEKRGAFDSDEDEDGPTQ  147

Query  454  ---LPQDVIAHMFQFLDIQTLLVAALVCRSWSQAA  549
               LPQD++  +F+ L    L  AA V RSW   A
Sbjct  148  FTELPQDIMDLVFRKLYAWDLARAACVSRSWRDTA  182



>ref|NP_001174497.1| Os05g0526300 [Oryza sativa Japonica Group]
 dbj|BAH93225.1| Os05g0526300, partial [Oryza sativa Japonica Group]
Length=156

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 63/131 (48%), Gaps = 15/131 (11%)
 Frame = +1

Query  529  RSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVECSRCTSAQNVQDICRE------ETSTS  690
            R W+ AA+DNHLW++ Y+ FFG   +N      C+   +A NVQ+          + S  
Sbjct  1    RPWNSAANDNHLWEMNYSLFFGICHIN------CNSTPTAGNVQNTDYHVQNSIYQVSPD  54

Query  691  TSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEH--TSHGGKNHSVK  864
               +WK AF + Y +  +     S R  C YC SV+WL +  C+  H   ++G     + 
Sbjct  55   PGFNWKEAFHKKYAEQET-WSSASNRALCGYCRSVIWLCDLTCATPHYCLNNGKDGVKLG  113

Query  865  PLSVEQIVDYI  897
            PL    + DYI
Sbjct  114  PLLPHTVADYI  124



>gb|ADM75674.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75677.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75691.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75695.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75699.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75707.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75710.1| SKP1-interacting-like protein, partial [Picea sitchensis]
Length=173

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 81/168 (48%), Gaps = 10/168 (6%)
 Frame = +1

Query  529   RSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVEC--SRCTSAQNVQDICREETSTSTSVD  702
             RSW+ A  +N LW+  Y+  FG    N++   +C  +   +   ++    ++       D
Sbjct  1     RSWNLAGKENTLWKAQYSLHFGDDLPNNALVKQCMNNALDNEGGIRHQRPQKPELRVHTD  60

Query  703   WKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCS-NEHTSHGGKNHSVKPLSVE  879
             W  AFK+ Y+   S++V+ S R YC  C S +WL+N     +  T      H +KP+   
Sbjct  61    WHEAFKKRYRGHPSRVVM-SDRAYCKTCKSPIWLNNKSVDLDGSTIKKNHQHMLKPMLPG  119

Query  880   QIVDYITSNTLPGsyssdsdledsdyeslF------KLWAYPKRIAKS  1005
             Q++ ++  +++  S SS SD +      L       KLWAYPK I KS
Sbjct  120   QVLHFLLRDSMASSSSSSSDSDSDSEGVLIVEQRFSKLWAYPKLIQKS  167



>gb|ADM75673.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75675.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75676.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75678.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75679.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75680.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75681.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75682.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75683.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75685.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75687.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75689.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75690.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75692.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75693.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75694.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75696.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75697.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75698.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75700.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75701.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75702.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75704.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75705.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75706.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75708.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75709.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75711.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75712.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75713.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75714.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75715.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75716.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75717.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75718.1| SKP1-interacting-like protein, partial [Picea sitchensis]
Length=173

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 81/168 (48%), Gaps = 10/168 (6%)
 Frame = +1

Query  529   RSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVEC--SRCTSAQNVQDICREETSTSTSVD  702
             RSW+ A  +N LW+  Y+  FG    N++   +C  +   +   ++    ++       D
Sbjct  1     RSWNLAGKENTLWKAQYSLHFGDDLPNNALVKQCMNNALDNEGGIRHQRLQKPELRVHTD  60

Query  703   WKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCS-NEHTSHGGKNHSVKPLSVE  879
             W  AFK+ Y+   S++V+ S R YC  C S +WL+N     +  T      H +KP+   
Sbjct  61    WHEAFKKRYRGHPSRVVM-SDRAYCKTCKSPIWLNNKSVDLDGSTIKKNHQHMLKPMLPG  119

Query  880   QIVDYITSNTLPGsyssdsdledsdyeslF------KLWAYPKRIAKS  1005
             Q++ ++  +++  S SS SD +      L       KLWAYPK I KS
Sbjct  120   QVLHFLLRDSMASSSSSSSDSDSDSEGVLIVEQRFSKLWAYPKLIQKS  167



>gb|ADM75684.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75686.1| SKP1-interacting-like protein, partial [Picea sitchensis]
 gb|ADM75688.1| SKP1-interacting-like protein, partial [Picea sitchensis]
Length=173

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 80/168 (48%), Gaps = 10/168 (6%)
 Frame = +1

Query  529   RSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVEC--SRCTSAQNVQDICREETSTSTSVD  702
             RSW+ A  +N LW+  Y+  FG    N +   +C  +   +   ++    ++       D
Sbjct  1     RSWNLAGKENTLWKAQYSLHFGDDLPNIALVKQCMNNALDNEGGIRHQRLQKPELRVHTD  60

Query  703   WKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCS-NEHTSHGGKNHSVKPLSVE  879
             W  AFK+ Y+   S++V+ S R YC  C S +WL+N     +  T      H +KP+   
Sbjct  61    WHEAFKKRYRGHPSRVVM-SDRAYCKTCKSPIWLNNKSVDLDGSTIKKNHQHMLKPMLPG  119

Query  880   QIVDYITSNTLPGsyssdsdledsdyeslF------KLWAYPKRIAKS  1005
             Q++ ++  +++  S SS SD +      L       KLWAYPK I KS
Sbjct  120   QVLHFLLRDSMASSSSSSSDSDSDSEGVLIVEQRFSKLWAYPKLIQKS  167



>gb|ADM75703.1| SKP1-interacting-like protein, partial [Picea sitchensis]
Length=173

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 80/168 (48%), Gaps = 10/168 (6%)
 Frame = +1

Query  529   RSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVEC--SRCTSAQNVQDICREETSTSTSVD  702
             RSW+ A  +N LW+  Y+  FG    N++   +C  +   +   ++    ++       D
Sbjct  1     RSWNLAGKENTLWKAQYSLHFGNDLPNNALVKQCMNNALDNEGGIRHQRLQKPELRVHTD  60

Query  703   WKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCS-NEHTSHGGKNHSVKPLSVE  879
             W  AFK+ Y+   S++V+ S R YC  C S +W +N     +  T      H +KP+   
Sbjct  61    WHEAFKKRYRGHPSRVVM-SDRAYCKTCKSPIWFNNKSVDLDGSTIKKNHQHMLKPMLPG  119

Query  880   QIVDYITSNTLPGsyssdsdledsdyeslF------KLWAYPKRIAKS  1005
             Q++ ++  +++  S SS SD +      L       KLWAYPK I KS
Sbjct  120   QVLHFLLRDSMASSSSSSSDSDSDSEGVLIVEQRFSKLWAYPKLIQKS  167



>ref|XP_002994646.1| hypothetical protein SELMODRAFT_432551, partial [Selaginella 
moellendorffii]
 gb|EFJ04287.1| hypothetical protein SELMODRAFT_432551, partial [Selaginella 
moellendorffii]
Length=314

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 75/159 (47%), Gaps = 16/159 (10%)
 Frame = +1

Query  451  HLPQDVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPLNSSNDVEC  630
             LP DV+ H+F FLD  +L  A  VCRSW+    D +LWQ ++T     +  + +  ++ 
Sbjct  127  QLPVDVLVHVFSFLDPISLATAGCVCRSWNSEYKDANLWQKLFTVVLENTSFDPTRVLQL  186

Query  631  S-------RCTSAQNVQDICREETSTSTSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCC  789
            +         ++   V+D+  ++        WK AF+ A    S KL+    R  C  C 
Sbjct  187  AGFELGDDDSSTPLRVKDVSIQKIGC-----WKKAFEIAVL-RSPKLLYLFTRAQCLTCK  240

Query  790  SVVW---LDNGKCSNEHTSHGGKNHSVKPLSVEQIVDYI  897
            +  W   L     +N+ +    + H ++PL +EQ+V ++
Sbjct  241  ATFWSSELCLQTFANQCSKKNFQEHKLRPLLLEQVVSFV  279



>dbj|BAH57056.1| AT5G52880 [Arabidopsis thaliana]
 dbj|BAH57135.1| AT5G52880 [Arabidopsis thaliana]
 dbj|BAH57244.1| AT5G52880 [Arabidopsis thaliana]
Length=102

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +1

Query  691  TSVDWKNAFKRAYKDMSSKLVLTSQRGYCSYCCSVVWLDNGKCSNEHTSHGGKNHSVKPL  870
            + +DW+ AFK+AY   +S   L S RGYCSYC S+VW +N +C N+       N  +  +
Sbjct  3    SDIDWREAFKKAYIAANSSEALRSGRGYCSYCDSIVWHENLRCLNKQCRLKSGNKPLDLI  62

Query  871  SVEQIVDYI  897
            +  Q+V+Y+
Sbjct  63   TTHQVVNYL  71



>gb|ADN33778.1| ATP binding protein [Cucumis melo subsp. melo]
Length=837

 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +1

Query  91   WRMEELSQTSRYRWLGLRDALNRHYHYSIVCNELSLILRNAYSRLSKNLQSLIFDDILLA  270
            +R    +   RY  L L D+L + Y Y + C ELS ++R A+ +L KNLQSLI+  I+ A
Sbjct  772  YRFRMSNPLERYHKLSLIDSLGKSYSYPLACKELSFLIRGAFIKLPKNLQSLIYQHIITA  831

Query  271  FRLLPE  288
            F LLPE
Sbjct  832  FHLLPE  837



>ref|XP_002491088.1| F-box receptor protein, subunit of the Skp1-Cdc53-F-box receptor 
(SCF) E3 ubiquitin ligase complex [Komagataella pastoris 
GS115]
 emb|CAY68808.1| F-box receptor protein, subunit of the Skp1-Cdc53-F-box receptor 
(SCF) E3 ubiquitin ligase complex [Komagataella pastoris 
GS115]
 emb|CCA38784.1| F-box/WD repeat-containing protein pof10 [Komagataella pastoris 
CBS 7435]
Length=686

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 0/62 (0%)
 Frame = +1

Query  427  NCEEQGPIHLPQDVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTSPL  606
            N   +G   LP +V+  +F FLD  TL   +LVC+ W    +DN LW+  +  FFG+   
Sbjct  22   NVPVRGLPELPSEVLVTIFSFLDPMTLDGLSLVCKRWKMVINDNELWRENFIKFFGSKQF  81

Query  607  NS  612
             S
Sbjct  82   QS  83



>emb|CDP01257.1| unnamed protein product [Coffea canephora]
Length=171

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +1

Query  361  KRCIATKEFKHAIIAHKRRAKANCEEQGPIHLPQDVIAHMFQFLDIQTLLVAALVCRSWS  540
            KR +   E +  II  K RA+ +C     +    +++  + + +D +TL  AA V + WS
Sbjct  2    KRPVIAGE-EDQIIKKKTRAEEDCGAGEAVLSDDNLLYEVLKHVDARTLAAAACVSQQWS  60

Query  541  QAASDNHLWQLIYTNFFGTSPL  606
            +AA D  LW+LI T  +  +PL
Sbjct  61   RAAQDERLWELICTEHYAKNPL  82



>ref|XP_001819893.1| F-box and WD40 domain protein [Aspergillus oryzae RIB40]
 dbj|BAE57891.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EIT76717.1| beta-TrCP/Slimb protein [Aspergillus oryzae 3.042]
 gb|KDE80482.1| beta-TrCP /Slimb protein [Aspergillus oryzae 100-8]
Length=673

 Score = 51.2 bits (121),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +1

Query  451  HLPQDVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTS-PLNSS  615
            HLP +V++H+F +LD Q+L+    V  +WS+ AS  H+W+ ++ + +G S P+ +S
Sbjct  240  HLPPEVMSHIFTYLDPQSLMQCESVSHAWSEQASSRHIWRHVFRHTYGHSRPVGAS  295



>ref|XP_002374577.1| F-box and WD40 domain protein, putative [Aspergillus flavus NRRL3357]
 gb|EED55795.1| F-box and WD40 domain protein, putative [Aspergillus flavus NRRL3357]
Length=689

 Score = 51.2 bits (121),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +1

Query  451  HLPQDVIAHMFQFLDIQTLLVAALVCRSWSQAASDNHLWQLIYTNFFGTS-PLNSS  615
            HLP +V++H+F +LD Q+L+    V  +WS+ AS  H+W+ ++ + +G S P+ +S
Sbjct  240  HLPPEVMSHIFTYLDPQSLMQCESVSHAWSEQASSRHIWRHVFRHTYGHSRPVGAS  295



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2653716996480