BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18445_g1_i3 len=1060 path=[921:0-287 1861:288-404 1209:405-625
1430:626-1059]

Length=1060
                                                                      Score     E

ref|XP_009758852.1|  PREDICTED: universal stress protein A-like p...    204   2e-60   
ref|XP_009588426.1|  PREDICTED: universal stress protein A-like p...    201   4e-59   
ref|XP_011094180.1|  PREDICTED: universal stress protein A-like p...    199   8e-59   
gb|EYU18171.1|  hypothetical protein MIMGU_mgv1a026609mg                197   4e-58   
emb|CDP10546.1|  unnamed protein product                                201   1e-57   
ref|XP_004229048.1|  PREDICTED: universal stress protein A-like p...    196   2e-57   
gb|AIR07400.1|  universal stress protein A                              195   2e-57   
ref|XP_006337956.1|  PREDICTED: universal stress protein A-like p...    190   4e-55   
gb|KCW48157.1|  hypothetical protein EUGRSUZ_K01888                     187   7e-54   
ref|XP_010036539.1|  PREDICTED: universal stress protein A-like p...    187   3e-53   
ref|XP_004229049.1|  PREDICTED: universal stress protein A-like p...    182   2e-52   
ref|NP_850563.1|  universal stress protein-like protein                 184   2e-52   Arabidopsis thaliana [mouse-ear cress]
gb|KDO70762.1|  hypothetical protein CISIN_1g044973mg                   183   3e-52   
ref|XP_006429980.1|  hypothetical protein CICLE_v10012835mg             183   3e-52   
ref|XP_002266746.3|  PREDICTED: universal stress protein A-like p...    182   8e-52   Vitis vinifera
ref|XP_006481854.1|  PREDICTED: universal stress protein A-like p...    181   1e-51   
gb|AID16045.1|  putative universal stress protein                       177   2e-50   
ref|XP_006481852.1|  PREDICTED: universal stress protein A-like p...    176   9e-50   
gb|KDO70763.1|  hypothetical protein CISIN_1g046290mg                   176   1e-49   
ref|NP_566406.1|  universal stress protein-like protein                 176   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850562.1|  universal stress protein-like protein                 175   3e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407393.1|  hypothetical protein EUTSA_v10021565mg             175   3e-49   
ref|XP_006407394.1|  hypothetical protein EUTSA_v10021565mg             175   3e-49   
ref|NP_001030675.1|  universal stress protein-like protein              175   4e-49   Arabidopsis thaliana [mouse-ear cress]
gb|KDP21925.1|  hypothetical protein JCGZ_03063                         174   4e-49   
ref|XP_010653225.1|  PREDICTED: universal stress protein A-like p...    175   5e-49   
ref|XP_002882756.1|  universal stress protein family protein            174   5e-49   
ref|XP_006429978.1|  hypothetical protein CICLE_v10012833mg             174   1e-48   
ref|XP_010263144.1|  PREDICTED: universal stress protein A-like p...    173   2e-48   
ref|XP_004303418.1|  PREDICTED: universal stress protein YxiE-like      173   2e-48   
ref|XP_010498281.1|  PREDICTED: uncharacterized protein LOC104775...    172   3e-48   
ref|XP_010486865.1|  PREDICTED: uncharacterized protein LOC104764...    172   4e-48   
ref|XP_010498273.1|  PREDICTED: uncharacterized protein LOC104775...    172   5e-48   
ref|XP_010486864.1|  PREDICTED: uncharacterized protein LOC104764...    172   5e-48   
emb|CDY47907.1|  BnaAnng09390D                                          172   6e-48   
ref|XP_009121035.1|  PREDICTED: uncharacterized protein LOC103845...    172   6e-48   
ref|XP_007202546.1|  hypothetical protein PRUPE_ppa011155mg             172   7e-48   
gb|AAM66054.1|  ethylene-responsive protein, putative                   172   7e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135196.1|  PREDICTED: uncharacterized protein LOC103859...    171   7e-48   
ref|XP_010498264.1|  PREDICTED: uncharacterized protein LOC104775...    172   7e-48   
ref|XP_010486863.1|  PREDICTED: uncharacterized protein LOC104764...    172   8e-48   
ref|XP_009121027.1|  PREDICTED: uncharacterized protein LOC103845...    171   8e-48   
ref|XP_009135195.1|  PREDICTED: uncharacterized protein LOC103859...    171   8e-48   
ref|XP_010464927.1|  PREDICTED: uncharacterized protein LOC104745...    171   1e-47   
ref|XP_010105075.1|  Universal stress protein A-like protein            171   1e-47   
ref|XP_002323356.2|  hypothetical protein POPTR_0016s06400g             171   1e-47   Populus trichocarpa [western balsam poplar]
ref|XP_010464928.1|  PREDICTED: universal stress protein A-like p...    170   2e-47   
ref|XP_010464931.1|  PREDICTED: universal stress protein A-like p...    169   3e-47   
ref|XP_010464930.1|  PREDICTED: universal stress protein A-like p...    169   4e-47   
ref|XP_006296619.1|  hypothetical protein CARUB_v10014583mg             170   4e-47   
ref|XP_006296620.1|  hypothetical protein CARUB_v10014583mg             170   6e-47   
ref|XP_008241214.1|  PREDICTED: uncharacterized protein LOC103339659    169   7e-47   
ref|XP_009376345.1|  PREDICTED: uncharacterized protein LOC103965052    168   2e-46   
ref|XP_006429977.1|  hypothetical protein CICLE_v10012833mg             167   2e-46   
ref|XP_009588427.1|  PREDICTED: universal stress protein A-like p...    166   6e-46   
ref|XP_011042515.1|  PREDICTED: universal stress protein A-like p...    165   1e-45   
ref|XP_006429979.1|  hypothetical protein CICLE_v10013408mg             165   3e-45   
ref|XP_011047113.1|  PREDICTED: uncharacterized protein LOC105141...    165   3e-45   
ref|XP_010263143.1|  PREDICTED: universal stress protein A-like p...    164   3e-45   
ref|XP_007202545.1|  hypothetical protein PRUPE_ppa011155mg             165   4e-45   
ref|XP_011047112.1|  PREDICTED: universal stress protein A-like p...    164   4e-45   
emb|CDY08484.1|  BnaA05g27200D                                          164   7e-45   
gb|AFK43196.1|  unknown                                                 163   1e-44   
ref|XP_007029143.1|  Adenine nucleotide alpha hydrolases-like sup...    162   1e-44   
ref|XP_007029142.1|  Adenine nucleotide alpha hydrolases-like sup...    161   2e-44   
ref|XP_010519995.1|  PREDICTED: universal stress protein A-like p...    162   4e-44   
ref|XP_010519994.1|  PREDICTED: universal stress protein A-like p...    161   6e-44   
ref|XP_006481853.1|  PREDICTED: universal stress protein A-like p...    161   7e-44   
gb|KDP21924.1|  hypothetical protein JCGZ_03062                         160   7e-44   
ref|XP_004504522.1|  PREDICTED: universal stress protein A-like p...    159   2e-43   
gb|KEH41787.1|  adenine nucleotide alpha hydrolase superfamily pr...    159   3e-43   
ref|XP_009146670.1|  PREDICTED: uncharacterized protein LOC103870298    159   5e-43   
gb|KFK38558.1|  hypothetical protein AALP_AA3G129200                    159   5e-43   
emb|CDY01070.1|  BnaC05g41300D                                          156   2e-42   
ref|XP_010524871.1|  PREDICTED: universal stress protein A-like p...    157   2e-42   
ref|XP_002308342.2|  hypothetical protein POPTR_0006s21250g             157   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_003519020.1|  PREDICTED: universal stress protein A-like p...    156   4e-42   
ref|XP_010524879.1|  PREDICTED: universal stress protein A-like p...    155   5e-42   
ref|XP_011094181.1|  PREDICTED: uncharacterized protein C167.05-like    155   5e-42   
gb|KFK35113.1|  hypothetical protein AALP_AA5G237800                    156   7e-42   
ref|XP_006293247.1|  hypothetical protein CARUB_v10019581mg             155   1e-41   
gb|KFK35112.1|  hypothetical protein AALP_AA5G237800                    155   2e-41   
emb|CDX67744.1|  BnaA07g17840D                                          155   2e-41   
ref|XP_010504800.1|  PREDICTED: uncharacterized protein LOC104781...    154   4e-41   
ref|XP_009593917.1|  PREDICTED: uncharacterized protein LOC104090...    152   4e-41   
ref|XP_010524887.1|  PREDICTED: universal stress protein A-like p...    152   7e-41   
ref|XP_010504799.1|  PREDICTED: uncharacterized protein LOC104781...    153   7e-41   
emb|CDP10547.1|  unnamed protein product                                152   1e-40   
ref|XP_009104144.1|  PREDICTED: universal stress protein A-like p...    152   3e-40   
ref|XP_007145747.1|  hypothetical protein PHAVU_007G264400g             150   4e-40   
emb|CBI39085.3|  unnamed protein product                                149   4e-40   
ref|XP_007202660.1|  hypothetical protein PRUPE_ppa012339mg             150   5e-40   
ref|XP_006402787.1|  hypothetical protein EUTSA_v10006473mg             150   9e-40   
ref|XP_008241135.1|  PREDICTED: universal stress protein A-like p...    149   1e-39   
ref|XP_002876463.1|  universal stress protein family protein            149   2e-39   
ref|XP_007145748.1|  hypothetical protein PHAVU_007G264400g             149   2e-39   
ref|NP_850717.1|  adenine nucleotide alpha hydrolases-like superf...    149   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191404.2|  adenine nucleotide alpha hydrolases-like superf...    149   3e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007029144.1|  Adenine nucleotide alpha hydrolases-like sup...    147   4e-39   
ref|XP_010516493.1|  PREDICTED: uncharacterized protein LOC104792...    148   6e-39   
ref|XP_010516491.1|  PREDICTED: uncharacterized protein LOC104792...    147   1e-38   
ref|XP_009795288.1|  PREDICTED: uncharacterized protein LOC104242017    148   1e-38   
ref|XP_010677621.1|  PREDICTED: universal stress protein A-like p...    146   2e-38   
gb|KEH41788.1|  adenine nucleotide alpha hydrolase superfamily pr...    145   3e-38   
ref|XP_009393020.1|  PREDICTED: universal stress protein A-like p...    144   1e-37   
ref|XP_008241215.1|  PREDICTED: uncharacterized protein LOC103339661    142   3e-36   
ref|XP_010534373.1|  PREDICTED: universal stress protein A-like p...    139   1e-35   
ref|XP_010917884.1|  PREDICTED: universal stress protein A-like p...    139   2e-35   
ref|XP_002467191.1|  hypothetical protein SORBIDRAFT_01g021200          138   2e-35   Sorghum bicolor [broomcorn]
ref|XP_010431458.1|  PREDICTED: universal stress protein A-like p...    137   2e-35   
gb|AAR87267.1|  putative stress-related protein                         137   5e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007029145.1|  Adenine nucleotide alpha hydrolases-like sup...    135   1e-34   
ref|XP_003559418.1|  PREDICTED: universal stress protein A-like p...    135   4e-34   
gb|ADB54817.1|  universal stress protein 9308                           134   5e-34   Hordeum vulgare subsp. vulgare [barley]
gb|ADB54816.1|  universal stress protein 9308                           132   2e-33   Hordeum vulgare subsp. vulgare [barley]
ref|XP_011094182.1|  PREDICTED: universal stress protein A-like p...    133   3e-33   
gb|EMS53028.1|  Universal stress protein A-like protein                 135   3e-33   
ref|XP_007202608.1|  hypothetical protein PRUPE_ppa011744mg             132   8e-33   
ref|XP_006650590.1|  PREDICTED: universal stress protein A-like p...    129   4e-32   
ref|XP_004983044.1|  PREDICTED: universal stress protein A-like p...    129   5e-32   
ref|XP_004981765.1|  PREDICTED: universal stress protein A-like p...    128   1e-31   
ref|XP_002463873.1|  hypothetical protein SORBIDRAFT_01g007990          127   2e-31   Sorghum bicolor [broomcorn]
ref|XP_009389841.1|  PREDICTED: universal stress protein A-like p...    126   9e-31   
gb|EMT31581.1|  Universal stress protein A-like protein                 125   1e-30   
gb|EPS58073.1|  hypothetical protein M569_16744                         123   1e-30   
emb|CDX98295.1|  BnaC06g16560D                                          125   2e-30   
gb|AGT17355.1|  hypothetical protein SHCRBa_260_G18_F_60                124   2e-30   
gb|EMT31582.1|  Universal stress protein A-like protein                 124   3e-30   
gb|EEC76183.1|  hypothetical protein OsI_13519                          124   4e-30   Oryza sativa Indica Group [Indian rice]
emb|CAB68183.1|  putative protein                                       122   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb|EMS48379.1|  Universal stress protein A-like protein                 123   2e-29   
ref|XP_009116521.1|  PREDICTED: uncharacterized protein C167.05-l...    122   3e-29   
ref|XP_010668291.1|  PREDICTED: universal stress protein A-like p...    118   1e-28   
emb|CDX71957.1|  BnaC08g29170D                                          120   1e-28   
ref|XP_009116523.1|  PREDICTED: uncharacterized protein C167.05-l...    119   2e-28   
ref|XP_009116522.1|  PREDICTED: uncharacterized protein C167.05-l...    119   2e-28   
ref|NP_001064677.1|  Os10g0437500                                       119   3e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009373939.1|  PREDICTED: uncharacterized protein C167.05-like    117   6e-28   
gb|EAY78646.1|  hypothetical protein OsI_33745                          118   6e-28   Oryza sativa Indica Group [Indian rice]
tpg|DAA51379.1|  TPA: ethylene-responsive protein isoform 1             118   7e-28   
ref|XP_008679881.1|  PREDICTED: ethylene-responsive protein isofo...    117   8e-28   
ref|XP_008352713.1|  PREDICTED: uncharacterized protein C167.05-like    117   9e-28   
ref|XP_008679887.1|  PREDICTED: ethylene-responsive protein isofo...    117   9e-28   
ref|XP_009116524.1|  PREDICTED: universal stress protein A-like p...    117   1e-27   
ref|XP_007223587.1|  hypothetical protein PRUPE_ppa012379mg             115   4e-27   
ref|XP_008679878.1|  PREDICTED: ethylene-responsive protein isofo...    115   5e-27   
gb|EPS60930.1|  hypothetical protein M569_13873                         111   2e-26   
ref|NP_001151646.1|  ethylene-responsive protein                        113   3e-26   Zea mays [maize]
ref|XP_009593918.1|  PREDICTED: universal stress protein A-like p...    110   5e-26   
ref|XP_002962652.1|  hypothetical protein SELMODRAFT_79236              112   6e-26   
ref|XP_008219288.1|  PREDICTED: universal stress protein A-like p...    111   1e-25   
emb|CDP11494.1|  unnamed protein product                                108   8e-25   
ref|XP_002285692.1|  PREDICTED: universal stress protein A-like p...    108   2e-24   Vitis vinifera
emb|CDY53924.1|  BnaC03g73550D                                          104   2e-24   
ref|XP_010475820.1|  PREDICTED: universal stress protein A-like p...    107   3e-24   
ref|XP_011016909.1|  PREDICTED: uncharacterized protein LOC105120...    107   3e-24   
ref|XP_002514027.1|  conserved hypothetical protein                     107   5e-24   Ricinus communis
gb|EEE59934.1|  hypothetical protein OsJ_12581                          112   5e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010490289.1|  PREDICTED: universal stress protein A-like p...    107   5e-24   
ref|XP_006305720.1|  hypothetical protein CARUB_v10010470mg             105   1e-23   
ref|XP_007018204.1|  Adenine nucleotide alpha hydrolases-like sup...    105   1e-23   
ref|NP_001051280.1|  Os03g0750000                                       104   2e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011023763.1|  PREDICTED: universal stress protein A-like p...    105   2e-23   
gb|EMT14537.1|  Universal stress protein A-like protein                 105   2e-23   
ref|XP_002319486.1|  hypothetical protein POPTR_0013s01110g             105   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_004148419.1|  PREDICTED: universal stress protein A-like p...    105   2e-23   
ref|XP_011016913.1|  PREDICTED: uncharacterized protein LOC105120...    105   2e-23   
ref|XP_007141257.1|  hypothetical protein PHAVU_008G180800g             105   3e-23   
ref|XP_006486684.1|  PREDICTED: uncharacterized protein C167.05-like    105   3e-23   
ref|XP_009770125.1|  PREDICTED: universal stress protein A-like p...    104   4e-23   
ref|XP_002302337.2|  ethylene-responsive family protein                 104   5e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010458272.1|  PREDICTED: universal stress protein A-like p...    103   5e-23   
gb|ADB54810.1|  universal stress protein 23267                          103   6e-23   Hordeum vulgare subsp. vulgare [barley]
gb|EMS51706.1|  Universal stress protein A-like protein                 103   7e-23   
gb|KDO35866.1|  hypothetical protein CISIN_1g038513mg                   100   7e-23   
gb|EMS51705.1|  Universal stress protein A-like protein                 103   8e-23   
ref|NP_172445.2|  adenine nucleotide alpha hydrolases-like protein      103   9e-23   Arabidopsis thaliana [mouse-ear cress]
gb|EYU18168.1|  hypothetical protein MIMGU_mgv1a023549mg                101   1e-22   
ref|XP_003544826.1|  PREDICTED: uncharacterized protein LOC100805...    103   1e-22   
gb|ADB54809.1|  universal stress protein 23267                          102   1e-22   Hordeum vulgare subsp. vulgare [barley]
ref|XP_002889767.1|  hypothetical protein ARALYDRAFT_471075             103   1e-22   
ref|XP_010544073.1|  PREDICTED: uncharacterized protein C167.05         102   2e-22   
ref|XP_009403083.1|  PREDICTED: uncharacterized protein LOC103986718    102   2e-22   
ref|XP_003580727.1|  PREDICTED: universal stress protein A-like p...    101   3e-22   
ref|XP_008444941.1|  PREDICTED: uncharacterized protein LOC103488134    102   3e-22   
gb|AID16041.1|  putative universal stress protein                       101   4e-22   
gb|AFK36153.1|  unknown                                                 102   4e-22   
ref|XP_006417542.1|  hypothetical protein EUTSA_v10008924mg             101   4e-22   
ref|XP_003615271.1|  Universal stress protein A-like protein            101   4e-22   
ref|XP_004299723.1|  PREDICTED: universal stress protein A-like p...    101   4e-22   
ref|XP_004490433.1|  PREDICTED: universal stress protein Rv2026c/...    101   4e-22   
ref|XP_004490436.1|  PREDICTED: universal stress protein Rv2026c/...    101   5e-22   
gb|EMT03450.1|  Universal stress protein A-like protein                 101   5e-22   
emb|CDY20676.1|  BnaC08g13820D                                          101   5e-22   
emb|CDY31068.1|  BnaA08g26180D                                          100   7e-22   
ref|XP_002454587.1|  hypothetical protein SORBIDRAFT_04g033920          100   7e-22   Sorghum bicolor [broomcorn]
ref|XP_008338937.1|  PREDICTED: uncharacterized protein LOC103401983    100   8e-22   
ref|XP_009588034.1|  PREDICTED: universal stress protein A-like p...    100   1e-21   
gb|EYU18169.1|  hypothetical protein MIMGU_mgv11b0160062mg            97.4    1e-21   
ref|XP_006338073.1|  PREDICTED: universal stress protein A-like p...    100   1e-21   
ref|XP_006422530.1|  hypothetical protein CICLE_v10030411mg             100   1e-21   
gb|ABK23398.1|  unknown                                               99.4    1e-21   Picea sitchensis
gb|KDP41468.1|  hypothetical protein JCGZ_15875                         100   2e-21   
ref|XP_010107691.1|  Universal stress protein A-like protein          99.8    2e-21   
ref|NP_001148900.1|  ER6 protein                                      99.4    2e-21   Zea mays [maize]
gb|EYU37243.1|  hypothetical protein MIMGU_mgv1a023360mg              99.8    2e-21   
gb|AAV65310.1|  universal stress protein                              99.8    2e-21   Hordeum vulgare subsp. vulgare [barley]
ref|XP_010921685.1|  PREDICTED: universal stress protein A-like p...  99.4    2e-21   
ref|XP_010675243.1|  PREDICTED: universal stress protein A-like p...  99.4    2e-21   
ref|XP_008369008.1|  PREDICTED: uncharacterized protein LOC103432...  99.0    2e-21   
gb|ABR17632.1|  unknown                                               99.0    3e-21   Picea sitchensis
gb|AAB60745.1|  ESTs gb|ATTS1236,gb|T43334,gb|N97019,gb|AA395203 ...  99.4    3e-21   Arabidopsis thaliana [mouse-ear cress]
gb|ABR16994.1|  unknown                                               98.6    3e-21   Picea sitchensis
gb|AEZ00873.1|  putative universal stress protein                     98.6    4e-21   
gb|KHG02612.1|  hypothetical protein F383_24945                       99.0    4e-21   
gb|AFW73547.1|  ER6 protein                                           98.6    4e-21   
ref|XP_010921510.1|  PREDICTED: universal stress protein A-like p...  98.6    4e-21   
ref|XP_003615270.1|  Universal stress protein A-like protein          99.0    4e-21   
ref|XP_006647942.1|  PREDICTED: uncharacterized protein C167.05-like  98.2    6e-21   
ref|XP_010265105.1|  PREDICTED: universal stress protein A-like p...  98.2    6e-21   
ref|XP_008774998.1|  PREDICTED: uncharacterized protein LOC103695...  98.2    7e-21   
ref|NP_001048190.1|  Os02g0760500                                     97.8    7e-21   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ92093.1|  predicted protein                                    97.8    7e-21   
gb|KHG27977.1|  hypothetical protein F383_14126                       97.8    8e-21   
gb|AAD46412.1|AF096262_1  ER6 protein                                 97.8    8e-21   Solanum lycopersicum
gb|AGV40783.1|  universal stress protein                              97.4    8e-21   
ref|XP_004237985.1|  PREDICTED: universal stress protein A-like p...  97.8    8e-21   
ref|XP_004958663.1|  PREDICTED: uncharacterized protein LOC101769282  98.2    1e-20   
ref|XP_006840564.1|  hypothetical protein AMTR_s00045p00225160        97.4    1e-20   
ref|XP_004953997.1|  PREDICTED: uncharacterized protein C167.05-like  97.4    1e-20   
gb|ABK26351.1|  unknown                                               96.7    1e-20   Picea sitchensis
gb|KHN25064.1|  Universal stress protein A-like protein               97.8    2e-20   
ref|XP_006487496.1|  PREDICTED: uncharacterized protein LOC102621...  96.7    2e-20   
gb|EYU37244.1|  hypothetical protein MIMGU_mgv1a026749mg              97.1    2e-20   
gb|ADE77419.1|  unknown                                               96.3    2e-20   
gb|EYU40765.1|  hypothetical protein MIMGU_mgv1a025375mg              96.3    2e-20   
ref|XP_004230297.1|  PREDICTED: universal stress protein A-like p...  96.7    2e-20   
ref|XP_002980442.1|  hypothetical protein SELMODRAFT_112416           97.1    2e-20   
ref|XP_006423740.1|  hypothetical protein CICLE_v10029454mg           96.3    2e-20   
ref|XP_009110805.1|  PREDICTED: universal stress protein A-like p...  96.7    2e-20   
ref|XP_008369004.1|  PREDICTED: uncharacterized protein LOC103432...  96.3    2e-20   
ref|XP_003570587.1|  PREDICTED: uncharacterized protein C167.05 i...  96.3    2e-20   
ref|XP_008451574.1|  PREDICTED: uncharacterized protein LOC103492814  96.3    2e-20   
ref|XP_004136030.1|  PREDICTED: universal stress protein MJ0531-like  96.3    2e-20   
ref|XP_009630150.1|  PREDICTED: universal stress protein A-like p...  96.3    2e-20   
gb|ABK21517.1|  unknown                                               96.7    3e-20   Picea sitchensis
ref|XP_009804591.1|  PREDICTED: universal stress protein A-like p...  96.3    3e-20   
ref|NP_001148498.1|  ethylene-responsive protein                      96.3    3e-20   Zea mays [maize]
ref|XP_009595892.1|  PREDICTED: universal stress protein A-like p...  95.9    3e-20   
ref|XP_008389277.1|  PREDICTED: universal stress protein A-like p...  96.7    3e-20   
ref|XP_002512499.1|  conserved hypothetical protein                   96.3    3e-20   Ricinus communis
ref|XP_006423746.1|  hypothetical protein CICLE_v10029382mg           95.9    3e-20   
ref|XP_004230296.1|  PREDICTED: universal stress protein A-like p...  95.9    4e-20   
ref|XP_006842311.1|  hypothetical protein AMTR_s00079p00131240        95.5    4e-20   
ref|XP_010060094.1|  PREDICTED: uncharacterized protein LOC104448021  95.9    5e-20   
ref|XP_009630149.1|  PREDICTED: universal stress protein A-like p...  95.9    5e-20   
ref|XP_006344751.1|  PREDICTED: uncharacterized protein C167.05-like  95.5    5e-20   
ref|XP_009399264.1|  PREDICTED: uncharacterized protein LOC103983718  95.5    5e-20   
ref|XP_010276435.1|  PREDICTED: universal stress protein A-like p...  95.1    6e-20   
ref|XP_007044293.1|  Adenine nucleotide alpha hydrolases-like sup...  95.1    6e-20   
ref|XP_010266116.1|  PREDICTED: uncharacterized protein C167.05       96.7    7e-20   
ref|NP_001236718.1|  uncharacterized protein LOC100306046             94.7    7e-20   
ref|XP_009795153.1|  PREDICTED: universal stress protein A-like p...  94.4    1e-19   
ref|XP_010939749.1|  PREDICTED: uncharacterized protein LOC105058496  94.7    1e-19   
ref|XP_008369005.1|  PREDICTED: uncharacterized protein LOC103432...  94.4    1e-19   
ref|XP_010681485.1|  PREDICTED: universal stress protein A-like p...  94.4    1e-19   
ref|XP_008801104.1|  PREDICTED: universal stress protein A-like p...  95.1    1e-19   
ref|XP_006487493.1|  PREDICTED: uncharacterized protein LOC102621046  94.0    1e-19   
ref|XP_010684515.1|  PREDICTED: uncharacterized protein LOC104899079  94.0    2e-19   
ref|XP_010264179.1|  PREDICTED: universal stress protein A-like p...  94.0    2e-19   
emb|CBI36844.3|  unnamed protein product                              93.6    2e-19   
ref|XP_006448454.1|  hypothetical protein CICLE_v10017054mg           93.2    2e-19   
ref|XP_002271563.1|  PREDICTED: universal stress protein A-like p...  93.2    3e-19   Vitis vinifera
ref|XP_004494374.1|  PREDICTED: universal stress protein MJ0531-like  92.8    3e-19   
ref|XP_007035604.1|  Adenine nucleotide alpha hydrolases-like sup...  94.7    3e-19   
ref|XP_004240539.1|  PREDICTED: universal stress protein A-like p...  92.8    3e-19   
gb|ABK24596.1|  unknown                                               93.2    3e-19   Picea sitchensis
ref|XP_008781086.1|  PREDICTED: universal stress protein A-like p...  93.2    4e-19   
gb|AFK41746.1|  unknown                                               92.8    4e-19   
emb|CAN74011.1|  hypothetical protein VITISV_003548                   92.8    4e-19   
emb|CDX94953.1|  BnaC05g07180D                                        92.8    5e-19   
ref|XP_008369003.1|  PREDICTED: uncharacterized protein LOC103432...  92.4    5e-19   
gb|KDO76973.1|  hypothetical protein CISIN_1g031713mg                 92.0    6e-19   
ref|XP_006448455.1|  hypothetical protein CICLE_v10017054mg           92.0    6e-19   
ref|XP_010265106.1|  PREDICTED: universal stress protein A-like p...  92.4    6e-19   
gb|KDP29423.1|  hypothetical protein JCGZ_18344                       92.4    6e-19   
ref|XP_010507861.1|  PREDICTED: universal stress protein A-like p...  92.0    7e-19   
ref|XP_009148276.1|  PREDICTED: universal stress protein A-like p...  92.0    8e-19   
ref|XP_006355801.1|  PREDICTED: uncharacterized protein LOC102583766  92.0    8e-19   
ref|XP_009804590.1|  PREDICTED: universal stress protein A-like p...  92.0    8e-19   
gb|KHN43511.1|  Universal stress protein A-like protein               91.3    1e-18   
ref|XP_010264150.1|  PREDICTED: universal stress protein A-like p...  91.7    1e-18   
ref|XP_009342098.1|  PREDICTED: universal stress protein A-like p...  91.7    1e-18   
ref|XP_011079565.1|  PREDICTED: universal stress protein A-like p...  91.7    1e-18   
ref|XP_004968834.1|  PREDICTED: uncharacterized protein C167.05-l...  91.7    1e-18   
ref|XP_010518486.1|  PREDICTED: universal stress protein A-like p...  91.3    1e-18   
ref|XP_009356255.1|  PREDICTED: universal stress protein A-like p...  92.0    1e-18   
ref|XP_004968833.1|  PREDICTED: uncharacterized protein C167.05-l...  92.0    1e-18   
ref|XP_010549540.1|  PREDICTED: universal stress protein A-like p...  91.3    1e-18   
ref|XP_006844758.1|  hypothetical protein AMTR_s00016p00256970        91.3    1e-18   
ref|XP_009356876.1|  PREDICTED: universal stress protein A-like p...  91.7    1e-18   
ref|XP_003554619.1|  PREDICTED: universal stress protein A-like p...  91.7    2e-18   
ref|XP_002882129.1|  universal stress protein family protein          90.9    2e-18   
gb|ABK21527.1|  unknown                                               91.3    2e-18   
ref|XP_002282460.1|  PREDICTED: universal stress protein A-like p...  90.9    2e-18   
ref|XP_008391602.1|  PREDICTED: universal stress protein A-like p...  88.6    2e-18   
ref|NP_566108.1|  adenine nucleotide alpha hydrolases-like protein    90.5    2e-18   
ref|XP_002526987.1|  conserved hypothetical protein                   90.5    3e-18   
ref|XP_008800823.1|  PREDICTED: universal stress protein A-like p...  90.5    3e-18   
ref|XP_002265489.2|  PREDICTED: uncharacterized protein LOC100260568  93.6    3e-18   
ref|XP_006468711.1|  PREDICTED: universal stress protein A-like p...  90.1    3e-18   
emb|CAN69650.1|  hypothetical protein VITISV_010535                   90.5    3e-18   
ref|XP_007223620.1|  hypothetical protein PRUPE_ppa012591mg           90.5    3e-18   
ref|NP_001043170.1|  Os01g0511100                                     90.5    3e-18   
ref|NP_001066983.1|  Os12g0552500                                     90.5    3e-18   
gb|ACU19158.1|  unknown                                               90.5    3e-18   
ref|XP_010921785.1|  PREDICTED: universal stress protein A-like p...  90.1    3e-18   
ref|XP_011008059.1|  PREDICTED: universal stress protein A-like p...  90.1    3e-18   
ref|XP_008797667.1|  PREDICTED: universal stress protein A-like p...  90.1    4e-18   
ref|XP_011007726.1|  PREDICTED: universal stress protein A-like p...  90.1    4e-18   
gb|ABK23106.1|  unknown                                               90.1    4e-18   
ref|XP_004290788.1|  PREDICTED: universal stress protein MJ0531-like  89.7    4e-18   
ref|XP_002489071.1|  hypothetical protein SORBIDRAFT_0139s002020      90.5    4e-18   
ref|XP_006576202.1|  PREDICTED: uncharacterized protein LOC100527...  90.1    4e-18   
ref|XP_004968835.1|  PREDICTED: uncharacterized protein C167.05-l...  89.7    5e-18   
ref|XP_007050903.1|  Adenine nucleotide alpha hydrolases-like sup...  89.7    5e-18   
ref|XP_009763276.1|  PREDICTED: uncharacterized protein LOC104215220  88.2    5e-18   
ref|XP_010264134.1|  PREDICTED: universal stress protein A-like p...  89.7    6e-18   
emb|CDP20842.1|  unnamed protein product                              89.4    6e-18   
emb|CDO98861.1|  unnamed protein product                              89.4    6e-18   
ref|NP_001238718.1|  uncharacterized protein LOC100527357             89.4    6e-18   
ref|XP_010692533.1|  PREDICTED: uncharacterized protein LOC104905637  89.4    6e-18   
ref|XP_009797826.1|  PREDICTED: universal stress protein A-like p...  89.4    7e-18   
ref|XP_009405430.1|  PREDICTED: uncharacterized protein LOC103988576  89.7    7e-18   
ref|XP_008369009.1|  PREDICTED: uncharacterized protein LOC103432589  89.4    7e-18   
ref|XP_008339660.1|  PREDICTED: universal stress protein A-like p...  89.7    7e-18   
ref|XP_010681486.1|  PREDICTED: universal stress protein A-like p...  89.0    8e-18   
ref|XP_002301477.2|  hypothetical protein POPTR_0002s20670g           90.5    8e-18   
emb|CDX95730.1|  BnaC03g26110D                                        89.0    9e-18   
ref|XP_006295139.1|  hypothetical protein CARUB_v10024211mg           89.0    1e-17   
ref|XP_010931649.1|  PREDICTED: universal stress protein A-like p...  89.0    1e-17   
ref|XP_009782538.1|  PREDICTED: universal stress protein A-like p...  88.6    1e-17   
ref|XP_009133823.1|  PREDICTED: universal stress protein A-like p...  89.0    1e-17   
gb|AAM63890.1|  unknown                                               89.0    1e-17   
ref|XP_008243247.1|  PREDICTED: uncharacterized protein C167.05-like  88.6    1e-17   
ref|XP_009791886.1|  PREDICTED: universal stress protein A-like p...  89.0    1e-17   
ref|XP_010532403.1|  PREDICTED: universal stress protein A-like p...  88.6    1e-17   
gb|ACF74293.1|  universal stress protein                              89.0    1e-17   
ref|NP_001288970.1|  universal stress protein A-like protein          88.6    1e-17   
ref|XP_010069941.1|  PREDICTED: universal stress protein A-like p...  88.6    1e-17   
gb|KFK37511.1|  hypothetical protein AALP_AA4G266700                  88.6    1e-17   
ref|XP_006574464.1|  PREDICTED: uncharacterized protein LOC100816...  88.6    1e-17   
emb|CDP00635.1|  unnamed protein product                              88.6    1e-17   
ref|XP_010269547.1|  PREDICTED: uncharacterized protein LOC104606...  88.2    2e-17   
ref|XP_010038209.1|  PREDICTED: uncharacterized protein LOC104426758  88.2    2e-17   
gb|AAT07452.1|  putative universal stress protein                     88.6    2e-17   
ref|XP_010044257.1|  PREDICTED: universal stress protein A-like p...  88.2    2e-17   
ref|NP_001240086.1|  uncharacterized protein LOC100816212             88.2    2e-17   
ref|XP_009598749.1|  PREDICTED: universal stress protein A-like p...  87.8    2e-17   
ref|XP_006588416.1|  PREDICTED: uncharacterized protein LOC100527...  88.2    2e-17   
ref|XP_004956772.1|  PREDICTED: uncharacterized protein LOC101762...  88.2    2e-17   
ref|XP_009395576.1|  PREDICTED: universal stress protein A-like p...  88.2    2e-17   
ref|NP_001066982.1|  Os12g0552400                                     87.8    2e-17   
ref|XP_006841415.1|  hypothetical protein AMTR_s00003p00027540        87.8    2e-17   
ref|XP_007145154.1|  hypothetical protein PHAVU_007G214800g           87.8    2e-17   
ref|XP_010269548.1|  PREDICTED: universal stress protein A-like p...  87.8    2e-17   
ref|XP_010099245.1|  Universal stress protein A-like protein          87.8    2e-17   
ref|XP_010321386.1|  PREDICTED: universal stress protein A-like p...  87.4    3e-17   
ref|XP_004495963.1|  PREDICTED: universal stress protein A-like p...  87.8    3e-17   
ref|XP_011022261.1|  PREDICTED: universal stress protein A-like p...  87.8    3e-17   
ref|XP_011036946.1|  PREDICTED: universal stress protein A-like p...  87.8    3e-17   
ref|XP_002282537.1|  PREDICTED: universal stress protein A-like p...  87.8    3e-17   
ref|XP_004299066.1|  PREDICTED: universal stress protein A-like p...  87.8    3e-17   
ref|XP_009373274.1|  PREDICTED: universal stress protein A-like p...  87.4    3e-17   
ref|XP_006342804.1|  PREDICTED: uncharacterized protein C167.05-like  87.0    3e-17   
emb|CBI27006.3|  unnamed protein product                              87.0    4e-17   
gb|ABK24890.1|  unknown                                               87.4    4e-17   
ref|XP_006397968.1|  hypothetical protein EUTSA_v10001666mg           87.4    4e-17   
ref|XP_002283457.1|  PREDICTED: universal stress protein A-like p...  87.4    4e-17   
ref|XP_004242313.1|  PREDICTED: uncharacterized protein LOC101246641  87.0    4e-17   
ref|XP_002312405.1|  universal stress family protein                  87.0    4e-17   
ref|XP_002523068.1|  conserved hypothetical protein                   87.0    5e-17   
ref|XP_004495667.1|  PREDICTED: universal stress protein A-like p...  87.0    5e-17   
ref|XP_010041145.1|  PREDICTED: universal stress protein A-like p...  87.0    5e-17   
ref|XP_010041104.1|  PREDICTED: universal stress protein A-like p...  87.0    6e-17   
gb|AFW56490.1|  hypothetical protein ZEAMMB73_742470                  87.0    6e-17   
ref|XP_010040271.1|  PREDICTED: universal stress protein A-like p...  86.7    6e-17   
ref|NP_001060607.1|  Os07g0673400                                     87.0    6e-17   
ref|XP_007221660.1|  hypothetical protein PRUPE_ppb010253mg           87.0    6e-17   
ref|XP_006664626.1|  PREDICTED: uncharacterized protein LOC102702434  87.0    6e-17   
ref|XP_004962797.1|  PREDICTED: uncharacterized protein LOC101782...  86.7    7e-17   
ref|XP_010038207.1|  PREDICTED: universal stress protein A-like p...  86.3    8e-17   
gb|EYU37238.1|  hypothetical protein MIMGU_mgv1a015255mg              86.3    8e-17   
ref|XP_009596691.1|  PREDICTED: universal stress protein A-like p...  86.3    9e-17   
emb|CDP18238.1|  unnamed protein product                              86.7    9e-17   
gb|ABK21351.1|  unknown                                               85.9    9e-17   
ref|XP_004495962.1|  PREDICTED: universal stress protein A-like p...  86.3    9e-17   
ref|XP_010110918.1|  Universal stress protein A-like protein          86.3    1e-16   
ref|XP_008789877.1|  PREDICTED: universal stress protein A-like p...  86.3    1e-16   
gb|EYU46674.1|  hypothetical protein MIMGU_mgv1a015298mg              85.9    1e-16   
ref|XP_003591211.1|  Universal stress protein A-like protein          86.3    1e-16   
ref|XP_010039561.1|  PREDICTED: universal stress protein A-like p...  85.9    1e-16   
ref|XP_010523981.1|  PREDICTED: universal stress protein A-like p...  85.9    1e-16   
gb|KHG02297.1|  hypothetical protein F383_24645                       86.3    1e-16   
ref|XP_008388484.1|  PREDICTED: universal stress protein A-like p...  85.9    1e-16   
ref|XP_004956773.1|  PREDICTED: uncharacterized protein LOC101762...  85.9    1e-16   
ref|XP_007031132.1|  USP-like protein isoform 1                       85.9    1e-16   
ref|XP_010938498.1|  PREDICTED: universal stress protein A-like p...  87.0    1e-16   
ref|XP_007031134.1|  USP-like protein isoform 3                       85.5    1e-16   
gb|EMT26129.1|  Universal stress protein A-like protein               86.3    2e-16   
gb|KDP28148.1|  hypothetical protein JCGZ_13919                       85.5    2e-16   
ref|XP_007206031.1|  hypothetical protein PRUPE_ppa012501mg           85.5    2e-16   
ref|XP_004136170.1|  PREDICTED: universal stress protein YxiE-like    85.5    2e-16   
ref|XP_006382407.1|  hypothetical protein POPTR_0005s01860g           85.5    2e-16   
ref|XP_008781084.1|  PREDICTED: universal stress protein A-like p...  85.5    2e-16   
emb|CBI27004.3|  unnamed protein product                              84.7    2e-16   
emb|CBI36845.3|  unnamed protein product                              85.5    2e-16   
ref|XP_008243246.1|  PREDICTED: universal stress protein A-like p...  85.5    2e-16   
gb|EYU37241.1|  hypothetical protein MIMGU_mgv1a026191mg              85.1    2e-16   
ref|XP_010259730.1|  PREDICTED: uncharacterized protein LOC104599062  85.1    2e-16   
gb|KCW50026.1|  hypothetical protein EUGRSUZ_K03472                   85.5    2e-16   
ref|XP_009394438.1|  PREDICTED: universal stress protein A-like p...  84.7    2e-16   
ref|XP_010659697.1|  PREDICTED: universal stress protein A-like p...  85.1    3e-16   
ref|XP_006472184.1|  PREDICTED: universal stress protein A-like p...  85.1    3e-16   
gb|ADE77011.1|  unknown                                               85.1    3e-16   
ref|XP_003575575.1|  PREDICTED: uncharacterized protein LOC100829422  85.1    3e-16   
ref|XP_007163107.1|  hypothetical protein PHAVU_001G206900g           84.7    3e-16   
ref|XP_011087485.1|  PREDICTED: universal stress protein A-like p...  84.7    3e-16   
ref|XP_002314854.1|  hypothetical protein POPTR_0010s13310g           84.7    3e-16   
ref|XP_002283390.1|  PREDICTED: universal stress protein A-like p...  84.7    3e-16   
ref|XP_003591542.1|  Universal stress protein                         84.7    4e-16   
gb|KDP29425.1|  hypothetical protein JCGZ_18346                       84.3    4e-16   
gb|KHG25530.1|  hypothetical protein F383_01533                       84.7    4e-16   
ref|XP_011076634.1|  PREDICTED: universal stress protein A-like p...  84.3    4e-16   
gb|ADE76176.1|  unknown                                               84.7    4e-16   
ref|XP_009586786.1|  PREDICTED: universal stress protein A-like p...  84.3    4e-16   
gb|EMT31433.1|  Peptidyl-prolyl isomerase FKBP12                      89.4    5e-16   
ref|XP_010938295.1|  PREDICTED: universal stress protein A-like p...  84.3    5e-16   
gb|ACF84743.1|  unknown                                               84.0    5e-16   
ref|XP_006281889.1|  hypothetical protein CARUB_v10028087mg           84.3    5e-16   
ref|XP_008451580.1|  PREDICTED: uncharacterized protein LOC103492...  84.0    6e-16   
gb|EAY83459.1|  hypothetical protein OsI_38670                        86.7    6e-16   
emb|CDY53014.1|  BnaC04g00160D                                        84.0    6e-16   
ref|NP_001150162.1|  fiber protein Fb19                               84.0    6e-16   
gb|AFK39818.1|  unknown                                               83.6    6e-16   
ref|XP_006444481.1|  hypothetical protein CICLE_v10022542mg           83.6    7e-16   
gb|KHN30645.1|  Universal stress protein A-like protein               83.6    7e-16   
ref|NP_001236412.1|  uncharacterized protein LOC100306535             83.6    7e-16   
ref|XP_004299064.1|  PREDICTED: universal stress protein Sll1388-...  83.6    7e-16   
gb|ADE76296.1|  unknown                                               84.0    7e-16   
ref|XP_006841209.1|  hypothetical protein AMTR_s00135p00026790        84.0    8e-16   
ref|XP_010024119.1|  PREDICTED: universal stress protein A-like p...  83.6    8e-16   
ref|XP_006604738.1|  PREDICTED: universal stress protein A-like p...  83.2    9e-16   
ref|XP_006352812.1|  PREDICTED: uncharacterized protein LOC102580875  83.2    9e-16   
gb|AES98230.2|  adenine nucleotide alpha hydrolase superfamily pr...  84.3    9e-16   
gb|EPZ31257.1|  UspA domain-containing protein                        83.6    9e-16   
ref|XP_010236087.1|  PREDICTED: uncharacterized protein LOC100839...  84.3    9e-16   
ref|NP_001235063.1|  uncharacterized protein LOC100527623             84.0    9e-16   
gb|EYU46675.1|  hypothetical protein MIMGU_mgv1a015298mg              83.2    9e-16   
gb|AID16039.1|  putative universal stress protein                     83.2    1e-15   
ref|XP_004229244.1|  PREDICTED: universal stress protein A-like p...  83.2    1e-15   
ref|XP_008663115.1|  PREDICTED: universal stress protein A-like p...  83.6    1e-15   
ref|XP_002314856.1|  hypothetical protein POPTR_0010s13330g           83.6    1e-15   
ref|XP_004300460.1|  PREDICTED: stress response protein NhaX-like     83.6    1e-15   
gb|EPS57241.1|  hypothetical protein M569_17579                       83.2    1e-15   
ref|XP_002526986.1|  conserved hypothetical protein                   83.2    1e-15   
gb|KHG06374.1|  hypothetical protein F383_32883                       83.2    1e-15   
ref|XP_003591541.1|  Universal stress protein                         83.2    1e-15   
ref|XP_010046100.1|  PREDICTED: universal stress protein A-like p...  83.2    1e-15   
ref|XP_010542168.1|  PREDICTED: universal stress protein A-like p...  82.8    1e-15   
gb|EAZ05105.1|  hypothetical protein OsI_27297                        83.2    2e-15   
gb|AAM09541.1|AF491815_1  putative universal stress protein USP1      82.8    2e-15   
ref|XP_010040948.1|  PREDICTED: universal stress protein A-like p...  82.8    2e-15   
ref|XP_006433519.1|  hypothetical protein CICLE_v10002689mg           82.8    2e-15   
ref|XP_010445967.1|  PREDICTED: universal stress protein A-like p...  82.8    2e-15   
ref|XP_010066712.1|  PREDICTED: universal stress protein A-like p...  82.8    2e-15   
emb|CDP00637.1|  unnamed protein product                              82.4    2e-15   
gb|KDP28246.1|  hypothetical protein JCGZ_14017                       82.4    2e-15   
ref|XP_002283402.1|  PREDICTED: universal stress protein A-like p...  82.4    2e-15   
ref|XP_009142507.1|  PREDICTED: universal stress protein A-like p...  82.4    2e-15   
ref|XP_011007756.1|  PREDICTED: universal stress protein A-like p...  82.4    2e-15   
ref|XP_010445975.1|  PREDICTED: universal stress protein A-like p...  82.8    2e-15   
ref|XP_007201282.1|  hypothetical protein PRUPE_ppa012608mg           82.4    2e-15   
ref|XP_002443334.1|  hypothetical protein SORBIDRAFT_08g017660        82.4    3e-15   
ref|XP_006658108.1|  PREDICTED: uncharacterized protein LOC102707323  82.4    3e-15   
ref|XP_006472185.1|  PREDICTED: universal stress protein A-like p...  82.4    3e-15   
ref|XP_010268015.1|  PREDICTED: universal stress protein A-like p...  82.4    3e-15   
ref|XP_008370382.1|  PREDICTED: universal stress protein A-like p...  82.0    4e-15   
ref|XP_003562469.1|  PREDICTED: universal stress protein A-like p...  82.0    4e-15   
gb|ADB54814.1|  universal stress protein 9303                         81.6    4e-15   
gb|ACG26484.1|  universal stress protein                              81.6    4e-15   
ref|NP_001132550.1|  universal stress protein                         81.6    4e-15   
ref|XP_011033550.1|  PREDICTED: uncharacterized protein LOC105132002  81.6    5e-15   
ref|XP_008389279.1|  PREDICTED: universal stress protein A-like p...  81.3    5e-15   
gb|KDP23405.1|  hypothetical protein JCGZ_23238                       81.3    5e-15   
ref|XP_010046109.1|  PREDICTED: uncharacterized protein LOC104434968  84.3    6e-15   
ref|XP_007144278.1|  hypothetical protein PHAVU_007G143000g           81.3    6e-15   
gb|AAR07598.1|  fiber protein Fb19                                    80.9    6e-15   
ref|XP_004134490.1|  PREDICTED: universal stress protein MJ0531-like  80.9    8e-15   
ref|XP_011082474.1|  PREDICTED: universal stress protein A-like p...  80.9    8e-15   



>ref|XP_009758852.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
Length=189

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 137/231 (59%), Gaps = 50/231 (22%)
 Frame = -2

Query  909  TRTETSAYACPGEAMHSQVPTVKETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNY  730
            T  ETSA   P      Q P +           +MVA+D+S ESF ALKWA+D+LL  + 
Sbjct  4    TAAETSA--APASVTVDQPPHMAAAAGETKRKMIMVAMDESEESFYALKWALDHLLNNS-  60

Query  729  PSAATAADEIPAAMVTLVNVQPTFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRA  550
                    E    ++TL+NVQP F P++YP GP +   P MVEAVKK+Q+ NA+ +LSRA
Sbjct  61   --------EEETTIITLINVQPPFSPMVYPAGPVVFAAPTMVEAVKKAQQENATTILSRA  112

Query  549  LQICRENKVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SR  370
             ++C + +V+AETLILEGD KD+IC+AA+E+HVDLLV+GSRGLGKIK             
Sbjct  113  FRMCTQKRVKAETLILEGDPKDKICQAADELHVDLLVMGSRGLGKIK-------------  159

Query  369  SILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                                      RAFLGSVSDYCAHHVHCPILIVKPP
Sbjct  160  --------------------------RAFLGSVSDYCAHHVHCPILIVKPP  184



>ref|XP_009588426.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Nicotiana tomentosiformis]
Length=188

 Score =   201 bits (510),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 133/223 (60%), Gaps = 49/223 (22%)
 Frame = -2

Query  885  ACPGEAMHSQVPTVKETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAAD  706
            A P      Q P +     T+    +MVA+D+S ESF AL WA+D+LL  +         
Sbjct  10   AAPASVTEEQPPHMAAAGETKRKM-IMVAMDESEESFYALNWALDHLLNNS---------  59

Query  705  EIPAAMVTLVNVQPTFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENK  526
            E    ++TL+NVQP F P++YP GP +   P MVEAVKK+Q+ NA+ +LSRA  +C + +
Sbjct  60   EEETTIITLINVQPPFSPLVYPAGPVVFAAPTMVEAVKKAQQENATTILSRAFHMCTQKR  119

Query  525  VRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVI  346
            V+AETLILEGD KD+IC+AA+E+HVDLLV+GSRGLGKIK                     
Sbjct  120  VKAETLILEGDPKDKICQAADELHVDLLVMGSRGLGKIK---------------------  158

Query  345  IKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                              RAFLGSVSDYCAHHVHCPILIVKPP
Sbjct  159  ------------------RAFLGSVSDYCAHHVHCPILIVKPP  183



>ref|XP_011094180.1| PREDICTED: universal stress protein A-like protein [Sesamum indicum]
Length=184

 Score =   199 bits (507),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 128/208 (62%), Gaps = 44/208 (21%)
 Frame = -2

Query  825  RTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPII  646
            R   KV+V +D+S  SF AL+WA+D+L   N P      DE     +TLVNVQP F P I
Sbjct  20   RKKMKVLVPVDESDGSFYALRWALDHLFISNEPQ-----DEQEPNTITLVNVQPVFQPFI  74

Query  645  YPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAA  466
            YP GP +  TP ++++VKK+QE NA+ +L+RAL IC++ KV+AETLILEGD KDRIC+AA
Sbjct  75   YPAGPVVYATPAVIDSVKKAQEQNAANILARALSICKDKKVKAETLILEGDPKDRICQAA  134

Query  465  EEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRA  286
            E++ VDL+VVGSRGLG IK                                       RA
Sbjct  135  EQLQVDLVVVGSRGLGTIK---------------------------------------RA  155

Query  285  FLGSVSDYCAHHVHCPILIVKPPSKEPN  202
             LGSVS+YCAHH HCP+LIVKPP K P+
Sbjct  156  LLGSVSNYCAHHAHCPVLIVKPPPKLPH  183



>gb|EYU18171.1| hypothetical protein MIMGU_mgv1a026609mg [Erythranthe guttata]
Length=172

 Score =   197 bits (501),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 130/210 (62%), Gaps = 46/210 (22%)
 Frame = -2

Query  831  ATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAA---MVTLVNVQPT  661
            A     KV+V +DDS  SF ALKWA+DNL   +    A +   +PAA    +TL+NVQP 
Sbjct  2    AKEKRMKVLVPMDDSDGSFYALKWALDNLFGNH----AASEPPLPAAEENFITLLNVQPL  57

Query  660  FGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDR  481
            F P IYP GP +  TP +++AVKK Q+ NA+ +LSRAL IC++NKV+AETL+LEGDAKD+
Sbjct  58   FQPFIYPAGPVVYATPAVIDAVKKGQQQNAANILSRALHICKQNKVKAETLMLEGDAKDK  117

Query  480  ICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL  301
            IC+AAEE+HVDLLV+GSRGLG IK                                    
Sbjct  118  ICQAAEELHVDLLVLGSRGLGTIK------------------------------------  141

Query  300  **CRAFLGSVSDYCAHHVHCPILIVKPPSK  211
               RA LGSVS+YCAHH  CP+LIVKPP +
Sbjct  142  ---RALLGSVSNYCAHHATCPVLIVKPPPR  168



>emb|CDP10546.1| unnamed protein product [Coffea canephora]
Length=309

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 131/202 (65%), Gaps = 43/202 (21%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIP---AAMVTLVNVQPTFGPIIY  643
            KVMVA+D+S  SF ALKW +++   +  P+A     E P   ++M+T+V+VQ  F P IY
Sbjct  140  KVMVAVDESEGSFYALKWTLNHFFHQ-LPAAGAVPPEEPGRESSMITIVHVQEPFQPFIY  198

Query  642  PPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAE  463
            P GP +  TPM+VE+VK++QE NA+ VLSRAL +C++ K++AETLILEGD KDRICEAAE
Sbjct  199  PAGPAVYATPMVVESVKRAQEKNAASVLSRALLMCKDYKIKAETLILEGDPKDRICEAAE  258

Query  462  EMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAF  283
            E+HVDL+VVGSRGLGKIK                                       RAF
Sbjct  259  ELHVDLVVVGSRGLGKIK---------------------------------------RAF  279

Query  282  LGSVSDYCAHHVHCPILIVKPP  217
            LGSVSDYCAHHV CP+LIVKPP
Sbjct  280  LGSVSDYCAHHVRCPVLIVKPP  301



>ref|XP_004229048.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Solanum lycopersicum]
Length=172

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 132/222 (59%), Gaps = 52/222 (23%)
 Frame = -2

Query  867  MHSQVPTVKETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAM  688
            M ++     +T  TR    +MVAID+S ESF +LKWA+DNL+              P+ +
Sbjct  1    MEAETSAASDTPVTRKKM-IMVAIDESEESFYSLKWALDNLIND------------PSII  47

Query  687  VTLVNVQPTFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETL  508
            +TL+NVQ  F P++YP GP +  TP +VEAV+K Q+ NA+ +LSRAL +C++  V+AETL
Sbjct  48   ITLINVQIPFTPMVYPAGPVVFATPTVVEAVRKGQQENATRILSRALHLCQQKMVKAETL  107

Query  507  ILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI  328
            I+EGD KD IC+ A E+HVDLLV+GSRGLGKIK                           
Sbjct  108  IVEGDPKDMICQTAHELHVDLLVIGSRGLGKIK---------------------------  140

Query  327  **VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPPSKEPN  202
                        RAFLGSVSDYCAHHV CPILIVKPP + P 
Sbjct  141  ------------RAFLGSVSDYCAHHVQCPILIVKPPKENPK  170



>gb|AIR07400.1| universal stress protein A [Solanum habrochaites]
Length=172

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/221 (47%), Positives = 132/221 (60%), Gaps = 52/221 (24%)
 Frame = -2

Query  867  MHSQVPTVKETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAM  688
            M ++     +T  TR    +MVAID+S E+F ALKWA+DNL+              P+ +
Sbjct  1    MEAETSAASDTPVTRKKM-IMVAIDESDENFYALKWALDNLIND------------PSII  47

Query  687  VTLVNVQPTFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETL  508
            +TL+NVQ  F P++YP GP +  TP +VEAV+K Q+ NA+ +LSRAL +C++  V+AETL
Sbjct  48   ITLINVQIPFTPMVYPAGPVVFATPTVVEAVRKRQQENATRILSRALHLCQQKMVKAETL  107

Query  507  ILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI  328
            I+EGD KD IC+ A E+HVDLLV+GSRGLGKIK                           
Sbjct  108  IVEGDPKDMICQTAHELHVDLLVIGSRGLGKIK---------------------------  140

Query  327  **VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPPSKEP  205
                        RAFLGSVSDYCAHHV CPILIVKPP + P
Sbjct  141  ------------RAFLGSVSDYCAHHVQCPILIVKPPKENP  169



>ref|XP_006337956.1| PREDICTED: universal stress protein A-like protein-like [Solanum 
tuberosum]
Length=179

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 122/203 (60%), Gaps = 51/203 (25%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGP  631
            +MVAID+S ESF ALKWA+DNL+              P+ ++TL+NVQ  F P++YP GP
Sbjct  26   IMVAIDESEESFYALKWALDNLIND------------PSIIITLINVQLPFTPMVYPAGP  73

Query  630  NLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHV  451
             +   P +VEAVKK Q  NA+ +LSRAL +C++  V+AETLIL+GD KD IC+AA E+H 
Sbjct  74   VVFAAPTVVEAVKKGQHENATRILSRALHLCKQKMVKAETLILDGDPKDMICQAAHELHA  133

Query  450  DLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSV  271
            DLLVVGSRGLGKIK                                       RAFLGSV
Sbjct  134  DLLVVGSRGLGKIK---------------------------------------RAFLGSV  154

Query  270  SDYCAHHVHCPILIVKPPSKEPN  202
            SDYCAHHV CPILIVKP  + P 
Sbjct  155  SDYCAHHVQCPILIVKPSKEIPK  177



>gb|KCW48157.1| hypothetical protein EUGRSUZ_K01888 [Eucalyptus grandis]
Length=207

 Score =   187 bits (476),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 139/242 (57%), Gaps = 48/242 (20%)
 Frame = -2

Query  921  MEKTTRTETSAYACPGEAMHSQVP--TVKETTA--TRTTWKVMVAIDDSGESFNALKWAI  754
            M+ TT T T+  A  G    S V    ++E  A  T+   KVMVA+D+S  SF AL+W +
Sbjct  1    MDATTATGTAPLAAGGPVEESTVVGMVMQEPVAAETKLKMKVMVAVDESEGSFYALRWTL  60

Query  753  DNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGPN---LELTPMMVEAVKKSQ  583
            D+LLRR+ P+ A   DE+   M+TLV+VQ  F    +P GP          +VE+V+K+Q
Sbjct  61   DHLLRRSSPALAADGDEV--EMITLVHVQQPFQHYAFPAGPGGAAFYAASSVVESVRKAQ  118

Query  582  EHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*  403
            E N++ +LSRAL +C+E+ V+AETLIL GD KD IC+A E+MH DLLVVGSRGLGKIK  
Sbjct  119  EENSALILSRALHMCKESMVKAETLILIGDPKDMICQATEQMHTDLLVVGSRGLGKIK--  176

Query  402  FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVK  223
                                                 RAFLGS SDYCAHH  CPILIVK
Sbjct  177  -------------------------------------RAFLGSGSDYCAHHAKCPILIVK  199

Query  222  PP  217
            PP
Sbjct  200  PP  201



>ref|XP_010036539.1| PREDICTED: universal stress protein A-like protein [Eucalyptus 
grandis]
Length=250

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 139/242 (57%), Gaps = 48/242 (20%)
 Frame = -2

Query  921  MEKTTRTETSAYACPGEAMHSQVP--TVKETTA--TRTTWKVMVAIDDSGESFNALKWAI  754
            M+ TT T T+  A  G    S V    ++E  A  T+   KVMVA+D+S  SF AL+W +
Sbjct  44   MDATTATGTAPLAAGGPVEESTVVGMVMQEPVAAETKLKMKVMVAVDESEGSFYALRWTL  103

Query  753  DNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGPN---LELTPMMVEAVKKSQ  583
            D+LLRR+ P+ A   DE+   M+TLV+VQ  F    +P GP          +VE+V+K+Q
Sbjct  104  DHLLRRSSPALAADGDEV--EMITLVHVQQPFQHYAFPAGPGGAAFYAASSVVESVRKAQ  161

Query  582  EHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*  403
            E N++ +LSRAL +C+E+ V+AETLIL GD KD IC+A E+MH DLLVVGSRGLGKIK  
Sbjct  162  EENSALILSRALHMCKESMVKAETLILIGDPKDMICQATEQMHTDLLVVGSRGLGKIK--  219

Query  402  FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVK  223
                                                 RAFLGS SDYCAHH  CPILIVK
Sbjct  220  -------------------------------------RAFLGSGSDYCAHHAKCPILIVK  242

Query  222  PP  217
            PP
Sbjct  243  PP  244



>ref|XP_004229049.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Solanum lycopersicum]
Length=162

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/222 (45%), Positives = 126/222 (57%), Gaps = 62/222 (28%)
 Frame = -2

Query  867  MHSQVPTVKETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAM  688
            M ++     +T  TR    +MVAID+S ESF +LKWA+DNL+              P+ +
Sbjct  1    MEAETSAASDTPVTRKKM-IMVAIDESEESFYSLKWALDNLIND------------PSII  47

Query  687  VTLVNVQPTFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETL  508
            +TL+NVQ  F P++YP GP          AV+K Q+ NA+ +LSRAL +C++  V+AETL
Sbjct  48   ITLINVQIPFTPMVYPAGP----------AVRKGQQENATRILSRALHLCQQKMVKAETL  97

Query  507  ILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI  328
            I+EGD KD IC+ A E+HVDLLV+GSRGLGKIK                           
Sbjct  98   IVEGDPKDMICQTAHELHVDLLVIGSRGLGKIK---------------------------  130

Query  327  **VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPPSKEPN  202
                        RAFLGSVSDYCAHHV CPILIVKPP + P 
Sbjct  131  ------------RAFLGSVSDYCAHHVQCPILIVKPPKENPK  160



>ref|NP_850563.1| universal stress protein-like protein [Arabidopsis thaliana]
 dbj|BAH19740.1| AT3G11930 [Arabidopsis thaliana]
 gb|AEE75120.1| universal stress protein-like protein [Arabidopsis thaliana]
Length=226

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/237 (46%), Positives = 148/237 (62%), Gaps = 28/237 (12%)
 Frame = -2

Query  900  ETSAYACPGEAMHSQVPTVKETTA-TRTTWKVMVAIDDSGESFNALKWAID---NLLRRN  733
            E +A A    A+  Q  T  E  A + TT +++VAID+S  SF AL+W ID   NLL   
Sbjct  4    EQAATAMETSAVEKQPETTTEAEAPSLTTKRMVVAIDESDSSFYALQWVIDHFSNLLL--  61

Query  732  YPSAATAADEIPAAMVTLVNVQPTFGPII-YPPGPN----LELTPMMVEAVKKSQEHNAS  568
                 TAA E  + M+T+++VQ  F     +P GP     +  +  M+E+VKK+Q+  ++
Sbjct  62   ----TTAAAEAESGMLTVIHVQSPFNHFAAFPAGPGGATAVYASSSMIESVKKAQQETSA  117

Query  567  EVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLI  388
             +LSRALQ+CR  ++R ETL+LEG+AK+ ICEA E+MHVDLLVVGSRGLGKIKR  + +I
Sbjct  118  ALLSRALQMCRAKQIRTETLVLEGEAKEMICEAVEKMHVDLLVVGSRGLGKIKR--YCII  175

Query  387  CFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                  +  ++  +    F+  VR        RAFLGSVSDYCAHH +CPILIVKPP
Sbjct  176  -----NNFFLYINLSAYYFVCFVRF------GRAFLGSVSDYCAHHANCPILIVKPP  221



>gb|KDO70762.1| hypothetical protein CISIN_1g044973mg [Citrus sinensis]
Length=197

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 125/214 (58%), Gaps = 43/214 (20%)
 Frame = -2

Query  840  ETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPT  661
            E    +   KVMVA+D+SGESF ALKWA+DNL           +D   A  VTLV+VQ  
Sbjct  19   EEMMGKNEMKVMVALDESGESFYALKWALDNLFGITGAVTPGTSDR-GAGTVTLVHVQQP  77

Query  660  FGPIIYPPGPN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDA  490
            F   ++P GP       T  + ++++K+QE N++ +LSRALQIC++  V+AETL+L GD 
Sbjct  78   FQHFVFPAGPGGAAFYATSSVEQSIRKAQEENSAALLSRALQICKDKNVKAETLVLTGDP  137

Query  489  KDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSI  310
            KD IC+AAE+MH+DLLVVGSRGLGKIK                                 
Sbjct  138  KDMICQAAEQMHMDLLVVGSRGLGKIK---------------------------------  164

Query  309  YIL**CRAFLGSVSDYCAHHVHCPILIVKPPSKE  208
                  RA LGSVSDYCAHHV CPI+IVKPP K+
Sbjct  165  ------RALLGSVSDYCAHHVQCPIIIVKPPPKQ  192



>ref|XP_006429980.1| hypothetical protein CICLE_v10012835mg [Citrus clementina]
 gb|ESR43220.1| hypothetical protein CICLE_v10012835mg [Citrus clementina]
Length=197

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 124/209 (59%), Gaps = 43/209 (21%)
 Frame = -2

Query  825  RTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPII  646
            +   KVMVA+D+SGESF ALKWA+DNL           +D   A  VTLV+VQ  F   +
Sbjct  24   KNEMKVMVALDESGESFYALKWALDNLFGITGAVTPGTSDR-GAGTVTLVHVQQPFQHFV  82

Query  645  YPPGPN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
            +P GP       T  + ++++K+QE N++ +LSRALQIC++  V+AETL+L GD KD IC
Sbjct  83   FPAGPGGAAFYATSSVEQSIRKAQEENSAALLSRALQICKDKNVKAETLVLTGDPKDMIC  142

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            +AAE+MH+DLLVVGSRGLGKIK                                      
Sbjct  143  QAAEQMHMDLLVVGSRGLGKIK--------------------------------------  164

Query  294  CRAFLGSVSDYCAHHVHCPILIVKPPSKE  208
             RA LGSVSDYCAHHV CPI+IVKPP K+
Sbjct  165  -RALLGSVSDYCAHHVQCPIIIVKPPPKQ  192



>ref|XP_002266746.3| PREDICTED: universal stress protein A-like protein isoform X1 
[Vitis vinifera]
Length=212

 Score =   182 bits (463),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 125/201 (62%), Gaps = 43/201 (21%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGP  631
            VMVA+D S  SF AL+WA++NL RR    AA   +E+   MVT+V+VQ  F   + P GP
Sbjct  48   VMVAVDQSESSFYALQWALENLFRRK--GAAVETEEV--GMVTVVHVQQPFHNYVLPAGP  103

Query  630  NLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHV  451
             +  T  ++E+V+K+QE N+S +LSRAL++C++  V+AETLIL+GD K+ IC+AAE+MHV
Sbjct  104  GIYATSTVIESVRKAQEQNSSVILSRALRLCKDKMVKAETLILDGDPKEMICQAAEQMHV  163

Query  450  DLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSV  271
            DLL+VGSRGL K+K                                       RAFLGSV
Sbjct  164  DLLLVGSRGLSKLK---------------------------------------RAFLGSV  184

Query  270  SDYCAHHVHCPILIVKPPSKE  208
            SDYCAHH  CPILIVKPP ++
Sbjct  185  SDYCAHHAKCPILIVKPPEEK  205



>ref|XP_006481854.1| PREDICTED: universal stress protein A-like protein-like [Citrus 
sinensis]
Length=197

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 125/214 (58%), Gaps = 43/214 (20%)
 Frame = -2

Query  840  ETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPT  661
            E    +   KVMVA+D+SGESF ALKWA+DNL           +D   A  VTLV+VQ  
Sbjct  19   EEMMGKNEMKVMVALDESGESFYALKWALDNLFGITGAVTPGTSDR-GAGTVTLVHVQQP  77

Query  660  FGPIIYPPGPN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDA  490
            F   ++P GP       T  + ++++K+QE N++ +LSRALQIC++  V+AETL+L GD 
Sbjct  78   FQHFVFPAGPGGAAFYATSSVEQSIRKAQEENSAALLSRALQICKDKNVKAETLVLTGDP  137

Query  489  KDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSI  310
            KD IC+AAE++H+DLLVVGSRGLGKIK                                 
Sbjct  138  KDMICQAAEQVHMDLLVVGSRGLGKIK---------------------------------  164

Query  309  YIL**CRAFLGSVSDYCAHHVHCPILIVKPPSKE  208
                  RA LGSVSDYCAHHV CPI+IVKPP K+
Sbjct  165  ------RALLGSVSDYCAHHVQCPIIIVKPPPKQ  192



>gb|AID16045.1| putative universal stress protein, partial [Catharanthus roseus]
Length=180

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 123/212 (58%), Gaps = 46/212 (22%)
 Frame = -2

Query  825  RTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSA------ATAADEIPAAMVTLVNVQP  664
            R   KVM+ +D+S  SF ALKW +D+L              A ++ E    ++T+V+V+ 
Sbjct  5    RERMKVMIPLDESEGSFYALKWVLDHLFNSPTAPTTTTTDLAQSSQEAEPHLITIVHVRQ  64

Query  663  TFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENK-VRAETLILEGDAK  487
             F P IYP GP +  TPM+V+AV+K+ E  A+ + SRAL +C++ K V+AETL+LEGD K
Sbjct  65   PFTPFIYPAGPVVYATPMVVDAVRKANEEIATRIFSRALHMCKDQKMVKAETLVLEGDPK  124

Query  486  DRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIY  307
            DRICE A+E H DLLV+GSRGLGKIK                                  
Sbjct  125  DRICEVADEQHFDLLVIGSRGLGKIK----------------------------------  150

Query  306  IL**CRAFLGSVSDYCAHHVHCPILIVKPPSK  211
                 RAFLGSVSDYCAHHV CPILIVKPP +
Sbjct  151  -----RAFLGSVSDYCAHHVKCPILIVKPPKE  177



>ref|XP_006481852.1| PREDICTED: universal stress protein A-like protein-like [Citrus 
sinensis]
Length=197

 Score =   176 bits (447),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 125/214 (58%), Gaps = 49/214 (23%)
 Frame = -2

Query  834  TATRTTWKVMVAIDDSGESFNALKWAIDNL--LRRNYPSAATAADEIPAAMVTLVNVQPT  661
            T  +   KVMVAID+S ESFNALKWA+DNL  +    P A          ++T+V+VQ  
Sbjct  26   TDGKKKMKVMVAIDESAESFNALKWALDNLYGIVGFTPEAGGGG-----GILTIVHVQEP  80

Query  660  FGPIIYPP---GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDA  490
            F   + P          T  MVE+V+KSQE N++ +LSRALQ+C++  V+AE+L+LEGD 
Sbjct  81   FQRFVLPALSTSSAFYATSSMVESVRKSQEENSAALLSRALQMCKDKMVKAESLVLEGDP  140

Query  489  KDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSI  310
            KD IC++AE+MH+DLLVVGSRGLGKIK                                 
Sbjct  141  KDMICQSAEQMHIDLLVVGSRGLGKIK---------------------------------  167

Query  309  YIL**CRAFLGSVSDYCAHHVHCPILIVKPPSKE  208
                  RAFLGSVSDYCAHH  CPI+IVKPP ++
Sbjct  168  ------RAFLGSVSDYCAHHTVCPIIIVKPPKEQ  195



>gb|KDO70763.1| hypothetical protein CISIN_1g046290mg [Citrus sinensis]
Length=197

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 125/214 (58%), Gaps = 49/214 (23%)
 Frame = -2

Query  834  TATRTTWKVMVAIDDSGESFNALKWAIDNL--LRRNYPSAATAADEIPAAMVTLVNVQPT  661
            T  +   KVMVAID+S ESFNALKWA+DNL  +    P A          ++T+V+VQ  
Sbjct  26   TDGKKKMKVMVAIDESAESFNALKWALDNLYGIVGFTPEAGGGG-----GILTIVHVQEP  80

Query  660  FGPIIYPP---GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDA  490
            F   + P          T  MVE+V+KSQE N++ +LSRALQ+C++  V+AE+L+LEGD 
Sbjct  81   FQRFVLPALSTSSAFYATSSMVESVRKSQEENSAALLSRALQMCKDKMVKAESLVLEGDP  140

Query  489  KDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSI  310
            KD IC++AE+MH+DLLVVGSRGLGKIK                                 
Sbjct  141  KDMICQSAEQMHIDLLVVGSRGLGKIK---------------------------------  167

Query  309  YIL**CRAFLGSVSDYCAHHVHCPILIVKPPSKE  208
                  RAFLGSVSDYCAHH  CPI+IVKPP ++
Sbjct  168  ------RAFLGSVSDYCAHHAVCPIIIVKPPKEQ  195



>ref|NP_566406.1| universal stress protein-like protein [Arabidopsis thaliana]
 gb|AEE75119.1| universal stress protein-like protein [Arabidopsis thaliana]
Length=199

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/236 (44%), Positives = 136/236 (58%), Gaps = 53/236 (22%)
 Frame = -2

Query  900  ETSAYACPGEAMHSQVPTVKETTA-TRTTWKVMVAIDDSGESFNALKWAID---NLLRRN  733
            E +A A    A+  Q  T  E  A + TT +++VAID+S  SF AL+W ID   NLL   
Sbjct  4    EQAATAMETSAVEKQPETTTEAEAPSLTTKRMVVAIDESDSSFYALQWVIDHFSNLLL--  61

Query  732  YPSAATAADEIPAAMVTLVNVQPTFGPII-YPPGPN---LELTPMMVEAVKKSQEHNASE  565
                 TAA E  + M+T+++VQ  F     +P GP    +  +  M+E+VKK+Q+  ++ 
Sbjct  62   ----TTAAAEAESGMLTVIHVQSPFNHFAAFPAGPGGATVYASSSMIESVKKAQQETSAA  117

Query  564  VLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLIC  385
            +LSRALQ+CR  ++R ETL+LEG+AK+ ICEA E+MHVDLLVVGSRGLGKIK        
Sbjct  118  LLSRALQMCRAKQIRTETLVLEGEAKEMICEAVEKMHVDLLVVGSRGLGKIK--------  169

Query  384  FP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                                           RAFLGSVSDYCAHH +CPILIVKPP
Sbjct  170  -------------------------------RAFLGSVSDYCAHHANCPILIVKPP  194



>ref|NP_850562.1| universal stress protein-like protein [Arabidopsis thaliana]
 gb|AAF23209.1|AC016795_22 unknown protein [Arabidopsis thaliana]
 gb|AAK49598.1|AF372882_1 MEC18.3/MEC18.3 [Arabidopsis thaliana]
 gb|AAL16217.1|AF428448_1 At3g11930/MEC18.3 [Arabidopsis thaliana]
 dbj|BAB03102.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK91376.1| MEC18.3/MEC18.3 [Arabidopsis thaliana]
 gb|AAL15351.1| AT3g11930/MEC18.3 [Arabidopsis thaliana]
 gb|AEE75121.1| universal stress protein-like protein [Arabidopsis thaliana]
Length=200

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 136/237 (57%), Gaps = 54/237 (23%)
 Frame = -2

Query  900  ETSAYACPGEAMHSQVPTVKETTA-TRTTWKVMVAIDDSGESFNALKWAID---NLLRRN  733
            E +A A    A+  Q  T  E  A + TT +++VAID+S  SF AL+W ID   NLL   
Sbjct  4    EQAATAMETSAVEKQPETTTEAEAPSLTTKRMVVAIDESDSSFYALQWVIDHFSNLLL--  61

Query  732  YPSAATAADEIPAAMVTLVNVQPTFGPII-YPPGPN----LELTPMMVEAVKKSQEHNAS  568
                 TAA E  + M+T+++VQ  F     +P GP     +  +  M+E+VKK+Q+  ++
Sbjct  62   ----TTAAAEAESGMLTVIHVQSPFNHFAAFPAGPGGATAVYASSSMIESVKKAQQETSA  117

Query  567  EVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLI  388
             +LSRALQ+CR  ++R ETL+LEG+AK+ ICEA E+MHVDLLVVGSRGLGKIK       
Sbjct  118  ALLSRALQMCRAKQIRTETLVLEGEAKEMICEAVEKMHVDLLVVGSRGLGKIK-------  170

Query  387  CFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                                            RAFLGSVSDYCAHH +CPILIVKPP
Sbjct  171  --------------------------------RAFLGSVSDYCAHHANCPILIVKPP  195



>ref|XP_006407393.1| hypothetical protein EUTSA_v10021565mg [Eutrema salsugineum]
 gb|ESQ48846.1| hypothetical protein EUTSA_v10021565mg [Eutrema salsugineum]
Length=193

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 123/216 (57%), Gaps = 49/216 (23%)
 Frame = -2

Query  852  PTVKETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVN  673
            P + ET +  TT ++MVAID+S  SF  L+W ID+       S+  A       ++T+++
Sbjct  19   PEMTETPSVTTTKRIMVAIDESDSSFYVLQWVIDHF------SSLLATTLAEGGLLTVIH  72

Query  672  VQPTFGPII-YPPGP---NLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLI  505
            VQ  F     +P GP    +  +  M+EAVKKSQ+  ++ +LSRALQ+CR  ++R ETL+
Sbjct  73   VQSPFQHFTAFPAGPGSATVYASSSMIEAVKKSQQKASAALLSRALQMCRAKQIRTETLV  132

Query  504  LEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI*  325
            LEGDAKD IC+A E+MHVDLL VGSRGLGKIK                            
Sbjct  133  LEGDAKDMICQAVEQMHVDLLAVGSRGLGKIK----------------------------  164

Query  324  *VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                       RAFLGSVSDYCAHH  CPILIVKPP
Sbjct  165  -----------RAFLGSVSDYCAHHAKCPILIVKPP  189



>ref|XP_006407394.1| hypothetical protein EUTSA_v10021565mg [Eutrema salsugineum]
 gb|ESQ48847.1| hypothetical protein EUTSA_v10021565mg [Eutrema salsugineum]
Length=194

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 123/217 (57%), Gaps = 50/217 (23%)
 Frame = -2

Query  852  PTVKETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVN  673
            P + ET +  TT ++MVAID+S  SF  L+W ID+       S+  A       ++T+++
Sbjct  19   PEMTETPSVTTTKRIMVAIDESDSSFYVLQWVIDHF------SSLLATTLAEGGLLTVIH  72

Query  672  VQPTFGPII-YPPGPN----LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETL  508
            VQ  F     +P GP     +  +  M+EAVKKSQ+  ++ +LSRALQ+CR  ++R ETL
Sbjct  73   VQSPFQHFTAFPAGPGSATAVYASSSMIEAVKKSQQKASAALLSRALQMCRAKQIRTETL  132

Query  507  ILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI  328
            +LEGDAKD IC+A E+MHVDLL VGSRGLGKIK                           
Sbjct  133  VLEGDAKDMICQAVEQMHVDLLAVGSRGLGKIK---------------------------  165

Query  327  **VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                        RAFLGSVSDYCAHH  CPILIVKPP
Sbjct  166  ------------RAFLGSVSDYCAHHAKCPILIVKPP  190



>ref|NP_001030675.1| universal stress protein-like protein [Arabidopsis thaliana]
 gb|AEE75122.1| universal stress protein-like protein [Arabidopsis thaliana]
Length=201

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 105/238 (44%), Positives = 136/238 (57%), Gaps = 55/238 (23%)
 Frame = -2

Query  900  ETSAYACPGEAMHSQVPTVKETTA-TRTTWKVMVAIDDSGESFNALKWAID---NLLRRN  733
            E +A A    A+  Q  T  E  A + TT +++VAID+S  SF AL+W ID   NLL   
Sbjct  4    EQAATAMETSAVEKQPETTTEAEAPSLTTKRMVVAIDESDSSFYALQWVIDHFSNLLL--  61

Query  732  YPSAATAADEIPAAMVTLVNVQPTFGPII-YPPGPN-----LELTPMMVEAVKKSQEHNA  571
                 TAA E  + M+T+++VQ  F     +P GP      +  +  M+E+VKK+Q+  +
Sbjct  62   ----TTAAAEAESGMLTVIHVQSPFNHFAAFPAGPGGATAAVYASSSMIESVKKAQQETS  117

Query  570  SEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNL  391
            + +LSRALQ+CR  ++R ETL+LEG+AK+ ICEA E+MHVDLLVVGSRGLGKIK      
Sbjct  118  AALLSRALQMCRAKQIRTETLVLEGEAKEMICEAVEKMHVDLLVVGSRGLGKIK------  171

Query  390  ICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                                             RAFLGSVSDYCAHH +CPILIVKPP
Sbjct  172  ---------------------------------RAFLGSVSDYCAHHANCPILIVKPP  196



>gb|KDP21925.1| hypothetical protein JCGZ_03063 [Jatropha curcas]
Length=187

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 99/221 (45%), Positives = 126/221 (57%), Gaps = 45/221 (20%)
 Frame = -2

Query  867  MHSQVPTVKETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAM  688
            M S   + +     R   KVMVA+D+S  SF AL+W++DNL+  +  SA        + +
Sbjct  1    MESGATSARVVVGQRQKMKVMVALDESDGSFYALQWSLDNLI--DGVSATNEPSLQESGL  58

Query  687  VTLVNVQPTFGPIIYPPGPN--LELTP--MMVEAVKKSQEHNASEVLSRALQICRENKVR  520
            VTLV+VQ  F P  YP GP       P   ++E+V+K+Q  N++ +LSRAL++C E  ++
Sbjct  59   VTLVHVQQPFQPSFYPVGPGGAAAFYPPTTLMESVRKAQAENSAAILSRALKMCNEKMIK  118

Query  519  AETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIK  340
            AETLILEGDAKD+I +A E+M VDLLVVGSRGLGKIK                       
Sbjct  119  AETLILEGDAKDKISQATEQMDVDLLVVGSRGLGKIK-----------------------  155

Query  339  RMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                            RAFLGSVSDYCAHH  CPILIVKPP
Sbjct  156  ----------------RAFLGSVSDYCAHHAKCPILIVKPP  180



>ref|XP_010653225.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Vitis vinifera]
Length=205

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 123/201 (61%), Gaps = 50/201 (25%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGP  631
            VMVA+D S  SF AL+WA++NL RR    AA   +E+   MVT+V+VQ  F   + P GP
Sbjct  48   VMVAVDQSESSFYALQWALENLFRRK--GAAVETEEV--GMVTVVHVQQPFHNYVLPAGP  103

Query  630  NLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHV  451
                   ++E+V+K+QE N+S +LSRAL++C++  V+AETLIL+GD K+ IC+AAE+MHV
Sbjct  104  -------VIESVRKAQEQNSSVILSRALRLCKDKMVKAETLILDGDPKEMICQAAEQMHV  156

Query  450  DLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSV  271
            DLL+VGSRGL K+K                                       RAFLGSV
Sbjct  157  DLLLVGSRGLSKLK---------------------------------------RAFLGSV  177

Query  270  SDYCAHHVHCPILIVKPPSKE  208
            SDYCAHH  CPILIVKPP ++
Sbjct  178  SDYCAHHAKCPILIVKPPEEK  198



>ref|XP_002882756.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59015.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=200

 Score =   174 bits (442),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 125/210 (60%), Gaps = 53/210 (25%)
 Frame = -2

Query  822  TTWKVMVAIDDSGESFNALKWAID---NLLRRNYPSAATAADEIPAAMVTLVNVQ-PTFG  655
            TT +++VAID+S  SF AL+W ID   NLL        T A E  + M+T+V+VQ P + 
Sbjct  31   TTKRMVVAIDESDSSFYALQWVIDHFSNLLL------TTEAAEAESGMLTVVHVQSPYYH  84

Query  654  PIIYPPGPN----LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAK  487
               +P GP     +  +  M+E+VKK+Q+  ++ +LSRALQ+CR  ++R ETL+LEGDAK
Sbjct  85   FAAFPAGPGGATAVYASSTMIESVKKAQQETSAALLSRALQMCRAKQIRTETLVLEGDAK  144

Query  486  DRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIY  307
            + ICEA E+MHVDLLVVGSRGLGKIK                                  
Sbjct  145  EMICEAVEQMHVDLLVVGSRGLGKIK----------------------------------  170

Query  306  IL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                 RAFLGSVSDYCAHH +CPILIVKPP
Sbjct  171  -----RAFLGSVSDYCAHHANCPILIVKPP  195



>ref|XP_006429978.1| hypothetical protein CICLE_v10012833mg [Citrus clementina]
 gb|ESR43218.1| hypothetical protein CICLE_v10012833mg [Citrus clementina]
Length=197

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 124/214 (58%), Gaps = 49/214 (23%)
 Frame = -2

Query  834  TATRTTWKVMVAIDDSGESFNALKWAIDNL--LRRNYPSAATAADEIPAAMVTLVNVQPT  661
            T  +   KVMVAID+S ES NALKWA+DNL  +    P A          ++T+V+VQ  
Sbjct  26   TDGKKKMKVMVAIDESAESVNALKWALDNLYGIVGFTPEAGGGG-----GILTIVHVQQP  80

Query  660  FGPIIYPP---GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDA  490
            F   + P          T  MVE+V+KSQE N++ +LSRALQ+C++  V+AE+L+LEGD 
Sbjct  81   FQRFVLPALSTSSAFYATSSMVESVRKSQEENSAALLSRALQMCKDKMVKAESLVLEGDP  140

Query  489  KDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSI  310
            KD IC++AE+MH+DLLVVGSRGLGKIK                                 
Sbjct  141  KDMICQSAEQMHIDLLVVGSRGLGKIK---------------------------------  167

Query  309  YIL**CRAFLGSVSDYCAHHVHCPILIVKPPSKE  208
                  RAFLGSVSDYCAHH  CPI+IVKPP ++
Sbjct  168  ------RAFLGSVSDYCAHHAVCPIIIVKPPKEQ  195



>ref|XP_010263144.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Nelumbo nucifera]
Length=187

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 124/201 (62%), Gaps = 44/201 (22%)
 Frame = -2

Query  819  TWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADE-IPAAMVTLVNVQPTFGPIIY  643
            T KV+VAID+S  SF AL+WAIDN+    +  A  A D+ +  + + L++VQ  F   I+
Sbjct  28   TMKVIVAIDESEGSFYALRWAIDNI----FTYAVAAPDQSLELSKIYLLHVQQPFQHYIF  83

Query  642  PPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAE  463
            P GP +  T  ++++VKK+QE N++ +L+RALQIC+E  ++AET+IL+GD KD IC+AAE
Sbjct  84   PSGPAVYATSAVLDSVKKAQEQNSATLLARALQICKERMIKAETIILDGDPKDVICQAAE  143

Query  462  EMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAF  283
            ++H D ++VGSRGLGKIK                                       RAF
Sbjct  144  QIHADYVIVGSRGLGKIK---------------------------------------RAF  164

Query  282  LGSVSDYCAHHVHCPILIVKP  220
            LGSVSDYCAHHV CP+LIVKP
Sbjct  165  LGSVSDYCAHHVKCPVLIVKP  185



>ref|XP_004303418.1| PREDICTED: universal stress protein YxiE-like [Fragaria vesca 
subsp. vesca]
Length=204

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 120/206 (58%), Gaps = 44/206 (21%)
 Frame = -2

Query  825  RTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPII  646
            RT  +VMVAID+S  SF AL WA+D+L     P +     E  A +VT+V+V   F   +
Sbjct  28   RTKMRVMVAIDESDSSFYALTWALDHLFIN--PPSTVEGGEGEAGLVTVVHVTQPFQHFV  85

Query  645  YPPGPN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
            YP GP       +  +VE+VKK+QE +++ +LSRALQIC++  ++AETLI+ GD KD IC
Sbjct  86   YPAGPGGATYYASASVVESVKKAQEESSAAILSRALQICKDRMIKAETLIMTGDPKDVIC  145

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            +A E+MHVDLLVVGSRGLG +K                                      
Sbjct  146  QATEQMHVDLLVVGSRGLGMVK--------------------------------------  167

Query  294  CRAFLGSVSDYCAHHVHCPILIVKPP  217
             RAFLGSVSDYCAHH  CP++IVKPP
Sbjct  168  -RAFLGSVSDYCAHHAACPVVIVKPP  192



>ref|XP_010498281.1| PREDICTED: uncharacterized protein LOC104775979 isoform X3 [Camelina 
sativa]
Length=204

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 123/208 (59%), Gaps = 50/208 (24%)
 Frame = -2

Query  819  TWKVMVAIDDSGESFNALKWAID---NLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPI  649
            T ++MVAID+S  SF AL+W ID   NLL     +  T A E    M+T+V+VQ  F   
Sbjct  34   TKRMMVAIDESDSSFYALQWVIDHFSNLLM----TTGTEAAESEGGMLTVVHVQSPFHHF  89

Query  648  I-YPPGPN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDR  481
              +P GP    +  +  M+E+VKK+Q+  ++ +LSRALQICR  ++R ETL+LEG+AK+ 
Sbjct  90   AAFPAGPGGATVYASSTMIESVKKAQQETSAALLSRALQICRAKQIRTETLVLEGEAKEM  149

Query  480  ICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL  301
            ICEA E+MHVDLL+VGSRGLGKIK                                    
Sbjct  150  ICEAVEQMHVDLLIVGSRGLGKIK------------------------------------  173

Query  300  **CRAFLGSVSDYCAHHVHCPILIVKPP  217
               RAF+GSVSDYCAHH +CPILIVKPP
Sbjct  174  ---RAFIGSVSDYCAHHANCPILIVKPP  198



>ref|XP_010486865.1| PREDICTED: uncharacterized protein LOC104764950 isoform X3 [Camelina 
sativa]
Length=200

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 123/208 (59%), Gaps = 50/208 (24%)
 Frame = -2

Query  819  TWKVMVAIDDSGESFNALKWAID---NLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPI  649
            T ++MVAID+S  SF AL+W ID   NLL     +  T A E    M+T+V+VQ  F   
Sbjct  30   TKRMMVAIDESDSSFYALQWVIDHFSNLLM----TTGTEAAESEGGMLTVVHVQSPFHHF  85

Query  648  I-YPPGPN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDR  481
              +P GP    +  +  M+E+VKK+Q+  ++ +LSRALQICR  ++R ETL+LEG+AK+ 
Sbjct  86   AAFPAGPGGATVYASSTMIESVKKAQQETSAALLSRALQICRAKQIRTETLVLEGEAKEM  145

Query  480  ICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL  301
            ICEA E+MHVDLL+VGSRGLGKIK                                    
Sbjct  146  ICEAVEQMHVDLLIVGSRGLGKIK------------------------------------  169

Query  300  **CRAFLGSVSDYCAHHVHCPILIVKPP  217
               RAF+GSVSDYCAHH +CPILIVKPP
Sbjct  170  ---RAFIGSVSDYCAHHANCPILIVKPP  194



>ref|XP_010498273.1| PREDICTED: uncharacterized protein LOC104775979 isoform X2 [Camelina 
sativa]
Length=205

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 123/209 (59%), Gaps = 51/209 (24%)
 Frame = -2

Query  819  TWKVMVAIDDSGESFNALKWAID---NLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPI  649
            T ++MVAID+S  SF AL+W ID   NLL     +  T A E    M+T+V+VQ  F   
Sbjct  34   TKRMMVAIDESDSSFYALQWVIDHFSNLLM----TTGTEAAESEGGMLTVVHVQSPFHHF  89

Query  648  I-YPPGPN----LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKD  484
              +P GP     +  +  M+E+VKK+Q+  ++ +LSRALQICR  ++R ETL+LEG+AK+
Sbjct  90   AAFPAGPGGATAVYASSTMIESVKKAQQETSAALLSRALQICRAKQIRTETLVLEGEAKE  149

Query  483  RICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYI  304
             ICEA E+MHVDLL+VGSRGLGKIK                                   
Sbjct  150  MICEAVEQMHVDLLIVGSRGLGKIK-----------------------------------  174

Query  303  L**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                RAF+GSVSDYCAHH +CPILIVKPP
Sbjct  175  ----RAFIGSVSDYCAHHANCPILIVKPP  199



>ref|XP_010486864.1| PREDICTED: uncharacterized protein LOC104764950 isoform X2 [Camelina 
sativa]
Length=201

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 123/209 (59%), Gaps = 51/209 (24%)
 Frame = -2

Query  819  TWKVMVAIDDSGESFNALKWAID---NLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPI  649
            T ++MVAID+S  SF AL+W ID   NLL     +  T A E    M+T+V+VQ  F   
Sbjct  30   TKRMMVAIDESDSSFYALQWVIDHFSNLLM----TTGTEAAESEGGMLTVVHVQSPFHHF  85

Query  648  I-YPPGPN----LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKD  484
              +P GP     +  +  M+E+VKK+Q+  ++ +LSRALQICR  ++R ETL+LEG+AK+
Sbjct  86   AAFPAGPGGATAVYASSTMIESVKKAQQETSAALLSRALQICRAKQIRTETLVLEGEAKE  145

Query  483  RICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYI  304
             ICEA E+MHVDLL+VGSRGLGKIK                                   
Sbjct  146  MICEAVEQMHVDLLIVGSRGLGKIK-----------------------------------  170

Query  303  L**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                RAF+GSVSDYCAHH +CPILIVKPP
Sbjct  171  ----RAFIGSVSDYCAHHANCPILIVKPP  195



>emb|CDY47907.1| BnaAnng09390D [Brassica napus]
 emb|CDY08481.1| BnaA05g27170D [Brassica napus]
Length=200

 Score =   172 bits (435),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 104/236 (44%), Positives = 133/236 (56%), Gaps = 59/236 (25%)
 Frame = -2

Query  900  ETSAYACPGEAMHSQVPTVKETTATRTTWKVMVAIDDSGESFNALKWAID---NLLRRNY  730
            ETSA     E   ++ PTV        T ++MVAID+S  SF AL+W ID   NLL    
Sbjct  11   ETSAVEKQPETTGAEAPTVT------ITKRMMVAIDESDSSFYALQWVIDHFSNLLM---  61

Query  729  PSAATAADEIPAAMVTLVNVQ-PTFGPIIYPPGPN----LELTPMMVEAVKKSQEHNASE  565
                T A E    ++T+V+VQ P+     +P GP     +  +  M+E+VKK+Q+  ++ 
Sbjct  62   ---TTEAAEAEGGLLTVVHVQSPSHHFAAFPAGPGGATAVYASSSMIESVKKAQQEASAA  118

Query  564  VLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLIC  385
            +LSRALQ+CR  ++R ETLILEG+AKD IC+A E+MHVDLLVVGSRGLGKIK        
Sbjct  119  LLSRALQMCRAKQIRTETLILEGEAKDMICQAVEQMHVDLLVVGSRGLGKIK--------  170

Query  384  FP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                                           RAF+GSVSDYCAHH +CPILIVKPP
Sbjct  171  -------------------------------RAFIGSVSDYCAHHANCPILIVKPP  195



>ref|XP_009121035.1| PREDICTED: uncharacterized protein LOC103845875 isoform X2 [Brassica 
rapa]
Length=199

 Score =   172 bits (435),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 103/235 (44%), Positives = 133/235 (57%), Gaps = 58/235 (25%)
 Frame = -2

Query  900  ETSAYACPGEAMHSQVPTVKETTATRTTWKVMVAIDDSGESFNALKWAID---NLLRRNY  730
            ETSA     E   ++ PTV        T ++MVAID+S  SF AL+W ID   NLL    
Sbjct  11   ETSAVEKQPETTGAEAPTVT------ITKRMMVAIDESDSSFYALQWVIDHFSNLLM---  61

Query  729  PSAATAADEIPAAMVTLVNVQ-PTFGPIIYPPGPN---LELTPMMVEAVKKSQEHNASEV  562
                T A E    ++T+V+VQ P+     +P GP    +  +  M+E+VKK+Q+  ++ +
Sbjct  62   ---TTEAAEAEGGLLTVVHVQSPSHHFAAFPAGPGGATVYASSSMIESVKKAQQEASAAL  118

Query  561  LSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICF  382
            LSRALQ+CR  ++R ETL+LEG+AKD IC+A E+MHVDLLVVGSRGLGKIK         
Sbjct  119  LSRALQMCRAKQIRTETLVLEGEAKDMICQAVEQMHVDLLVVGSRGLGKIK---------  169

Query  381  P*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                                          RAF+GSVSDYCAHH +CPILIVKPP
Sbjct  170  ------------------------------RAFIGSVSDYCAHHANCPILIVKPP  194



>ref|XP_007202546.1| hypothetical protein PRUPE_ppa011155mg [Prunus persica]
 gb|EMJ03745.1| hypothetical protein PRUPE_ppa011155mg [Prunus persica]
Length=221

 Score =   172 bits (437),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 98/220 (45%), Positives = 125/220 (57%), Gaps = 49/220 (22%)
 Frame = -2

Query  840  ETTATRTTWKVMVAIDDSGESFNALKWAIDNLL-RRNYPSAATAADEIPA------AMVT  682
            E    +   +VMVAID+S  SF ALKWA+D+L    N  +   A  E PA      +M T
Sbjct  11   EEQQGKKKMRVMVAIDESEWSFYALKWALDHLFVGPNDKAGVAATREAPAVSQENVSMAT  70

Query  681  LVNVQPTFGPIIYPPGPN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAET  511
            LV+V P F   + P GP      +TP ++E+V+K+QE  A++VLSRAL+IC++  ++AET
Sbjct  71   LVHVMPPFYNYVLPAGPGGAAYYVTPALLESVRKAQEDGAADVLSRALEICKDKMIKAET  130

Query  510  LILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMF  331
            LIL GD KD ICEA E+ HVDLLVVGSRGLG +K                          
Sbjct  131  LILRGDPKDMICEATEQSHVDLLVVGSRGLGMVK--------------------------  164

Query  330  I**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPPSK  211
                         RAFLGSVSDYCAHH  CP++IVKPP +
Sbjct  165  -------------RAFLGSVSDYCAHHAKCPVVIVKPPKE  191



>gb|AAM66054.1| ethylene-responsive protein, putative [Arabidopsis thaliana]
Length=199

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 104/236 (44%), Positives = 135/236 (57%), Gaps = 53/236 (22%)
 Frame = -2

Query  900  ETSAYACPGEAMHSQVPTVKETTA-TRTTWKVMVAIDDSGESFNALKWAID---NLLRRN  733
            E +A A    A+  Q  T  E  A + TT +++VAID+S  SF AL+  ID   NLL   
Sbjct  4    EQAATAMETSAVEKQPETTTEAEAPSLTTKRMVVAIDESDSSFYALQLVIDHFSNLLL--  61

Query  732  YPSAATAADEIPAAMVTLVNVQPTFGPII-YPPGPN---LELTPMMVEAVKKSQEHNASE  565
                 TAA E  + M+T+++VQ  F     +P GP    +  +  M+E+VKK+Q+  ++ 
Sbjct  62   ----TTAAAEAESGMLTVIHVQSPFNHFAAFPAGPGGATVYASSSMIESVKKAQQETSAA  117

Query  564  VLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLIC  385
            +LSRALQ+CR  ++R ETL+LEG+AK+ ICEA E+MHVDLLVVGSRGLGKIK        
Sbjct  118  LLSRALQMCRAKQIRTETLVLEGEAKEMICEAVEKMHVDLLVVGSRGLGKIK--------  169

Query  384  FP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                                           RAFLGSVSDYCAHH +CPILIVKPP
Sbjct  170  -------------------------------RAFLGSVSDYCAHHANCPILIVKPP  194



>ref|XP_009135196.1| PREDICTED: uncharacterized protein LOC103859417 isoform X2 [Brassica 
rapa]
Length=198

 Score =   171 bits (434),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 125/217 (58%), Gaps = 47/217 (22%)
 Frame = -2

Query  852  PTVKETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVN  673
            P  ++     TT ++MVAID+S  SF AL+W ID+       + A  A+     ++T+V+
Sbjct  19   PETEQPRVMTTTKRMMVAIDESDSSFYALQWVIDHFSSLLMTTEAAGAE---GDLLTVVH  75

Query  672  VQ-PTFGPIIYPPGPN----LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETL  508
            VQ P +    +P GP     +  +  M+E+VKK+Q+  ++ +LSR LQ+CR  ++RAETL
Sbjct  76   VQSPFYHFAAFPAGPGGATAVYASTAMIESVKKAQQETSAALLSRVLQMCRAKQIRAETL  135

Query  507  ILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI  328
            +LEGDAKD IC+A E+MHVDLLVVGSRGLGKIK                           
Sbjct  136  VLEGDAKDMICQAVEQMHVDLLVVGSRGLGKIK---------------------------  168

Query  327  **VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                        RAFLGSVSDYCAHH  CPILIV+PP
Sbjct  169  ------------RAFLGSVSDYCAHHAKCPILIVRPP  193



>ref|XP_010498264.1| PREDICTED: uncharacterized protein LOC104775979 isoform X1 [Camelina 
sativa]
Length=206

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 123/210 (59%), Gaps = 52/210 (25%)
 Frame = -2

Query  819  TWKVMVAIDDSGESFNALKWAID---NLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPI  649
            T ++MVAID+S  SF AL+W ID   NLL     +  T A E    M+T+V+VQ  F   
Sbjct  34   TKRMMVAIDESDSSFYALQWVIDHFSNLLM----TTGTEAAESEGGMLTVVHVQSPFHHF  89

Query  648  I-YPPGPN-----LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAK  487
              +P GP      +  +  M+E+VKK+Q+  ++ +LSRALQICR  ++R ETL+LEG+AK
Sbjct  90   AAFPAGPGGATAAVYASSTMIESVKKAQQETSAALLSRALQICRAKQIRTETLVLEGEAK  149

Query  486  DRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIY  307
            + ICEA E+MHVDLL+VGSRGLGKIK                                  
Sbjct  150  EMICEAVEQMHVDLLIVGSRGLGKIK----------------------------------  175

Query  306  IL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                 RAF+GSVSDYCAHH +CPILIVKPP
Sbjct  176  -----RAFIGSVSDYCAHHANCPILIVKPP  200



>ref|XP_010486863.1| PREDICTED: uncharacterized protein LOC104764950 isoform X1 [Camelina 
sativa]
Length=202

 Score =   172 bits (435),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 123/210 (59%), Gaps = 52/210 (25%)
 Frame = -2

Query  819  TWKVMVAIDDSGESFNALKWAID---NLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPI  649
            T ++MVAID+S  SF AL+W ID   NLL     +  T A E    M+T+V+VQ  F   
Sbjct  30   TKRMMVAIDESDSSFYALQWVIDHFSNLLM----TTGTEAAESEGGMLTVVHVQSPFHHF  85

Query  648  I-YPPGPN-----LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAK  487
              +P GP      +  +  M+E+VKK+Q+  ++ +LSRALQICR  ++R ETL+LEG+AK
Sbjct  86   AAFPAGPGGATAAVYASSTMIESVKKAQQETSAALLSRALQICRAKQIRTETLVLEGEAK  145

Query  486  DRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIY  307
            + ICEA E+MHVDLL+VGSRGLGKIK                                  
Sbjct  146  EMICEAVEQMHVDLLIVGSRGLGKIK----------------------------------  171

Query  306  IL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                 RAF+GSVSDYCAHH +CPILIVKPP
Sbjct  172  -----RAFIGSVSDYCAHHANCPILIVKPP  196



>ref|XP_009121027.1| PREDICTED: uncharacterized protein LOC103845875 isoform X1 [Brassica 
rapa]
Length=200

 Score =   171 bits (434),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 103/236 (44%), Positives = 133/236 (56%), Gaps = 59/236 (25%)
 Frame = -2

Query  900  ETSAYACPGEAMHSQVPTVKETTATRTTWKVMVAIDDSGESFNALKWAID---NLLRRNY  730
            ETSA     E   ++ PTV        T ++MVAID+S  SF AL+W ID   NLL    
Sbjct  11   ETSAVEKQPETTGAEAPTVT------ITKRMMVAIDESDSSFYALQWVIDHFSNLLM---  61

Query  729  PSAATAADEIPAAMVTLVNVQ-PTFGPIIYPPGPN----LELTPMMVEAVKKSQEHNASE  565
                T A E    ++T+V+VQ P+     +P GP     +  +  M+E+VKK+Q+  ++ 
Sbjct  62   ---TTEAAEAEGGLLTVVHVQSPSHHFAAFPAGPGGATAVYASSSMIESVKKAQQEASAA  118

Query  564  VLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLIC  385
            +LSRALQ+CR  ++R ETL+LEG+AKD IC+A E+MHVDLLVVGSRGLGKIK        
Sbjct  119  LLSRALQMCRAKQIRTETLVLEGEAKDMICQAVEQMHVDLLVVGSRGLGKIK--------  170

Query  384  FP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                                           RAF+GSVSDYCAHH +CPILIVKPP
Sbjct  171  -------------------------------RAFIGSVSDYCAHHANCPILIVKPP  195



>ref|XP_009135195.1| PREDICTED: uncharacterized protein LOC103859417 isoform X1 [Brassica 
rapa]
Length=199

 Score =   171 bits (434),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 94/218 (43%), Positives = 125/218 (57%), Gaps = 48/218 (22%)
 Frame = -2

Query  852  PTVKETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVN  673
            P  ++     TT ++MVAID+S  SF AL+W ID+       + A  A+     ++T+V+
Sbjct  19   PETEQPRVMTTTKRMMVAIDESDSSFYALQWVIDHFSSLLMTTEAAGAE---GDLLTVVH  75

Query  672  VQ-PTFGPIIYPPGPN-----LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAET  511
            VQ P +    +P GP      +  +  M+E+VKK+Q+  ++ +LSR LQ+CR  ++RAET
Sbjct  76   VQSPFYHFAAFPAGPGGATAAVYASTAMIESVKKAQQETSAALLSRVLQMCRAKQIRAET  135

Query  510  LILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMF  331
            L+LEGDAKD IC+A E+MHVDLLVVGSRGLGKIK                          
Sbjct  136  LVLEGDAKDMICQAVEQMHVDLLVVGSRGLGKIK--------------------------  169

Query  330  I**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                         RAFLGSVSDYCAHH  CPILIV+PP
Sbjct  170  -------------RAFLGSVSDYCAHHAKCPILIVRPP  194



>ref|XP_010464927.1| PREDICTED: uncharacterized protein LOC104745401 isoform X1 [Camelina 
sativa]
 ref|XP_010464929.1| PREDICTED: uncharacterized protein LOC104745401 isoform X3 [Camelina 
sativa]
Length=206

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 123/210 (59%), Gaps = 52/210 (25%)
 Frame = -2

Query  819  TWKVMVAIDDSGESFNALKWAID---NLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPI  649
            T ++MVAID+S  SF AL+W ID   NLL     +  T A E    M+T+V+VQ  F   
Sbjct  34   TKRMMVAIDESDSSFYALQWVIDHFSNLLM----TTGTEAAESEGGMLTVVHVQSPFHHF  89

Query  648  I-YPPGPN-----LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAK  487
              +P GP      +  +  M+E+VKK+Q+  ++ +LSRALQICR  ++R ETL+LEG+AK
Sbjct  90   AAFPAGPGGATAAVYASSTMIESVKKAQQETSAALLSRALQICRAKQIRTETLVLEGEAK  149

Query  486  DRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIY  307
            + ICEA E+MHVDLL+VGSRGLGKIK                                  
Sbjct  150  EMICEAVEKMHVDLLIVGSRGLGKIK----------------------------------  175

Query  306  IL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                 RAF+GSVSDYCAHH +CPILIVKPP
Sbjct  176  -----RAFIGSVSDYCAHHANCPILIVKPP  200



>ref|XP_010105075.1| Universal stress protein A-like protein [Morus notabilis]
 gb|EXC03813.1| Universal stress protein A-like protein [Morus notabilis]
Length=189

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 124/211 (59%), Gaps = 45/211 (21%)
 Frame = -2

Query  825  RTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIP--AAMVTLVNVQPTFGP  652
            R   +VMVA+D+S  SF+ALKWA+D++     P+A    +  P    MV LV+VQ  F  
Sbjct  15   RKPMRVMVAMDESDFSFHALKWALDHVFVTPEPAAEKTEEASPEEVDMVVLVHVQEPFVH  74

Query  651  IIYPPGPN---LELTPMMVEAVKKSQEHNASEVLSRALQICREN-KVRAETLILEGDAKD  484
              +P GP    +  T  +VE+V+K+QE N++ +LSRALQ+C+E   ++AETL+LEGD KD
Sbjct  75   YGFPAGPGGTAVYATTTVVESVRKAQEENSAALLSRALQMCKEKPNIKAETLMLEGDPKD  134

Query  483  RICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYI  304
            RIC+A E+MHVDLLVVGSRGLG IK                                   
Sbjct  135  RICQATEQMHVDLLVVGSRGLGTIK-----------------------------------  159

Query  303  L**CRAFLGSVSDYCAHHVHCPILIVKPPSK  211
                RAFLGSVSDYC HH  CP+LIVKPP +
Sbjct  160  ----RAFLGSVSDYCTHHAKCPVLIVKPPKE  186



>ref|XP_002323356.2| hypothetical protein POPTR_0016s06400g [Populus trichocarpa]
 gb|EEF05117.2| hypothetical protein POPTR_0016s06400g [Populus trichocarpa]
Length=213

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 125/206 (61%), Gaps = 44/206 (21%)
 Frame = -2

Query  825  RTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPII  646
            R   ++MVAID+S  SF ALKWA+D+L+    P+   + +E  ++++TLV+VQ  F   +
Sbjct  31   RKRMRIMVAIDESDGSFYALKWALDHLVDGITPTNVPSQEE--SSLITLVHVQQPFQHSV  88

Query  645  YPPGPN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
             P GP       TP +VE+V+++Q  N + +LSRALQ+C++  ++AE+LILEG+ KD+IC
Sbjct  89   IPAGPGGAAFYATPSIVESVREAQAENDAALLSRALQMCKDKMIKAESLILEGEPKDKIC  148

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            +A E+M VDLLV+GSRGLGKIK                                      
Sbjct  149  QATEQMQVDLLVLGSRGLGKIK--------------------------------------  170

Query  294  CRAFLGSVSDYCAHHVHCPILIVKPP  217
             RAFLGSVSDYCAHH  CP+LIVKPP
Sbjct  171  -RAFLGSVSDYCAHHAKCPVLIVKPP  195



>ref|XP_010464928.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Camelina sativa]
Length=185

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 123/210 (59%), Gaps = 52/210 (25%)
 Frame = -2

Query  819  TWKVMVAIDDSGESFNALKWAID---NLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPI  649
            T ++MVAID+S  SF AL+W ID   NLL     +  T A E    M+T+V+VQ  F   
Sbjct  13   TKRMMVAIDESDSSFYALQWVIDHFSNLLM----TTGTEAAESEGGMLTVVHVQSPFHHF  68

Query  648  I-YPPGPN-----LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAK  487
              +P GP      +  +  M+E+VKK+Q+  ++ +LSRALQICR  ++R ETL+LEG+AK
Sbjct  69   AAFPAGPGGATAAVYASSTMIESVKKAQQETSAALLSRALQICRAKQIRTETLVLEGEAK  128

Query  486  DRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIY  307
            + ICEA E+MHVDLL+VGSRGLGKIK                                  
Sbjct  129  EMICEAVEKMHVDLLIVGSRGLGKIK----------------------------------  154

Query  306  IL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                 RAF+GSVSDYCAHH +CPILIVKPP
Sbjct  155  -----RAFIGSVSDYCAHHANCPILIVKPP  179



>ref|XP_010464931.1| PREDICTED: universal stress protein A-like protein isoform X5 
[Camelina sativa]
Length=168

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 121/205 (59%), Gaps = 50/205 (24%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAID---NLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPII-Y  643
            +MVAID+S  SF AL+W ID   NLL     +  T A E    M+T+V+VQ  F     +
Sbjct  1    MMVAIDESDSSFYALQWVIDHFSNLLM----TTGTEAAESEGGMLTVVHVQSPFHHFAAF  56

Query  642  PPGPN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICE  472
            P GP    +  +  M+E+VKK+Q+  ++ +LSRALQICR  ++R ETL+LEG+AK+ ICE
Sbjct  57   PAGPGGATVYASSTMIESVKKAQQETSAALLSRALQICRAKQIRTETLVLEGEAKEMICE  116

Query  471  AAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**C  292
            A E+MHVDLL+VGSRGLGKIK                                       
Sbjct  117  AVEKMHVDLLIVGSRGLGKIK---------------------------------------  137

Query  291  RAFLGSVSDYCAHHVHCPILIVKPP  217
            RAF+GSVSDYCAHH +CPILIVKPP
Sbjct  138  RAFIGSVSDYCAHHANCPILIVKPP  162



>ref|XP_010464930.1| PREDICTED: universal stress protein A-like protein isoform X4 
[Camelina sativa]
Length=169

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 121/206 (59%), Gaps = 51/206 (25%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAID---NLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPII-Y  643
            +MVAID+S  SF AL+W ID   NLL     +  T A E    M+T+V+VQ  F     +
Sbjct  1    MMVAIDESDSSFYALQWVIDHFSNLLM----TTGTEAAESEGGMLTVVHVQSPFHHFAAF  56

Query  642  PPGPN----LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
            P GP     +  +  M+E+VKK+Q+  ++ +LSRALQICR  ++R ETL+LEG+AK+ IC
Sbjct  57   PAGPGGATAVYASSTMIESVKKAQQETSAALLSRALQICRAKQIRTETLVLEGEAKEMIC  116

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            EA E+MHVDLL+VGSRGLGKIK                                      
Sbjct  117  EAVEKMHVDLLIVGSRGLGKIK--------------------------------------  138

Query  294  CRAFLGSVSDYCAHHVHCPILIVKPP  217
             RAF+GSVSDYCAHH +CPILIVKPP
Sbjct  139  -RAFIGSVSDYCAHHANCPILIVKPP  163



>ref|XP_006296619.1| hypothetical protein CARUB_v10014583mg, partial [Capsella rubella]
 gb|EOA29517.1| hypothetical protein CARUB_v10014583mg, partial [Capsella rubella]
Length=220

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 122/208 (59%), Gaps = 52/208 (25%)
 Frame = -2

Query  819  TWKVMVAIDDSGESFNALKWAID---NLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPI  649
            T ++MVAID+S  SF AL+W ID   NLL        T A E    M+T+V+VQ  F   
Sbjct  52   TKRMMVAIDESDSSFYALQWVIDHFSNLLM------TTEAAEGDGGMLTVVHVQSPFHHF  105

Query  648  I-YPPGPN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDR  481
              +P GP    +  +  M+E+VKK+Q+  ++ +LSRALQ+CR  ++R ETL+LEG+AK+ 
Sbjct  106  AAFPAGPGGATVYASSTMIESVKKAQQETSAALLSRALQMCRAKQIRTETLVLEGEAKEM  165

Query  480  ICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL  301
            ICEA E+MHVDLLVVGSRGLGKIK                                    
Sbjct  166  ICEAVEQMHVDLLVVGSRGLGKIK------------------------------------  189

Query  300  **CRAFLGSVSDYCAHHVHCPILIVKPP  217
               RAF+GSVSDYCAHH +CPILIVKPP
Sbjct  190  ---RAFIGSVSDYCAHHANCPILIVKPP  214



>ref|XP_006296620.1| hypothetical protein CARUB_v10014583mg, partial [Capsella rubella]
 gb|EOA29518.1| hypothetical protein CARUB_v10014583mg, partial [Capsella rubella]
Length=221

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 122/209 (58%), Gaps = 53/209 (25%)
 Frame = -2

Query  819  TWKVMVAIDDSGESFNALKWAID---NLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPI  649
            T ++MVAID+S  SF AL+W ID   NLL        T A E    M+T+V+VQ  F   
Sbjct  52   TKRMMVAIDESDSSFYALQWVIDHFSNLLM------TTEAAEGDGGMLTVVHVQSPFHHF  105

Query  648  I-YPPGPN----LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKD  484
              +P GP     +  +  M+E+VKK+Q+  ++ +LSRALQ+CR  ++R ETL+LEG+AK+
Sbjct  106  AAFPAGPGGATAVYASSTMIESVKKAQQETSAALLSRALQMCRAKQIRTETLVLEGEAKE  165

Query  483  RICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYI  304
             ICEA E+MHVDLLVVGSRGLGKIK                                   
Sbjct  166  MICEAVEQMHVDLLVVGSRGLGKIK-----------------------------------  190

Query  303  L**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                RAF+GSVSDYCAHH +CPILIVKPP
Sbjct  191  ----RAFIGSVSDYCAHHANCPILIVKPP  215



>ref|XP_008241214.1| PREDICTED: uncharacterized protein LOC103339659 [Prunus mume]
Length=208

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 98/221 (44%), Positives = 125/221 (57%), Gaps = 49/221 (22%)
 Frame = -2

Query  843  KETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAAD-EIPA------AMV  685
            K+        +VMVAID+S  SF ALKWA+D+L       A  AA  E PA      +M 
Sbjct  16   KDEQQREKKMRVMVAIDESEWSFYALKWALDHLFVGPNDKAGVAATLEAPAGSQENVSMA  75

Query  684  TLVNVQPTFGPIIYPPGPN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAE  514
            TLV+V P F   + P GP      +TP ++E+V+K+QE  A++VLSRAL+IC++  ++AE
Sbjct  76   TLVHVMPPFYNYVLPAGPGGAAYYVTPALLESVRKAQEDGAADVLSRALEICKDKMIKAE  135

Query  513  TLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRM  334
            T+IL GD KD ICEA E+ HVDLLVVGSRGLG +K                         
Sbjct  136  TVILRGDPKDMICEATEQRHVDLLVVGSRGLGMVK-------------------------  170

Query  333  FI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPPSK  211
                          RAFLGSVSDYCAHH  CP++IVKPP +
Sbjct  171  --------------RAFLGSVSDYCAHHAKCPVVIVKPPKE  197



>ref|XP_009376345.1| PREDICTED: uncharacterized protein LOC103965052 [Pyrus x bretschneideri]
Length=205

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 121/214 (57%), Gaps = 50/214 (23%)
 Frame = -2

Query  825  RTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAAT--------AADEIPAAMVTLVNV  670
            R   +VMVAID+S  SF ALKWA+D+L        A         AA +   +M+TLV+V
Sbjct  25   RKKMRVMVAIDESDWSFYALKWALDHLFVGATDQVAISTGTATVEAASQENVSMMTLVHV  84

Query  669  QPTFGPIIYPPGPN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILE  499
               F   + P GP       TP ++E+++K+QE +A+ VLSRAL+IC E  +++ETLIL 
Sbjct  85   MKPFQHYVLPAGPGATAFYATPSVLESIRKAQEESAASVLSRALEICNEKMIKSETLILG  144

Query  498  GDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**V  319
            GD KD IC+AAE+MHVDLLVVGSRGLG +K                              
Sbjct  145  GDPKDMICQAAEQMHVDLLVVGSRGLGMVK------------------------------  174

Query  318  RSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                     RAFLGSVSDYCAHH  CP++IVKPP
Sbjct  175  ---------RAFLGSVSDYCAHHATCPVVIVKPP  199



>ref|XP_006429977.1| hypothetical protein CICLE_v10012833mg [Citrus clementina]
 gb|ESR43217.1| hypothetical protein CICLE_v10012833mg [Citrus clementina]
Length=188

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/240 (42%), Positives = 131/240 (55%), Gaps = 56/240 (23%)
 Frame = -2

Query  921  MEKTTRTETSAYACPGEAMHSQVPTVKETTATRTTWKVMVAIDDSGESFNALKWAIDNL-  745
            MEK T    S  A     + S+     + T  +   KVMVAID+S ES NALKWA+DNL 
Sbjct  1    MEKETVPGGSGSA----MLQSKEEEETKMTDGKKKMKVMVAIDESAESVNALKWALDNLY  56

Query  744  -LRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGPNLELTPMMVEAVKKSQEHNAS  568
             +    P A          ++T+V+VQ  F   + P            E+V+KSQE N++
Sbjct  57   GIVGFTPEAGGGG-----GILTIVHVQQPFQRFVLPA------LSTSSESVRKSQEENSA  105

Query  567  EVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLI  388
             +LSRALQ+C++  V+AE+L+LEGD KD IC++AE+MH+DLLVVGSRGLGKIK       
Sbjct  106  ALLSRALQMCKDKMVKAESLVLEGDPKDMICQSAEQMHIDLLVVGSRGLGKIK-------  158

Query  387  CFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPPSKE  208
                                            RAFLGSVSDYCAHH  CPI+IVKPP ++
Sbjct  159  --------------------------------RAFLGSVSDYCAHHAVCPIIIVKPPKEQ  186



>ref|XP_009588427.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Nicotiana tomentosiformis]
Length=170

 Score =   166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 109/160 (68%), Gaps = 10/160 (6%)
 Frame = -2

Query  885  ACPGEAMHSQVPTVKETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAAD  706
            A P      Q P +     T+    +MVA+D+S ESF AL WA+D+LL  +         
Sbjct  10   AAPASVTEEQPPHMAAAGETKRKM-IMVAMDESEESFYALNWALDHLLNNS---------  59

Query  705  EIPAAMVTLVNVQPTFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENK  526
            E    ++TL+NVQP F P++YP GP +   P MVEAVKK+Q+ NA+ +LSRA  +C + +
Sbjct  60   EEETTIITLINVQPPFSPLVYPAGPVVFAAPTMVEAVKKAQQENATTILSRAFHMCTQKR  119

Query  525  VRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR  406
            V+AETLILEGD KD+IC+AA+E+HVDLLV+GSRGLGKIKR
Sbjct  120  VKAETLILEGDPKDKICQAADELHVDLLVMGSRGLGKIKR  159



>ref|XP_011042515.1| PREDICTED: universal stress protein A-like protein [Populus euphratica]
Length=181

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 123/203 (61%), Gaps = 45/203 (22%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            ++MVAID+S  SF ALKWA+D+L+ R  P+   + +E  ++++TLV+VQ  F   + P G
Sbjct  2    RIMVAIDESDGSFYALKWALDHLVDRITPTNVPSQEE--SSLITLVHVQLPFQHHMIPAG  59

Query  633  PN----LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAA  466
            P        TP +VE+V+K+Q  N + + SRALQ+C++  ++AE+LILEG+ K++IC+A 
Sbjct  60   PGGAAAFYATPSIVESVRKAQAENDAALQSRALQMCKDKMIKAESLILEGEPKNKICQAT  119

Query  465  EEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRA  286
            E+M VDLLV+GSRGLGKIK                                       RA
Sbjct  120  EQMQVDLLVLGSRGLGKIK---------------------------------------RA  140

Query  285  FLGSVSDYCAHHVHCPILIVKPP  217
             LGSVSDYCAHH  CP+LIVKPP
Sbjct  141  ILGSVSDYCAHHAKCPVLIVKPP  163



>ref|XP_006429979.1| hypothetical protein CICLE_v10013408mg [Citrus clementina]
 gb|ESR43219.1| hypothetical protein CICLE_v10013408mg [Citrus clementina]
Length=198

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 118/200 (59%), Gaps = 50/200 (25%)
 Frame = -2

Query  801  AIDDSGESFNALKWAIDNL--LRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGPN  628
            AID+S ESF ALKWA+DNL  +    P A + ++     ++T+V+ Q  F     P G  
Sbjct  36   AIDESAESFYALKWALDNLYVITDITPEAGSGSN-----VLTIVHAQQPF----IPAGAA  86

Query  627  LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVD  448
               T  +VE VKK++E +++ +LSRALQ+C+EN V A+TLIL+GDA+D IC+A E+MH+D
Sbjct  87   FYATSTLVENVKKAEEQSSAALLSRALQVCKENMVNAQTLILDGDARDVICQAVEQMHID  146

Query  447  LLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVS  268
            LLVVGSRGLGK+K                                       RAFLGSVS
Sbjct  147  LLVVGSRGLGKVK---------------------------------------RAFLGSVS  167

Query  267  DYCAHHVHCPILIVKPPSKE  208
            DYCAHH  CPILIVKPP + 
Sbjct  168  DYCAHHAVCPILIVKPPKEH  187



>ref|XP_011047113.1| PREDICTED: uncharacterized protein LOC105141564 isoform X2 [Populus 
euphratica]
Length=203

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/224 (43%), Positives = 127/224 (57%), Gaps = 47/224 (21%)
 Frame = -2

Query  873  EAMHSQVPT--VKETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEI  700
            E M  Q+P   +KE    R   ++MVAIDDS  SF AL  A+DNL+    P+   + +E 
Sbjct  10   EGMQEQMPHQPLKEKQ-IRKRLRIMVAIDDSVGSFYALNLALDNLVDGIVPTTEPSQEE-  67

Query  699  PAAMVTLVNVQPTFGPIIYPPGPN---LELTPMMVEAVKKSQEHNASEVLSRALQICREN  529
             +++VTLV+VQ  F   +YP G       ++  ++E+V+K+Q  NA+ +LSRAL +C++ 
Sbjct  68   -SSLVTLVHVQQPFQHHVYPAGSGGAVFYVSSSIIESVRKAQAENATALLSRALVMCKDK  126

Query  528  KVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPV  349
             ++AETLILEGD KD+IC A E+M  D+LVVGSRGLGKIK                    
Sbjct  127  MIKAETLILEGDPKDKICRATEQMQADVLVVGSRGLGKIK--------------------  166

Query  348  IIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                               RA LGS SDYCAHH  CPILIVKPP
Sbjct  167  -------------------RALLGSRSDYCAHHAKCPILIVKPP  191



>ref|XP_010263143.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Nelumbo nucifera]
Length=199

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/213 (43%), Positives = 125/213 (59%), Gaps = 56/213 (26%)
 Frame = -2

Query  819  TWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADE-IPAAMVTLVNVQPTFGPIIY  643
            T KV+VAID+S  SF AL+WAIDN+    +  A  A D+ +  + + L++VQ  F   I+
Sbjct  28   TMKVIVAIDESEGSFYALRWAIDNI----FTYAVAAPDQSLELSKIYLLHVQQPFQHYIF  83

Query  642  PPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICREN------------KVRAETLILE  499
            P GP +  T  ++++VKK+QE N++ +L+RALQIC+E             +++AET+IL+
Sbjct  84   PSGPAVYATSAVLDSVKKAQEQNSATLLARALQICKERMACDTTGVLNPVQIKAETIILD  143

Query  498  GDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**V  319
            GD KD IC+AAE++H D ++VGSRGLGKIK                              
Sbjct  144  GDPKDVICQAAEQIHADYVIVGSRGLGKIK------------------------------  173

Query  318  RSIYIL**CRAFLGSVSDYCAHHVHCPILIVKP  220
                     RAFLGSVSDYCAHHV CP+LIVKP
Sbjct  174  ---------RAFLGSVSDYCAHHVKCPVLIVKP  197



>ref|XP_007202545.1| hypothetical protein PRUPE_ppa011155mg [Prunus persica]
 gb|EMJ03744.1| hypothetical protein PRUPE_ppa011155mg [Prunus persica]
Length=221

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 121/215 (56%), Gaps = 49/215 (23%)
 Frame = -2

Query  840  ETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRR-NYPSAATAADEIPA------AMVT  682
            E    +   +VMVAID+S  SF ALKWA+D+L    N  +   A  E PA      +M T
Sbjct  11   EEQQGKKKMRVMVAIDESEWSFYALKWALDHLFVGPNDKAGVAATREAPAVSQENVSMAT  70

Query  681  LVNVQPTFGPIIYPPGPN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAET  511
            LV+V P F   + P GP      +TP ++E+V+K+QE  A++VLSRAL+IC++  ++AET
Sbjct  71   LVHVMPPFYNYVLPAGPGGAAYYVTPALLESVRKAQEDGAADVLSRALEICKDKMIKAET  130

Query  510  LILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMF  331
            LIL GD KD ICEA E+ HVDLLVVGSRGLG +K                          
Sbjct  131  LILRGDPKDMICEATEQSHVDLLVVGSRGLGMVK--------------------------  164

Query  330  I**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIV  226
                         RAFLGSVSDYCAHH  CP++IV
Sbjct  165  -------------RAFLGSVSDYCAHHAKCPVVIV  186



>ref|XP_011047112.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Populus euphratica]
Length=204

 Score =   164 bits (416),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/225 (43%), Positives = 127/225 (56%), Gaps = 48/225 (21%)
 Frame = -2

Query  873  EAMHSQVPT--VKETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEI  700
            E M  Q+P   +KE    R   ++MVAIDDS  SF AL  A+DNL+    P+   + +E 
Sbjct  10   EGMQEQMPHQPLKEKQ-IRKRLRIMVAIDDSVGSFYALNLALDNLVDGIVPTTEPSQEE-  67

Query  699  PAAMVTLVNVQPTFGPIIYPPGPN----LELTPMMVEAVKKSQEHNASEVLSRALQICRE  532
             +++VTLV+VQ  F   +YP G        ++  ++E+V+K+Q  NA+ +LSRAL +C++
Sbjct  68   -SSLVTLVHVQQPFQHHVYPAGSGGAAVFYVSSSIIESVRKAQAENATALLSRALVMCKD  126

Query  531  NKVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWP  352
              ++AETLILEGD KD+IC A E+M  D+LVVGSRGLGKIK                   
Sbjct  127  KMIKAETLILEGDPKDKICRATEQMQADVLVVGSRGLGKIK-------------------  167

Query  351  VIIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                                RA LGS SDYCAHH  CPILIVKPP
Sbjct  168  --------------------RALLGSRSDYCAHHAKCPILIVKPP  192



>emb|CDY08484.1| BnaA05g27200D [Brassica napus]
Length=200

 Score =   164 bits (414),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 120/207 (58%), Gaps = 46/207 (22%)
 Frame = -2

Query  819  TWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPII-Y  643
            T ++MVAID+S  SF AL+W ID+    +     T   E    ++T+V+VQPTF     +
Sbjct  33   TKRIMVAIDESDSSFYALQWVIDHF---STLLLTTEGAEAERGLLTVVHVQPTFHHFAPF  89

Query  642  PPGPNLELT---PMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICE  472
            P GP         +M+E+VKK+Q+  ++ +L RALQ+CR  ++R+ETL+ EG+AK+ IC+
Sbjct  90   PAGPGATAVYPPSLMIESVKKTQQETSAALLLRALQMCRAKQIRSETLVFEGEAKEMICQ  149

Query  471  AAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**C  292
            A E+MHVDLLVVGSRGLGKI+                                       
Sbjct  150  AVEQMHVDLLVVGSRGLGKIR---------------------------------------  170

Query  291  RAFLGSVSDYCAHHVHCPILIVKPPSK  211
            RA +GSVSDYCAHH +CPILIVKPP +
Sbjct  171  RALIGSVSDYCAHHANCPILIVKPPKE  197



>gb|AFK43196.1| unknown [Lotus japonicus]
Length=193

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 124/208 (60%), Gaps = 46/208 (22%)
 Frame = -2

Query  825  RTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIP--AAMVTLVNVQPTFGP  652
            R   KVMVA+D+S  SF+ALKWA+DN+L  N  + AT  + I     MV LV+V+P F P
Sbjct  19   RMKMKVMVAVDESDCSFHALKWALDNVLN-NMTTTATPDENIEDGGGMVFLVHVEPAFHP  77

Query  651  IIYPPGPNLELTPM---MVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDR  481
             +YP G +  L P    + + ++K+Q   ++  LSRALQ+CR+N+++AE++IL GDA++ 
Sbjct  78   AVYPIGTS-ALYPASASLEDLMRKAQREKSTSTLSRALQMCRDNQIKAESIILTGDAREM  136

Query  480  ICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL  301
            IC+AA++MHVDLL++GSRGL  +K                                    
Sbjct  137  ICQAADQMHVDLLIMGSRGLSVLK------------------------------------  160

Query  300  **CRAFLGSVSDYCAHHVHCPILIVKPP  217
               RAFLGSVSDYCAHH   PILIVKPP
Sbjct  161  ---RAFLGSVSDYCAHHAKTPILIVKPP  185



>ref|XP_007029143.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOY09645.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 2 [Theobroma cacao]
Length=167

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 121/210 (58%), Gaps = 52/210 (25%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP-  637
            + MV ID+S ESF AL+W +DNL    +P  + A   + A ++TLV+VQ  F P  +P  
Sbjct  2    RAMVGIDESDESFYALQWFLDNL----FPDLSAA---LSAGLLTLVHVQQPFQPYGFPAA  54

Query  636  -----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICE  472
                 G     + ++ ++V+KSQE  ++ +LSRALQ+C++  ++AE+LILEGD KD +CE
Sbjct  55   RPGVAGKTFYPSTVVADSVRKSQEQTSAALLSRALQMCKDKLIKAESLILEGDPKDMLCE  114

Query  471  AAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**C  292
             +E+M+VDLL+VGSRGLGKIK                                       
Sbjct  115  ISEQMNVDLLIVGSRGLGKIK---------------------------------------  135

Query  291  RAFLGSVSDYCAHHVHCPILIVKPPSKEPN  202
            RAFLGSVSDYCAHH  CP LIVKPP +  N
Sbjct  136  RAFLGSVSDYCAHHAKCPTLIVKPPKEASN  165



>ref|XP_007029142.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY09644.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 1 [Theobroma cacao]
Length=165

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 122/208 (59%), Gaps = 50/208 (24%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYP--  640
            + MV ID+S ESF AL+W +DNL    +P  + A   + A ++TLV+VQ  F P  +P  
Sbjct  2    RAMVGIDESDESFYALQWFLDNL----FPDLSAA---LSAGLLTLVHVQQPFQPYGFPAA  54

Query  639  -PG-PNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAA  466
             PG      + ++ ++V+KSQE  ++ +LSRALQ+C++  ++AE+LILEGD KD +CE +
Sbjct  55   RPGVAAFYPSTVVADSVRKSQEQTSAALLSRALQMCKDKLIKAESLILEGDPKDMLCEIS  114

Query  465  EEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRA  286
            E+M+VDLL+VGSRGLGKIK                                       RA
Sbjct  115  EQMNVDLLIVGSRGLGKIK---------------------------------------RA  135

Query  285  FLGSVSDYCAHHVHCPILIVKPPSKEPN  202
            FLGSVSDYCAHH  CP LIVKPP +  N
Sbjct  136  FLGSVSDYCAHHAKCPTLIVKPPKEASN  163



>ref|XP_010519995.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Tarenaya hassleriana]
Length=198

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 115/209 (55%), Gaps = 49/209 (23%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADE------IPAAMVTLVNVQPTFGP  652
            KVMVAID+S  SF AL+W ID+      P     A+E          M+T+V+VQ  F  
Sbjct  24   KVMVAIDESDNSFYALQWVIDHFSSLVVPQPPPEAEEESPAAATDGGMLTVVHVQQPFQQ  83

Query  651  IIYPPGPN----LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKD  484
              +P GP     + +T  M+EAV+K+Q   A+ + +RALQICR+NKV  ETL++EGD KD
Sbjct  84   FAFPAGPGGATAVYMTSSMMEAVRKAQRETATALFARALQICRKNKVNVETLLMEGDPKD  143

Query  483  RICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYI  304
             IC+A EEM V LLV+GSRGLGKIK                                   
Sbjct  144  VICQAVEEMRVQLLVMGSRGLGKIK-----------------------------------  168

Query  303  L**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                RAFLGSVSDYCAHH  C ILIVKPP
Sbjct  169  ----RAFLGSVSDYCAHHAKCAILIVKPP  193



>ref|XP_010519994.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Tarenaya hassleriana]
Length=199

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 115/210 (55%), Gaps = 50/210 (24%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADE------IPAAMVTLVNVQPTFGP  652
            KVMVAID+S  SF AL+W ID+      P     A+E          M+T+V+VQ  F  
Sbjct  24   KVMVAIDESDNSFYALQWVIDHFSSLVVPQPPPEAEEESPAAATDGGMLTVVHVQQPFQQ  83

Query  651  IIYPPGPN-----LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAK  487
              +P GP      + +T  M+EAV+K+Q   A+ + +RALQICR+NKV  ETL++EGD K
Sbjct  84   FAFPAGPGGATAAVYMTSSMMEAVRKAQRETATALFARALQICRKNKVNVETLLMEGDPK  143

Query  486  DRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIY  307
            D IC+A EEM V LLV+GSRGLGKIK                                  
Sbjct  144  DVICQAVEEMRVQLLVMGSRGLGKIK----------------------------------  169

Query  306  IL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                 RAFLGSVSDYCAHH  C ILIVKPP
Sbjct  170  -----RAFLGSVSDYCAHHAKCAILIVKPP  194



>ref|XP_006481853.1| PREDICTED: universal stress protein A-like protein-like [Citrus 
sinensis]
Length=198

 Score =   161 bits (407),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 117/200 (59%), Gaps = 50/200 (25%)
 Frame = -2

Query  801  AIDDSGESFNALKWAIDNL--LRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGPN  628
            AID+S ESF ALKWA+DNL  +    P A++ ++     ++T+V+ Q  F     P G  
Sbjct  36   AIDESAESFYALKWALDNLYVITDITPEASSGSN-----VLTIVHAQQPF----IPAGAA  86

Query  627  LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVD  448
               T  +VE VKK++E +++ +LSRALQ+C+E  V A+TLIL+GD +D IC+A E+MH+D
Sbjct  87   FYATSTLVENVKKAEEQSSAALLSRALQVCKEKMVNAQTLILDGDTRDVICQAVEQMHID  146

Query  447  LLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVS  268
            LLVVGSRGLGK+K                                       RAFLGSVS
Sbjct  147  LLVVGSRGLGKVK---------------------------------------RAFLGSVS  167

Query  267  DYCAHHVHCPILIVKPPSKE  208
            DYCAHH  CPILIVKPP + 
Sbjct  168  DYCAHHAVCPILIVKPPKEH  187



>gb|KDP21924.1| hypothetical protein JCGZ_03062 [Jatropha curcas]
Length=180

 Score =   160 bits (406),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 115/201 (57%), Gaps = 50/201 (25%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGP  631
            VMVA+D+S  SF ALKW +DNL+ +     +         MVTLV+VQ +F   I P GP
Sbjct  22   VMVALDESDTSFYALKWTLDNLIIKGVSQDSD--------MVTLVHVQHSFQTSIVPLGP  73

Query  630  N---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEE  460
                L     + ++VKK+Q+ N++ ++SRAL++C E  V+AE+LILEGDAKD IC+A E+
Sbjct  74   AGAALYTPSSIADSVKKAQQENSAAIVSRALKMCDEKMVKAESLILEGDAKDMICKATEQ  133

Query  459  MHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFL  280
            M VDL+VVGSRGLGKIK                                       RA L
Sbjct  134  MQVDLVVVGSRGLGKIK---------------------------------------RALL  154

Query  279  GSVSDYCAHHVHCPILIVKPP  217
            GSVS YCAHH  CPILIVKPP
Sbjct  155  GSVSYYCAHHAKCPILIVKPP  175



>ref|XP_004504522.1| PREDICTED: universal stress protein A-like protein-like [Cicer 
arietinum]
Length=184

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/206 (43%), Positives = 120/206 (58%), Gaps = 44/206 (21%)
 Frame = -2

Query  825  RTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPII  646
            R   K MVAID+S  SF ALKWA+DNL      + AT +      M+ LV+V+P F   +
Sbjct  12   RMKMKAMVAIDESDGSFYALKWALDNLFNVMTTTEATTSQN--EGMLFLVHVEPIFHNYV  69

Query  645  YPPGP-NLELTP--MMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
            +P GP      P  ++V++VKK+Q+  ++ +LSRALQ+C++  V+AE++IL GD ++ IC
Sbjct  70   HPIGPAGAAFYPASLVVDSVKKAQQEKSASILSRALQMCKDKLVKAESVILTGDPREMIC  129

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            +AAE+M VD+L++GSRGLG +K                                      
Sbjct  130  QAAEQMQVDILIMGSRGLGTLK--------------------------------------  151

Query  294  CRAFLGSVSDYCAHHVHCPILIVKPP  217
             RAFLGSVSDYCAHHV  PILIVKPP
Sbjct  152  -RAFLGSVSDYCAHHVKAPILIVKPP  176



>gb|KEH41787.1| adenine nucleotide alpha hydrolase superfamily protein [Medicago 
truncatula]
Length=190

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 125/223 (56%), Gaps = 47/223 (21%)
 Frame = -2

Query  876  GEAMHSQVPTVKETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIP  697
            G A+H      +E    R   KVMVAID+S  SF ALKWA+DNL         T+++   
Sbjct  5    GRAIHEGREGAEER---RMKMKVMVAIDESDGSFYALKWALDNLFNVMTTMEGTSSEN--  59

Query  696  AAMVTLVNVQPTFGPIIYPPGPN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENK  526
              MV LV+V+P F   ++P GP         ++V++VKK Q+  ++ +LSRALQ+C++ +
Sbjct  60   EGMVFLVHVEPIFHNYVHPIGPGGAAFYPASVVVDSVKKGQQERSAVILSRALQMCKDKQ  119

Query  525  VRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVI  346
            V+AE++IL GD ++ IC+A+E+M VDLL++GSRGLG +K                     
Sbjct  120  VKAESVILNGDPREMICQASEQMQVDLLIMGSRGLGTLK---------------------  158

Query  345  IKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                              RAFLGSVSDYCAHH   PILIVKPP
Sbjct  159  ------------------RAFLGSVSDYCAHHAKAPILIVKPP  183



>ref|XP_009146670.1| PREDICTED: uncharacterized protein LOC103870298 [Brassica rapa]
Length=200

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 119/207 (57%), Gaps = 46/207 (22%)
 Frame = -2

Query  819  TWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTF---GPI  649
            T ++MVAID+S  SF AL+W ID+    +     T   E    ++T+V+VQPTF    P 
Sbjct  33   TKRIMVAIDESDSSFYALQWVIDHF---STLLLTTEGAEAERGLLTVVHVQPTFHHFAPF  89

Query  648  IYPPGPNLELTP-MMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICE  472
               PG      P +M+E+VKK+Q+  ++ +L RALQ+CR  ++R+ETL+ EG+AK+ IC+
Sbjct  90   PAGPGATAVYPPSLMIESVKKTQQETSAALLLRALQMCRAKQIRSETLVFEGEAKEMICQ  149

Query  471  AAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**C  292
            A E+M VDLLVVGSRGLGKI+                                       
Sbjct  150  AVEQMPVDLLVVGSRGLGKIR---------------------------------------  170

Query  291  RAFLGSVSDYCAHHVHCPILIVKPPSK  211
            RA +GSVSDYCAHH +CPILIVKPP +
Sbjct  171  RALIGSVSDYCAHHANCPILIVKPPKE  197



>gb|KFK38558.1| hypothetical protein AALP_AA3G129200 [Arabis alpina]
Length=199

 Score =   159 bits (401),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 122/208 (59%), Gaps = 47/208 (23%)
 Frame = -2

Query  819  TWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPII-Y  643
            T ++MVAID+S  SF AL+W ID+    +     T A E    ++T+V+VQP F     +
Sbjct  32   TKRMMVAIDESDSSFYALQWVIDHF---SSLLMTTEAAEAEGGLLTVVHVQPPFQHFAAF  88

Query  642  PPGPN----LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
            P GP     +  +  M E+VKK+Q+  ++ +L+RALQ+CR  ++R ETL++EGD KD IC
Sbjct  89   PAGPGGATAVYASTNMRESVKKAQQEASAALLARALQMCRAKQIRTETLVVEGDTKDMIC  148

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            E AE+MHVDLLVVGSRGLGKIK                                      
Sbjct  149  EVAEQMHVDLLVVGSRGLGKIK--------------------------------------  170

Query  294  CRAFLGSVSDYCAHHVHCPILIVKPPSK  211
             RAFLGSVSDYCAHHV+CPILIVKPP +
Sbjct  171  -RAFLGSVSDYCAHHVNCPILIVKPPKE  197



>emb|CDY01070.1| BnaC05g41300D [Brassica napus]
Length=164

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 116/203 (57%), Gaps = 46/203 (23%)
 Frame = -2

Query  807  MVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPII-YPPGP  631
            M+AID+S  SF AL+W ID+    +     T   E    ++T+V+VQPTF     +P GP
Sbjct  1    MLAIDESDSSFYALQWVIDHF---STLLMTTEGAEAEGGLLTVVHVQPTFHHFAPFPAGP  57

Query  630  NLELT---PMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEE  460
                     +M+E+VKK+Q+  ++ ++ RALQ+CR  ++R+ETL+ EG AK+ IC+A E+
Sbjct  58   GATAVYPPSLMIESVKKTQQETSAALVLRALQMCRAKQIRSETLVFEGKAKEIICQAVEQ  117

Query  459  MHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFL  280
            MHVDLLVVGSRGLGKI+                                       RA +
Sbjct  118  MHVDLLVVGSRGLGKIR---------------------------------------RALI  138

Query  279  GSVSDYCAHHVHCPILIVKPPSK  211
            GSVSDYCAHH +CPILIVKPP +
Sbjct  139  GSVSDYCAHHANCPILIVKPPKE  161



>ref|XP_010524871.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Tarenaya hassleriana]
Length=183

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 116/209 (56%), Gaps = 43/209 (21%)
 Frame = -2

Query  840  ETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPT  661
            E+   R   +V+VA+D+S  SF A++WA+D+L  R+  SA          ++TL++V P 
Sbjct  2    ESEVERKKLRVLVAVDESENSFYAIEWAMDHL--RDVISAEPDTGR-AGGLLTLLHVHPP  58

Query  660  FGPIIYPPGPNLELTPMMV-EAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKD  484
            +   +YP G         V E+VKK +E   + + +RALQICR   V+AETL+LEGD KD
Sbjct  59   YAHYVYPAGSAAVFAATSVPESVKKEREERTAALFTRALQICRGKMVKAETLVLEGDPKD  118

Query  483  RICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYI  304
             IC+A E+MHVDLLV+G+RGLG IK                                   
Sbjct  119  VICQAVEQMHVDLLVIGNRGLGMIK-----------------------------------  143

Query  303  L**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                RAFLGSVSDYCAHH  CPILIVKPP
Sbjct  144  ----RAFLGSVSDYCAHHAKCPILIVKPP  168



>ref|XP_002308342.2| hypothetical protein POPTR_0006s21250g [Populus trichocarpa]
 gb|EEE91865.2| hypothetical protein POPTR_0006s21250g [Populus trichocarpa]
Length=186

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 111/205 (54%), Gaps = 55/205 (27%)
 Frame = -2

Query  825  RTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPII  646
            R   ++MVAIDDS  SF AL WA+DNL+    P+   + +E  + +VTLV+VQ  F   +
Sbjct  27   RKRLRIMVAIDDSDGSFYALNWALDNLVDGIVPTTEPSQEE--SGLVTLVHVQQPFQHHM  84

Query  645  YPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAA  466
            YP G                   NA+ +LSRALQ+C++  ++AETLILEGD KD+IC A 
Sbjct  85   YPAG--------------SGGAENATALLSRALQMCKDKMIKAETLILEGDPKDKICRAT  130

Query  465  EEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRA  286
            E+M  D+LVVGSRGLGKIK                                       RA
Sbjct  131  EQMQADVLVVGSRGLGKIK---------------------------------------RA  151

Query  285  FLGSVSDYCAHHVHCPILIVKPPSK  211
             LGS+SDYCAHH  CPILIVKPP +
Sbjct  152  LLGSISDYCAHHAKCPILIVKPPKE  176



>ref|XP_003519020.1| PREDICTED: universal stress protein A-like protein-like [Glycine 
max]
 gb|KHN00015.1| Universal stress protein A-like protein [Glycine soja]
Length=191

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 119/213 (56%), Gaps = 43/213 (20%)
 Frame = -2

Query  828  TRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPI  649
            +R   KVMVAID+S  SF ALKWA+DNL      +   A+      MV LV+V+P     
Sbjct  18   SRMRMKVMVAIDESEGSFYALKWALDNLFT-TMATVGEASSPENDGMVFLVHVEPKVHNY  76

Query  648  IYPPGPN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRI  478
            +YP GP         ++V++VKK+Q+  ++ +LSRAL++C +  V+ E++IL GDA++ I
Sbjct  77   VYPIGPGGAAFYPATVVVDSVKKAQQERSAAILSRALKMCHDKLVKGESIILHGDAREMI  136

Query  477  CEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL*  298
            CEAAE+M ++LLV+GSRGLG +K                                     
Sbjct  137  CEAAEQMQINLLVLGSRGLGTLK-------------------------------------  159

Query  297  *CRAFLGSVSDYCAHHVHCPILIVKPPSKEPNL  199
              R FLGSVSDYCAHH   PILIVKPPS+   +
Sbjct  160  --RTFLGSVSDYCAHHAKTPILIVKPPSEHSKM  190



>ref|XP_010524879.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Tarenaya hassleriana]
Length=182

 Score =   155 bits (393),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 116/208 (56%), Gaps = 42/208 (20%)
 Frame = -2

Query  840  ETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPT  661
            E+   R   +V+VA+D+S  SF A++WA+D+L  R+  SA          ++TL++V P 
Sbjct  2    ESEVERKKLRVLVAVDESENSFYAIEWAMDHL--RDVISAEPDTGR-AGGLLTLLHVHPP  58

Query  660  FGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDR  481
            +   +YP    +     + E+VKK +E   + + +RALQICR   V+AETL+LEGD KD 
Sbjct  59   YAHYVYPAAAAVFAATSVPESVKKEREERTAALFTRALQICRGKMVKAETLVLEGDPKDV  118

Query  480  ICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL  301
            IC+A E+MHVDLLV+G+RGLG IK                                    
Sbjct  119  ICQAVEQMHVDLLVIGNRGLGMIK------------------------------------  142

Query  300  **CRAFLGSVSDYCAHHVHCPILIVKPP  217
               RAFLGSVSDYCAHH  CPILIVKPP
Sbjct  143  ---RAFLGSVSDYCAHHAKCPILIVKPP  167



>ref|XP_011094181.1| PREDICTED: uncharacterized protein C167.05-like [Sesamum indicum]
Length=178

 Score =   155 bits (393),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 117/204 (57%), Gaps = 48/204 (24%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGP  631
            V+VAIDDS ESF+AL+W +D +L+R+ P+   AA E    +VT+V+V  +     +  G 
Sbjct  22   VLVAIDDSDESFHALQWVLDKILKRS-PATEAAAPESSRPVVTIVHVVESLARYAFHGG-  79

Query  630  NLELTPMMVEAVKKSQEHNASEVLSRALQICREN-KVRAETLILEGDAKDRICEAAEEMH  454
                   +V+  +K QE NA+ +LSRA +ICR+   + A+TLILEGD KD+IC A EEM 
Sbjct  80   ------HVVDYGRKEQEQNAARILSRAFEICRDKLSLNAKTLILEGDPKDKICRAVEEMD  133

Query  453  VDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGS  274
            ++LLVVGSRGLG+IK                                       RAFLGS
Sbjct  134  INLLVVGSRGLGQIK---------------------------------------RAFLGS  154

Query  273  VSDYCAHHVHCPILIVKPPSKEPN  202
            VSDYCAHH  CP+L+VKPP K  +
Sbjct  155  VSDYCAHHAKCPVLVVKPPRKRTD  178



>gb|KFK35113.1| hypothetical protein AALP_AA5G237800 [Arabis alpina]
Length=204

 Score =   156 bits (394),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 117/199 (59%), Gaps = 46/199 (23%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            KVMVAID+S  SF AL+WA+++L  R+  SA    ++    ++TLV+V PT+   IYP G
Sbjct  44   KVMVAIDESKNSFYALEWAVEHL--RDVISAEPETNQ-EGGLLTLVHVHPTYLQYIYPTG  100

Query  633  PNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMH  454
                 T  + E+++K++E N +++ +RAL+ICR   V+ ET+I+EGDAK+ IC+A E+ H
Sbjct  101  G----TDSVPESMRKAREENTTKLFTRALEICRGKMVKTETMIIEGDAKEMICQAVEQTH  156

Query  453  VDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGS  274
            VDLLVVGSRGLG IK                                       RA LGS
Sbjct  157  VDLLVVGSRGLGMIK---------------------------------------RALLGS  177

Query  273  VSDYCAHHVHCPILIVKPP  217
            VSDYCA H  CPILIV+PP
Sbjct  178  VSDYCAQHAKCPILIVRPP  196



>ref|XP_006293247.1| hypothetical protein CARUB_v10019581mg [Capsella rubella]
 gb|EOA26145.1| hypothetical protein CARUB_v10019581mg [Capsella rubella]
Length=203

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 117/202 (58%), Gaps = 45/202 (22%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            KVMVAID+S  SF+AL+WA+++L  R+  SA    ++    ++TLV+V PT+   IYP G
Sbjct  30   KVMVAIDESKNSFDALQWAVEHL--RDVISAEPETNQ-EGGLLTLVHVHPTYLQYIYPSG  86

Query  633  PN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAE  463
                 +  T  + E V+K++E + + + +RAL+ICR   V+ ET+ILEGD K+ IC+A E
Sbjct  87   GTASAVYATDSVPEQVRKAREESTTNLFTRALEICRGKMVKTETMILEGDPKEMICQAVE  146

Query  462  EMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAF  283
            + H+DLLVVGSRGLG IK                                       RAF
Sbjct  147  QTHIDLLVVGSRGLGMIK---------------------------------------RAF  167

Query  282  LGSVSDYCAHHVHCPILIVKPP  217
            LGSVSDYCA H  CPILIV+PP
Sbjct  168  LGSVSDYCAQHARCPILIVRPP  189



>gb|KFK35112.1| hypothetical protein AALP_AA5G237800 [Arabis alpina]
Length=207

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 118/201 (59%), Gaps = 47/201 (23%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            KVMVAID+S  SF AL+WA+++L  R+  SA    ++    ++TLV+V PT+   IYP G
Sbjct  44   KVMVAIDESKNSFYALEWAVEHL--RDVISAEPETNQ-EGGLLTLVHVHPTYLQYIYPTG  100

Query  633  --PNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEE  460
               + +  P   E+++K++E N +++ +RAL+ICR   V+ ET+I+EGDAK+ IC+A E+
Sbjct  101  GTASADSVP---ESMRKAREENTTKLFTRALEICRGKMVKTETMIIEGDAKEMICQAVEQ  157

Query  459  MHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFL  280
             HVDLLVVGSRGLG IK                                       RA L
Sbjct  158  THVDLLVVGSRGLGMIK---------------------------------------RALL  178

Query  279  GSVSDYCAHHVHCPILIVKPP  217
            GSVSDYCA H  CPILIV+PP
Sbjct  179  GSVSDYCAQHAKCPILIVRPP  199



>emb|CDX67744.1| BnaA07g17840D [Brassica napus]
Length=201

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/218 (42%), Positives = 123/218 (56%), Gaps = 52/218 (24%)
 Frame = -2

Query  840  ETTATRTT-------WKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVT  682
            +T AT TT        KVMVA+D+S  SF AL+WA+++L  R+  SA    D+    ++T
Sbjct  11   DTEATTTTAKQNKKKLKVMVAMDESKNSFYALEWAVEHL--RDVISAEPETDQ-AGGLLT  67

Query  681  LVNVQPTFGPIIYPPGPN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAET  511
            LV+V PT+   IYP G     +     + E++KK++E + +++ +R+L+ICR   V+ ET
Sbjct  68   LVHVHPTYLQYIYPSGGTASAMYAVDSVPESMKKAREESTTKLFTRSLEICRGKLVKTET  127

Query  510  LILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMF  331
            +ILEGD K+ IC+A E+ HVDLLVVGSRGLG IK                          
Sbjct  128  MILEGDPKEMICQAVEQTHVDLLVVGSRGLGMIK--------------------------  161

Query  330  I**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                         RAFLGSVSDYCA H  CPILIV+PP
Sbjct  162  -------------RAFLGSVSDYCAQHAKCPILIVRPP  186



>ref|XP_010504800.1| PREDICTED: uncharacterized protein LOC104781757 isoform X2 [Camelina 
sativa]
Length=193

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 114/199 (57%), Gaps = 46/199 (23%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            KVMVAID+S  SF+AL+W +++L  R+  SA     +    ++TLV+V PT+   IYP G
Sbjct  27   KVMVAIDESKNSFDALQWVVEHL--RDVISAEPETGQ-EGGLLTLVHVHPTYLQYIYPSG  83

Query  633  PNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMH  454
                 T  + E V+K++E + + + +RAL+ICR   V+ ET+ILEGD K+ IC+A E+ H
Sbjct  84   G----TDSVPEQVRKAREESTTNLFTRALEICRGKMVKTETMILEGDPKEMICQAVEQTH  139

Query  453  VDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGS  274
            VDLLVVGSRGLG IK                                       RAFLGS
Sbjct  140  VDLLVVGSRGLGMIK---------------------------------------RAFLGS  160

Query  273  VSDYCAHHVHCPILIVKPP  217
            VSDYCA H  CPILIV+PP
Sbjct  161  VSDYCAQHAKCPILIVRPP  179



>ref|XP_009593917.1| PREDICTED: uncharacterized protein LOC104090515 isoform X1 [Nicotiana 
tomentosiformis]
Length=155

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 114/198 (58%), Gaps = 51/198 (26%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            +V+VAID+S ESFNALKW +D  LR+  PS  T  ++ P+  ++LV+V   F    YP  
Sbjct  2    RVLVAIDNSEESFNALKWILDYFLRQ--PSHTTEEEKEPSTKLSLVHVMEPFPQYAYP--  57

Query  633  PNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMH  454
                    ++E+  ++Q   A+ +L+RA ++C++  V+AETLILEGD K+ +CEA E+M+
Sbjct  58   --------VIESATRAQAQEAARILARASEMCKDKMVKAETLILEGDPKNMLCEATEKMN  109

Query  453  VDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGS  274
            +DLL VGSRGLG+IK                                       RAFLGS
Sbjct  110  IDLLAVGSRGLGQIK---------------------------------------RAFLGS  130

Query  273  VSDYCAHHVHCPILIVKP  220
            VSDYCAHH  CP+LIVKP
Sbjct  131  VSDYCAHHAKCPMLIVKP  148



>ref|XP_010524887.1| PREDICTED: universal stress protein A-like protein isoform X3 
[Tarenaya hassleriana]
Length=180

 Score =   152 bits (385),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 116/208 (56%), Gaps = 44/208 (21%)
 Frame = -2

Query  840  ETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPT  661
            E+   R   +V+VA+D+S  SF A++WA+D+L  R+  SA          ++TL++V P 
Sbjct  2    ESEVERKKLRVLVAVDESENSFYAIEWAMDHL--RDVISAEPDTGR-AGGLLTLLHVHPP  58

Query  660  FGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDR  481
            +   +YP    +     + E+VKK +E   + + +RALQICR   V+AETL+LEGD KD 
Sbjct  59   YAHYVYPAA--VFAATSVPESVKKEREERTAALFTRALQICRGKMVKAETLVLEGDPKDV  116

Query  480  ICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL  301
            IC+A E+MHVDLLV+G+RGLG IK                                    
Sbjct  117  ICQAVEQMHVDLLVIGNRGLGMIK------------------------------------  140

Query  300  **CRAFLGSVSDYCAHHVHCPILIVKPP  217
               RAFLGSVSDYCAHH  CPILIVKPP
Sbjct  141  ---RAFLGSVSDYCAHHAKCPILIVKPP  165



>ref|XP_010504799.1| PREDICTED: uncharacterized protein LOC104781757 isoform X1 [Camelina 
sativa]
Length=200

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 115/202 (57%), Gaps = 45/202 (22%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            KVMVAID+S  SF+AL+W +++L  R+  SA     +    ++TLV+V PT+   IYP G
Sbjct  27   KVMVAIDESKNSFDALQWVVEHL--RDVISAEPETGQ-EGGLLTLVHVHPTYLQYIYPSG  83

Query  633  PN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAE  463
                 +  T  + E V+K++E + + + +RAL+ICR   V+ ET+ILEGD K+ IC+A E
Sbjct  84   GTASAVYATDSVPEQVRKAREESTTNLFTRALEICRGKMVKTETMILEGDPKEMICQAVE  143

Query  462  EMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAF  283
            + HVDLLVVGSRGLG IK                                       RAF
Sbjct  144  QTHVDLLVVGSRGLGMIK---------------------------------------RAF  164

Query  282  LGSVSDYCAHHVHCPILIVKPP  217
            LGSVSDYCA H  CPILIV+PP
Sbjct  165  LGSVSDYCAQHAKCPILIVRPP  186



>emb|CDP10547.1| unnamed protein product [Coffea canephora]
Length=185

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/214 (41%), Positives = 117/214 (55%), Gaps = 54/214 (25%)
 Frame = -2

Query  825  RTTWKVMVAIDDSGESFNALKWAID----NLLRRNYPSAATAADE-----IPAAMVTLVN  673
            R   + MVA+DDS ESF AL W +D    N++    P+     D      + + +V+LV+
Sbjct  17   RKKMRAMVAVDDSEESFYALNWVLDKFFSNIVMSTLPTGTETPDHQHDHRVESNLVSLVH  76

Query  672  VQPTFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGD  493
            V       ++P G        +VE+  K++E NA+++LS+A Q+C++ KV AETLILEGD
Sbjct  77   VMDRLPHYVFPGG-------YVVESATKAREQNAAKILSQASQMCKDRKVAAETLILEGD  129

Query  492  AKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRS  313
             K+ ICEA E MHVD+LVVGSRGLG+IKR                               
Sbjct  130  PKEMICEAVERMHVDVLVVGSRGLGQIKR-------------------------------  158

Query  312  IYIL**CRAFLGSVSDYCAHHVHCPILIVKPPSK  211
                   +AFLGSVSDYCAHH  CP++IVK P K
Sbjct  159  -------QAFLGSVSDYCAHHAKCPVVIVKLPHK  185



>ref|XP_009104144.1| PREDICTED: universal stress protein A-like protein [Brassica 
rapa]
Length=204

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 117/202 (58%), Gaps = 45/202 (22%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            KVMVA+D+S  SF AL+WA+++L  R+  SA    D+    ++TLV+V PT+   IYP G
Sbjct  30   KVMVAMDESKNSFYALEWAVEHL--RDVISAEPETDQ-AGGLLTLVHVHPTYLQYIYPSG  86

Query  633  PN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAE  463
                 +     + E++KK++E + +++ +R+L+ICR   ++ ET+ILEGD K+ IC+A E
Sbjct  87   GTASAMYAIDSVPESMKKAREESTTKLFTRSLEICRGKLMKTETMILEGDPKEMICQAVE  146

Query  462  EMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAF  283
            + HVDLLVVGSRGLG IK                                       RAF
Sbjct  147  QTHVDLLVVGSRGLGMIK---------------------------------------RAF  167

Query  282  LGSVSDYCAHHVHCPILIVKPP  217
            LGSVSDYCA H  CPILIV+PP
Sbjct  168  LGSVSDYCAQHAKCPILIVRPP  189



>ref|XP_007145747.1| hypothetical protein PHAVU_007G264400g [Phaseolus vulgaris]
 gb|ESW17741.1| hypothetical protein PHAVU_007G264400g [Phaseolus vulgaris]
Length=175

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 116/210 (55%), Gaps = 49/210 (23%)
 Frame = -2

Query  825  RTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATA--ADEIPAAMVTLVNVQPTFGP  652
            R   KVMV +D+S  S  ALKWAIDNL    + + AT   A E    MV L++V+P    
Sbjct  12   RMRMKVMVGVDESDGSLYALKWAIDNL----FTAMATVGEATEENEGMVFLLHVEPKVHN  67

Query  651  IIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICE  472
             +YP GP       +VE+VKK+QE  ++ VLSRAL++C +  V+AE++IL GD ++ ICE
Sbjct  68   FVYPVGPG----GAVVESVKKAQEEKSASVLSRALKMCHDKLVKAESMILNGDPREMICE  123

Query  471  AAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**C  292
            AA++M V+LLV+GSRGLG +K                                       
Sbjct  124  AADQMQVNLLVLGSRGLGALK---------------------------------------  144

Query  291  RAFLGSVSDYCAHHVHCPILIVKPPSKEPN  202
            R  LGSVSD+CAHH   P+LIVKPP +  N
Sbjct  145  RTLLGSVSDHCAHHARTPVLIVKPPQQNKN  174



>emb|CBI39085.3| unnamed protein product [Vitis vinifera]
Length=129

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 100/161 (62%), Gaps = 39/161 (24%)
 Frame = -2

Query  690  MVTLVNVQPTFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAET  511
            MVT+V+VQ  F   + P GP +  T  ++E+V+K+QE N+S +LSRAL++C++  V+AET
Sbjct  1    MVTVVHVQQPFHNYVLPAGPGIYATSTVIESVRKAQEQNSSVILSRALRLCKDKMVKAET  60

Query  510  LILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMF  331
            LIL+GD K+ IC+AAE+MHVDLL+VGSRGL K+K                          
Sbjct  61   LILDGDPKEMICQAAEQMHVDLLLVGSRGLSKLK--------------------------  94

Query  330  I**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPPSKE  208
                         RAFLGSVSDYCAHH  CPILIVKPP ++
Sbjct  95   -------------RAFLGSVSDYCAHHAKCPILIVKPPEEK  122



>ref|XP_007202660.1| hypothetical protein PRUPE_ppa012339mg [Prunus persica]
 gb|EMJ03859.1| hypothetical protein PRUPE_ppa012339mg [Prunus persica]
Length=173

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 114/215 (53%), Gaps = 61/215 (28%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLL---RRNY----PSAATAADEIPAA-------MVTLV  676
            +VMVAID S ES  ALKWA+D LL   + N      S  TA  E P A       MVTL+
Sbjct  2    RVMVAIDGSDESLYALKWALDLLLVGPKDNADDVATSTGTATLEAPHAGSHENVSMVTLI  61

Query  675  NVQPTFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEG  496
            +V   F   + P   + EL        +K QE  A+ +L+RAL+IC++  ++AETLIL G
Sbjct  62   HVMQPFQNYVLPAAGSAEL--------RKEQEEKAAAILARALEICKDKMIKAETLILRG  113

Query  495  DAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VR  316
            D KDRICEA E+ HVDLLVVGSRGLG +K                               
Sbjct  114  DPKDRICEATEQRHVDLLVVGSRGLGMVK-------------------------------  142

Query  315  SIYIL**CRAFLGSVSDYCAHHVHCPILIVKPPSK  211
                    RAFLGSVS YCAHH  CP++IVKPP +
Sbjct  143  --------RAFLGSVSSYCAHHAKCPVVIVKPPKE  169



>ref|XP_006402787.1| hypothetical protein EUTSA_v10006473mg [Eutrema salsugineum]
 gb|ESQ44240.1| hypothetical protein EUTSA_v10006473mg [Eutrema salsugineum]
Length=204

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 116/209 (56%), Gaps = 48/209 (23%)
 Frame = -2

Query  825  RTTWK---VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFG  655
            RT+ K   VMVAID+S  SF A++WA+ +L R    S      E    ++TLV+V PT+ 
Sbjct  26   RTSKKKLNVMVAIDESKNSFYAVEWAVQHL-RDVISSEPETGQE--GGLLTLVHVHPTYL  82

Query  654  PIIYPPGPN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKD  484
              IYP G     L  T  + E++KK++E + + + +RAL+ICR   V+ ET+ILEGD K+
Sbjct  83   QYIYPSGGTASALYATDSVPESMKKAREESTTRMFTRALEICRGKMVKTETMILEGDPKE  142

Query  483  RICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYI  304
             IC+A E+ HVDLLVVGSRGLG IK                                   
Sbjct  143  MICQAVEQTHVDLLVVGSRGLGMIK-----------------------------------  167

Query  303  L**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                RAFLGSVSDYCA H  CPILIV+PP
Sbjct  168  ----RAFLGSVSDYCAQHAKCPILIVRPP  192



>ref|XP_008241135.1| PREDICTED: universal stress protein A-like protein [Prunus mume]
Length=173

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 112/213 (53%), Gaps = 61/213 (29%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLL---RRNY----PSAATAADEIPAA-------MVTLV  676
            KV+VAID S ESF ALKWA+D LL   + N      S  TA  E P A       MVTLV
Sbjct  2    KVIVAIDGSEESFYALKWALDFLLVGPKDNADDVATSTGTATLEAPQAGSHENVSMVTLV  61

Query  675  NVQPTFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEG  496
             V   F   + P   + EL        +K QE  A+ +L+RAL+IC++  ++AETLIL G
Sbjct  62   YVMQPFQNYVLPAAGSAEL--------RKEQEEKAAAILARALEICKDKMIKAETLILRG  113

Query  495  DAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VR  316
            D KD ICEA E+ HVDLLVVGSRGLG +K                               
Sbjct  114  DPKDMICEATEQRHVDLLVVGSRGLGMVK-------------------------------  142

Query  315  SIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                    RAFLGSVS YCAHH  CP++IVKPP
Sbjct  143  --------RAFLGSVSSYCAHHAKCPVVIVKPP  167



>ref|XP_002876463.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52722.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=194

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 114/201 (57%), Gaps = 45/201 (22%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            KVMVAID+S  SF+AL+WA+D+L  R   SA     +    ++TLV+V PT+   IYP G
Sbjct  30   KVMVAIDESKNSFDALEWAVDHL--RVVISAEPETGQ-EGGLLTLVHVHPTYLQYIYPSG  86

Query  633  PN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAE  463
                 +  T  + E ++K++E + + + +RAL+ICR   V+ ET+ILEGD K+ IC+A E
Sbjct  87   GTASAVYATDSVPEPMRKAREESTTNLFTRALEICRGKMVKTETMILEGDPKEMICQAVE  146

Query  462  EMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAF  283
            + HVDLLVVGSRGLG IK                                       RAF
Sbjct  147  QTHVDLLVVGSRGLGMIK---------------------------------------RAF  167

Query  282  LGSVSDYCAHHVHCPILIVKP  220
            LGSVSDYCA H  CPILIV+P
Sbjct  168  LGSVSDYCAQHAKCPILIVRP  188



>ref|XP_007145748.1| hypothetical protein PHAVU_007G264400g [Phaseolus vulgaris]
 gb|ESW17742.1| hypothetical protein PHAVU_007G264400g [Phaseolus vulgaris]
Length=182

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 117/213 (55%), Gaps = 48/213 (23%)
 Frame = -2

Query  825  RTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATA--ADEIPAAMVTLVNVQPTFGP  652
            R   KVMV +D+S  S  ALKWAIDNL    + + AT   A E    MV L++V+P    
Sbjct  12   RMRMKVMVGVDESDGSLYALKWAIDNL----FTAMATVGEATEENEGMVFLLHVEPKVHN  67

Query  651  IIYPPGPN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDR  481
             +YP GP         ++VE+VKK+QE  ++ VLSRAL++C +  V+AE++IL GD ++ 
Sbjct  68   FVYPVGPGGAAFYPANVVVESVKKAQEEKSASVLSRALKMCHDKLVKAESMILNGDPREM  127

Query  480  ICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL  301
            ICEAA++M V+LLV+GSRGLG +K                                    
Sbjct  128  ICEAADQMQVNLLVLGSRGLGALK------------------------------------  151

Query  300  **CRAFLGSVSDYCAHHVHCPILIVKPPSKEPN  202
               R  LGSVSD+CAHH   P+LIVKPP +  N
Sbjct  152  ---RTLLGSVSDHCAHHARTPVLIVKPPQQNKN  181



>ref|NP_850717.1| adenine nucleotide alpha hydrolases-like superfamily protein 
[Arabidopsis thaliana]
 gb|AEE79783.1| universal stress protein family protein [Arabidopsis thaliana]
Length=197

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 113/198 (57%), Gaps = 46/198 (23%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGP  631
            VMVAID+S  SF+AL+WA+D+L  R   SA     +    ++TL++V PT+   IYP G 
Sbjct  32   VMVAIDESKNSFDALEWAVDHL--RVVISAEPETGQ-EGGLLTLLHVHPTYLQYIYPSGG  88

Query  630  NLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHV  451
                T  + E ++K++E + + + +RAL+ICR   V+ ET+ILEGD K+ IC+A E+ HV
Sbjct  89   ----TDSVPEPMRKAREESTTNLFTRALEICRGKMVKTETMILEGDPKEMICQAVEQTHV  144

Query  450  DLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSV  271
            DLLVVGSRGLG IK                                       RAFLGSV
Sbjct  145  DLLVVGSRGLGMIK---------------------------------------RAFLGSV  165

Query  270  SDYCAHHVHCPILIVKPP  217
            SDYCA H  CPILIV+PP
Sbjct  166  SDYCAQHAKCPILIVRPP  183



>ref|NP_191404.2| adenine nucleotide alpha hydrolases-like superfamily protein 
[Arabidopsis thaliana]
 gb|AAO42062.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50593.1| unknown protein [Arabidopsis thaliana]
 gb|AEE79782.1| universal stress protein family protein [Arabidopsis thaliana]
Length=204

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/201 (43%), Positives = 114/201 (57%), Gaps = 45/201 (22%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGP  631
            VMVAID+S  SF+AL+WA+D+L  R   SA     +    ++TL++V PT+   IYP G 
Sbjct  32   VMVAIDESKNSFDALEWAVDHL--RVVISAEPETGQ-EGGLLTLLHVHPTYLQYIYPSGG  88

Query  630  N---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEE  460
                +  T  + E ++K++E + + + +RAL+ICR   V+ ET+ILEGD K+ IC+A E+
Sbjct  89   TASAVYATDSVPEPMRKAREESTTNLFTRALEICRGKMVKTETMILEGDPKEMICQAVEQ  148

Query  459  MHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFL  280
             HVDLLVVGSRGLG IK                                       RAFL
Sbjct  149  THVDLLVVGSRGLGMIK---------------------------------------RAFL  169

Query  279  GSVSDYCAHHVHCPILIVKPP  217
            GSVSDYCA H  CPILIV+PP
Sbjct  170  GSVSDYCAQHAKCPILIVRPP  190



>ref|XP_007029144.1| Adenine nucleotide alpha hydrolases-like superfamily protein, 
putative [Theobroma cacao]
 gb|EOY09646.1| Adenine nucleotide alpha hydrolases-like superfamily protein, 
putative [Theobroma cacao]
Length=171

 Score =   147 bits (372),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 118/206 (57%), Gaps = 50/206 (24%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNY-PSAATAADEIPAAMVTLVNV-QPT----FGP  652
            +VMV ID S  SF AL+W +DNL      P+ A    E  A ++TLV+V QP     F P
Sbjct  2    RVMVGIDGSDASFYALQWTLDNLFNGLISPAPAVVGGE--ATLLTLVHVHQPIKHYGFAP  59

Query  651  IIYPPGPNL--ELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRI  478
              +P GP +    +  +V++V+KSQE  ++ +LSRAL++C++ K++AETLILEGD  D I
Sbjct  60   SAFPAGPGVLAYASTTLVDSVRKSQEQISAGILSRALKMCKD-KIKAETLILEGDPTDMI  118

Query  477  CEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL*  298
            C+ +E+M+VDLLVVGSRGLGKIK                                     
Sbjct  119  CDISEQMNVDLLVVGSRGLGKIK-------------------------------------  141

Query  297  *CRAFLGSVSDYCAHHVHCPILIVKP  220
              RA LGSVSDYCAH+  CP LIVKP
Sbjct  142  --RALLGSVSDYCAHYAKCPTLIVKP  165



>ref|XP_010516493.1| PREDICTED: uncharacterized protein LOC104792132 isoform X2 [Camelina 
sativa]
Length=193

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 113/199 (57%), Gaps = 46/199 (23%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            KVMVAID+S  SF+AL+W +++L  R+  SA     +    ++TLV+V PT+   IYP G
Sbjct  27   KVMVAIDESKNSFDALQWVVEHL--RDVISAEPETGQ-EGGLLTLVHVHPTYLQYIYPSG  83

Query  633  PNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMH  454
                 T  + E V+K++E + + + +RAL+ICR   V+ ET+ILEGD K+ IC+A E+ H
Sbjct  84   G----TDSVPEQVRKAREESTTNLFTRALEICRGKMVKTETMILEGDPKEMICQAVEQTH  139

Query  453  VDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGS  274
            VDLLV+GSRGLG IK                                       RAFLGS
Sbjct  140  VDLLVLGSRGLGMIK---------------------------------------RAFLGS  160

Query  273  VSDYCAHHVHCPILIVKPP  217
            VSDYCA H   PILIV+PP
Sbjct  161  VSDYCAQHAKRPILIVRPP  179



>ref|XP_010516491.1| PREDICTED: uncharacterized protein LOC104792132 isoform X1 [Camelina 
sativa]
Length=200

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 114/202 (56%), Gaps = 45/202 (22%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            KVMVAID+S  SF+AL+W +++L  R+  SA     +    ++TLV+V PT+   IYP G
Sbjct  27   KVMVAIDESKNSFDALQWVVEHL--RDVISAEPETGQ-EGGLLTLVHVHPTYLQYIYPSG  83

Query  633  PN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAE  463
                 +  T  + E V+K++E + + + +RAL+ICR   V+ ET+ILEGD K+ IC+A E
Sbjct  84   GTASAVYATDSVPEQVRKAREESTTNLFTRALEICRGKMVKTETMILEGDPKEMICQAVE  143

Query  462  EMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAF  283
            + HVDLLV+GSRGLG IK                                       RAF
Sbjct  144  QTHVDLLVLGSRGLGMIK---------------------------------------RAF  164

Query  282  LGSVSDYCAHHVHCPILIVKPP  217
            LGSVSDYCA H   PILIV+PP
Sbjct  165  LGSVSDYCAQHAKRPILIVRPP  186



>ref|XP_009795288.1| PREDICTED: uncharacterized protein LOC104242017 [Nicotiana sylvestris]
Length=227

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 120/223 (54%), Gaps = 60/223 (27%)
 Frame = -2

Query  888  YACPGEAMHSQVPTVKETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAA  709
            YA PG            T   +   +V+VAID+S ESFNALKW +D LLR+ Y +     
Sbjct  54   YAYPG------------THEEKKKMRVLVAIDNSEESFNALKWILDYLLRQPYHTTEEVK  101

Query  708  DEIPAAMVTLVNVQPTFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICREN  529
            +  P   ++LV+V   F    YP G ++      +E+  ++Q   A+ +L+RA ++C++ 
Sbjct  102  E--PCIKLSLVHVMEPFPQYAYP-GTHV------IESATRAQAQEAARILARASEMCKDK  152

Query  528  KVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPV  349
             ++AETLILEGD K+ +CEA E+M++DLL VGSRGLG+IK                    
Sbjct  153  MIKAETLILEGDPKNILCEATEKMNIDLLAVGSRGLGQIK--------------------  192

Query  348  IIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKP  220
                               RAFLGSVSDYCAHH  CP+LIVKP
Sbjct  193  -------------------RAFLGSVSDYCAHHAKCPLLIVKP  216



>ref|XP_010677621.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=171

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/201 (39%), Positives = 110/201 (55%), Gaps = 44/201 (22%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            KVMVA+D+S  S  AL W + N+++          +E   + V L++V   F   +YP G
Sbjct  2    KVMVALDESKRSLYALNWVLSNVIK-----PVGQEEEQSDSFVCLLHVNLPFQTYVYPAG  56

Query  633  PNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMH  454
            P +  TP +V++V+++QE  ++ + +RA++ C E K++ E + L GD K+ IC+A EE H
Sbjct  57   PVIYTTPSVVDSVRQAQEQISAGIFARAIRCCEEKKIKTEAVSLRGDPKEVICQAIEERH  116

Query  453  VDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGS  274
            VDLLVVGSRGLG +K                                       RAFLGS
Sbjct  117  VDLLVVGSRGLGMLK---------------------------------------RAFLGS  137

Query  273  VSDYCAHHVHCPILIVKPPSK  211
            VSDYCAHH  CP+LIVKPP +
Sbjct  138  VSDYCAHHAKCPVLIVKPPKE  158



>gb|KEH41788.1| adenine nucleotide alpha hydrolase superfamily protein [Medicago 
truncatula]
Length=177

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 119/208 (57%), Gaps = 50/208 (24%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLR---RNYPSAATAADEIPAAMVTLVNVQPTFGPIIY  643
            KVMVAID+S  S  ALKWA+DNL      +  +  T+ +E    +V LV+V+P F    Y
Sbjct  4    KVMVAIDESDGSLYALKWALDNLFNIMATDTMNGTTSENE--EGIVFLVHVEPNFHTYAY  61

Query  642  P--PGP-NLELTPMMVE---AVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDR  481
            P   GP  +   P + E   ++KK+Q+  ++ + S+ALQ+C++ +V+AE++IL GDA++ 
Sbjct  62   PIPMGPAGVAFYPSIPEVGDSLKKAQQEKSAAIASQALQMCKDKQVKAESVILNGDAREM  121

Query  480  ICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL  301
            ICEA E+M VDLL++GSRGLGK+K                                    
Sbjct  122  ICEATEKMQVDLLIMGSRGLGKLK------------------------------------  145

Query  300  **CRAFLGSVSDYCAHHVHCPILIVKPP  217
               RAFLGSVSDYCAHH   PILIVKPP
Sbjct  146  ---RAFLGSVSDYCAHHAKAPILIVKPP  170



>ref|XP_009393020.1| PREDICTED: universal stress protein A-like protein [Musa acuminata 
subsp. malaccensis]
Length=179

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 115/214 (54%), Gaps = 48/214 (22%)
 Frame = -2

Query  843  KETTAT--RTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNV  670
            KE  AT  R    V+VA+D+S  S  AL WA+DNL    + +A   A   P  +  LV V
Sbjct  5    KEPVATEGREKMTVLVAVDESEGSLYALSWALDNL----FVAAVGGAPNKPQPLGRLVLV  60

Query  669  ---QPTFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILE  499
               QP    I++P GP +  T  ++++VKK+QE N+ +V+ RA  ICR   V AE +++ 
Sbjct  61   HAQQPLQQFIMHPIGPAVYATSSVIDSVKKAQEQNSRDVIERAKGICRRRLVEAEAVVVA  120

Query  498  GDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**V  319
            GD K+ IC+AAE+M  DLLVVGSRGL KI+                              
Sbjct  121  GDPKETICQAAEQMQTDLLVVGSRGLSKIR------------------------------  150

Query  318  RSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                     RA LGSVSDYCAHH +CP+LIVKPP
Sbjct  151  ---------RAILGSVSDYCAHHANCPVLIVKPP  175



>ref|XP_008241215.1| PREDICTED: uncharacterized protein LOC103339661 [Prunus mume]
Length=220

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 89/222 (40%), Positives = 113/222 (51%), Gaps = 61/222 (27%)
 Frame = -2

Query  840  ETTATRTTWKVMVAIDDSGESFNALKWAIDNLL---RRNY----PSAATAADEIPAA---  691
            E    +   +V+VAID S  SF ALKWA+D LL   + N      S  TA  E P A   
Sbjct  40   EQQRKKEKMRVVVAIDGSEGSFYALKWALDLLLVGPKDNADDVATSTGTATLEAPHAGSH  99

Query  690  ----MVTLVNVQPTFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKV  523
                MVTLV V   F         N  L+  +   ++K QE  A+ +L+ AL+IC++ K+
Sbjct  100  ENVSMVTLVYVMQPF--------QNYVLSAAVSGELRKEQEERATAILAHALEICKDKKI  151

Query  522  RAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVII  343
            +A+TLIL GD  D IC+A E+MHVDLLVVGSRGLG +K                      
Sbjct  152  KAQTLILSGDPNDMICQATEQMHVDLLVVGSRGLGMVK----------------------  189

Query  342  KRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                             R F+GSVSDYCAHH  CP++IVKPP
Sbjct  190  -----------------RTFIGSVSDYCAHHAKCPVVIVKPP  214



>ref|XP_010534373.1| PREDICTED: universal stress protein A-like protein [Tarenaya 
hassleriana]
Length=190

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/227 (39%), Positives = 118/227 (52%), Gaps = 50/227 (22%)
 Frame = -2

Query  879  PGEAMHSQVPTVKETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEI  700
            P E    ++  VK    T+   K+MVA+DDS  SF AL+WAID+     +     A D  
Sbjct  5    PPEKAAEKLTEVKTRPETKN-MKLMVAMDDSENSFYALQWAIDH-----FSGLIPAEDTA  58

Query  699  PAAMVTLVNVQPTFGPIIYPPGPN-----LELTPMMVEAVKKSQEHNASEVLSRALQICR  535
               ++ +V+VQ  F    +P GP      + ++   +EAV+K+Q   ++ + +R LQ+CR
Sbjct  59   EQGILAVVHVQQPFHHFSFPAGPGGAAAAVYISSSTMEAVRKTQREMSAALFARVLQMCR  118

Query  534  ENKVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIW  355
              K+  +T  LEGD KD IC+A EEMHV LLVVGSRGLGKIK                  
Sbjct  119  GKKINVKTAALEGDPKDMICQAIEEMHVQLLVVGSRGLGKIK------------------  160

Query  354  PVIIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPPS  214
                                 RAFLGSVSDYCAHH  C +LIVKPP+
Sbjct  161  ---------------------RAFLGSVSDYCAHHAKCSVLIVKPPT  186



>ref|XP_010917884.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=190

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 109/204 (53%), Gaps = 43/204 (21%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPA-AMVTLVNVQPTFGPIIYPP  637
            KVM  +D+S  S +AL WA+D+L      +     D+  A   + L++ Q      ++P 
Sbjct  29   KVMAGVDESEGSMHALCWALDHLFT---ATGGEVPDKTQALGRLILLHAQQPLYHFVHPM  85

Query  636  GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEM  457
            GP +  T   +E+++ +Q+ N+  VL RA QIC E  V+AET+I++GD KD IC+A EEM
Sbjct  86   GPAVYATLTAMESMRNAQKENSIWVLERASQICIERLVKAETIIIDGDPKDVICQATEEM  145

Query  456  HVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLG  277
             +DLL++GSRGLGK+K                                       RA LG
Sbjct  146  SIDLLIMGSRGLGKVK---------------------------------------RAILG  166

Query  276  SVSDYCAHHVHCPILIVKPPSKEP  205
            SVSDYCAHH  CPILIVKPP   P
Sbjct  167  SVSDYCAHHAKCPILIVKPPKVHP  190



>ref|XP_002467191.1| hypothetical protein SORBIDRAFT_01g021200 [Sorghum bicolor]
 gb|EER94189.1| hypothetical protein SORBIDRAFT_01g021200 [Sorghum bicolor]
Length=174

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 109/207 (53%), Gaps = 46/207 (22%)
 Frame = -2

Query  819  TWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQ-PTFGPIIY  643
            T KV+VA+DDS  S +AL W +D+L    +P+A     E P   + LV+ Q P    ++Y
Sbjct  2    TMKVLVAVDDSDGSRHALAWVLDHL----FPAAEQPHQEEPQPALVLVHAQEPLRHVMMY  57

Query  642  PPGPNLEL--TPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
            P GP   +   P M+E V+ +Q  NA  +L RA QIC    V AE +++EGD ++ +C A
Sbjct  58   PVGPGSAVYGAPSMMERVRAAQAENARNLLDRANQICHRRGVSAECVVVEGDPREALCRA  117

Query  468  AEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CR  289
            A++M   LLVVGSRGLG IK                                       R
Sbjct  118  AQDMGAGLLVVGSRGLGAIK---------------------------------------R  138

Query  288  AFLGSVSDYCAHHVHCPILIVKPPSKE  208
            AFLGSVSDYCA H  CPI++VKPP +E
Sbjct  139  AFLGSVSDYCAQHASCPIMVVKPPPRE  165



>ref|XP_010431458.1| PREDICTED: universal stress protein A-like protein [Camelina 
sativa]
Length=167

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 107/192 (56%), Gaps = 45/192 (23%)
 Frame = -2

Query  783  ESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGPN---LELTP  613
            ++F+AL+W +++L  R+  SA     +    ++TLV+V PT+   IYP G     +  T 
Sbjct  4    QNFDALQWVVEHL--RDVISAEPETGQ-EGGLLTLVHVHPTYLQYIYPSGGTASAVYATD  60

Query  612  MMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLLVVG  433
             + E V+K++E + + + +RAL+ICR   V+ ET+ILEGD K+ IC+A E+ HVDLLVVG
Sbjct  61   SVPEQVRKAREESTTNLFTRALEICRGKMVKTETMILEGDPKEMICQAVEQTHVDLLVVG  120

Query  432  SRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYCAH  253
            SRGLG IK                                       RAFLGSVSDYCA 
Sbjct  121  SRGLGMIK---------------------------------------RAFLGSVSDYCAQ  141

Query  252  HVHCPILIVKPP  217
            H  CPILIV+PP
Sbjct  142  HAKCPILIVRPP  153



>gb|AAR87267.1| putative stress-related protein [Oryza sativa Japonica Group]
 gb|ABF98894.1| universal stress protein family protein, expressed [Oryza sativa 
Japonica Group]
Length=182

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/214 (39%), Positives = 111/214 (52%), Gaps = 55/214 (26%)
 Frame = -2

Query  849  TVKETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNV  670
            T  E  A   T KV+VA+D S ES NAL WA+DN++ R             A  V++V V
Sbjct  14   TSGEPGAAAGTMKVVVAVDASEESLNALSWALDNVIGRR------------AGAVSVVVV  61

Query  669  QPTFGP--IIYPPGPNLELTPMM--VEAVKKSQEHNASEVLSRALQICRENKVRAETLIL  502
                GP   +YP   +         +E+++K+QE  + +V+SRAL +C++ +V A   I+
Sbjct  62   HAQHGPDHFVYPVAAHAIAYAPASAIESMRKAQEEISRKVVSRALDVCKQREVSATGAIV  121

Query  501  EGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**  322
            EGDAK+ IC+A EEMH D+LV+GSRGLGKIK                             
Sbjct  122  EGDAKEAICQAVEEMHADMLVLGSRGLGKIK-----------------------------  152

Query  321  VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKP  220
                      RAFLGSVSDY  HH  CP+L+VKP
Sbjct  153  ----------RAFLGSVSDYLVHHACCPVLVVKP  176



>ref|XP_007029145.1| Adenine nucleotide alpha hydrolases-like superfamily protein, 
putative [Theobroma cacao]
 gb|EOY09647.1| Adenine nucleotide alpha hydrolases-like superfamily protein, 
putative [Theobroma cacao]
Length=172

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 110/206 (53%), Gaps = 47/206 (23%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLL----RRNYPSAATAADEIPAAMVTLVNVQPTFGPII  646
            +VMV ID+S ESF+AL+W +D L      R  P      +E  A ++TL++VQ  F    
Sbjct  2    RVMVGIDESDESFHALRWTLDKLFDGMSTRTAPPEEANQEE-AANLLTLLHVQKAFHNYG  60

Query  645  YPPGPNLE--LTPMMVE-AVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
             P G        P  +E +V+KSQ   + E+L  A Q+C++  ++ ++LILEGD K++IC
Sbjct  61   IPVGAGASAFYVPYSIEESVRKSQNQISKELLFHASQMCKDKSIKVKSLILEGDPKEKIC  120

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            +  E+M VDLLVVGSR LGKIK                                      
Sbjct  121  QVIEQMQVDLLVVGSRKLGKIK--------------------------------------  142

Query  294  CRAFLGSVSDYCAHHVHCPILIVKPP  217
             RA LGSVSDYCAH+ +CP+LIVKPP
Sbjct  143  -RALLGSVSDYCAHNANCPVLIVKPP  167



>ref|XP_003559418.1| PREDICTED: universal stress protein A-like protein [Brachypodium 
distachyon]
Length=208

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 110/210 (52%), Gaps = 52/210 (25%)
 Frame = -2

Query  834  TATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFG  655
            ++  T  KV+VA+D S ES +AL WA+D+++R +           P A V +++ Q    
Sbjct  45   SSQATAMKVVVAVDASEESLHALSWALDHVVRFH-----------PGASVVVLHAQHGAD  93

Query  654  PIIYPPGPN--LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDR  481
              +YP   +      P  ++AV+K QE  +S+V+SRAL +C + +V A  +++EGD K+ 
Sbjct  94   HFVYPIAAHGLAYAPPTSLDAVRKDQEELSSKVVSRALDVCNQKQVNASAVVVEGDPKEA  153

Query  480  ICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL  301
            IC+AAE MH  LLV+GSRGLG IK                                    
Sbjct  154  ICQAAEVMHAGLLVLGSRGLGMIK------------------------------------  177

Query  300  **CRAFLGSVSDYCAHHVHCPILIVKPPSK  211
               RA LGSVSDY AHH  CP+LIVKPP K
Sbjct  178  ---RALLGSVSDYLAHHARCPVLIVKPPHK  204



>gb|ADB54817.1| universal stress protein 9308 [Hordeum vulgare subsp. vulgare]
Length=181

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 108/206 (52%), Gaps = 52/206 (25%)
 Frame = -2

Query  822  TTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIY  643
            TT KV+ A+D S ES +AL WA+DN++R +           P A V +V+ Q      +Y
Sbjct  22   TTMKVVAAVDASEESLHALSWALDNVVRHH-----------PGASVVVVHAQHPVDHFVY  70

Query  642  PPGPN--LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
            P   +      P  +++++++Q  N+ + ++RAL +CR+ +V A   ++EGDAK+ IC+A
Sbjct  71   PVAAHGLAYAPPTAMDSMRRAQAENSRKAVARALDVCRQKQVSATAAVVEGDAKEAICQA  130

Query  468  AEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CR  289
             E+   DLLV+GSRGLG IK                                       R
Sbjct  131  VEDARADLLVLGSRGLGMIK---------------------------------------R  151

Query  288  AFLGSVSDYCAHHVHCPILIVKPPSK  211
            A LGSVSDY AHH  CP+LIVKPP+K
Sbjct  152  ALLGSVSDYLAHHASCPVLIVKPPNK  177



>gb|ADB54816.1| universal stress protein 9308 [Hordeum vulgare subsp. vulgare]
Length=181

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/206 (36%), Positives = 108/206 (52%), Gaps = 52/206 (25%)
 Frame = -2

Query  822  TTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIY  643
            TT KV+ A+D S ES +AL WA+DN+++ +           P A V +V+ Q      +Y
Sbjct  22   TTMKVVAAVDASEESLHALSWALDNVVQHH-----------PGASVVVVHAQHPVDHFVY  70

Query  642  PPGPN--LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
            P   +      P  +++++++Q  N+ + ++RAL +CR+ +V A   ++EGDAK+ IC+A
Sbjct  71   PVAAHGLAYAPPTAMDSMRRAQAENSRKAVARALDVCRQKQVSATAAVVEGDAKEAICQA  130

Query  468  AEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CR  289
             E+   DLLV+GSRGLG IK                                       R
Sbjct  131  VEDARADLLVLGSRGLGMIK---------------------------------------R  151

Query  288  AFLGSVSDYCAHHVHCPILIVKPPSK  211
            A LGSVSDY AHH  CP+LIVKPP+K
Sbjct  152  ALLGSVSDYLAHHASCPVLIVKPPNK  177



>ref|XP_011094182.1| PREDICTED: universal stress protein A-like protein [Sesamum indicum]
Length=194

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 112/209 (54%), Gaps = 49/209 (23%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLL---------RRNYPSAATAADEIPAAMVTLVNVQPT  661
            +VMVA+D+S ESF AL W ++NL          + +Y    + ++     M+TL++V   
Sbjct  22   RVMVAMDESDESFYALHWVLNNLFSPGIVATETQTHYHHDDSNSNNT-MNMLTLIHVMEP  80

Query  660  FGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDR  481
            F   ++P    +  T  ++++V K+QE  AS +L++AL +C +  V+A+T ILEGD K+ 
Sbjct  81   FPHYVFPGMQAVFPTTSVIQSVNKAQEETASAMLTQALHMCAQRMVKAKTCILEGDPKEM  140

Query  480  ICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL  301
            IC+ AE+M +DL+ +GSRGLGKIK                                    
Sbjct  141  ICDVAEQMQIDLIAIGSRGLGKIK------------------------------------  164

Query  300  **CRAFLGSVSDYCAHHVHCPILIVKPPS  214
               RAF+GSVSDY  HH  CP+L++K PS
Sbjct  165  ---RAFMGSVSDYVTHHAKCPVLVIKQPS  190



>gb|EMS53028.1| Universal stress protein A-like protein [Triticum urartu]
Length=288

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 114/214 (53%), Gaps = 52/214 (24%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            KV+VA+D S ES +AL WA+DN++R +           P A V +V+ Q +    +YP  
Sbjct  29   KVVVAVDASEESLHALSWALDNVVRLH-----------PGASVAVVHAQHSVDHFVYPVA  77

Query  633  PN--LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEE  460
             +      P  +++++++QE N+   ++RAL +CR+ +  A   ++EGD K+ ICEA EE
Sbjct  78   AHGLAYAPPTALDSMRRAQEENSRRAVARALDVCRQKQASATAAVVEGDPKEAICEAVEE  137

Query  459  MHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFL  280
            M  DLLV+GSRGLG +K                                       RA L
Sbjct  138  MRADLLVLGSRGLGMVK---------------------------------------RALL  158

Query  279  GSVSDYCAHHVHCPILIVKPPSKEPNL*SINIIQ  178
            GSVSDY AHH  CP+LIVKPP+K  +  SI+I++
Sbjct  159  GSVSDYLAHHACCPVLIVKPPNKAHHKSSISIMK  192



>ref|XP_007202608.1| hypothetical protein PRUPE_ppa011744mg [Prunus persica]
 gb|EMJ03807.1| hypothetical protein PRUPE_ppa011744mg [Prunus persica]
Length=198

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 115/222 (52%), Gaps = 61/222 (27%)
 Frame = -2

Query  840  ETTATRTTWKVMVAIDDSGESFNALKWAIDNLL---RRNY----PSAATAADEIPAA---  691
            E    +   +V+VAID S  SF ALKWA+D LL   + N      S  TA  E P A   
Sbjct  18   EQQRKKEKMRVVVAIDGSEGSFYALKWALDLLLVLPKDNADDVATSTGTATLEAPLAGSH  77

Query  690  ----MVTLVNVQPTFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKV  523
                MVTLV V   F         N  L+  +   ++K QE  A+ +L+RAL+IC++ K+
Sbjct  78   ENVSMVTLVYVMQPF--------QNYVLSAAVSGELRKEQEERAAAILARALEICKDKKI  129

Query  522  RAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVII  343
            +AETLIL GD KD IC+A E+MHVDLLVVGSRGLG IK                      
Sbjct  130  KAETLILGGDPKDMICQATEQMHVDLLVVGSRGLGIIK----------------------  167

Query  342  KRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                             R F+GSVSDYCAHH  CP++IVKPP
Sbjct  168  -----------------RTFIGSVSDYCAHHAKCPVVIVKPP  192



>ref|XP_006650590.1| PREDICTED: universal stress protein A-like protein-like [Oryza 
brachyantha]
Length=159

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/200 (38%), Positives = 106/200 (53%), Gaps = 50/200 (25%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            KV+VA+D S ES  AL WA+DN++ R      +         V +++ Q      +YP  
Sbjct  2    KVVVAVDASEESLRALAWALDNVIGRRRAGGVS---------VVVLHAQHGADHFVYPVA  52

Query  633  PN-LELTPM-MVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEE  460
             + +   P   +E+++K+QE  + +V+SRAL +C++ +V A   I+EGDAK+ IC+A EE
Sbjct  53   AHAVAYAPTSAIESMRKAQEEISRKVVSRALDVCKQREVNAMGAIVEGDAKEAICQAVEE  112

Query  459  MHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFL  280
            MH D+LV+GSRGLGKIK                                       RAFL
Sbjct  113  MHADMLVLGSRGLGKIK---------------------------------------RAFL  133

Query  279  GSVSDYCAHHVHCPILIVKP  220
            GSVSDY  HH  CP+L+VKP
Sbjct  134  GSVSDYLVHHACCPVLVVKP  153



>ref|XP_004983044.1| PREDICTED: universal stress protein A-like protein-like [Setaria 
italica]
Length=175

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 107/207 (52%), Gaps = 48/207 (23%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAAD---EIPAAMVTLVNVQPTFGPIIY  643
            KV+VA+DDS  S +AL W +D+L    +P  A AAD   E P   + LV+       I+Y
Sbjct  2    KVLVAVDDSDFSRHALAWVLDHL----FPFPAAAADQPAEEPRPALVLVHALEPLRHIMY  57

Query  642  PPGPNLEL--TPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
            P GP   +   P M+++V  +Q  NA  +L RA + C +  V AE +++EG+ ++ +C A
Sbjct  58   PIGPGSAVYGAPSMMQSVWAAQAENARSLLDRAKRTCHQRGVSAEVVVVEGEPREALCRA  117

Query  468  AEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CR  289
            A +M   LLVVGSRGLG IK                                       R
Sbjct  118  AADMGAGLLVVGSRGLGAIK---------------------------------------R  138

Query  288  AFLGSVSDYCAHHVHCPILIVKPPSKE  208
            AFLGSVSDYCAHH  CPI++VKPP  +
Sbjct  139  AFLGSVSDYCAHHASCPIMVVKPPRDD  165



>ref|XP_004981765.1| PREDICTED: universal stress protein A-like protein-like [Setaria 
italica]
Length=184

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/233 (35%), Positives = 112/233 (48%), Gaps = 63/233 (27%)
 Frame = -2

Query  903  TETSAYACPGEAMHSQVPTVKETTATR---TTWKVMVAIDDSGESFNALKWAIDNLLRRN  733
            TE +A   PG           E  A R      KV+ A+D S ES  AL WA+DN++R +
Sbjct  4    TEAAASGTPGAGA--------EDGAGRPVSKALKVVAAVDASEESLQALSWALDNVVRCH  55

Query  732  YPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGPN--LELTPMMVEAVKKSQEHNASEVL  559
                       P A + +V+ Q      +YP   +      P  VE+++K+QE N+  +L
Sbjct  56   -----------PDASLVVVHAQHAVDHFVYPIATHGIAYAPPAAVESMRKAQEENSRRIL  104

Query  558  SRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP  379
            +RAL +C+E +V A   ++EGDAK+ IC+A E     LLV+GSRGLGKIK          
Sbjct  105  ARALGMCKERQVDATAAVVEGDAKEAICQAVERFQAGLLVLGSRGLGKIK----------  154

Query  378  *SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKP  220
                                         RAFLGSVSDY +HH  CP+L+VKP
Sbjct  155  -----------------------------RAFLGSVSDYLSHHACCPVLVVKP  178



>ref|XP_002463873.1| hypothetical protein SORBIDRAFT_01g007990 [Sorghum bicolor]
 gb|EER90871.1| hypothetical protein SORBIDRAFT_01g007990 [Sorghum bicolor]
Length=186

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 108/210 (51%), Gaps = 56/210 (27%)
 Frame = -2

Query  822  TTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIY  643
            T  K++ A+D S ES +AL WA+DN++R +           P A + +V+ Q       Y
Sbjct  27   TALKLVAAVDSSEESLHALSWALDNIVRCH-----------PDATLVVVHAQHAVDHFAY  75

Query  642  P---PGPNL--ELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRI  478
            P    G N+         E+++K+QE N+  +++RAL IC+E +V A   ++EGDAK+ I
Sbjct  76   PVAAHGINILPSCKSTAAESMRKAQEENSRRIVARALDICKERQVGATGTVVEGDAKEAI  135

Query  477  CEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL*  298
            C+A E MH  LLV+GSRGLG+IK                                     
Sbjct  136  CQAVERMHAGLLVLGSRGLGRIK-------------------------------------  158

Query  297  *CRAFLGSVSDYCAHHVHCPILIVKP-PSK  211
              RAFLGSVSDY  HH  CP+L+V+P P+K
Sbjct  159  --RAFLGSVSDYLIHHACCPVLVVRPRPTK  186



>ref|XP_009389841.1| PREDICTED: universal stress protein A-like protein [Musa acuminata 
subsp. malaccensis]
Length=187

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 109/214 (51%), Gaps = 58/214 (27%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPA-AMVTLVNVQPTFGPIIYPP  637
            KV+VA++++  S  AL WA+DNL    + SA+   D+  +   + L++ Q      ++P 
Sbjct  12   KVLVAVEETEGSLYALSWALDNL----FTSASDVPDKTESLGRLVLIHAQQPLQHFMHPV  67

Query  636  GPNLE--------------LTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILE  499
            GP +                T  ++++V+++QE N+  +L RA Q+CR   V AE +I++
Sbjct  68   GPCMTDPHHRSFSVLFAVYATSSVIDSVRRAQEQNSRNLLERATQVCRSKLVEAEMVIVD  127

Query  498  GDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**V  319
            GD K+ IC+ AE+M  DLLVVGSRGL KI+                              
Sbjct  128  GDPKEMICQFAEQMQADLLVVGSRGLSKIR------------------------------  157

Query  318  RSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                     RA LGSVS YCAHH  CP+LIVKPP
Sbjct  158  ---------RAILGSVSGYCAHHATCPVLIVKPP  182



>gb|EMT31581.1| Universal stress protein A-like protein [Aegilops tauschii]
Length=183

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 106/208 (51%), Gaps = 62/208 (30%)
 Frame = -2

Query  819  TWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPII--  646
            T KV+VA+D S ES +AL WA+DN++R +           P A V +++ Q      +  
Sbjct  29   TMKVVVAVDASEESLHALSWALDNVVRHH-----------PGASVVVLHAQHRVDHFVAH  77

Query  645  ---YPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
               Y P       P  +++++++QE N+  V++RAL +CR+ +  A   ++EGD K+ I 
Sbjct  78   GLAYAP-------PTALDSMRRAQEENSRRVVARALDVCRQKQASATAAVVEGDPKEAIY  130

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            +A EEM  DLLV+GSRGLG IK                                      
Sbjct  131  QAVEEMRADLLVLGSRGLGMIK--------------------------------------  152

Query  294  CRAFLGSVSDYCAHHVHCPILIVKPPSK  211
             RA LGSVSDY AHH  CP+LIVKPP+K
Sbjct  153  -RALLGSVSDYLAHHACCPVLIVKPPNK  179



>gb|EPS58073.1| hypothetical protein M569_16744, partial [Genlisea aurea]
Length=106

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 84/136 (62%), Gaps = 38/136 (28%)
 Frame = -2

Query  618  TPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLLV  439
            TP ++E+VKK QE  AS +L+RAL +C+   V AE++I+EGD KD+ICEAAE+++V+L++
Sbjct  5    TPAVIESVKKGQEEFASRILARALNMCKGKMVNAESIIVEGDPKDKICEAAEQLNVELVI  64

Query  438  VGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYC  259
            +GSRGLG IKR                W                      A LGSVSDYC
Sbjct  65   LGSRGLGAIKR----------------W----------------------ALLGSVSDYC  86

Query  258  AHHVHCPILIVKPPSK  211
            AHH+HCP+LIVKPP +
Sbjct  87   AHHLHCPVLIVKPPRR  102



>emb|CDX98295.1| BnaC06g16560D [Brassica napus]
Length=194

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 105/202 (52%), Gaps = 58/202 (29%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            KVMVA+D+S  SF AL+WA+++L  R+  SA    D+    ++TLV+V PT+   IYP G
Sbjct  27   KVMVAMDESKNSFYALEWAVEHL--RDVISAEPETDQ-AGGLLTLVHVHPTYLQYIYPSG  83

Query  633  PN---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAE  463
                 +  T  + E++KK++E +  ++ +R+L+ICR                + IC+A E
Sbjct  84   GTASAVYATDSVPESMKKAREESTIKLFTRSLEICR-------------GKMEMICQAVE  130

Query  462  EMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAF  283
            + HVDLLVVGSRGLG IK                                       R F
Sbjct  131  QTHVDLLVVGSRGLGMIK---------------------------------------RVF  151

Query  282  LGSVSDYCAHHVHCPILIVKPP  217
            LGSVSDYCA H  CPILIV+PP
Sbjct  152  LGSVSDYCAQHAKCPILIVRPP  173



>gb|AGT17355.1| hypothetical protein SHCRBa_260_G18_F_60 [Saccharum hybrid cultivar 
R570]
Length=173

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 107/204 (52%), Gaps = 48/204 (24%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADE--IPAAMVTLVNVQ-PTFGPIIY  643
            KV+VA+DDS  S +AL W +D+L    +P+A    +E   P  ++ LV+ Q P    ++Y
Sbjct  2    KVLVAVDDSDGSRHALAWVLDHL----FPAAEKQHEEEPQPPPVLVLVHAQEPLRHVMMY  57

Query  642  PPGPNLEL--TPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
            P GP   +   P  +E V+ +Q  NA  +L RA +IC    V +E +++EGD ++ +C A
Sbjct  58   PVGPGSAVYGAPSTMEWVRAAQAENARNLLDRANRICHRRGVSSEGVVVEGDPREALCRA  117

Query  468  AEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CR  289
            A++M   LLVVGSRGLG IK                                       R
Sbjct  118  AQDMGAGLLVVGSRGLGAIK---------------------------------------R  138

Query  288  AFLGSVSDYCAHHVHCPILIVKPP  217
            AFLGSVSDYCA H  CPIL+VKPP
Sbjct  139  AFLGSVSDYCAQHASCPILVVKPP  162



>gb|EMT31582.1| Universal stress protein A-like protein [Aegilops tauschii]
Length=183

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/222 (35%), Positives = 114/222 (51%), Gaps = 66/222 (30%)
 Frame = -2

Query  852  PTVKETTATRT---TWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVT  682
            P      ATR+   T KV+VA+D S ES +AL WA+D+++R +           P A V 
Sbjct  16   PGAGGGEATRSPAATMKVVVAVDASEESLHALSWALDHVVRLH-----------PGASVV  64

Query  681  LVNVQ-----PTFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRA  517
            +V+ Q       +G + Y P       P  ++A++++Q  N  +V+SRAL +C++ +  A
Sbjct  65   VVHAQHRVDRSAYG-LAYVP-------PTAMDAMRRTQAENTRKVVSRALDVCKQKQASA  116

Query  516  ETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKR  337
              +++ GDAK+ IC+A E+M  DLLV+GSRGLG ++                        
Sbjct  117  TAVLVVGDAKEAICQAVEDMRADLLVLGSRGLGMVR------------------------  152

Query  336  MFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPPSK  211
                           RA LGSVSDY A+H  CP+LIVKPP+K
Sbjct  153  ---------------RALLGSVSDYLANHARCPVLIVKPPNK  179



>gb|EEC76183.1| hypothetical protein OsI_13519 [Oryza sativa Indica Group]
Length=177

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 105/215 (49%), Gaps = 62/215 (29%)
 Frame = -2

Query  849  TVKETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNV  670
            T  E  A   T KV+VA+D S ES NAL WA+DN++ R             A  V++V V
Sbjct  14   TSGEPGAAAGTMKVVVAVDASEESLNALSWALDNVIGRR------------AGAVSVVVV  61

Query  669  QPTFGP--IIYP---PGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLI  505
                GP   +YP              +E+++K+QE  + +V+SRAL       V A   I
Sbjct  62   HAQHGPDHFVYPVAAHAAIAYAPASAIESMRKAQEEISRKVVSRALD------VSATGAI  115

Query  504  LEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI*  325
            +EGDAK+ IC+A EEMH D+LV+GSRGLGKIK                            
Sbjct  116  VEGDAKEAICQAVEEMHADMLVLGSRGLGKIK----------------------------  147

Query  324  *VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKP  220
                       RAFLGSVSDY  HH  CP+L+VKP
Sbjct  148  -----------RAFLGSVSDYLVHHACCPVLVVKP  171



>emb|CAB68183.1| putative protein [Arabidopsis thaliana]
Length=174

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 93/138 (67%), Gaps = 6/138 (4%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGP  631
            VMVAID+S  SF+AL+WA+D+L  R   SA     +    ++TL++V PT+   IYP G 
Sbjct  32   VMVAIDESKNSFDALEWAVDHL--RVVISAEPETGQ-EGGLLTLLHVHPTYLQYIYPSGG  88

Query  630  N---LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEE  460
                +  T  + E ++K++E + + + +RAL+ICR   V+ ET+ILEGD K+ IC+A E+
Sbjct  89   TASAVYATDSVPEPMRKAREESTTNLFTRALEICRGKMVKTETMILEGDPKEMICQAVEQ  148

Query  459  MHVDLLVVGSRGLGKIKR  406
             HVDLLVVGSRGLG IKR
Sbjct  149  THVDLLVVGSRGLGMIKR  166



>gb|EMS48379.1| Universal stress protein A-like protein [Triticum urartu]
Length=205

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/206 (34%), Positives = 104/206 (50%), Gaps = 62/206 (30%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQ-----PTFGPI  649
            KV+VA+D S ES + L WA+D+++R +           P A V +++ Q       +  +
Sbjct  53   KVVVAVDASEESLHTLSWALDHVVRHH-----------PGASVVVLHAQHRVDRSAYAGL  101

Query  648  IYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
             Y P       P  ++A++++Q  N  + +SRAL  C++ +  A   ++ GDAK+ IC+A
Sbjct  102  AYVP-------PTAMDAMRRTQAENTRKAVSRALDACKQKQASATAAVVVGDAKEAICQA  154

Query  468  AEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CR  289
             E+M  DLLV+GSRGLG +K                                       R
Sbjct  155  VEDMRADLLVLGSRGLGMVK---------------------------------------R  175

Query  288  AFLGSVSDYCAHHVHCPILIVKPPSK  211
            AFLGSVSDY AHH  CP+LIVKPP++
Sbjct  176  AFLGSVSDYLAHHARCPVLIVKPPNE  201



>ref|XP_009116521.1| PREDICTED: uncharacterized protein C167.05-like isoform X1 [Brassica 
rapa]
 emb|CDY06041.1| BnaA09g37390D [Brassica napus]
Length=190

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/214 (37%), Positives = 110/214 (51%), Gaps = 58/214 (27%)
 Frame = -2

Query  837  TTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTF  658
            ++  +   KVMVAID+S  SF AL+WA+++L  ++  SA    D+    ++TLV+V P+ 
Sbjct  21   SSKNKKKLKVMVAIDESKNSFYALEWAVEHL--KDVMSAEPETDQ-EGGLLTLVHVNPS-  76

Query  657  GPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKV-------RAETLILE  499
                   G     T  + E +KK+    ++ + + AL++CR   V       + ET+ILE
Sbjct  77   -------GATASATDSVPELMKKAGVQ-STNLFTPALELCRAKMVGDLRTCVKTETMILE  128

Query  498  GDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**V  319
            GD K+ IC+A E+ HVDLLVVGSRGLG IK                              
Sbjct  129  GDPKEMICQAVEQNHVDLLVVGSRGLGMIK------------------------------  158

Query  318  RSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                     RAFLGSVSDYC  H  CP+LIV+PP
Sbjct  159  ---------RAFLGSVSDYCVQHAQCPVLIVRPP  183



>ref|XP_010668291.1| PREDICTED: universal stress protein A-like protein [Beta vulgaris 
subsp. vulgaris]
Length=125

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 76/131 (58%), Gaps = 39/131 (30%)
 Frame = -2

Query  609  MVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLLVVGS  430
            +VE+VKK+Q   ++ +L RA  IC++N VR ETLI EGD K+ IC+A E++H+D+LV+GS
Sbjct  30   VVESVKKAQAEISAAILQRAFSICKQNMVRVETLIFEGDPKEEICKAVEQVHMDMLVIGS  89

Query  429  RGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYCAHH  250
            RGLG IK                                       RAFLGSVSDYCAHH
Sbjct  90   RGLGGIK---------------------------------------RAFLGSVSDYCAHH  110

Query  249  VHCPILIVKPP  217
              CP+LIVKPP
Sbjct  111  AGCPVLIVKPP  121



>emb|CDX71957.1| BnaC08g29170D [Brassica napus]
Length=191

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 108/210 (51%), Gaps = 58/210 (28%)
 Frame = -2

Query  825  RTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPII  646
            +   KVMVAID+S  SF AL+WA+++L  ++  SA    D+    ++TLV+V P+     
Sbjct  26   KKKLKVMVAIDESKNSFYALEWAVEHL--KDVMSAEPETDQ-EGGLLTLVHVNPS-----  77

Query  645  YPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKV-------RAETLILEGDAK  487
               G     T  + E +KK+    ++ + + AL++CR   V       + ET+ILEGD K
Sbjct  78   ---GATASATDSVPELMKKAGVQ-STNLFTPALELCRAKMVGDLRTCVKTETMILEGDPK  133

Query  486  DRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIY  307
            + IC+A E+ HVDLLVVGSRGLG IK                                  
Sbjct  134  EMICQAVEQNHVDLLVVGSRGLGMIK----------------------------------  159

Query  306  IL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                 RAF+GSVSDYC  H  CP+LIV+PP
Sbjct  160  -----RAFIGSVSDYCVQHAQCPVLIVRPP  184



>ref|XP_009116523.1| PREDICTED: uncharacterized protein C167.05-like isoform X3 [Brassica 
rapa]
Length=186

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 108/214 (50%), Gaps = 62/214 (29%)
 Frame = -2

Query  837  TTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTF  658
            ++  +   KVMVAID+S  SF AL+WA+++L  ++  SA    D+    ++TLV+V P+ 
Sbjct  21   SSKNKKKLKVMVAIDESKNSFYALEWAVEHL--KDVMSAEPETDQ-EGGLLTLVHVNPSG  77

Query  657  GPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKV-------RAETLILE  499
                 P            E +KK+    ++ + + AL++CR   V       + ET+ILE
Sbjct  78   ATDSVP------------ELMKKAGVQ-STNLFTPALELCRAKMVGDLRTCVKTETMILE  124

Query  498  GDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**V  319
            GD K+ IC+A E+ HVDLLVVGSRGLG IK                              
Sbjct  125  GDPKEMICQAVEQNHVDLLVVGSRGLGMIK------------------------------  154

Query  318  RSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                     RAFLGSVSDYC  H  CP+LIV+PP
Sbjct  155  ---------RAFLGSVSDYCVQHAQCPVLIVRPP  179



>ref|XP_009116522.1| PREDICTED: uncharacterized protein C167.05-like isoform X2 [Brassica 
rapa]
Length=187

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 108/214 (50%), Gaps = 61/214 (29%)
 Frame = -2

Query  837  TTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTF  658
            ++  +   KVMVAID+S  SF AL+WA+++L  ++  SA    D+    ++TLV+V P+ 
Sbjct  21   SSKNKKKLKVMVAIDESKNSFYALEWAVEHL--KDVMSAEPETDQ-EGGLLTLVHVNPSA  77

Query  657  GPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKV-------RAETLILE  499
                  P           E +KK+    ++ + + AL++CR   V       + ET+ILE
Sbjct  78   SATDSVP-----------ELMKKAGVQ-STNLFTPALELCRAKMVGDLRTCVKTETMILE  125

Query  498  GDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**V  319
            GD K+ IC+A E+ HVDLLVVGSRGLG IK                              
Sbjct  126  GDPKEMICQAVEQNHVDLLVVGSRGLGMIK------------------------------  155

Query  318  RSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                     RAFLGSVSDYC  H  CP+LIV+PP
Sbjct  156  ---------RAFLGSVSDYCVQHAQCPVLIVRPP  180



>ref|NP_001064677.1| Os10g0437500 [Oryza sativa Japonica Group]
 gb|AAP53941.1| universal stress protein family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26591.1| Os10g0437500 [Oryza sativa Japonica Group]
 gb|EAZ16194.1| hypothetical protein OsJ_31643 [Oryza sativa Japonica Group]
 dbj|BAG97974.1| unnamed protein product [Oryza sativa Japonica Group]
Length=181

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 105/207 (51%), Gaps = 50/207 (24%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATA----ADEIP--AAMVTLVNVQPTFGP  652
            KV+VA+DDS  S  AL W +D+L    +P+AAT      +++P  A  + LV+       
Sbjct  2    KVLVAVDDSRGSHRALSWVLDHLF---FPAAATGDGGEEEQVPRPAPELVLVHAIEPLHH  58

Query  651  IIYPPGPNLEL--TPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRI  478
            +++P GP   +     M+EAV+ +Q  NA  +L RA  IC    V A T+ +EG+ ++ +
Sbjct  59   VMFPVGPGSAVYGAASMMEAVRAAQAENARNLLVRARLICERRGVAAATVAVEGEPREAL  118

Query  477  CEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL*  298
            C AAE+    LLVVGSRGLG +K                                     
Sbjct  119  CRAAEDAGAGLLVVGSRGLGALK-------------------------------------  141

Query  297  *CRAFLGSVSDYCAHHVHCPILIVKPP  217
              RAFLGSVSDYCAH   CPI++VKPP
Sbjct  142  --RAFLGSVSDYCAHRASCPIMVVKPP  166



>ref|XP_009373939.1| PREDICTED: uncharacterized protein C167.05-like [Pyrus x bretschneideri]
 ref|XP_009373948.1| PREDICTED: uncharacterized protein C167.05-like [Pyrus x bretschneideri]
 ref|XP_009342557.1| PREDICTED: uncharacterized protein C167.05-like [Pyrus x bretschneideri]
 ref|XP_009342558.1| PREDICTED: uncharacterized protein C167.05-like [Pyrus x bretschneideri]
Length=172

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 74/202 (37%), Positives = 100/202 (50%), Gaps = 48/202 (24%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP-  637
            V+VA+D S ES NAL WA+DNL LR + P + T+A  +   +V  V   P+    + PP 
Sbjct  8    VIVAVDGSEESMNALTWALDNLKLRSSAPDSTTSAGHL---VVLHVQPPPSIAAGLSPPA  64

Query  636  ----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
                GPN    P    A++  Q      ++  AL+IC E KV  +T ++ GD K++I EA
Sbjct  65   IPFGGPNDLEVPAFTAAIEAHQRRITEVIIEHALKICSEKKVNVKTQVVVGDPKEKIGEA  124

Query  468  AEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CR  289
             E +H DLLV+GSR  G IK                                       R
Sbjct  125  VENLHADLLVMGSRAFGPIK---------------------------------------R  145

Query  288  AFLGSVSDYCAHHVHCPILIVK  223
             FLGSVS++CA+HV CP+LIVK
Sbjct  146  MFLGSVSNFCANHVQCPVLIVK  167



>gb|EAY78646.1| hypothetical protein OsI_33745 [Oryza sativa Indica Group]
Length=181

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 105/207 (51%), Gaps = 50/207 (24%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATA----ADEIP--AAMVTLVNVQPTFGP  652
            KV+VA+DDS  S  AL W +D+L    +P+AAT      +++P  A  + LV+       
Sbjct  2    KVLVAVDDSRGSHRALSWVLDHLF---FPAAATGDGGEEEQVPRPAPELVLVHAIEPLHH  58

Query  651  IIYPPGPNLEL--TPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRI  478
            +++P GP   +     M+EAV+ +Q  NA  +L RA  IC    V A T+ +EG+ ++ +
Sbjct  59   VMFPVGPGSAVYGAASMMEAVRAAQAENALNLLVRARLICERRGVAAATVAVEGEPREAL  118

Query  477  CEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL*  298
            C AAE+    LLVVGSRGLG +K                                     
Sbjct  119  CRAAEDAGAGLLVVGSRGLGALK-------------------------------------  141

Query  297  *CRAFLGSVSDYCAHHVHCPILIVKPP  217
              RAFLGSVSDYCAH   CPI++VKPP
Sbjct  142  --RAFLGSVSDYCAHRASCPIMVVKPP  166



>tpg|DAA51379.1| TPA: ethylene-responsive protein isoform 1 [Zea mays]
 tpg|DAA51380.1| TPA: ethylene-responsive protein isoform 2 [Zea mays]
Length=185

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 76/213 (36%), Positives = 105/213 (49%), Gaps = 57/213 (27%)
 Frame = -2

Query  828  TRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPI  649
             R   KV+ A+D S ES +AL WA+DN++R +           P A + +V+ Q      
Sbjct  23   ARKALKVVAAVDASEESLHALSWALDNVVRCH-----------PDATLVVVHAQHAADHF  71

Query  648  IYPP-----GPNLELTPM-MVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAK  487
             YP      G  +   P   VE+V+ +QE ++  V++RAL IC+E +V A   ++EGDAK
Sbjct  72   AYPVAAHGIGTGIVYAPSSAVESVRAAQEESSRRVVARALDICKERQVDATGAVVEGDAK  131

Query  486  DRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIY  307
            + I +A E M   LLV+GSRGLG IK                                  
Sbjct  132  EAIRQAVERMQAGLLVLGSRGLGAIK----------------------------------  157

Query  306  IL**CRAFLGSVSDYCAHHVHCPILIVKP-PSK  211
                 RAFLGSVSDY  HH  CP+L+V+P P+K
Sbjct  158  -----RAFLGSVSDYLIHHACCPVLVVRPRPTK  185



>ref|XP_008679881.1| PREDICTED: ethylene-responsive protein isoform X2 [Zea mays]
Length=182

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 104/210 (50%), Gaps = 54/210 (26%)
 Frame = -2

Query  828  TRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPI  649
             R   KV+ A+D S ES +AL WA+DN++R +           P A + +V+ Q      
Sbjct  23   ARKALKVVAAVDASEESLHALSWALDNVVRCH-----------PDATLVVVHAQHAADHF  71

Query  648  IYPPGPNLELT---PMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRI  478
             YP   +  +       VE+V+ +QE ++  V++RAL IC+E +V A   ++EGDAK+ I
Sbjct  72   AYPVAAHEGIVYAPSSAVESVRAAQEESSRRVVARALDICKERQVDATGAVVEGDAKEAI  131

Query  477  CEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL*  298
             +A E M   LLV+GSRGLG IK                                     
Sbjct  132  RQAVERMQAGLLVLGSRGLGAIK-------------------------------------  154

Query  297  *CRAFLGSVSDYCAHHVHCPILIVKP-PSK  211
              RAFLGSVSDY  HH  CP+L+V+P P+K
Sbjct  155  --RAFLGSVSDYLIHHACCPVLVVRPRPTK  182



>ref|XP_008352713.1| PREDICTED: uncharacterized protein C167.05-like [Malus domestica]
 ref|XP_008361569.1| PREDICTED: uncharacterized protein C167.05-like [Malus domestica]
Length=172

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 99/202 (49%), Gaps = 48/202 (24%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP-  637
            V+VA+D S ES NAL WA+DNL LR + P + T+A      +V  V   P+    + PP 
Sbjct  8    VIVAVDGSEESMNALTWALDNLKLRSSAPDSTTSAGHF---VVLHVQSPPSIAAGLSPPA  64

Query  636  ----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
                GPN    P    A++  Q      ++  AL+IC E KV  +T ++ GD K++I EA
Sbjct  65   IPFGGPNDLEVPAFTAAIEAHQRRITEAIIEHALKICSEKKVNVKTQVVVGDPKEKIGEA  124

Query  468  AEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CR  289
             E +H DLLV+GSR  G IK                                       R
Sbjct  125  VENLHADLLVMGSRAFGPIK---------------------------------------R  145

Query  288  AFLGSVSDYCAHHVHCPILIVK  223
             FLGSVS++CA+HV CP++IVK
Sbjct  146  MFLGSVSNFCANHVQCPVIIVK  167



>ref|XP_008679887.1| PREDICTED: ethylene-responsive protein isoform X3 [Zea mays]
 tpg|DAA51381.1| TPA: hypothetical protein ZEAMMB73_051712 [Zea mays]
Length=181

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 75/209 (36%), Positives = 105/209 (50%), Gaps = 53/209 (25%)
 Frame = -2

Query  828  TRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPI  649
             R   KV+ A+D S ES +AL WA+DN++R +           P A + +V+ Q      
Sbjct  23   ARKALKVVAAVDASEESLHALSWALDNVVRCH-----------PDATLVVVHAQHAADHF  71

Query  648  IYPPGPN-LELTPM-MVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
             YP   + +   P   VE+V+ +QE ++  V++RAL IC+E +V A   ++EGDAK+ I 
Sbjct  72   AYPVAAHGIVYAPSSAVESVRAAQEESSRRVVARALDICKERQVDATGAVVEGDAKEAIR  131

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            +A E M   LLV+GSRGLG IK                                      
Sbjct  132  QAVERMQAGLLVLGSRGLGAIK--------------------------------------  153

Query  294  CRAFLGSVSDYCAHHVHCPILIVKP-PSK  211
             RAFLGSVSDY  HH  CP+L+V+P P+K
Sbjct  154  -RAFLGSVSDYLIHHACCPVLVVRPRPTK  181



>ref|XP_009116524.1| PREDICTED: universal stress protein A-like protein isoform X4 
[Brassica rapa]
Length=183

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/214 (36%), Positives = 105/214 (49%), Gaps = 65/214 (30%)
 Frame = -2

Query  837  TTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTF  658
            ++  +   KVMVAID+S  SF AL+WA+++L  ++  SA    D+    ++TLV+V P+ 
Sbjct  21   SSKNKKKLKVMVAIDESKNSFYALEWAVEHL--KDVMSAEPETDQ-EGGLLTLVHVNPSD  77

Query  657  GPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKV-------RAETLILE  499
                             V  + K     ++ + + AL++CR   V       + ET+ILE
Sbjct  78   S----------------VPELMKKAGVQSTNLFTPALELCRAKMVGDLRTCVKTETMILE  121

Query  498  GDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**V  319
            GD K+ IC+A E+ HVDLLVVGSRGLG IK                              
Sbjct  122  GDPKEMICQAVEQNHVDLLVVGSRGLGMIK------------------------------  151

Query  318  RSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                     RAFLGSVSDYC  H  CP+LIV+PP
Sbjct  152  ---------RAFLGSVSDYCVQHAQCPVLIVRPP  176



>ref|XP_007223587.1| hypothetical protein PRUPE_ppa012379mg [Prunus persica]
 gb|EMJ24786.1| hypothetical protein PRUPE_ppa012379mg [Prunus persica]
Length=172

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 74/202 (37%), Positives = 99/202 (49%), Gaps = 48/202 (24%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP-  637
            V+VA+D S ES NAL WA+DNL LR   P + T+A      +V  V   P+    + PP 
Sbjct  8    VIVAVDGSEESMNALSWALDNLKLRSPAPDSTTSAGHF---VVLHVQSPPSIAAGLSPPA  64

Query  636  ----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
                GP+    P    A++  Q      +L  AL+IC E KV  +T ++ GD K++I EA
Sbjct  65   IPFGGPSDVEVPAFNAAIEAHQRRITEAILEYALRICSEKKVNVKTQVVVGDPKEKIGEA  124

Query  468  AEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CR  289
            AE +H DLLV+GSR  G +K                                       R
Sbjct  125  AENLHADLLVMGSRAFGPLK---------------------------------------R  145

Query  288  AFLGSVSDYCAHHVHCPILIVK  223
             FLGSVS+YCA+HV CPI+I+K
Sbjct  146  MFLGSVSNYCANHVQCPIIIIK  167



>ref|XP_008679878.1| PREDICTED: ethylene-responsive protein isoform X1 [Zea mays]
Length=186

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 105/214 (49%), Gaps = 58/214 (27%)
 Frame = -2

Query  828  TRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPI  649
             R   KV+ A+D S ES +AL WA+DN++R +           P A + +V+ Q      
Sbjct  23   ARKALKVVAAVDASEESLHALSWALDNVVRCH-----------PDATLVVVHAQHAADHF  71

Query  648  IYPPGPNLELTPMMV-------EAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDA  490
             YP   +   T  +V       E+V+ +QE ++  V++RAL IC+E +V A   ++EGDA
Sbjct  72   AYPVAAHGIGTEGIVYAPSSAVESVRAAQEESSRRVVARALDICKERQVDATGAVVEGDA  131

Query  489  KDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSI  310
            K+ I +A E M   LLV+GSRGLG IK                                 
Sbjct  132  KEAIRQAVERMQAGLLVLGSRGLGAIK---------------------------------  158

Query  309  YIL**CRAFLGSVSDYCAHHVHCPILIVKP-PSK  211
                  RAFLGSVSDY  HH  CP+L+V+P P+K
Sbjct  159  ------RAFLGSVSDYLIHHACCPVLVVRPRPTK  186



>gb|EPS60930.1| hypothetical protein M569_13873, partial [Genlisea aurea]
Length=117

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 82/131 (63%), Gaps = 14/131 (11%)
 Frame = -2

Query  609  MVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLLVVGS  430
            +VE+  K+QE NA+ +LSRA +ICRE  +   T ILEGD KD+IC+A EEM +DLL+VGS
Sbjct  1    VVESASKAQEDNAARILSRAFEICREKSINPNTRILEGDPKDKICKAVEEMKIDLLLVGS  60

Query  429  RGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYCAHH  250
            RGLG+IKR FF LI        L   + I   +              A LGSVSDYC HH
Sbjct  61   RGLGQIKRFFFFLINNLLLLFYLFINLFIFFGW--------------ALLGSVSDYCVHH  106

Query  249  VHCPILIVKPP  217
              CP+L+VKPP
Sbjct  107  ATCPVLVVKPP  117



>ref|NP_001151646.1| ethylene-responsive protein [Zea mays]
 gb|ACG43644.1| ethylene-responsive protein [Zea mays]
Length=185

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/213 (35%), Positives = 103/213 (48%), Gaps = 57/213 (27%)
 Frame = -2

Query  828  TRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPI  649
             R   KV+ A+D S ES +AL WA+DN++R +           P A + +V+ Q      
Sbjct  23   ARKALKVVAAVDASEESLHALSWALDNVVRCH-----------PDATLVVVHAQHAADHF  71

Query  648  IYPP-----GPNLELTPM-MVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAK  487
             YP      G  +   P   V +V+ +Q  ++  V++RAL IC+E +V A   ++EGDAK
Sbjct  72   AYPVAAHGIGTGIVYAPSSAVXSVRAAQXESSRRVVARALDICKERQVDATGAVVEGDAK  131

Query  486  DRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIY  307
            + I +A E M   LLV+GSRGLG IK                                  
Sbjct  132  EAIRQAVERMQAGLLVLGSRGLGAIK----------------------------------  157

Query  306  IL**CRAFLGSVSDYCAHHVHCPILIVKP-PSK  211
                 RAFLGSVSDY  HH  CP+L+V+P P+K
Sbjct  158  -----RAFLGSVSDYLIHHACCPVLVVRPRPTK  185



>ref|XP_009593918.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Nicotiana tomentosiformis]
Length=111

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 76/130 (58%), Gaps = 39/130 (30%)
 Frame = -2

Query  609  MVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLLVVGS  430
            ++E+  ++Q   A+ +L+RA ++C++  V+AETLILEGD K+ +CEA E+M++DLL VGS
Sbjct  14   VIESATRAQAQEAARILARASEMCKDKMVKAETLILEGDPKNMLCEATEKMNIDLLAVGS  73

Query  429  RGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYCAHH  250
            RGLG+IK                                       RAFLGSVSDYCAHH
Sbjct  74   RGLGQIK---------------------------------------RAFLGSVSDYCAHH  94

Query  249  VHCPILIVKP  220
              CP+LIVKP
Sbjct  95   AKCPMLIVKP  104



>ref|XP_002962652.1| hypothetical protein SELMODRAFT_79236 [Selaginella moellendorffii]
 gb|EFJ36115.1| hypothetical protein SELMODRAFT_79236 [Selaginella moellendorffii]
Length=187

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 102/204 (50%), Gaps = 57/204 (28%)
 Frame = -2

Query  825  RTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPII  646
            R   KV+VAID+S ES  AL++A+D +++             P   + L++ Q  F P  
Sbjct  37   RKAKKVIVAIDESQESIRALRYALDTVVQ-------------PGDGLVLLHSQ--FMPHS  81

Query  645  Y--PPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRA-ETLILEGDAKDRIC  475
            Y  P GP   +TP +V A +K QE+++  +L +A +IC +  V   E L+  GD +D IC
Sbjct  82   YVGPGGPGFYITPDLVAATRKHQENSSKVLLDKAKRICGDANVHHPELLMATGDPRDSIC  141

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            +A E++H DLLV+GSRG G IK                                      
Sbjct  142  DAVEKIHADLLVMGSRGHGAIK--------------------------------------  163

Query  294  CRAFLGSVSDYCAHHVHCPILIVK  223
             R FLGSVSDYC H+  CP+LIV+
Sbjct  164  -RTFLGSVSDYCTHNAKCPVLIVR  186



>ref|XP_008219288.1| PREDICTED: universal stress protein A-like protein [Prunus mume]
Length=172

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 98/202 (49%), Gaps = 48/202 (24%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP-  637
            V+VA+D S ES NAL WA+D L LR   P + T+A      ++  V   P+    + PP 
Sbjct  8    VIVAVDGSEESMNALSWALDKLKLRSPAPDSTTSAGYF---VILHVQSPPSIAAGLSPPA  64

Query  636  ----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
                GP+    P    A++  Q      ++  AL+IC E KV  +T ++ GD K++I EA
Sbjct  65   IPFGGPSDVEVPAFNAAIEAHQRRITEAIMEYALRICSEKKVNVKTHVVVGDPKEKIGEA  124

Query  468  AEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CR  289
            AE +H DLLV+GSR  G +K                                       R
Sbjct  125  AENLHADLLVMGSRAFGPLK---------------------------------------R  145

Query  288  AFLGSVSDYCAHHVHCPILIVK  223
             FLGSVS+YCA+HV CPI+IVK
Sbjct  146  MFLGSVSNYCANHVQCPIIIVK  167



>emb|CDP11494.1| unnamed protein product [Coffea canephora]
Length=163

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 96/201 (48%), Gaps = 47/201 (23%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQPT-FGPIIYPP  637
            V+VA+D S ES + LKWA+DN+ L+    S      + P ++ T +N  P  FG      
Sbjct  8    VIVAVDGSEESMSGLKWALDNVKLKSEDGSFVVLHVQSPPSIATGLNPGPIPFG------  61

Query  636  GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEM  457
            GP+    P    A++  Q+     +   ALQIC E  V+ ET ++ GD K++ICE  EE+
Sbjct  62   GPSDFQVPAFTAAIEAHQKRITHAIFQHALQICSEKNVKVETKVVIGDPKEKICEVVEEL  121

Query  456  HVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLG  277
            H DLLV+GSR  G IK                                       R FLG
Sbjct  122  HADLLVMGSRAFGPIK---------------------------------------RMFLG  142

Query  276  SVSDYCAHHVHCPILIVKPPS  214
            SVS+YC++   CP++IVK  S
Sbjct  143  SVSNYCSNRAQCPVMIVKGSS  163



>ref|XP_002285692.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera]
 ref|XP_010664379.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera]
 ref|XP_010664380.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera]
 ref|XP_010664381.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera]
 ref|XP_010664382.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera]
 emb|CBI19251.3| unnamed protein product [Vitis vinifera]
Length=168

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 95/198 (48%), Gaps = 40/198 (20%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            +V+VA+D S ES  AL+WA+DN+  R+ PS A A   +   + +  ++     P   P G
Sbjct  7    RVIVAVDGSEESMKALRWALDNIKLRSPPSHAEAGSFVILHVQSPPSIATGLNPGAIPFG  66

Query  633  PNLEL-TPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEM  457
               +L  P    A++  Q      +L  AL+IC +  V  +T ++ GD K++ICEAA  +
Sbjct  67   GPTDLEVPAFTAAIEAHQRRITEAILDHALKICSDKNVNVKTDVVIGDPKEKICEAAVNL  126

Query  456  HVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLG  277
            H DLLV+GSR  G I+                                       R FLG
Sbjct  127  HADLLVMGSRAFGPIR---------------------------------------RMFLG  147

Query  276  SVSDYCAHHVHCPILIVK  223
            SVS+YC +H  CP++IVK
Sbjct  148  SVSNYCTNHAQCPVMIVK  165



>emb|CDY53924.1| BnaC03g73550D [Brassica napus]
 emb|CDX73846.1| BnaA03g32010D [Brassica napus]
Length=71

 Score =   104 bits (260),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 55/106 (52%), Positives = 62/106 (58%), Gaps = 39/106 (37%)
 Frame = -2

Query  528  KVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPV  349
            ++RAETL+LEGDAKD IC+A E+MHVDLLVVGSRGLGKIK                    
Sbjct  2    QIRAETLVLEGDAKDMICQAVEQMHVDLLVVGSRGLGKIK--------------------  41

Query  348  IIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPPSK  211
                               RAFLGSVSDYCAHH  CPILIV+PP +
Sbjct  42   -------------------RAFLGSVSDYCAHHAKCPILIVRPPKE  68



>ref|XP_010475820.1| PREDICTED: universal stress protein A-like protein [Camelina 
sativa]
Length=171

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 95/209 (45%), Gaps = 65/209 (31%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL------------LRRNYPSAATAADEIPAAMVTLVNVQ  667
            V+VA+D S  S  AL+WA+DNL            +    PS + AA   P  +       
Sbjct  10   VVVAVDGSEVSMEALRWALDNLKLSSSSPDSSFVILHVQPSPSVAAGVSPGTI-------  62

Query  666  PTFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAK  487
              FG      GP+    P    A+++ Q+     +L  ALQIC +  V  +T ++ GD K
Sbjct  63   -PFG------GPSGLEVPAFTAAIEQHQKRITDTILEHALQICAQKSVTVKTQVVVGDPK  115

Query  486  DRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIY  307
             +ICEA EE+H DLLV+GSR  G+IK                                  
Sbjct  116  YKICEAVEELHADLLVMGSRAYGRIK----------------------------------  141

Query  306  IL**CRAFLGSVSDYCAHHVHCPILIVKP  220
                 R FLGSVS+YC +H HCP++I+KP
Sbjct  142  -----RMFLGSVSNYCTNHAHCPVVIIKP  165



>ref|XP_011016909.1| PREDICTED: uncharacterized protein LOC105120428 isoform X1 [Populus 
euphratica]
 ref|XP_011016910.1| PREDICTED: uncharacterized protein LOC105120428 isoform X1 [Populus 
euphratica]
 ref|XP_011016911.1| PREDICTED: uncharacterized protein LOC105120428 isoform X1 [Populus 
euphratica]
 ref|XP_011016912.1| PREDICTED: uncharacterized protein LOC105120428 isoform X1 [Populus 
euphratica]
Length=179

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/209 (35%), Positives = 101/209 (48%), Gaps = 44/209 (21%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTL-VNVQPTFGPIIYPP-  637
            V+VA+D S ES NAL++A+DNL  R   S A  + E P + V L V   P+    + P  
Sbjct  8    VIVAVDGSEESMNALRYALDNLKLR---SPAPDSTETPGSFVILHVQSPPSIAAGLNPGA  64

Query  636  ----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
                GP+    P    A++  Q      +L  A +ICRE KV  +T ++ GD K++ICE 
Sbjct  65   IPFGGPSGLEVPAFTAAIEAHQRRITEAILEHATEICREKKVNVKTQVVIGDPKEKICEV  124

Query  468  AEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CR  289
            AE +  DLLV+G R  G IK   F                 + RM               
Sbjct  125  AENLSADLLVMGCRSFGPIKSVLF-----------------VSRM---------------  152

Query  288  AFLGSVSDYCAHHVHCPILIVKPPSKEPN  202
             FLGSVS+YC +   CP++IVK   K+P+
Sbjct  153  -FLGSVSNYCTNQAQCPVIIVK--GKDPS  178



>ref|XP_002514027.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48610.1| conserved hypothetical protein [Ricinus communis]
Length=176

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 73/205 (36%), Positives = 97/205 (47%), Gaps = 51/205 (25%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQ--PTFGPIIYPP  637
            V+VA+D S ES  AL+WAI+NL  R   S A  + E P     +++VQ  PT    + P 
Sbjct  8    VIVAVDGSEESMYALRWAIENLKLR---SPAPDSTETPPGSFFILHVQSPPTIATGLNPG  64

Query  636  -----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRA--ETLILEGDAKDRI  478
                 GP+    P    A++  Q      VL  AL ICR+  V A  +T ++ GD K++I
Sbjct  65   AIPFGGPSDLEVPAFTAAIEAHQRRITEAVLEHALDICRQKNVEANVKTQVVIGDPKEKI  124

Query  477  CEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL*  298
            CE AE+MH DLLV+G R  G IK                                     
Sbjct  125  CEVAEKMHADLLVMGCRAFGPIK-------------------------------------  147

Query  297  *CRAFLGSVSDYCAHHVHCPILIVK  223
              R FLGSVS+YC +H  CP++IVK
Sbjct  148  --RMFLGSVSNYCTNHAECPVIIVK  170



>gb|EEE59934.1| hypothetical protein OsJ_12581 [Oryza sativa Japonica Group]
Length=498

 Score =   112 bits (279),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 94/194 (48%), Gaps = 61/194 (31%)
 Frame = -2

Query  789  SGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGP--IIYP--PGPNLE  622
            S ES NAL WA+DN++ R             A  V++V V    GP   +YP        
Sbjct  356  SEESLNALSWALDNVIGRR------------AGAVSVVVVHAQHGPDHFVYPVAAHAIAY  403

Query  621  LTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLL  442
                 +E+++K+QE  + +V+SRAL       V A   I+EGDAK+ IC+A EEMH D+L
Sbjct  404  APASAIESMRKAQEEISRKVVSRALD------VSATGAIVEGDAKEAICQAVEEMHADML  457

Query  441  VVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDY  262
            V+GSRGLGKIK                                       RAFLGSVSDY
Sbjct  458  VLGSRGLGKIK---------------------------------------RAFLGSVSDY  478

Query  261  CAHHVHCPILIVKP  220
              HH  CP+L+VKP
Sbjct  479  LVHHACCPVLVVKP  492



>ref|XP_010490289.1| PREDICTED: universal stress protein A-like protein [Camelina 
sativa]
Length=171

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 94/209 (45%), Gaps = 65/209 (31%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL------------LRRNYPSAATAADEIPAAMVTLVNVQ  667
            V+VA+D S  S  AL+WA+DNL            +    PS + AA   P  +       
Sbjct  10   VVVAVDGSEVSMEALRWALDNLKLSSSSPDSSFVILHVQPSPSVAAGVSPGTI-------  62

Query  666  PTFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAK  487
              FG      GP+    P    A+++ Q+     +L  A QIC E  V  +T ++ GD K
Sbjct  63   -PFG------GPSGLEVPAFTAAIEQHQKRITDTILEHAHQICAEKSVTVKTQVVVGDPK  115

Query  486  DRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIY  307
             +ICEA EE+H DLLV+GSR  G+IK                                  
Sbjct  116  YKICEAVEELHADLLVIGSRAFGRIK----------------------------------  141

Query  306  IL**CRAFLGSVSDYCAHHVHCPILIVKP  220
                 R FLGSVS+YC +H HCP++I+KP
Sbjct  142  -----RMFLGSVSNYCTNHAHCPVVIIKP  165



>ref|XP_006305720.1| hypothetical protein CARUB_v10010470mg [Capsella rubella]
 gb|EOA38618.1| hypothetical protein CARUB_v10010470mg [Capsella rubella]
Length=171

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 97/198 (49%), Gaps = 43/198 (22%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            V+VA+D S  S  AL+WA+DNL L  + P ++     +  +      V P   P   P G
Sbjct  10   VVVAVDGSEVSMEALRWALDNLKLSSSSPDSSFVVLHVQPSPSVAAGVSPGTIPFGGPSG  69

Query  633  PNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMH  454
              LE+ P    A+++ Q+     +L  A Q+C E  V  +T ++ GDAK +ICEA E++H
Sbjct  70   --LEV-PAFTAAIEQHQKRITDTILQHAHQVCAEKSVNVKTQVVIGDAKYKICEAVEDLH  126

Query  453  VDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGS  274
             DLLV+GSR  G+IK                                       R FLGS
Sbjct  127  ADLLVMGSRAYGRIK---------------------------------------RMFLGS  147

Query  273  VSDYCAHHVHCPILIVKP  220
            VS+YC +H HCP++I+KP
Sbjct  148  VSNYCTNHAHCPVVIIKP  165



>ref|XP_007018204.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 1 [Theobroma cacao]
 ref|XP_007018205.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 1 [Theobroma cacao]
 ref|XP_007018206.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY15429.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY15430.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY15431.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 1 [Theobroma cacao]
Length=175

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 94/202 (47%), Gaps = 48/202 (24%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP-  637
            V+VA+D S ES +AL+WA+DNL LR + P +  +       +V  V   P+    + P  
Sbjct  8    VIVAVDGSEESMDALRWALDNLKLRSSTPDSTKSPGYF---LVLHVQSPPSIAAGLNPGA  64

Query  636  ----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
                GP+    P    A++  Q+     +L  ALQIC E     +T +  GD K++ICE 
Sbjct  65   IPFGGPSGLEVPAFTAAIEAHQKRITEVILDHALQICSERNANVKTQVAIGDPKEKICEV  124

Query  468  AEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CR  289
             E +H DLLV+GSR  G IK                                       R
Sbjct  125  VENLHSDLLVMGSRAFGPIK---------------------------------------R  145

Query  288  AFLGSVSDYCAHHVHCPILIVK  223
             FLGSVS+YCA+H  CP++I+K
Sbjct  146  MFLGSVSNYCANHAQCPVIIIK  167



>ref|NP_001051280.1| Os03g0750000 [Oryza sativa Japonica Group]
 dbj|BAF13194.1| Os03g0750000, partial [Oryza sativa Japonica Group]
Length=128

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 74/129 (57%), Gaps = 39/129 (30%)
 Frame = -2

Query  606  VEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLLVVGSR  427
            +E+++K+QE  + +V+SRAL +C++ +V A   I+EGDAK+ IC+A EEMH D+LV+GSR
Sbjct  33   IESMRKAQEEISRKVVSRALDVCKQREVSATGAIVEGDAKEAICQAVEEMHADMLVLGSR  92

Query  426  GLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHV  247
            GLGKIK                                       RAFLGSVSDY  HH 
Sbjct  93   GLGKIK---------------------------------------RAFLGSVSDYLVHHA  113

Query  246  HCPILIVKP  220
             CP+L+VKP
Sbjct  114  CCPVLVVKP  122



>ref|XP_011023763.1| PREDICTED: universal stress protein A-like protein [Populus euphratica]
Length=171

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 103/203 (51%), Gaps = 54/203 (27%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP-  637
            K++VA+D+S ES +AL W + N+L  N PS  T         + L+ V+P    ++Y   
Sbjct  12   KILVAVDESEESMHALSWCLKNVLVSNNPSRDT---------LILLYVKPP--RVVYSAL  60

Query  636  -GPNLELTPMMVEAVKKSQEHNASEVLSRALQICREN--KVRAETLILEGDAKDRICEAA  466
             G    L+  ++  ++K     A  V+ +A ++CRE    V+ ET+I  GD +D IC+AA
Sbjct  61   DGTGYLLSSDIMATMQKYNNDIADCVIEKAKRMCREQVQDVKVETIIEHGDPRDLICQAA  120

Query  465  EEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRA  286
            E++HVD+LV+GS G G IKR                                       A
Sbjct  121  EKLHVDMLVMGSHGYGLIKR---------------------------------------A  141

Query  285  FLGSVSDYCAHHVHCPILIVKPP  217
            FLGSVS++CA +V CP+LIVK P
Sbjct  142  FLGSVSNHCAQNVKCPVLIVKRP  164



>gb|EMT14537.1| Universal stress protein A-like protein [Aegilops tauschii]
Length=164

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 100/204 (49%), Gaps = 63/204 (31%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP-  637
            K+MVAID+S  S  AL+WA+ NL  R                + L  VQP F P+ Y P 
Sbjct  14   KMMVAIDESECSHYALEWALRNLAPRR---------------LILFTVQP-FSPLSYLPV  57

Query  636  ------GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
                  GP++  +P ++ +V + Q   A  ++ +A  IC E+ V AET+I  GD K+ IC
Sbjct  58   GSPRAVGPSVA-SPELIRSVTEHQRQLAQALVDKAKAICAEHGVDAETVIEVGDPKETIC  116

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            EAAE+++VDLL++GS   G ++                                      
Sbjct  117  EAAEKLNVDLLILGSHSRGPVQ--------------------------------------  138

Query  294  CRAFLGSVSDYCAHHVHCPILIVK  223
             R FLGSVS+YC+HH  CP+L+VK
Sbjct  139  -RFFLGSVSNYCSHHAKCPVLVVK  161



>ref|XP_002319486.1| hypothetical protein POPTR_0013s01110g [Populus trichocarpa]
 gb|EEE95409.1| hypothetical protein POPTR_0013s01110g [Populus trichocarpa]
Length=171

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 102/203 (50%), Gaps = 54/203 (27%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP-  637
            K++VA+D+S ES +AL W + N+L  N PS  T         + L+ V+P    ++Y   
Sbjct  12   KILVAVDESEESMHALSWCLKNVLVSNNPSKDT---------LILLYVKPP--RVVYSSL  60

Query  636  -GPNLELTPMMVEAVKKSQEHNASEVLSRALQICREN--KVRAETLILEGDAKDRICEAA  466
             G    L+  ++  ++K     A  V+ +A ++CRE    V+ ET+I  GDA+D IC+ A
Sbjct  61   DGTGYLLSSDIMATMQKYSNDIADCVIEKAKRMCREQVQDVKVETIIEHGDARDLICQTA  120

Query  465  EEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRA  286
            E++H D+LV+GS G G IKR                                       A
Sbjct  121  EKLHADMLVMGSHGYGLIKR---------------------------------------A  141

Query  285  FLGSVSDYCAHHVHCPILIVKPP  217
            FLGSVS++CA +V CP+LIVK P
Sbjct  142  FLGSVSNHCAQNVKCPVLIVKRP  164



>ref|XP_004148419.1| PREDICTED: universal stress protein A-like protein-like [Cucumis 
sativus]
 ref|XP_004166062.1| PREDICTED: universal stress protein A-like protein-like [Cucumis 
sativus]
 gb|KGN62760.1| hypothetical protein Csa_2G371090 [Cucumis sativus]
Length=175

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/205 (35%), Positives = 98/205 (48%), Gaps = 56/205 (27%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQP--------TF  658
            V+VA+D S ES  AL+WA+ NL L  + P      D      V L +VQP        + 
Sbjct  8    VIVAVDGSDESMGALRWALQNLKLHSSSP------DSTDGTFVAL-HVQPPPSIAAGLSP  60

Query  657  GPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRI  478
             PI +    +LE+ P    A++  Q    + +L  A +IC E +V+ ET ++ GD K++I
Sbjct  61   DPIPFGGPSDLEV-PAFTAAIESHQRRITAAILEHASKICSEYQVKVETKVVIGDPKEKI  119

Query  477  CEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL*  298
            CE AE +H DLLV+GSR  G IK                                     
Sbjct  120  CEVAEHLHADLLVMGSRAFGPIK-------------------------------------  142

Query  297  *CRAFLGSVSDYCAHHVHCPILIVK  223
              R FLGSVS+YC +HV CP++IVK
Sbjct  143  --RMFLGSVSNYCTNHVECPVIIVK  165



>ref|XP_011016913.1| PREDICTED: uncharacterized protein LOC105120428 isoform X2 [Populus 
euphratica]
Length=173

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/209 (34%), Positives = 98/209 (47%), Gaps = 50/209 (24%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTL-VNVQPTFGPIIYPP-  637
            V+VA+D S ES NAL++A+DNL  R   S A  + E P + V L V   P+    + P  
Sbjct  8    VIVAVDGSEESMNALRYALDNLKLR---SPAPDSTETPGSFVILHVQSPPSIAAGLNPGA  64

Query  636  ----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
                GP+    P    A++  Q      +L  A +ICRE KV  +T ++ GD K++ICE 
Sbjct  65   IPFGGPSGLEVPAFTAAIEAHQRRITEAILEHATEICREKKVNVKTQVVIGDPKEKICEV  124

Query  468  AEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CR  289
            AE +  DLLV+G R  G IK                                       R
Sbjct  125  AENLSADLLVMGCRSFGPIK---------------------------------------R  145

Query  288  AFLGSVSDYCAHHVHCPILIVKPPSKEPN  202
             FLGSVS+YC +   CP++IVK   K+P+
Sbjct  146  MFLGSVSNYCTNQAQCPVIIVK--GKDPS  172



>ref|XP_007141257.1| hypothetical protein PHAVU_008G180800g [Phaseolus vulgaris]
 gb|ESW13251.1| hypothetical protein PHAVU_008G180800g [Phaseolus vulgaris]
Length=179

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 100/205 (49%), Gaps = 51/205 (25%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP  637
            +V+V++D S ES  AL+WA++NL LR   P++  A    P+ +V  V   P+    + P 
Sbjct  9    RVLVSVDGSEESMKALRWALNNLKLRSPTPNSTDA----PSFIVFHVQSPPSIATGLSPG  64

Query  636  -----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAE--TLILEGDAKDRI  478
                 GP+    P    A++  QE     VL  AL IC E  + ++  T ++ GD K++I
Sbjct  65   AIPFGGPSDIEVPAFTAAIEAHQERITRAVLDHALGICSEFNLSSQVRTHVVVGDPKEKI  124

Query  477  CEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL*  298
            CEA +++H D+LV+GSR  G IK                                     
Sbjct  125  CEAVQDLHADVLVMGSRAFGPIK-------------------------------------  147

Query  297  *CRAFLGSVSDYCAHHVHCPILIVK  223
              R FLGSVS+YCAHH  CP++I+K
Sbjct  148  --RMFLGSVSNYCAHHASCPVIIIK  170



>ref|XP_006486684.1| PREDICTED: uncharacterized protein C167.05-like [Citrus sinensis]
Length=173

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 96/202 (48%), Gaps = 48/202 (24%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTL-VNVQPTFGPIIYPP-  637
            V+VA+D   ES +AL+WAIDNL  R   S A  + + P + + L V   PT    + P  
Sbjct  8    VIVAVDGGEESMDALRWAIDNLKLR---SPAPGSTDPPGSFIVLHVQPPPTIAAGLNPGA  64

Query  636  ----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
                GP+    P    A++  Q      ++  AL+IC E  V  ++ ++ GDAK+++CE 
Sbjct  65   IPFGGPSHVEVPAFTAAIEAHQGRITQAIIDHALKICSEKNVNVKSEVVIGDAKEKVCEL  124

Query  468  AEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CR  289
             E++H DLLV+GS   G IK                                       R
Sbjct  125  VEKLHADLLVMGSHTFGPIK---------------------------------------R  145

Query  288  AFLGSVSDYCAHHVHCPILIVK  223
             FLGSVS+YCA+H  CP+++VK
Sbjct  146  MFLGSVSNYCANHAQCPVVVVK  167



>ref|XP_009770125.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
 ref|XP_009770126.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
 ref|XP_009770127.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
 ref|XP_009770128.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
Length=170

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 98/204 (48%), Gaps = 52/204 (25%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQ--PTFGPIIYP  640
            V+V++D S ES NAL WA+DN+ L+ + P +       P     +++VQ  P+    + P
Sbjct  8    VIVSVDGSEESMNALNWALDNIKLKPHDPDSGE-----PQGSFVILHVQSPPSIAAGLNP  62

Query  639  P-----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
                  GP+    P    A++  Q+     +L+ A +IC       +T +L GD K++IC
Sbjct  63   AAIPFGGPSDIEVPAFNAAIEAHQKRITQAILNHATEICASKNANFKTQVLIGDPKEKIC  122

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            +A EEMHVDLLV+GSR  G IK                                      
Sbjct  123  DAVEEMHVDLLVMGSRAFGPIK--------------------------------------  144

Query  294  CRAFLGSVSDYCAHHVHCPILIVK  223
             R FLGSVS+YC++H  CP++IVK
Sbjct  145  -RMFLGSVSNYCSNHAQCPVIIVK  167



>ref|XP_002302337.2| ethylene-responsive family protein [Populus trichocarpa]
 gb|EEE81610.2| ethylene-responsive family protein [Populus trichocarpa]
Length=173

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 98/209 (47%), Gaps = 50/209 (24%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTL-VNVQPTFGPIIYPP-  637
            V+VA+D S ES NAL+ A+DNL  R   S A  + E P + V L V   P+    + P  
Sbjct  8    VIVAVDGSEESMNALRHALDNLKLR---SPAPDSTETPGSFVILHVQSPPSIAAGLNPGA  64

Query  636  ----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
                GP+    P    A++  Q      +L  AL+ICRE KV  +T ++ GD K++ICE 
Sbjct  65   IPFGGPSGLEVPAFTAAIEAHQRRITEAILEHALEICREKKVNVKTQVVIGDPKEKICEV  124

Query  468  AEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CR  289
            AE +  DLLV+G R  G IK                                       R
Sbjct  125  AENLPADLLVMGCRSFGPIK---------------------------------------R  145

Query  288  AFLGSVSDYCAHHVHCPILIVKPPSKEPN  202
             FLGSVS+YC +   CP++IVK   K+P+
Sbjct  146  MFLGSVSNYCTNQAQCPVIIVK--GKDPS  172



>ref|XP_010458272.1| PREDICTED: universal stress protein A-like protein [Camelina 
sativa]
Length=171

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 96/198 (48%), Gaps = 43/198 (22%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            V+VA+D S  S  AL+WA+DNL L  + P ++     +  +      V P   P   P G
Sbjct  10   VVVAVDGSEVSMEALRWALDNLKLSSSSPDSSFVVLHVQPSPSVAAGVSPGTIPFGGPSG  69

Query  633  PNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMH  454
              LE+ P    A+++ Q+     +L  A +IC E  V  +T ++ GD K +ICEA EE+H
Sbjct  70   --LEV-PAFTAAIEQHQKRITDTILEHAHRICAEKSVTVKTQVVVGDPKYKICEAVEELH  126

Query  453  VDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGS  274
             DLLV+GSR  G+IK                                       R FLGS
Sbjct  127  ADLLVIGSRAYGRIK---------------------------------------RMFLGS  147

Query  273  VSDYCAHHVHCPILIVKP  220
            VS+YC +H HCP++I+KP
Sbjct  148  VSNYCTNHAHCPVVIIKP  165



>gb|ADB54810.1| universal stress protein 23267 [Hordeum vulgare subsp. vulgare]
 dbj|BAK03155.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=159

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 100/202 (50%), Gaps = 61/202 (30%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP-  637
            K+MVAID+S  S  AL+WA+ NL  R                + L  VQP F P+ Y P 
Sbjct  11   KMMVAIDESECSHYALEWALRNLAPRR---------------LVLFTVQP-FSPLSYLPA  54

Query  636  ----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
                GP++  +P ++ +V + Q   A  ++ +A  IC ++ V AET+I  GD K+ ICEA
Sbjct  55   GSPLGPSVA-SPELIRSVTEHQRQLAQALVDKAKAICADHGVDAETVIEVGDPKETICEA  113

Query  468  AEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CR  289
            A++++VDLL++GS   G I+                                       R
Sbjct  114  ADKLNVDLLILGSHSRGPIQ---------------------------------------R  134

Query  288  AFLGSVSDYCAHHVHCPILIVK  223
             FLGSVS+YC+HH  CP+L+VK
Sbjct  135  FFLGSVSNYCSHHAKCPVLVVK  156



>gb|EMS51706.1| Universal stress protein A-like protein [Triticum urartu]
Length=180

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 69/210 (33%), Positives = 97/210 (46%), Gaps = 51/210 (24%)
 Frame = -2

Query  846  VKETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQ  667
            V+E T  +T   V+V +DDS  S+ AL+WA+  +       A TA    P  +V +V+ +
Sbjct  18   VEEGTTNKTV--VLVGVDDSDHSYRALEWAVRYV-------AETAGPGAPVELV-VVHAK  67

Query  666  PTFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAK  487
            P    ++   GP       +V  V       A EV+ RA ++C  N V+    +++G+ +
Sbjct  68   PAVSSVVTLGGP--AAAGDVVRYVDADLRRRAEEVVDRARRLCAANSVQGVVKVIDGEPR  125

Query  486  DRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIY  307
              +C A E+ H DLLVVGS G G IK                                  
Sbjct  126  YVLCNAVEKHHADLLVVGSHGYGAIK----------------------------------  151

Query  306  IL**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                 RAFLGSVSDYCAHH HC ++IVK P
Sbjct  152  -----RAFLGSVSDYCAHHAHCSVMIVKQP  176



>gb|KDO35866.1| hypothetical protein CISIN_1g038513mg [Citrus sinensis]
Length=81

 Score =   100 bits (250),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 52/106 (49%), Positives = 61/106 (58%), Gaps = 39/106 (37%)
 Frame = -2

Query  528  KVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPV  349
            +V A+TLIL+GDA+D IC+A E+MH+DLLVVGSRGLGK+K                    
Sbjct  3    QVNAQTLILDGDARDVICQAVEQMHIDLLVVGSRGLGKVK--------------------  42

Query  348  IIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPPSK  211
                               RAFLGSVSDYCAHH  CPILIVKPP +
Sbjct  43   -------------------RAFLGSVSDYCAHHAVCPILIVKPPKE  69



>gb|EMS51705.1| Universal stress protein A-like protein [Triticum urartu]
Length=177

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 67/206 (33%), Positives = 100/206 (49%), Gaps = 53/206 (26%)
 Frame = -2

Query  825  RTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAM---VTLVNVQPTFG  655
            R+   V+VA+DDS  S+ AL+WA+ ++       AATA   +P A    + +V+ +P+  
Sbjct  18   RSKTVVLVAVDDSDHSYRALEWAVRHV-------AATAG--VPGARAVELVVVHAKPSPS  68

Query  654  PIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
            P++   GP +  +  +V  V+      A  V+ RA ++C  N V+    +++G+ +  +C
Sbjct  69   PVVTMGGPGV--SGDVVRLVEADLRKKADGVVDRARRLCVANSVQGVVEVVDGEPRHVLC  126

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
             A E+ H DLLVVGS G G IK                                      
Sbjct  127  NAVEKHHADLLVVGSHGYGAIK--------------------------------------  148

Query  294  CRAFLGSVSDYCAHHVHCPILIVKPP  217
             RA LGSVSDYCAHH HC ++IVK P
Sbjct  149  -RALLGSVSDYCAHHAHCSVMIVKQP  173



>ref|NP_172445.2| adenine nucleotide alpha hydrolases-like protein [Arabidopsis 
thaliana]
 gb|AAO64778.1| At1g09740 [Arabidopsis thaliana]
 dbj|BAF00178.1| putative ER6 protein [Arabidopsis thaliana]
 gb|AEE28487.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis 
thaliana]
Length=171

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 67/198 (34%), Positives = 94/198 (47%), Gaps = 43/198 (22%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            V+VA+D S  S  AL+WA+DNL L  +   ++     +  +      V P   P   P G
Sbjct  10   VVVAVDGSEVSMEALRWALDNLKLSSSSSDSSFVVLHVQPSPSVAAGVSPGTIPFGGPSG  69

Query  633  PNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMH  454
              LE+ P    A+++ Q+     +L  A QIC E  V  +T ++ GD K +ICEA E +H
Sbjct  70   --LEV-PAFTAAIEQHQKRITDTILEHASQICAEKSVNVKTQVVIGDPKYKICEAVENLH  126

Query  453  VDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGS  274
             DLLV+GSR  G+IK                                       R FLGS
Sbjct  127  ADLLVMGSRAYGRIK---------------------------------------RMFLGS  147

Query  273  VSDYCAHHVHCPILIVKP  220
            VS+YC +H HCP++I+KP
Sbjct  148  VSNYCTNHAHCPVVIIKP  165



>gb|EYU18168.1| hypothetical protein MIMGU_mgv1a023549mg, partial [Erythranthe 
guttata]
Length=101

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 74/135 (55%), Gaps = 39/135 (29%)
 Frame = -2

Query  618  TPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLLV  439
            T  ++++V K+QE +AS +L+ AL IC +  V+A+T I+EGD K+ IC  A++M VDL+ 
Sbjct  4    TTSVIQSVNKAQEEDASAILTHALDICTQRMVKAKTSIVEGDPKEMICNVADQMGVDLIA  63

Query  438  VGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYC  259
            +GSRGLGK+K                                       RAF+GSVSDY 
Sbjct  64   IGSRGLGKVK---------------------------------------RAFMGSVSDYV  84

Query  258  AHHVHCPILIVKPPS  214
             HH  CP+L++KP +
Sbjct  85   IHHASCPVLVIKPSA  99



>ref|XP_003544826.1| PREDICTED: uncharacterized protein LOC100805479 isoform X1 [Glycine 
max]
Length=179

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 99/205 (48%), Gaps = 53/205 (26%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP--  637
            V+VA+D S ES NAL+WA++NL  R   S A  + + P+  V  V   P+    + P   
Sbjct  10   VLVAVDGSEESMNALRWALNNLKLR---SPAPDSTDAPSFTVFHVQSPPSIATGLNPGAI  66

Query  636  ---GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRE----NKVRAETLILEGDAKDRI  478
               GP+    P    A++  Q+   + VL  AL IC E    +KVR   L+  GD K++I
Sbjct  67   PFGGPSDLEVPAFTAAIEAHQKRITNAVLDHALGICSEFNLTSKVRTHVLV--GDPKEKI  124

Query  477  CEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL*  298
            CEA ++++ D+LV+GSR  G IK                                     
Sbjct  125  CEAVQDLNADVLVMGSRAFGPIK-------------------------------------  147

Query  297  *CRAFLGSVSDYCAHHVHCPILIVK  223
              R FLGSVS+YCAHH  CP++I+K
Sbjct  148  --RMFLGSVSNYCAHHSPCPVIIIK  170



>gb|ADB54809.1| universal stress protein 23267 [Hordeum vulgare subsp. vulgare]
Length=159

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 99/202 (49%), Gaps = 61/202 (30%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP-  637
            K+MVAID+S  S  AL+WA+ NL  R                + L  VQP F P+ Y P 
Sbjct  11   KMMVAIDESECSHYALEWALRNLAPRR---------------LVLFTVQP-FSPLSYLPA  54

Query  636  ----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
                GP++  +P ++ +V + Q   A  +  +A  IC ++ V AET+I  GD K+ ICEA
Sbjct  55   GSPLGPSVA-SPELIRSVTEHQRQLAQALADKAKAICADHGVDAETVIEVGDPKETICEA  113

Query  468  AEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CR  289
            A++++VDLL++GS   G I+                                       R
Sbjct  114  ADKLNVDLLILGSHSRGPIQ---------------------------------------R  134

Query  288  AFLGSVSDYCAHHVHCPILIVK  223
             FLGSVS+YC+HH  CP+L+VK
Sbjct  135  FFLGSVSNYCSHHAKCPVLVVK  156



>ref|XP_002889767.1| hypothetical protein ARALYDRAFT_471075 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66026.1| hypothetical protein ARALYDRAFT_471075 [Arabidopsis lyrata subsp. 
lyrata]
Length=171

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/198 (34%), Positives = 94/198 (47%), Gaps = 43/198 (22%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            V+VA+D S  S  AL+WA+DNL L  +   ++     +  +      V P   P   P G
Sbjct  10   VVVAVDGSEVSMEALRWALDNLKLSSSSSDSSFVVLHVQPSPSVAAGVSPGTIPFGGPSG  69

Query  633  PNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMH  454
              LE+ P    A+++ Q+     +L  A QIC E  V  +T ++ GD K +ICEA E +H
Sbjct  70   --LEV-PAFTAAIEQHQKRITDTILEHANQICAEKSVNVKTKVVVGDPKYKICEAVENLH  126

Query  453  VDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGS  274
             DLLV+GSR  G+IK                                       R FLGS
Sbjct  127  ADLLVMGSRAYGRIK---------------------------------------RMFLGS  147

Query  273  VSDYCAHHVHCPILIVKP  220
            VS+YC +H HCP++I+KP
Sbjct  148  VSNYCTNHAHCPVVIIKP  165



>ref|XP_010544073.1| PREDICTED: uncharacterized protein C167.05 [Tarenaya hassleriana]
 ref|XP_010544074.1| PREDICTED: uncharacterized protein C167.05 [Tarenaya hassleriana]
Length=172

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 93/197 (47%), Gaps = 43/197 (22%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            V+VA+D S  S  AL+WA+DNL L  + P ++     + +       + P   P   P G
Sbjct  10   VIVAVDGSEASMEALRWALDNLKLSPSSPDSSFVVLHVQSPPSIAAGLNPGTIPFGGPSG  69

Query  633  PNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMH  454
              LE+ P    A++  Q+     +L  ALQIC +  V  +T+++ GD K++ICEA E +H
Sbjct  70   --LEV-PAFAAAIEAHQKRITDAILKHALQICSDKSVNVKTIVIVGDPKEKICEAVENLH  126

Query  453  VDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGS  274
             DLLV+G R +G IK                                       R FLGS
Sbjct  127  ADLLVMGCRAIGPIK---------------------------------------RMFLGS  147

Query  273  VSDYCAHHVHCPILIVK  223
            VS+YC +H  CP++I K
Sbjct  148  VSNYCTNHARCPVIIAK  164



>ref|XP_009403083.1| PREDICTED: uncharacterized protein LOC103986718 [Musa acuminata 
subsp. malaccensis]
Length=174

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 96/212 (45%), Gaps = 45/212 (21%)
 Frame = -2

Query  831  ATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTL-VNVQPTFG  655
            AT     V+VA+D S ES N L+WAIDNL  R     A  A E   A+V L V   P+  
Sbjct  2    ATGNLGCVVVAVDGSEESMNGLRWAIDNLRLRPAGEGADGAAEEAGALVVLHVQSPPSIA  61

Query  654  PIIYPP-----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDA  490
              + P      GP+    P    A++  Q      +++ ALQIC    V  +T ++ GD 
Sbjct  62   AGLNPGSVPFGGPDYIEVPAFTAAIEAHQRRITEAIMTHALQICAGKDVNVKTQVVVGDP  121

Query  489  KDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSI  310
            K+ ICE A  +H DLLV+GSR  G IK                                 
Sbjct  122  KEMICEVATNLHADLLVMGSRAFGPIK---------------------------------  148

Query  309  YIL**CRAFLGSVSDYCAHHVHCPILIVKPPS  214
                  R FLGSVS+YC +H +CP++++K  S
Sbjct  149  ------RMFLGSVSNYCINHANCPVVVIKGSS  174



>ref|XP_003580727.1| PREDICTED: universal stress protein A-like protein [Brachypodium 
distachyon]
Length=159

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 102/204 (50%), Gaps = 63/204 (31%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP-  637
            K+MVAIDDS  S  AL+WA+ NL               P  +V L+ VQP + P+ Y P 
Sbjct  9    KMMVAIDDSECSQYALEWALRNL--------------APGRLV-LLTVQP-YAPLGYIPA  52

Query  636  ------GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
                  GP++ ++P ++ +V + Q   A  ++ +A  IC ++ V AET+I  G+ K+ IC
Sbjct  53   AAGSPLGPSV-VSPELIRSVTEHQRQLAQALVDKAKAICADHGVDAETIIEVGEPKETIC  111

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            EAAE+++VDLL++GS   G I+                                      
Sbjct  112  EAAEKLNVDLLILGSHSRGPIQ--------------------------------------  133

Query  294  CRAFLGSVSDYCAHHVHCPILIVK  223
             R FLGSVS+YC HH  CP+L+VK
Sbjct  134  -RFFLGSVSNYCTHHAKCPVLVVK  156



>ref|XP_008444941.1| PREDICTED: uncharacterized protein LOC103488134 [Cucumis melo]
 ref|XP_008444942.1| PREDICTED: uncharacterized protein LOC103488134 [Cucumis melo]
 ref|XP_008444943.1| PREDICTED: uncharacterized protein LOC103488134 [Cucumis melo]
 ref|XP_008444944.1| PREDICTED: uncharacterized protein LOC103488134 [Cucumis melo]
 ref|XP_008444945.1| PREDICTED: uncharacterized protein LOC103488134 [Cucumis melo]
Length=175

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 96/203 (47%), Gaps = 54/203 (27%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQP--------TFG  655
            V+VA+D S ES +AL+WA  NL        ++  D      V L +VQP        +  
Sbjct  8    VIVAVDGSEESMDALRWAFQNLKL-----CSSGPDSTDGTFVVL-HVQPPPSIAAGLSPA  61

Query  654  PIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
            PI +    +LE+ P    A++  Q    + +L  A +IC E +V+ ET ++ GD K++IC
Sbjct  62   PIPFGGPSDLEV-PAFTAAIESHQRRITAAILEHASRICSEYQVKVETKVVIGDPKEKIC  120

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            E AE +H DLLV+GSR  G IK                                      
Sbjct  121  EVAENLHADLLVMGSRAFGPIK--------------------------------------  142

Query  294  CRAFLGSVSDYCAHHVHCPILIV  226
             R FLGSVS+YC +HV CP++IV
Sbjct  143  -RMFLGSVSNYCTNHVECPVIIV  164



>gb|AID16041.1| putative universal stress protein [Catharanthus roseus]
Length=169

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 101/204 (50%), Gaps = 47/204 (23%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP--  637
            V+VA+D S ES NALKWA++NL  R   S+   ++   + +V  V   P+    + P   
Sbjct  8    VIVAVDGSEESMNALKWALENLKLR---SSTNESNGESSFIVLHVQSPPSIAAGLNPGAI  64

Query  636  ---GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAA  466
               GP+    P    A++  Q+     +L  AL+IC E KV+ +T ++ GD K++ICEA 
Sbjct  65   PFGGPSELEVPAFNAAIEAHQKRITKAILDHALKICEEKKVKVQTKVVIGDPKEKICEAV  124

Query  465  EEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRA  286
            +E+H DLLV+GSR  G IK                                       R 
Sbjct  125  DELHADLLVMGSRAFGPIK---------------------------------------RM  145

Query  285  FLGSVSDYCAHHVHCPILIVKPPS  214
            FLGSVS+YC++H  CP++IVK  S
Sbjct  146  FLGSVSNYCSNHAQCPVMIVKESS  169



>gb|AFK36153.1| unknown [Lotus japonicus]
Length=178

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 98/207 (47%), Gaps = 57/207 (28%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAAD------EIPAAMVTLVNVQPTFGP  652
            V VA+D S ES NAL+ A+ NL LR   P + TA        + P ++ T +N     GP
Sbjct  9    VAVAVDGSDESMNALRRAMTNLKLRPQTPDSTTAGCFLILHVQSPPSIATGLNP----GP  64

Query  651  IIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRE----NKVRAETLILEGDAKD  484
            I +    NLE+ P    A++  Q+     +L  AL IC E     KVR   +I  GD K+
Sbjct  65   IPFGGPSNLEV-PAFAAAIEAHQKRITDSILDHALGICSEFNFTEKVRTHVVI--GDPKE  121

Query  483  RICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYI  304
            +ICEA ++ H D+LV+GSR  G IK                                   
Sbjct  122  KICEAVQDQHADVLVMGSRAFGPIK-----------------------------------  146

Query  303  L**CRAFLGSVSDYCAHHVHCPILIVK  223
                R FLGSVS+YCAHH  CP++I+K
Sbjct  147  ----RMFLGSVSNYCAHHAECPVIIIK  169



>ref|XP_006417542.1| hypothetical protein EUTSA_v10008924mg [Eutrema salsugineum]
 ref|XP_006417543.1| hypothetical protein EUTSA_v10008924mg [Eutrema salsugineum]
 ref|XP_006417544.1| hypothetical protein EUTSA_v10008924mg [Eutrema salsugineum]
 gb|ESQ35895.1| hypothetical protein EUTSA_v10008924mg [Eutrema salsugineum]
 gb|ESQ35896.1| hypothetical protein EUTSA_v10008924mg [Eutrema salsugineum]
 gb|ESQ35897.1| hypothetical protein EUTSA_v10008924mg [Eutrema salsugineum]
Length=171

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 92/209 (44%), Gaps = 65/209 (31%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL------------LRRNYPSAATAADEIPAAMVTLVNVQ  667
            V+VA+D S  S  AL+WA+DNL            +    PS + AA   P  +       
Sbjct  10   VVVAVDGSEVSMEALRWALDNLKLSSSSPDSSFVVLHVQPSPSVAAGVSPGTI-------  62

Query  666  PTFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAK  487
              FG      GP+    P    A+++ Q+     +L  A QIC +  V  +T ++ G+ K
Sbjct  63   -PFG------GPSGLEVPAFTAAIEQHQKRITDTILDHARQICADKSVNVKTQVVVGNPK  115

Query  486  DRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIY  307
            D+ICE  E +H DLLV+GSR  G IK                                  
Sbjct  116  DKICETVENLHADLLVMGSRAYGPIK----------------------------------  141

Query  306  IL**CRAFLGSVSDYCAHHVHCPILIVKP  220
                 R FLGSVS+YC +H HCPI+I+KP
Sbjct  142  -----RMFLGSVSNYCTNHAHCPIVIIKP  165



>ref|XP_003615271.1| Universal stress protein A-like protein [Medicago truncatula]
 gb|AES98229.1| adenine nucleotide alpha hydrolase superfamily protein [Medicago 
truncatula]
 gb|AFK35358.1| unknown [Medicago truncatula]
Length=177

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 91/198 (46%), Gaps = 41/198 (21%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYP-P  637
            V+VA+D S ES NAL+WA++NL LR   P +  A   I   + +  ++     P   P  
Sbjct  10   VVVAVDGSEESMNALRWALENLKLRSPAPDSTDAGSFIILHVQSPPSIATGLNPGSIPFG  69

Query  636  GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEM  457
            GP+    P    A++  Q+     +   AL IC     +  T ++ GD K++ICE  +++
Sbjct  70   GPSDLEVPAFAAAIEAHQKRITDSIFDHALGICSTFNTKVRTHVVVGDPKEKICETVQDL  129

Query  456  HVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLG  277
            H D+LV+GSR  G IK                                       R FLG
Sbjct  130  HADVLVMGSRAFGPIK---------------------------------------RMFLG  150

Query  276  SVSDYCAHHVHCPILIVK  223
            SVS+YCAHH  CP+ I+K
Sbjct  151  SVSNYCAHHSECPVTIIK  168



>ref|XP_004299723.1| PREDICTED: universal stress protein A-like protein-like [Fragaria 
vesca subsp. vesca]
Length=174

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 97/203 (48%), Gaps = 49/203 (24%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQ--PTFG----PI  649
            V+VA+D + ES NAL WA+DNL  R+  +   +     A    +++VQ  P+      P 
Sbjct  8    VIVAVDGNEESMNALTWALDNLKLRSSSTPDDSTS---AGHFVILHVQSPPSISAGLTPA  64

Query  648  IYP-PGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICE  472
            + P  GP+    P    A++   +     +L+ AL IC E KV  +T ++ GD K++ICE
Sbjct  65   VVPFGGPSDLEVPAFTAAIEAHLKRITEAILAHALAICSEKKVNVKTHVVVGDPKEKICE  124

Query  471  AAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**C  292
            A E +H DLLV+GSR  G +K                                       
Sbjct  125  AVENLHADLLVMGSRAFGPLK---------------------------------------  145

Query  291  RAFLGSVSDYCAHHVHCPILIVK  223
            R FLGSVS+YCA+H  CP++I K
Sbjct  146  RMFLGSVSNYCANHAQCPVIISK  168



>ref|XP_004490433.1| PREDICTED: universal stress protein Rv2026c/MT2085-like isoform 
X1 [Cicer arietinum]
 ref|XP_004490434.1| PREDICTED: universal stress protein Rv2026c/MT2085-like isoform 
X2 [Cicer arietinum]
 ref|XP_004490435.1| PREDICTED: universal stress protein Rv2026c/MT2085-like isoform 
X3 [Cicer arietinum]
Length=180

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/206 (33%), Positives = 99/206 (48%), Gaps = 54/206 (26%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEI------PAAMVTLVNVQPTFGP  652
            V+VA+D S ES NAL+WA+ NL LR   P    +A  I      P ++ T +N     GP
Sbjct  10   VVVAVDGSQESMNALRWALLNLKLRSPTPDTTDSASFIIFHVQSPPSIATGLNP----GP  65

Query  651  IIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRE---NKVRAETLILEGDAKDR  481
            I +    +LE+ P    A++  Q+     +L  AL IC +    + +  T ++ G+ K++
Sbjct  66   IPFGGPSDLEV-PAFAAAIEAHQKRITDSILYHALGICSQFNHTQAKVRTHVVVGEPKEK  124

Query  480  ICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL  301
            ICE  +++H D+LV+GSR  G IK                                    
Sbjct  125  ICETVQDLHADVLVIGSRAFGPIK------------------------------------  148

Query  300  **CRAFLGSVSDYCAHHVHCPILIVK  223
               R FLGSVS+YCAHH  CP++I+K
Sbjct  149  ---RMFLGSVSNYCAHHAQCPVIIIK  171



>ref|XP_004490436.1| PREDICTED: universal stress protein Rv2026c/MT2085-like isoform 
X4 [Cicer arietinum]
 ref|XP_004490437.1| PREDICTED: universal stress protein Rv2026c/MT2085-like isoform 
X5 [Cicer arietinum]
Length=179

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 67/205 (33%), Positives = 99/205 (48%), Gaps = 53/205 (26%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEI------PAAMVTLVNVQPTFGP  652
            V+VA+D S ES NAL+WA+ NL LR   P    +A  I      P ++ T +N     GP
Sbjct  10   VVVAVDGSQESMNALRWALLNLKLRSPTPDTTDSASFIIFHVQSPPSIATGLNP----GP  65

Query  651  IIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRE--NKVRAETLILEGDAKDRI  478
            I +    +LE+ P    A++  Q+     +L  AL IC +  +  +  T ++ G+ K++I
Sbjct  66   IPFGGPSDLEV-PAFAAAIEAHQKRITDSILYHALGICSQFNHTAKVRTHVVVGEPKEKI  124

Query  477  CEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL*  298
            CE  +++H D+LV+GSR  G IK                                     
Sbjct  125  CETVQDLHADVLVIGSRAFGPIK-------------------------------------  147

Query  297  *CRAFLGSVSDYCAHHVHCPILIVK  223
              R FLGSVS+YCAHH  CP++I+K
Sbjct  148  --RMFLGSVSNYCAHHAQCPVIIIK  170



>gb|EMT03450.1| Universal stress protein A-like protein [Aegilops tauschii]
Length=180

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 91/198 (46%), Gaps = 49/198 (25%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGP  631
            V+V +DDS  S+ AL+WA+  +       A TA    P  +V +V+ +P    ++   GP
Sbjct  28   VLVGVDDSDHSYRALEWAVRYV-------AETAGAGAPVELV-VVHAKPAVSSVVTLGGP  79

Query  630  NLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHV  451
                   +V  V       A EV+ RA ++C  N V+    +++G+ +  +C A E+ H 
Sbjct  80   --AAAGDVVRYVDADLRRRAEEVVDRARRLCAGNSVQGVVEVIDGEPRFVLCNAVEKHHA  137

Query  450  DLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSV  271
            DLLVVGS G G IK                                       RAFLGSV
Sbjct  138  DLLVVGSHGYGAIK---------------------------------------RAFLGSV  158

Query  270  SDYCAHHVHCPILIVKPP  217
            SDYCAHH HC ++IVK P
Sbjct  159  SDYCAHHAHCSVMIVKQP  176



>emb|CDY20676.1| BnaC08g13820D [Brassica napus]
Length=171

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/209 (33%), Positives = 96/209 (46%), Gaps = 55/209 (26%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPT------FGPI  649
            V+VA+D S  S  ALKWA+DNL  +  PS+       P +   +++VQP+        P 
Sbjct  10   VVVAVDGSEVSMEALKWALDNL--KLSPSS-------PDSSFVVLHVQPSPSITAGVSPG  60

Query  648  IYP-PGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICE  472
              P  GP+    P    A+++ Q+     +L  A QI  +  V  +T ++ GD KD+ICE
Sbjct  61   TIPFGGPSGVEVPAFAAAIEQHQKRITDAILEHARQIYADRSVNVKTQVVVGDPKDKICE  120

Query  471  AAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**C  292
              E ++ DLLV+GSR  G IK                                       
Sbjct  121  TVENLNADLLVLGSRAYGPIK---------------------------------------  141

Query  291  RAFLGSVSDYCAHHVHCPILIVKPPSKEP  205
            R FLGSVS YC +H HCP++I+KP    P
Sbjct  142  RMFLGSVSSYCTNHAHCPVVIIKPKEDSP  170



>emb|CDY31068.1| BnaA08g26180D [Brassica napus]
Length=171

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 96/204 (47%), Gaps = 55/204 (27%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPT------FGPI  649
            V+VA+D S  S  ALKWA+DNL  +  PS+       P +   +++VQP+        P 
Sbjct  10   VVVAVDGSEVSMEALKWALDNL--KLSPSS-------PDSSFVVLHVQPSPSIAAGVSPG  60

Query  648  IYP-PGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICE  472
              P  GP+    P    A+++ Q+     +L  A QI  +  V  +T ++ GD KD+ICE
Sbjct  61   TIPFGGPSGVEVPAFAAAIEQHQKRITDAILGHARQIYADRSVNVKTQVVVGDPKDKICE  120

Query  471  AAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**C  292
              E ++ DLLV+GSR  G IK                                       
Sbjct  121  TVENLNADLLVLGSRAYGPIK---------------------------------------  141

Query  291  RAFLGSVSDYCAHHVHCPILIVKP  220
            R FLGSVS+YC +H HCP++I+KP
Sbjct  142  RMFLGSVSNYCTNHAHCPVVIIKP  165



>ref|XP_002454587.1| hypothetical protein SORBIDRAFT_04g033920 [Sorghum bicolor]
 gb|EES07563.1| hypothetical protein SORBIDRAFT_04g033920 [Sorghum bicolor]
Length=162

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 92/204 (45%), Gaps = 46/204 (23%)
 Frame = -2

Query  831  ATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPT-FG  655
            AT     V+VA+D S ES NAL+WA+DNL  R          + P  +   +N  P  FG
Sbjct  2    ATGNLASVVVAVDGSEESMNALRWALDNLRLRPDGELVVLHVQPPPNIAAGLNPAPIPFG  61

Query  654  PIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
                  GP+    P   +A++  Q      +L  AL+IC E  V  +T ++ GD K++IC
Sbjct  62   ------GPSGVEVPAFTQAIEAHQRRITQAILEHALKICSEKNVEVKTEVVVGDPKEKIC  115

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            E A     DLLV+G R +G +K                                      
Sbjct  116  EVAANSKADLLVMGCRAIGPLK--------------------------------------  137

Query  294  CRAFLGSVSDYCAHHVHCPILIVK  223
             R FLGSVS+YC +HV CP++++K
Sbjct  138  -RVFLGSVSNYCINHVGCPVVVIK  160



>ref|XP_008338937.1| PREDICTED: uncharacterized protein LOC103401983 [Malus domestica]
Length=145

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 79/141 (56%), Gaps = 9/141 (6%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP-  637
            V+VA+D S ES NAL WA+DNL LR + P + T+A      +V  V   P+    + PP 
Sbjct  8    VIVAVDGSEESMNALTWALDNLKLRSSAPDSTTSAGHF---VVLHVQSPPSIAAGLSPPA  64

Query  636  ----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
                GPN    P    A++  Q      ++  AL+IC E KV  +T ++ GD K++I EA
Sbjct  65   IPFGGPNDLEVPAFTAAIEAHQRRITEAIIEHALKICSEKKVNVKTQVVVGDPKEKIGEA  124

Query  468  AEEMHVDLLVVGSRGLGKIKR  406
             E +H DLLV+GSR  G IKR
Sbjct  125  VENLHADLLVMGSRAFGPIKR  145



>ref|XP_009588034.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
tomentosiformis]
 ref|XP_009588035.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
tomentosiformis]
 gb|AIS71910.1| ER6 protein [Nicotiana tabacum]
Length=170

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 96/204 (47%), Gaps = 52/204 (25%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQ--PTFGPIIYP  640
            V++++D S ES NAL WA+DN+ L+ + P +       P     +++VQ  P+    + P
Sbjct  8    VILSVDGSEESMNALNWALDNIKLKPHDPDSGE-----PQGSFVILHVQSPPSIAAGLNP  62

Query  639  P-----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
                  GP+    P    A++  Q+     +L+ A +IC       +T +L GD K++IC
Sbjct  63   AAIPFGGPSDIEVPAFNAAIEAHQKRITQAILNHATEICASKNANVKTQVLIGDPKEKIC  122

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            +A EEMH DLLV+GSR  G  K                                      
Sbjct  123  DAVEEMHADLLVMGSRAFGPFK--------------------------------------  144

Query  294  CRAFLGSVSDYCAHHVHCPILIVK  223
             R FLGSVS+YC++H  CP++IVK
Sbjct  145  -RMFLGSVSNYCSNHAQCPVIIVK  167



>gb|EYU18169.1| hypothetical protein MIMGU_mgv11b0160062mg, partial [Erythranthe 
guttata]
Length=70

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 51/106 (48%), Positives = 62/106 (58%), Gaps = 39/106 (37%)
 Frame = -2

Query  525  VRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVI  346
            V+A+TLILEGD KDRIC A EEM+V+LLV+GSRGLG+IK                     
Sbjct  1    VKAKTLILEGDPKDRICRAVEEMNVNLLVIGSRGLGQIK---------------------  39

Query  345  IKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPPSKE  208
                              RAFLGSVSDYC+HH  CP+L+VKPP+K+
Sbjct  40   ------------------RAFLGSVSDYCSHHAKCPVLVVKPPAKK  67



>ref|XP_006338073.1| PREDICTED: universal stress protein A-like protein-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006338074.1| PREDICTED: universal stress protein A-like protein-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006338075.1| PREDICTED: universal stress protein A-like protein-like isoform 
X3 [Solanum tuberosum]
Length=170

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 95/203 (47%), Gaps = 48/203 (24%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYP-  640
            +V+V++D S ES NAL W +DN+ L+ + P +  +   I   ++  V   P+    + P 
Sbjct  7    RVIVSVDGSEESMNALNWTLDNIKLKPHDPDSQESQGSI---VILHVQSPPSIAAGLNPR  63

Query  639  ----PGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICE  472
                 GP+    P    A++  Q+     +L  AL+IC       +T ++ GD K++IC+
Sbjct  64   AIPFGGPSDIEVPAFTAAIEAHQKRITQAILDHALEICANKNANVKTQVVIGDPKEKICD  123

Query  471  AAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**C  292
            A EEM+ DLLV+GSR  G IK                                       
Sbjct  124  AVEEMNADLLVMGSRAFGPIK---------------------------------------  144

Query  291  RAFLGSVSDYCAHHVHCPILIVK  223
            R FLGSVS+YC +H  CP++IVK
Sbjct  145  RMFLGSVSNYCTNHAQCPVIIVK  167



>ref|XP_006422530.1| hypothetical protein CICLE_v10030411mg [Citrus clementina]
 gb|ESR35770.1| hypothetical protein CICLE_v10030411mg [Citrus clementina]
 gb|KDO68181.1| hypothetical protein CISIN_1g040308mg [Citrus sinensis]
Length=167

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/202 (32%), Positives = 93/202 (46%), Gaps = 54/202 (27%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTL-VNVQPTFGPIIYPP-  637
            V+VA+D   ES +AL+WAIDNL  R+           P + + L V   PT    + P  
Sbjct  8    VIVAVDGGEESMDALRWAIDNLKLRS---------PAPGSFIVLHVQPPPTIAAGLNPGA  58

Query  636  ----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
                GP+    P    A++  Q      ++  AL+IC E  V  ++ ++ GDAK+++CE 
Sbjct  59   IPFGGPSHVEVPAFTAAIEAHQGRITQAIIDHALKICSEKNVNVKSEVVIGDAKEKVCEL  118

Query  468  AEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CR  289
             E++H DLLV+GS   G IK                                       R
Sbjct  119  VEKLHADLLVMGSHTFGPIK---------------------------------------R  139

Query  288  AFLGSVSDYCAHHVHCPILIVK  223
             FLGSVS+YCA+H  CP+++VK
Sbjct  140  MFLGSVSNYCANHAQCPVVVVK  161



>gb|ABK23398.1| unknown [Picea sitchensis]
 gb|ABK26205.1| unknown [Picea sitchensis]
Length=153

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 93/200 (47%), Gaps = 52/200 (26%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            K+MVA+DDS  S  AL+WA++NL    + S  +         + L + QP    +   P 
Sbjct  6    KIMVAVDDSEFSHYALQWALNNL--HLFGSDVS---------LVLFHAQPV--AVFNSPA  52

Query  633  PNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMH  454
                 +P ++E +   Q+  + E+L+RA  IC +  V  ETL   GD KD IC+A E++ 
Sbjct  53   TMGVTSPGLIETIFHQQKQVSEEILARAKGICAQKNVIVETLSEIGDPKDAICDAIEKLQ  112

Query  453  VDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGS  274
            +DLL+ GS G G +K                                       RAFLGS
Sbjct  113  IDLLITGSHGYGMLK---------------------------------------RAFLGS  133

Query  273  VSDYCAHHVHCPILIVKPPS  214
            VS+YC  +  CP+L+ + PS
Sbjct  134  VSNYCVQYAKCPVLVTRKPS  153



>gb|KDP41468.1| hypothetical protein JCGZ_15875 [Jatropha curcas]
Length=188

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 90/202 (45%), Gaps = 48/202 (24%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP-  637
            V+VA+D S ES  AL+WA+DNL LR + P +   A      ++  V   P+    + P  
Sbjct  9    VIVAVDGSEESMYALRWALDNLKLRSSAPDSTETAGYF---LILHVQSPPSIAAGLNPGA  65

Query  636  ----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
                GP     P    A++  Q+     VL  ALQIC E     +T ++ GD K++ICEA
Sbjct  66   IPFGGPTDLEVPAFTAAIEAHQKRITEAVLEHALQICSEKNANVKTQVVVGDPKEKICEA  125

Query  468  AEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CR  289
             E    DLLV+G R  G IK                                       R
Sbjct  126  VENSGADLLVMGCRSYGPIK---------------------------------------R  146

Query  288  AFLGSVSDYCAHHVHCPILIVK  223
             FLGSVS+YC +H  CP++IVK
Sbjct  147  MFLGSVSNYCTNHAQCPVVIVK  168



>ref|XP_010107691.1| Universal stress protein A-like protein [Morus notabilis]
 gb|EXC16664.1| Universal stress protein A-like protein [Morus notabilis]
Length=169

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/200 (33%), Positives = 97/200 (49%), Gaps = 48/200 (24%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQ--PTFGPIIYPP  637
            V+VA+D S  S +AL+WA+DNL  +     + A D        +++VQ  P+    + P 
Sbjct  9    VIVAVDGSESSMDALRWALDNLKLQ-----SPAPDSTSGGSFVVLHVQSPPSIAAGLNPG  63

Query  636  G-PNLEL-TPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAE  463
              P  ++  P ++ A++  Q      VL  AL IC E  V+ +T ++ GD K++ICE AE
Sbjct  64   AIPFCDVAVPAIMAAIEAHQRRITEAVLEHALNICSEKNVKVKTEVVIGDPKEKICEVAE  123

Query  462  EMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAF  283
            +++ DLLV+GSR  G IK                                       R F
Sbjct  124  KLNADLLVMGSRAFGPIK---------------------------------------RMF  144

Query  282  LGSVSDYCAHHVHCPILIVK  223
            LGSVS+YC +H  CP++IVK
Sbjct  145  LGSVSNYCTNHAQCPVVIVK  164



>ref|NP_001148900.1| ER6 protein [Zea mays]
 gb|ACG33352.1| ER6 protein [Zea mays]
Length=162

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 94/210 (45%), Gaps = 58/210 (28%)
 Frame = -2

Query  831  ATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPT---  661
            AT     V+VA+D S ES NAL+WA+DNL  R            P   + +++VQP    
Sbjct  2    ATGNLASVVVAVDGSEESMNALQWALDNLRLR------------PDGELVVLHVQPLPNI  49

Query  660  ---FGPIIYP-PGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGD  493
                 P   P  GP+    P   +A++  Q      +L  AL+IC +  V  +T ++ GD
Sbjct  50   AAGLNPAPIPFGGPSGLEVPAFTQAIEAHQRRITQAILEHALKICSDKNVEVKTEVVVGD  109

Query  492  AKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRS  313
             KD+ICE A     DLLV+G R +G +K                                
Sbjct  110  PKDKICEIAANRKADLLVMGCRAIGPLK--------------------------------  137

Query  312  IYIL**CRAFLGSVSDYCAHHVHCPILIVK  223
                   R FLGSVS+YC +HV CP++++K
Sbjct  138  -------RVFLGSVSNYCINHVGCPVVVIK  160



>gb|EYU37243.1| hypothetical protein MIMGU_mgv1a023360mg [Erythranthe guttata]
Length=167

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/206 (32%), Positives = 97/206 (47%), Gaps = 53/206 (26%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYP--  640
            K++VA+D+S ES  AL W + NL+  N  +             TL+ +     P+IYP  
Sbjct  7    KILVAVDESEESTYALSWCLKNLVSDNQQNYKD----------TLILLFAKTHPLIYPVV  56

Query  639  PGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRE--NKVRAETLILEGDAKDRICEAA  466
                   +P ++  ++K     A +V++ A QIC++  +++  ET++  GD +D IC+ A
Sbjct  57   DTTGYATSPSIIAIMEKYANELAEKVMADATQICKDFNDQITVETMVEHGDPRDVICDVA  116

Query  465  EEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRA  286
            E   VD LVVGS G G IK                                       RA
Sbjct  117  ERFKVDFLVVGSHGYGIIK---------------------------------------RA  137

Query  285  FLGSVSDYCAHHVHCPILIVKPPSKE  208
            FLGSVS +CA +V CP+LIVK P+ +
Sbjct  138  FLGSVSSHCAQNVKCPVLIVKKPNSD  163



>gb|AAV65310.1| universal stress protein [Hordeum vulgare subsp. vulgare]
Length=173

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 93/204 (46%), Gaps = 52/204 (25%)
 Frame = -2

Query  828  TRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPI  649
            +R    V+VA+DDS  S+ AL+WA+ ++       A T A    AA + +V+ +P    +
Sbjct  18   SRKKTVVLVAVDDSDHSYRALEWAVRHV-------ATTGA----AAELVVVHAKPPASSV  66

Query  648  IYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEA  469
            +    P       +V  V       A +V+ RA ++C  N V A   ++EG+ +  +C A
Sbjct  67   VSFGSP--AAAGDLVRVVDADLRKRAEDVVDRARRLCVANSVHALIEVIEGEPRHVLCSA  124

Query  468  AEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CR  289
             ++ H DLL VGS G G IK                                       R
Sbjct  125  VDKHHADLLAVGSHGYGAIK---------------------------------------R  145

Query  288  AFLGSVSDYCAHHVHCPILIVKPP  217
            AFLGSVSDYCAHH HC ++IVK P
Sbjct  146  AFLGSVSDYCAHHAHCSVMIVKQP  169



>ref|XP_010921685.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=174

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 97/209 (46%), Gaps = 52/209 (25%)
 Frame = -2

Query  840  ETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPT  661
            ET   +T   ++V IDDS  SF AL+W +++                P   + +V+ +PT
Sbjct  12   ETVEEKTV--MVVGIDDSDHSFYALEWTLEHFFSPEVRGPN------PPFRLVIVHAKPT  63

Query  660  FGPIIYPPGPNL-ELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKD  484
               I+   GP   ++ P +   ++KS    A+ ++ +A ++C    V     ++EGDA++
Sbjct  64   PSSIVSLAGPGAADVLPFVDADLRKS----AARIVEKAREVCVAKSVSTLVEVVEGDARN  119

Query  483  RICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYI  304
             +CEA E+ H D+LVVGS G G IK                                   
Sbjct  120  VLCEAVEKHHADMLVVGSHGYGAIK-----------------------------------  144

Query  303  L**CRAFLGSVSDYCAHHVHCPILIVKPP  217
                RA LGSVSDYCAHH HC ++IVK P
Sbjct  145  ----RAVLGSVSDYCAHHAHCTVMIVKKP  169



>ref|XP_010675243.1| PREDICTED: universal stress protein A-like protein [Beta vulgaris 
subsp. vulgaris]
Length=173

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 96/201 (48%), Gaps = 53/201 (26%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP--  637
            V+VA+D S ES NALKWA+DN+  R        +D+  + ++  V   P+    I P   
Sbjct  8    VVVAVDGSDESMNALKWALDNVTLR--------SDDGGSFIILHVQSPPSIAMGINPGSI  59

Query  636  ---GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAA  466
               GP+LE+ P    A++   +     +++ AL+I  +     +T I+ GD K++ICE  
Sbjct  60   PFGGPSLEV-PAFAAAIEAHLKRVTDAIINHALEIATQKNPNVKTQIVVGDPKEKICEVV  118

Query  465  EEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRA  286
            +EMH DLLV+G+R  G IK                                       R 
Sbjct  119  DEMHADLLVMGNRAFGPIK---------------------------------------RM  139

Query  285  FLGSVSDYCAHHVHCPILIVK  223
            FLGSVS YC++H  CP++IVK
Sbjct  140  FLGSVSKYCSNHASCPVVIVK  160



>ref|XP_008369008.1| PREDICTED: uncharacterized protein LOC103432587 isoform X2 [Malus 
domestica]
Length=160

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 93/199 (47%), Gaps = 51/199 (26%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGP  631
            +++  DDS E   AL+W +D+L +          D  P  ++ +V+ +P+   ++   GP
Sbjct  8    MVIGADDSEEGHYALEWTLDHLFK------PLGGDTAPFKLI-IVHAKPSVSSVVGFVGP  60

Query  630  NLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETL-ILEGDAKDRICEAAEEMH  454
              E+ P++   +KK     A+ V  RA + C    V    + ++EGDA++ +CEA E  H
Sbjct  61   GAEVLPIVDADLKKM----AARVTERAKEFCASKSVTDVVVEVMEGDARNVLCEAVERHH  116

Query  453  VDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGS  274
              +LVVGS G G IK                                       RA LGS
Sbjct  117  ASILVVGSHGYGAIK---------------------------------------RAXLGS  137

Query  273  VSDYCAHHVHCPILIVKPP  217
            VSDYCAHHVHC ++IVK P
Sbjct  138  VSDYCAHHVHCTVMIVKKP  156



>gb|ABR17632.1| unknown [Picea sitchensis]
Length=164

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 98/206 (48%), Gaps = 60/206 (29%)
 Frame = -2

Query  825  RTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPII  646
            +++  ++VAIDD+ ES NAL+W ++NL         T+ D I      L++ Q     ++
Sbjct  9    KSSRGILVAIDDTQESLNALQWVLNNLF--------TSQDRI-----ILIHAQRNPNSLL  55

Query  645  YPPGPNL----ELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRI  478
                P      ++  +    +KKS E    ++L+RA +IC+   +  ET +  GDA++ I
Sbjct  56   ASGSPGFMVPVDVLKIFENDIKKSTE----KILARATEICKAKNLTPETEVHTGDAREVI  111

Query  477  CEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL*  298
            C AA++ + D+LV+GS G G +K                                     
Sbjct  112  CNAAKKYNSDILVLGSHGYGALK-------------------------------------  134

Query  297  *CRAFLGSVSDYCAHHVHCPILIVKP  220
              R  LGSVSDYC HHV CP+++VKP
Sbjct  135  --RVVLGSVSDYCVHHVQCPVVVVKP  158



>gb|AAB60745.1| ESTs gb|ATTS1236,gb|T43334,gb|N97019,gb|AA395203 come from this 
gene [Arabidopsis thaliana]
Length=174

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 96/201 (48%), Gaps = 46/201 (23%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            V+VA+D S  S  AL+WA+DNL L  +   ++     +  +      V P   P   P G
Sbjct  10   VVVAVDGSEVSMEALRWALDNLKLSSSSSDSSFVVLHVQPSPSVAAGVSPGTIPFGGPSG  69

Query  633  PNLELTPMMVEAVKKSQEHNASEVLSRALQICRE---NKVRAETLILEGDAKDRICEAAE  463
              LE+ P    A+++ Q+     +L  A QIC E   ++V  +T ++ GD K +ICEA E
Sbjct  70   --LEV-PAFTAAIEQHQKRITDTILEHASQICAEKSVSRVNVKTQVVIGDPKYKICEAVE  126

Query  462  EMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAF  283
             +H DLLV+GSR  G+IK                                       R F
Sbjct  127  NLHADLLVMGSRAYGRIK---------------------------------------RMF  147

Query  282  LGSVSDYCAHHVHCPILIVKP  220
            LGSVS+YC +H HCP++I+KP
Sbjct  148  LGSVSNYCTNHAHCPVVIIKP  168



>gb|ABR16994.1| unknown [Picea sitchensis]
Length=153

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 95/201 (47%), Gaps = 54/201 (27%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            K+MVA+DDS  S  AL+WA++NL    + S  +         + L + QP     ++   
Sbjct  6    KIMVAVDDSEFSHYALQWALNNL--HLFGSDVS---------LVLFHAQPL---AVFNSA  51

Query  633  PNLELT-PMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEM  457
              + +T P ++E +   Q+  + E+L+RA  IC +  V  ETL   GD KD IC+A E++
Sbjct  52   ATMGVTSPGLIETILHQQKQVSEEILARAKGICAKKNVIVETLSEIGDPKDAICDATEKL  111

Query  456  HVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLG  277
             +DLL+ GS G G +K                                       RAFLG
Sbjct  112  QIDLLITGSHGYGMLK---------------------------------------RAFLG  132

Query  276  SVSDYCAHHVHCPILIVKPPS  214
            SVS+YC  +  CP+L+ + PS
Sbjct  133  SVSNYCVQYAKCPVLVTRKPS  153



>gb|AEZ00873.1| putative universal stress protein [Elaeis guineensis]
Length=155

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 94/199 (47%), Gaps = 50/199 (25%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGP  631
            ++V IDDS  SF AL+W +++        +       P   + +V+ +PT   I+   GP
Sbjct  1    MVVGIDDSDHSFYALEWTLEHFF------SPEVRGPNPPFRLVIVHAKPTPSSIVSLAGP  54

Query  630  NL-ELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMH  454
               ++ P +   ++KS    A+ ++ +A ++C    V     ++EGDA++ +CEA E+ H
Sbjct  55   GAADVLPFVDADLRKS----AARIVEKAREVCVAKSVSTLVEVVEGDARNVLCEAVEKHH  110

Query  453  VDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGS  274
             D+LVVGS G G IK                                       RA LGS
Sbjct  111  ADMLVVGSHGYGAIK---------------------------------------RAVLGS  131

Query  273  VSDYCAHHVHCPILIVKPP  217
            VSDYCAHH HC ++IVK P
Sbjct  132  VSDYCAHHAHCTVMIVKKP  150



>gb|KHG02612.1| hypothetical protein F383_24945 [Gossypium arboreum]
Length=175

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 93/204 (46%), Gaps = 52/204 (25%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQP------TFGP  652
            V+V++D +  S +AL+WA+DN+ LR + P +       P     ++ VQP         P
Sbjct  8    VVVSVDGNEGSMDALRWALDNIKLRPSSPDSTQ-----PPGHFLILYVQPPPSIAAGLNP  62

Query  651  IIYP-PGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
               P  GP     P    A++  Q+     +L+ ALQIC E K   +T ++ GD K++IC
Sbjct  63   GAIPFGGPTHLEVPAFTAAIEAHQKRITDAILNHALQICAEKKANVKTQVVIGDPKEKIC  122

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            E  E +H DLLV+GSR  G IK                                      
Sbjct  123  EVIENVHADLLVMGSRAFGPIK--------------------------------------  144

Query  294  CRAFLGSVSDYCAHHVHCPILIVK  223
             R FLGSVS YCA+H  C ++IVK
Sbjct  145  -RMFLGSVSTYCANHAQCAVMIVK  167



>gb|AFW73547.1| ER6 protein [Zea mays]
Length=162

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 92/204 (45%), Gaps = 46/204 (23%)
 Frame = -2

Query  831  ATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPT-FG  655
            AT     V+VA+D S ES NAL+WA+DNL  R          + P  +   +N  P  FG
Sbjct  2    ATGNLASVVVAVDGSEESMNALQWALDNLRLRPDGELVVLHVQPPPNIAAGLNPAPIPFG  61

Query  654  PIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
                  GP+    P   +A++  Q      +L  AL+IC +  V  +T ++ GD K++IC
Sbjct  62   ------GPSGLEVPAFTQAIEAHQRRITQAILEHALKICSDKNVEVKTEVVVGDPKEKIC  115

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            E A     DLLV+G R +G +K                                      
Sbjct  116  EIAANRKADLLVMGCRAIGPLK--------------------------------------  137

Query  294  CRAFLGSVSDYCAHHVHCPILIVK  223
             R FLGSVS+YC +HV CP++++K
Sbjct  138  -RVFLGSVSNYCINHVGCPVVVIK  160



>ref|XP_010921510.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=167

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 98/204 (48%), Gaps = 50/204 (25%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP-  637
            +++VA+D+S ES  AL+W + NL+         +A E   A  TL+ V     P +Y P 
Sbjct  11   RIVVAVDESEESIYALQWCLHNLIH--------SAGEGATARNTLILVYARPPPPVYSPL  62

Query  636  -GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRE-NKVRAETLILEGDAKDRICEAAE  463
             G     +  +  ++ K  +  A  V+ RA  IC++ + ++ E  +  GDA+D ICE A+
Sbjct  63   DGTGYLFSDEVTASIDKYSKDLAVSVMERARNICKDYSNMKVEEKVCVGDARDVICEMAQ  122

Query  462  EMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAF  283
            ++  DLLV+GS G G IK                                       RAF
Sbjct  123  KLGADLLVMGSHGYGFIK---------------------------------------RAF  143

Query  282  LGSVSDYCAHHVHCPILIVKPPSK  211
            LGSVSDYCA +  CP+LIVK P+K
Sbjct  144  LGSVSDYCARNAKCPVLIVKRPTK  167



>ref|XP_003615270.1| Universal stress protein A-like protein [Medicago truncatula]
 gb|ACJ84030.1| unknown [Medicago truncatula]
 gb|AES98228.1| adenine nucleotide alpha hydrolase superfamily protein [Medicago 
truncatula]
 gb|AFK36077.1| unknown [Medicago truncatula]
Length=179

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 93/200 (47%), Gaps = 43/200 (22%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYP-P  637
            V+VA+D S ES NAL+WA++NL LR   P +  A   I   + +  ++     P   P  
Sbjct  10   VVVAVDGSEESMNALRWALENLKLRSPAPDSTDAGSFIILHVQSPPSIATGLNPGSIPFG  69

Query  636  GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAE--TLILEGDAKDRICEAAE  463
            GP+    P    A++  Q+     +   AL IC    V+ +  T ++ GD K++ICE  +
Sbjct  70   GPSDLEVPAFAAAIEAHQKRITDSIFDHALGICSTFNVKTKVRTHVVVGDPKEKICETVQ  129

Query  462  EMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAF  283
            ++H D+LV+GSR  G IK                                       R F
Sbjct  130  DLHADVLVMGSRAFGPIK---------------------------------------RMF  150

Query  282  LGSVSDYCAHHVHCPILIVK  223
            LGSVS+YCAHH  CP+ I+K
Sbjct  151  LGSVSNYCAHHSECPVTIIK  170



>ref|XP_006647942.1| PREDICTED: uncharacterized protein C167.05-like [Oryza brachyantha]
Length=162

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 95/211 (45%), Gaps = 60/211 (28%)
 Frame = -2

Query  831  ATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQP----  664
            AT     V+VA+D S ES NAL+WA+DNL  R            P   + +++VQP    
Sbjct  2    ATGNLASVVVAVDGSEESMNALRWALDNLRLR------------PDGALVVLHVQPPPSI  49

Query  663  ----TFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEG  496
                  GPI +  GP+    P   +A++  Q      ++  AL+IC E  V  +T ++ G
Sbjct  50   AAGLNPGPIPFG-GPSEVEVPAFTQAIETHQRRITQAIMDHALKICSEKNVEVKTDVVVG  108

Query  495  DAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VR  316
            D K++ICE    +  DLLV+G R  G +K                               
Sbjct  109  DPKEKICEVTANLKADLLVMGCRAFGPLK-------------------------------  137

Query  315  SIYIL**CRAFLGSVSDYCAHHVHCPILIVK  223
                    R FLGSVS+YC ++V CP++++K
Sbjct  138  --------RMFLGSVSNYCINNVTCPVVVIK  160



>ref|XP_010265105.1| PREDICTED: universal stress protein A-like protein [Nelumbo nucifera]
Length=166

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 93/199 (47%), Gaps = 54/199 (27%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGP  631
            V+VA+D+S  S  AL WA+DNL      S  T     PAA     +    +G        
Sbjct  22   VLVAVDESECSTYALHWALDNLRHCFSVSPLTIFTAQPAA-----DYNYLYGVA------  70

Query  630  NLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHV  451
                 P ++++V++ Q+   SE+ ++A +IC    V A+T+   GD K+ ICEA E+ ++
Sbjct  71   ----NPELIDSVREWQQKAVSEMFAKAKEICARRGVTAKTITANGDPKEAICEAVEKFNI  126

Query  450  DLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSV  271
            DLLV+G+ G G IK                                       RA LGSV
Sbjct  127  DLLVLGNHGRGIIK---------------------------------------RALLGSV  147

Query  270  SDYCAHHVHCPILIVKPPS  214
            SDYC HH  CPIL+V+ P+
Sbjct  148  SDYCVHHAKCPILVVRKPA  166



>ref|XP_008774998.1| PREDICTED: uncharacterized protein LOC103695443 isoform X1 [Phoenix 
dactylifera]
Length=177

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 66/215 (31%), Positives = 94/215 (44%), Gaps = 48/215 (22%)
 Frame = -2

Query  831  ATRTTWKVMVAIDDSGESFNALKWAIDNLLRR---NYPSAATAADEIPAAMVTL-----V  676
            AT     V+VA+D S ES NAL+WA+ NL  R     P+AA  A   P   V L     +
Sbjct  2    ATGNLGCVVVAVDGSEESMNALRWALQNLSLRPAGGDPAAAGEAQAEPGTFVVLHVQSPL  61

Query  675  NVQPTFGPIIYP-PGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILE  499
            ++     P   P  GP+    P    A++  Q      ++  AL+IC E     +T ++ 
Sbjct  62   SIAAGLNPGSIPFGGPSHVQVPAFAAAIEAHQRRITEAIMDHALKICAEKNANVKTQVVV  121

Query  498  GDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**V  319
            GD K+ IC+    +H DLLV+G R  G IK                              
Sbjct  122  GDPKEMICDVTSNLHADLLVMGCRAYGPIK------------------------------  151

Query  318  RSIYIL**CRAFLGSVSDYCAHHVHCPILIVKPPS  214
                     R FLGSVS++C +HV CP++++K  S
Sbjct  152  ---------RMFLGSVSNFCINHVSCPVVVIKGTS  177



>ref|NP_001048190.1| Os02g0760500 [Oryza sativa Japonica Group]
 dbj|BAD19406.1| putative ethylene-responsive protein [Oryza sativa Japonica Group]
 dbj|BAF10104.1| Os02g0760500 [Oryza sativa Japonica Group]
 dbj|BAG88500.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74042.1| hypothetical protein OsI_09021 [Oryza sativa Indica Group]
 gb|EEE57845.1| hypothetical protein OsJ_08468 [Oryza sativa Japonica Group]
Length=162

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 65/211 (31%), Positives = 95/211 (45%), Gaps = 60/211 (28%)
 Frame = -2

Query  831  ATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQP----  664
            AT     V+VA+D S ES NAL+WA+DNL  R            P   + +++VQP    
Sbjct  2    ATGNLASVVVAVDGSEESMNALRWALDNLRLR------------PDGALVVLHVQPPPSI  49

Query  663  ----TFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEG  496
                  GPI +  GP+    P   +A++  Q      +L  AL+IC E  V  +T ++ G
Sbjct  50   AAGLNPGPIPFG-GPSEVEVPAFTQAIEAHQRRITQAILDHALKICSEKNVEVKTDVVVG  108

Query  495  DAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VR  316
            D K++ICE    +  DLLV+G R  G +K                               
Sbjct  109  DPKEKICEVTANLKADLLVMGCRAFGPLK-------------------------------  137

Query  315  SIYIL**CRAFLGSVSDYCAHHVHCPILIVK  223
                    R FLGSVS+YC ++V CP++++K
Sbjct  138  --------RMFLGSVSNYCINNVVCPVVVIK  160



>dbj|BAJ92093.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99771.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96484.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93130.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=162

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/211 (30%), Positives = 95/211 (45%), Gaps = 60/211 (28%)
 Frame = -2

Query  831  ATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQP----  664
            AT     V+VA+D S ES  AL+WA+D+L  R            P   + +++VQP    
Sbjct  2    ATANLSSVVVAVDGSEESMKALRWALDSLRLR------------PDGALVVLHVQPPPGI  49

Query  663  ----TFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEG  496
                  GPI +  GP++   P   +A++  Q      +L  AL+IC +  V  +T ++ G
Sbjct  50   AAGLNPGPIPFG-GPSVAEVPAFTQAIESHQRRITEAILEHALKICSDKNVEVKTQVVVG  108

Query  495  DAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VR  316
            D K++ICE   E+  DLLV+G R  G +K                               
Sbjct  109  DPKEKICEVTAELKADLLVMGCRAFGPVK-------------------------------  137

Query  315  SIYIL**CRAFLGSVSDYCAHHVHCPILIVK  223
                    R FLGSVS+YC + V CP++++K
Sbjct  138  --------RMFLGSVSNYCINSVGCPVVVIK  160



>gb|KHG27977.1| hypothetical protein F383_14126 [Gossypium arboreum]
Length=161

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 97/200 (49%), Gaps = 52/200 (26%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            KVMVAID+S  S  AL+WA++NL              I A+ + + N QP      Y  G
Sbjct  9    KVMVAIDESEYSHWALQWALENL-----------GHTISASQLFIFNAQP-LPNFAYLSG  56

Query  633  PNLELTPM-MVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEM  457
                  P+ ++  V+++Q+  A  +L +A  IC    V AET+   GD K++ICEA E++
Sbjct  57   STYGAPPVDLINTVQENQKKLALALLEKAKGICANRGVNAETMTEVGDPKEKICEAVEKL  116

Query  456  HVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLG  277
            +++LL++GS G G I+                                       RAFLG
Sbjct  117  NIELLILGSHGRGAIQ---------------------------------------RAFLG  137

Query  276  SVSDYCAHHVHCPILIVKPP  217
            SVS++C H+  CP+L+V+ P
Sbjct  138  SVSNHCVHNAKCPVLVVRKP  157



>gb|AAD46412.1|AF096262_1 ER6 protein [Solanum lycopersicum]
Length=168

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 63/204 (31%), Positives = 96/204 (47%), Gaps = 52/204 (25%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQ--PTFGPIIYP  640
            V+V++D S ES NAL W +DN+ L+ + P +  +        + +++VQ  P+    + P
Sbjct  6    VIVSVDGSEESMNALNWTLDNIKLKPHDPDSPESQ-----GFIVILHVQSPPSIAAGLNP  60

Query  639  P-----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
                  GP+    P    A++  Q+     +L  AL IC +     +T ++ GD K++IC
Sbjct  61   GAIPFGGPSDVEVPAFTAAIEAHQKRITQAILDHALGICAKKNANVKTQVVIGDPKEKIC  120

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            +A EEM+ DLLV+GSR  G IK                                      
Sbjct  121  DAVEEMNADLLVMGSRAFGPIK--------------------------------------  142

Query  294  CRAFLGSVSDYCAHHVHCPILIVK  223
             R FLGSVS+YC +H  CP++IVK
Sbjct  143  -RMFLGSVSNYCTNHAQCPVIIVK  165



>gb|AGV40783.1| universal stress protein [Salicornia brachiata]
Length=161

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 94/200 (47%), Gaps = 53/200 (27%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGP  631
            ++VA+DDS +SF AL+W +D+      P+        P  ++ LVN +PT    I   GP
Sbjct  9    MLVAVDDSEQSFYALEWTLDHFFTPFAPN-------FPFKLI-LVNSKPTPTSAIGFAGP  60

Query  630  N-LELTPMMVEAVKKSQEHNASEVLSRALQICRENKV-RAETLILEGDAKDRICEAAEEM  457
               E+ P +   +KK     ++ V+ +A ++C    V      I+EGDA++ +CEA E  
Sbjct  61   GGSEVLPFVDTDLKKI----SARVIEKAKEMCHSKSVPDVSAEIVEGDARNVLCEAVESH  116

Query  456  HVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLG  277
            H  +LVVGS G G IK                                       RA LG
Sbjct  117  HASMLVVGSHGYGAIK---------------------------------------RAVLG  137

Query  276  SVSDYCAHHVHCPILIVKPP  217
            SVSDYCAHH HC ++IVK P
Sbjct  138  SVSDYCAHHAHCSVMIVKKP  157



>ref|XP_004237985.1| PREDICTED: universal stress protein A-like protein [Solanum lycopersicum]
 ref|XP_010320202.1| PREDICTED: universal stress protein A-like protein [Solanum lycopersicum]
Length=170

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 63/204 (31%), Positives = 96/204 (47%), Gaps = 52/204 (25%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-LRRNYPSAATAADEIPAAMVTLVNVQ--PTFGPIIYP  640
            V+V++D S ES NAL W +DN+ L+ + P +  +        + +++VQ  P+    + P
Sbjct  8    VIVSVDGSEESMNALNWTLDNIKLKPHDPDSPESQ-----GFIVILHVQSPPSIAAGLNP  62

Query  639  P-----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
                  GP+    P    A++  Q+     +L  AL IC +     +T ++ GD K++IC
Sbjct  63   GAIPFGGPSDVEVPAFTAAIEAHQKRITQAILDHALGICAKKNANVKTQVVIGDPKEKIC  122

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            +A EEM+ DLLV+GSR  G IK                                      
Sbjct  123  DAVEEMNADLLVMGSRAFGPIK--------------------------------------  144

Query  294  CRAFLGSVSDYCAHHVHCPILIVK  223
             R FLGSVS+YC +H  CP++IVK
Sbjct  145  -RMFLGSVSNYCTNHAQCPVIIVK  167



>ref|XP_004958663.1| PREDICTED: uncharacterized protein LOC101769282 [Setaria italica]
Length=189

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 87/195 (45%), Gaps = 52/195 (27%)
 Frame = -2

Query  801  AIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGPNLE  622
             +DDS  S+ AL+W + ++          A      A + +V+ +P+   ++   GP   
Sbjct  43   GVDDSEHSYYALEWTVRHV----------AGGVAGGAELVIVHAKPSASSVVSFGGPGAG  92

Query  621  LTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHVDLL  442
                 VEA  +     A  V+ RA Q+C  N V A   ++EG+ +  +C AAE+ H DLL
Sbjct  93   EAMRCVEADLRKM---AEAVVGRARQVCIANSVHALIEVVEGEPRYVLCNAAEKHHADLL  149

Query  441  VVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSVSDY  262
            VVGS G G IK                                       RAFLGSVSDY
Sbjct  150  VVGSHGYGAIK---------------------------------------RAFLGSVSDY  170

Query  261  CAHHVHCPILIVKPP  217
            CAHH HC ++IVK P
Sbjct  171  CAHHTHCTVMIVKRP  185



>ref|XP_006840564.1| hypothetical protein AMTR_s00045p00225160 [Amborella trichopoda]
 gb|ERN02239.1| hypothetical protein AMTR_s00045p00225160 [Amborella trichopoda]
Length=163

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 97/200 (49%), Gaps = 53/200 (27%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGP  631
            ++V +D+S ESF+AL+W +D+++          A   P  +V +V+ +P     +  PGP
Sbjct  11   LVVGLDESPESFHALEWTLDHIM-------CPLAGNSPFKLV-IVHAKPPVTSYLAMPGP  62

Query  630  N-LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETL-ILEGDAKDRICEAAEEM  457
              +E+ P++   +KKS E     ++ RA  IC+   V   T  ++EGDA++ +CEA E+ 
Sbjct  63   GAIEVLPLVEAGLKKSAE----RIVQRASDICKAKSVNDFTTEVVEGDARNVLCEAVEKH  118

Query  456  HVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLG  277
               +L VGS G G IK                                       RA LG
Sbjct  119  QATMLAVGSHGYGAIK---------------------------------------RAVLG  139

Query  276  SVSDYCAHHVHCPILIVKPP  217
            SVSDYC+HH HC ++IVK P
Sbjct  140  SVSDYCSHHAHCTVMIVKKP  159



>ref|XP_004953997.1| PREDICTED: uncharacterized protein C167.05-like [Setaria italica]
Length=162

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/204 (31%), Positives = 92/204 (45%), Gaps = 46/204 (23%)
 Frame = -2

Query  831  ATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPT-FG  655
            AT     V+VA+D S ES NAL+WA+DNL  R          + P  +   +N  P  FG
Sbjct  2    ATGNLASVVVAVDGSEESMNALRWALDNLRLRPDGELVVLHVQPPPNIAAGLNPAPIPFG  61

Query  654  PIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRIC  475
                  GP+    P   +A++  Q      +L  AL+IC    V  +T ++ GD K++IC
Sbjct  62   ------GPSGLEVPAFTQAIEAHQRRITQAILEHALKICSAKNVEVKTEVIVGDPKEKIC  115

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            EA    + DLLV+G R +G ++                                      
Sbjct  116  EATANRNADLLVMGCRAIGPLQ--------------------------------------  137

Query  294  CRAFLGSVSDYCAHHVHCPILIVK  223
             R FLGSVS+YC +HV CP++++K
Sbjct  138  -RMFLGSVSNYCINHVGCPVVVIK  160



>gb|ABK26351.1| unknown [Picea sitchensis]
Length=153

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 96/201 (48%), Gaps = 54/201 (27%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            K+MVA+DDS  S  AL+WA++NL    + S  +         + L + QP     ++   
Sbjct  6    KIMVAVDDSEFSHYALQWALNNL--HLFGSDVS---------LVLFHAQPL---AVFNSA  51

Query  633  PNLELT-PMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEM  457
              + +T P ++E +   Q+  + E+L+RA  IC +  V  ETL   GD KD IC+A E++
Sbjct  52   AIVGVTSPGLIETILLQQKQVSEEILARAKGICAKKNVIVETLSEIGDPKDVICDATEKL  111

Query  456  HVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLG  277
             +DLL+ GS G G +K                                       RAFLG
Sbjct  112  QIDLLITGSHGYGMLK---------------------------------------RAFLG  132

Query  276  SVSDYCAHHVHCPILIVKPPS  214
            SVS+YC  +  CP+L+++ PS
Sbjct  133  SVSNYCVQYAKCPVLVIRKPS  153



>gb|KHN25064.1| Universal stress protein A-like protein [Glycine soja]
Length=199

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/222 (33%), Positives = 103/222 (46%), Gaps = 67/222 (30%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL-------------LRRNYPSA--ATAADEIPAAMVTLV  676
            V+VA+D S ES NAL+WA++NL             L R  P+   + A D   A   T+ 
Sbjct  10   VLVAVDGSEESMNALRWALNNLKLTRFHRCSLLHHLPRPIPALHRSPAPDSTDAPSFTVF  69

Query  675  NVQ--PTFGPIIYPP-----GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRE----N  529
            +VQ  P+    + P      GP+    P    A++  Q+   + VL  AL IC E    +
Sbjct  70   HVQSPPSIATGLNPGAIPFGGPSDLEVPAFTAAIEAHQKRITNAVLDHALGICSEFNLTS  129

Query  528  KVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPV  349
            KVR   L+  GD K++ICEA ++++ D+LV+GSR  G IK                    
Sbjct  130  KVRTHVLV--GDPKEKICEAVQDLNADVLVMGSRAFGPIK--------------------  167

Query  348  IIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVK  223
                               R FLGSVS+YCAHH  CP++I+K
Sbjct  168  -------------------RMFLGSVSNYCAHHSPCPVIIIK  190



>ref|XP_006487496.1| PREDICTED: uncharacterized protein LOC102621599 isoform X2 [Citrus 
sinensis]
Length=161

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 96/207 (46%), Gaps = 53/207 (26%)
 Frame = -2

Query  831  ATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGP  652
            AT  T  ++V IDDS  S  AL+W +D+    +  +        P   + +V+ +P+   
Sbjct  2    ATAETQTMVVGIDDSEHSMYALQWTLDHFFANSTVN--------PPFKLVIVHAKPSPSS  53

Query  651  IIYPPGPNL-ELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETL-ILEGDAKDRI  478
            ++   GP   E+ P +   +KK     A+ V+ +A +IC    V    + ++EGDA++ +
Sbjct  54   VVGLAGPGAAEVLPYVDSDLKKI----AARVVEKAKEICSSKSVHDFVVEVVEGDARNIL  109

Query  477  CEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL*  298
            CEA E+ H  +LVVGS G G IK                                     
Sbjct  110  CEAVEKHHASILVVGSHGYGAIK-------------------------------------  132

Query  297  *CRAFLGSVSDYCAHHVHCPILIVKPP  217
              RA LGSVSDYCAHH HC ++IVK P
Sbjct  133  --RAVLGSVSDYCAHHAHCTVMIVKRP  157



>gb|EYU37244.1| hypothetical protein MIMGU_mgv1a026749mg [Erythranthe guttata]
Length=167

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 97/205 (47%), Gaps = 51/205 (25%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            K++VA+D   ES  AL W ++NLL  N+ +           ++ L    P   PI     
Sbjct  7    KILVAVDKGEESSYALSWCLENLLSENHQNYKDT-------LILLFAKTPL--PIYSGMD  57

Query  633  PNLELT-PMMVEAVKKSQEHNASEVLSRALQICRE--NKVRAETLILEGDAKDRICEAAE  463
                +T P ++ +V+K     A +V+ +A QIC++  +++  ET++  GD +D IC+ AE
Sbjct  58   TTGHVTSPSIIASVEKYANEVAEKVMCKATQICKDFNDQITMETMVEHGDPRDVICDVAE  117

Query  462  EMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAF  283
               VD LVVGSRG G IK                                       RAF
Sbjct  118  RFKVDFLVVGSRGYGIIK---------------------------------------RAF  138

Query  282  LGSVSDYCAHHVHCPILIVKPPSKE  208
            LGSVS++CA +V CP++IVK P  +
Sbjct  139  LGSVSNHCAQNVKCPVVIVKKPKSD  163



>gb|ADE77419.1| unknown [Picea sitchensis]
Length=153

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/201 (31%), Positives = 95/201 (47%), Gaps = 54/201 (27%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            K+MVA+DDS  S +AL+WA+ NL    Y S  +         + + + QP     ++   
Sbjct  6    KIMVAVDDSECSHHALQWALSNL--HLYGSDVS---------LVVFHAQPL---AVFNSA  51

Query  633  PNLELT-PMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEM  457
              + +T P ++E +   Q   +  +L+RA ++C +  V  ET+   GD KD IC+A +++
Sbjct  52   ATMGVTSPELIEIIVNQQRQVSEAILARAKEMCAQKNVTVETVSEIGDPKDGICDAIDKL  111

Query  456  HVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLG  277
             VDLL++GS G G +K                                       RAFLG
Sbjct  112  QVDLLIIGSHGYGMLK---------------------------------------RAFLG  132

Query  276  SVSDYCAHHVHCPILIVKPPS  214
            SVS+YC  H  CP+L+ K PS
Sbjct  133  SVSNYCVLHAKCPVLVTKKPS  153



>gb|EYU40765.1| hypothetical protein MIMGU_mgv1a025375mg [Erythranthe guttata]
Length=152

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 90/197 (46%), Gaps = 52/197 (26%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPG  634
            KVMVAID+S  S  ALKW +DNL            D +  + + +  VQP      Y   
Sbjct  3    KVMVAIDESDCSNYALKWTVDNL-----------RDSLIQSHLIIFTVQP-LSDYAYIHA  50

Query  633  PNLELTP-MMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEM  457
             +  LTP   + ++ ++++  A  +L RA  ICR N + AET    GD KD ICEA E+ 
Sbjct  51   SSFGLTPPEFLSSIHENRKKTALALLERAKDICRANGINAETTTEVGDPKDAICEAVEKQ  110

Query  456  HVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLG  277
            ++DLLV+GS   G +K                                       RA LG
Sbjct  111  NIDLLVIGSHNQGALK---------------------------------------RAILG  131

Query  276  SVSDYCAHHVHCPILIV  226
            SVS+YC H+  C +LIV
Sbjct  132  SVSNYCVHNAKCQVLIV  148



>ref|XP_004230297.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Solanum lycopersicum]
Length=166

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 98/205 (48%), Gaps = 55/205 (27%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP-  637
            K+++A+D+S ES  AL W I+N+L  N              ++ L +V P     +Y   
Sbjct  10   KILIAVDESEESIYALSWCIENILTGNSNDT----------LILLYSVPPR---AVYSTL  56

Query  636  -GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRE-NKVRAETLILEGDAKDRICEAAE  463
             G     +  ++  +++     A  V+ +A + C   N V+ ET++  GDA+D IC+AAE
Sbjct  57   DGSGYLFSSDILATMERYSSGVAQCVMEKAKRACEALNGVKVETIVEHGDARDVICQAAE  116

Query  462  EMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAF  283
            ++HVD+LV+GS G G IK                                       RAF
Sbjct  117  KLHVDMLVMGSHGYGVIK---------------------------------------RAF  137

Query  282  LGSVSDYCAHHVHCPILIVKPPSKE  208
            LGSVS++CA +V CP+LIVK P  +
Sbjct  138  LGSVSNHCAQNVKCPVLIVKKPKTD  162



>ref|XP_002980442.1| hypothetical protein SELMODRAFT_112416 [Selaginella moellendorffii]
 gb|EFJ18702.1| hypothetical protein SELMODRAFT_112416 [Selaginella moellendorffii]
Length=185

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 97/204 (48%), Gaps = 59/204 (29%)
 Frame = -2

Query  825  RTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPII  646
            R   KV+VAID+S ES  AL++A+D +++             P   + L++ Q  F P  
Sbjct  37   RKAKKVIVAIDESQESIRALRYALDTVVQ-------------PGDGLVLLHSQ--FMPHS  81

Query  645  Y--PPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRA-ETLILEGDAKDRIC  475
            Y  P GP   L   +V A     E+++  +L +A +IC +  V   E L+  GD +D IC
Sbjct  82   YVGPGGPGTTLR--LVLAFSIENENSSKVLLDKAKRICGDANVHHPELLMATGDPRDSIC  139

Query  474  EAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**  295
            +A E++H DLLV+GSRG G IK                                      
Sbjct  140  DAVEKIHADLLVMGSRGHGAIK--------------------------------------  161

Query  294  CRAFLGSVSDYCAHHVHCPILIVK  223
             R FLGSVSDYC H+  CP+LIV+
Sbjct  162  -RTFLGSVSDYCTHNAKCPVLIVR  184



>ref|XP_006423740.1| hypothetical protein CICLE_v10029454mg [Citrus clementina]
 ref|XP_006487494.1| PREDICTED: uncharacterized protein LOC102621316 [Citrus sinensis]
 gb|ESR36980.1| hypothetical protein CICLE_v10029454mg [Citrus clementina]
 gb|KDO50051.1| hypothetical protein CISIN_1g030516mg [Citrus sinensis]
Length=161

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 96/207 (46%), Gaps = 53/207 (26%)
 Frame = -2

Query  831  ATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGP  652
            AT  T  ++V IDDS +S  AL+W +D+    +  +        P   + +V+ +P+   
Sbjct  2    ATAETQTMVVGIDDSEQSTYALQWTLDHFFANSTVN--------PPFKLVIVHARPSPSA  53

Query  651  IIYPPGPN-LELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETL-ILEGDAKDRI  478
            +I   GP  +E+ P +    KK     A+ V+  A +IC    V    + ++EGDA++ +
Sbjct  54   VIGLAGPGAVEVLPHVDSDFKKI----AARVVEEAKEICSSKSVHDFVVEVVEGDARNIL  109

Query  477  CEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL*  298
            CEA E+ H  +LVVGS G G IK                                     
Sbjct  110  CEAVEKHHASILVVGSHGYGAIK-------------------------------------  132

Query  297  *CRAFLGSVSDYCAHHVHCPILIVKPP  217
              RA LGSVSDYCAHH HC ++IVK P
Sbjct  133  --RAVLGSVSDYCAHHAHCTVMIVKRP  157



>ref|XP_009110805.1| PREDICTED: universal stress protein A-like protein [Brassica 
rapa]
Length=171

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 91/209 (44%), Gaps = 65/209 (31%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNL------------LRRNYPSAATAADEIPAAMVTLVNVQ  667
            V+VA+D S  S  ALKWA+DNL            +    PS + AA   P  +       
Sbjct  10   VVVAVDGSEVSMEALKWALDNLKLSSSSSDSSFVVLHVQPSPSIAAGVSPGTI-------  62

Query  666  PTFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAK  487
              FG      GP+    P    A+++ Q+     +L  A QI  +  V  +T ++ GD K
Sbjct  63   -PFG------GPSGVEVPAFAAAIEQHQKRITDAILEHARQIYADRSVNVKTQVVVGDPK  115

Query  486  DRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIY  307
            D+ICE  E ++ DLLV+GSR  G IK                                  
Sbjct  116  DKICETVESLNADLLVLGSRAYGPIK----------------------------------  141

Query  306  IL**CRAFLGSVSDYCAHHVHCPILIVKP  220
                 R FLGSVS+YC +H HCP++I+KP
Sbjct  142  -----RMFLGSVSNYCTNHAHCPVVIIKP  165



>ref|XP_008369004.1| PREDICTED: uncharacterized protein LOC103432586 isoform X2 [Malus 
domestica]
Length=160

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/199 (31%), Positives = 92/199 (46%), Gaps = 51/199 (26%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGP  631
            +++  DDS ES  AL+W +D+  +          D  P  ++ +V+ +P+   ++   G 
Sbjct  8    MVIGADDSEESHYALEWTLDHFFK------PFGGDTAPFKLI-IVHAKPSVSSVVGFVGA  60

Query  630  NLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETL-ILEGDAKDRICEAAEEMH  454
              E+ P++   +KK     A+ V  +A + C    V    + ++EGDA++ +CEAAE  H
Sbjct  61   GAEILPIVDXDLKK----MAARVTEKAKEFCASKSVTDVVVEVMEGDARNVLCEAAERHH  116

Query  453  VDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGS  274
              +LVVGS G G IK                                       RAFLGS
Sbjct  117  ASILVVGSHGYGAIK---------------------------------------RAFLGS  137

Query  273  VSDYCAHHVHCPILIVKPP  217
            VSDYCAH  HC ++IVK P
Sbjct  138  VSDYCAHQAHCTVMIVKKP  156



>ref|XP_003570587.1| PREDICTED: uncharacterized protein C167.05 isoform X2 [Brachypodium 
distachyon]
Length=164

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 95/212 (45%), Gaps = 60/212 (28%)
 Frame = -2

Query  834  TATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQP---  664
            T       V+VA+D S ES  AL+WA+D++  R            P   + +++VQP   
Sbjct  3    TGGGNLGSVVVAVDGSEESMKALRWALDSVRLR------------PDGALVVLHVQPRPG  50

Query  663  -----TFGPIIYPPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILE  499
                   GPI +  GP     P   +A++  Q      +L  AL+IC E  V  +T ++ 
Sbjct  51   IAAGLNPGPIPFG-GPREVEVPAFTQAIEAHQRRITEAILEHALKICAEKNVEVKTEVVV  109

Query  498  GDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**V  319
            GD K++ICE A E+  DLLV+GSR +G +K                              
Sbjct  110  GDPKEKICEVAAELKADLLVMGSRAIGPVK------------------------------  139

Query  318  RSIYIL**CRAFLGSVSDYCAHHVHCPILIVK  223
                     R FLGSVS+YC + V CP++++K
Sbjct  140  ---------RMFLGSVSNYCINSVGCPVVVIK  162



>ref|XP_008451574.1| PREDICTED: uncharacterized protein LOC103492814 [Cucumis melo]
Length=162

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 97/207 (47%), Gaps = 52/207 (25%)
 Frame = -2

Query  831  ATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGP  652
            AT     ++V IDDS  S  AL+W +D+LL    P  +      P  ++ +V+ +P+   
Sbjct  2    ATGEKQVMVVGIDDSAHSLYALEWTLDHLLVPISPVNS------PFKLI-VVHAKPSASS  54

Query  651  IIYPPGPNL-ELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETL-ILEGDAKDRI  478
             I   GP   E+ P +   +KK     A+ V+ +A +IC    V    L ++EGDA++ +
Sbjct  55   AISLAGPGAAEVLPYVDSDLKKI----AARVIEKAKEICLARSVHDVVLEVIEGDARNVL  110

Query  477  CEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL*  298
            CEA E+ H  +LVVGS G G IK                                     
Sbjct  111  CEAVEKHHASVLVVGSHGYGAIK-------------------------------------  133

Query  297  *CRAFLGSVSDYCAHHVHCPILIVKPP  217
              RA LGSVSDYCAHH HC ++IVK P
Sbjct  134  --RAVLGSVSDYCAHHAHCTVMIVKKP  158



>ref|XP_004136030.1| PREDICTED: universal stress protein MJ0531-like [Cucumis sativus]
 ref|XP_004173164.1| PREDICTED: universal stress protein MJ0531-like [Cucumis sativus]
 gb|KGN44933.1| hypothetical protein Csa_7G396480 [Cucumis sativus]
Length=162

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 97/207 (47%), Gaps = 52/207 (25%)
 Frame = -2

Query  831  ATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGP  652
            AT     ++V IDDS  S  AL+W +D+LL    P  +      P  ++ +V+ +P+   
Sbjct  2    ATGEKQVMVVGIDDSAHSLYALEWTLDHLLVPTSPVNS------PFKLI-IVHAKPSASS  54

Query  651  IIYPPGPNL-ELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETL-ILEGDAKDRI  478
             +   GP   E+ P +   +KK     A+ V+ +A ++C    V    L ++EGDA++ +
Sbjct  55   AVSLAGPGAAEVLPYVDSDLKKI----AARVIEKAKELCLARSVHDVLLEVIEGDARNVL  110

Query  477  CEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL*  298
            CEA E+ H  +LVVGS G G IK                                     
Sbjct  111  CEAVEKHHASMLVVGSHGYGAIK-------------------------------------  133

Query  297  *CRAFLGSVSDYCAHHVHCPILIVKPP  217
              RA LGSVSDYCAHH HC ++IVK P
Sbjct  134  --RAVLGSVSDYCAHHAHCTVMIVKKP  158



>ref|XP_009630150.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Nicotiana tomentosiformis]
Length=166

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 99/202 (49%), Gaps = 55/202 (27%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP-  637
            K++VA+D+S ES  AL W I+N++  N   A          ++ L ++ P     +Y   
Sbjct  10   KILVAVDESEESTYALSWCIENIITGNTNDA----------LILLYSIPPR---AVYSSL  56

Query  636  -GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRE-NKVRAETLILEGDAKDRICEAAE  463
             G     +  ++  +++     A  V+ +A ++C++ + V+ ET++  GDA+D IC+ AE
Sbjct  57   DGTGYLFSSDILATMERYSNEVAQCVMEKAKRLCKDLDGVKVETIVERGDARDVICQVAE  116

Query  462  EMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAF  283
             +HVD+LV+GS G G IK                                       RAF
Sbjct  117  RLHVDMLVMGSHGYGVIK---------------------------------------RAF  137

Query  282  LGSVSDYCAHHVHCPILIVKPP  217
            LGSVS++CA +V CP+LIVK P
Sbjct  138  LGSVSNHCAQNVKCPVLIVKKP  159



>gb|ABK21517.1| unknown [Picea sitchensis]
Length=172

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 92/195 (47%), Gaps = 41/195 (21%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGP  631
            V+VA+D+S ES +AL WA   LL    P       ++P   + LV++QP      +  GP
Sbjct  8    VVVAVDESEESMSALLWACKYLLPAQCPHGNNT-QQLPCKFI-LVHIQPD---TCFAAGP  62

Query  630  NLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRICEAAEEMHV  451
                +  +V  ++        ++  RAL ICR+N V+AET +  G+ K R+CEAA ++ V
Sbjct  63   AYIASEDLVNLLEMDARRTTQKIFKRALCICRDNNVKAETEVFVGEVKQRLCEAAGKLGV  122

Query  450  DLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLGSV  271
            D LV+GS   G     FF                  KRM             CR  +GS+
Sbjct  123  DFLVMGSHSHG-----FF------------------KRM-------------CRVIVGSL  146

Query  270  SDYCAHHVHCPILIV  226
            SDYC     CP+++V
Sbjct  147  SDYCCQKAACPVVVV  161



>ref|XP_009804591.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Nicotiana sylvestris]
Length=167

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 100/202 (50%), Gaps = 54/202 (27%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPP-  637
            K++VA+D+S ES  AL W I+N+      +     D    A++ L ++ P     +Y   
Sbjct  10   KILVAVDESEESTYALSWCIENIF-----TGGNTND----ALILLYSIPPR---AVYSSL  57

Query  636  -GPNLELTPMMVEAVKKSQEHNASEVLSRALQICRE-NKVRAETLILEGDAKDRICEAAE  463
             G     +  ++  +++     A  V+ +A ++C++ + V+ ET++  GDA+D IC+AAE
Sbjct  58   DGTGYLFSSDILATMERYSNDVAQCVMEKAKRLCKDLDGVKVETIVERGDARDVICQAAE  117

Query  462  EMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAF  283
             +HVD+LV+GS G G IK                                       RAF
Sbjct  118  RLHVDMLVMGSHGYGVIK---------------------------------------RAF  138

Query  282  LGSVSDYCAHHVHCPILIVKPP  217
            LGSVS++CA +V CP+LIVK P
Sbjct  139  LGSVSNHCAQNVKCPVLIVKKP  160



>ref|NP_001148498.1| ethylene-responsive protein [Zea mays]
 gb|ACG31736.1| ethylene-responsive protein [Zea mays]
 tpg|DAA58186.1| TPA: ethylene-responsive protein [Zea mays]
Length=173

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 71/205 (35%), Positives = 99/205 (48%), Gaps = 60/205 (29%)
 Frame = -2

Query  813  KVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIY---  643
            KVMVA+D+S  S +AL+WA+ NL       A T A   P  +V  + VQP F P+ Y   
Sbjct  18   KVMVAVDESECSRHALEWALRNL-------APTLA---PPLLV--LTVQPHF-PLGYVSA  64

Query  642  -----PPGPNLELTPMMVEAVKKSQEHNASEVLSRALQICRENKVRAETLILEGDAKDRI  478
                 P G    + P ++ ++++ Q     E+L +A  IC E+ V  E ++  GDAK+ I
Sbjct  65   ASFGAPLGTVPPVAPELIRSMQEQQRELTQELLDKARAICAEHGVAVEAIVEVGDAKEVI  124

Query  477  CEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL*  298
            CE AE+ +VDLLV+GS   G I+                                     
Sbjct  125  CEVAEKKNVDLLVLGSHSRGPIQ-------------------------------------  147

Query  297  *CRAFLGSVSDYCAHHVHCPILIVK  223
              R FLGSVS+YC HH  CP+L+VK
Sbjct  148  --RLFLGSVSNYCVHHSKCPVLVVK  170



>ref|XP_009595892.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
tomentosiformis]
Length=158

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 98/205 (48%), Gaps = 56/205 (27%)
 Frame = -2

Query  810  VMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIPAAMVTLVNVQPTFGPIIYPPGP  631
            ++ A+DDS  SF AL+W +D+     +PS +T++ ++      +V+ +P    +I   GP
Sbjct  7    MIFALDDSDHSFYALEWTLDHF----FPSPSTSSFKL-----IIVHAKPNPTSVIGVVGP  57

Query  630  NLELTPMMVEA-VKKSQEHNASEVLSRALQICRENKV-RAETLILEGDAKDRICEAAEEM  457
                   MVE  +KK+    A +++ RA ++ +   V      ILEGDA++ IC+A E  
Sbjct  58   GTTDMYTMVETDIKKT----AQKIIDRAKELSKSKGVANVACEILEGDARNVICDAVERH  113

Query  456  HVDLLVVGSRGLGKIKR*FFNLICFP*SRSILIWPVIIKRMFI**VRSIYIL**CRAFLG  277
            H  LLV+GS G G  K                                       RA LG
Sbjct  114  HASLLVMGSHGYGTFK---------------------------------------RAVLG  134

Query  276  SVSDYCAHHVHCPILIVKPPSKEPN  202
            SVSDYC+HH HC ++IVK P  +PN
Sbjct  135  SVSDYCSHHAHCSVMIVKKP--KPN  157



>ref|XP_008389277.1| PREDICTED: universal stress protein A-like protein [Malus domestica]
Length=185

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 99/226 (44%), Gaps = 58/226 (26%)
 Frame = -2

Query  876  GEAMHSQVPTVKETTATRTTWKVMVAIDDSGESFNALKWAIDNLLRRNYPSAATAADEIP  697
            GEA+      + E  A     KVMVAID+S  S  AL W +DNL            D I 
Sbjct  2    GEAIPRGEERMGEVVAKGAEKKVMVAIDESECSHYALMWVLDNL-----------KDSIT  50

Query  696  AA-MVTLVNVQPTFGPIIYPP--GPNLELTPM-----MVEAVKKSQEHNASEVLSRALQI  541
             + ++  +   P+ G I +    G      PM      V + +++Q   A  +L +A QI
Sbjct  51   NSPLIIFMAQTPSNGNITFSASLGAARMYCPMSSSQEFVNSSQENQRKFALALLEKAKQI  110

Query  540  CRENKVRAETLILEGDAKDRICEAAEEMHVDLLVVGSRGLGKIKR*FFNLICFP*SRSIL  361
            C    V AET+   GD K+ IC+A ++  + LLVVG RGLGKIK                
Sbjct  111  CASRGVNAETVTEVGDPKEAICDAVKKHGIKLLVVGERGLGKIK----------------  154

Query  360  IWPVIIKRMFI**VRSIYIL**CRAFLGSVSDYCAHHVHCPILIVK  223
                                   RA LGSVSDYC  H +CP+L+VK
Sbjct  155  -----------------------RAILGSVSDYCVQHANCPVLVVK  177



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2448657046752