BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18444_g1_i1 len=979 path=[1089:0-275 1365:276-978]

Length=979
                                                                      Score     E

ref|XP_010262258.1|  PREDICTED: putative DNA-binding protein ESCA...    243   6e-75   
ref|XP_002312579.2|  hypothetical protein POPTR_0008s16440g             243   2e-74   Populus trichocarpa [western balsam poplar]
ref|XP_011029905.1|  PREDICTED: putative DNA-binding protein ESCA...    241   5e-74   
ref|XP_002529315.1|  DNA binding protein, putative                      241   6e-74   Ricinus communis
ref|XP_006354520.1|  PREDICTED: putative DNA-binding protein ESCA...    239   2e-73   
ref|XP_004247701.1|  PREDICTED: putative DNA-binding protein ESCA...    236   5e-72   
ref|XP_007035040.1|  AT-hook motif nuclear localized protein 20         236   5e-72   
ref|XP_002284519.1|  PREDICTED: putative DNA-binding protein ESCA...    233   3e-71   Vitis vinifera
ref|XP_011091221.1|  PREDICTED: putative DNA-binding protein ESCA...    232   5e-71   
ref|XP_009589526.1|  PREDICTED: putative DNA-binding protein ESCA...    236   9e-71   
ref|XP_009775204.1|  PREDICTED: putative DNA-binding protein ESCA...    232   1e-70   
ref|XP_006420137.1|  hypothetical protein CICLE_v10005603mg             232   1e-70   
ref|XP_010274873.1|  PREDICTED: putative DNA-binding protein ESCA...    233   7e-70   
ref|XP_006477506.1|  PREDICTED: putative DNA-binding protein ESCA...    233   8e-70   
ref|XP_011030530.1|  PREDICTED: putative DNA-binding protein ESCA...    230   1e-69   
ref|XP_010104063.1|  hypothetical protein L484_008144                   231   2e-69   
emb|CDO99189.1|  unnamed protein product                                229   2e-69   
ref|XP_008801301.1|  PREDICTED: putative DNA-binding protein ESCA...    228   3e-69   
ref|XP_007144108.1|  hypothetical protein PHAVU_007G129400g             229   3e-69   
gb|ABZ89182.1|  putative protein                                        225   1e-67   Coffea canephora [robusta coffee]
ref|XP_002314642.2|  hypothetical protein POPTR_0010s08500g             224   3e-67   Populus trichocarpa [western balsam poplar]
ref|XP_004296621.1|  PREDICTED: putative DNA-binding protein ESCA...    223   4e-67   
gb|ADY38789.1|  DNA-binding protein                                     223   7e-67   
ref|XP_009394683.1|  PREDICTED: putative DNA-binding protein ESCA...    222   1e-66   
emb|CBI35166.3|  unnamed protein product                                221   2e-66   
ref|XP_006606853.1|  PREDICTED: putative DNA-binding protein ESCA...    223   6e-66   
ref|XP_010024974.1|  PREDICTED: putative DNA-binding protein ESCA...    219   1e-65   
ref|XP_007226723.1|  hypothetical protein PRUPE_ppa019745mg             218   7e-65   
gb|KHN01050.1|  Putative DNA-binding protein ESCAROLA                   218   9e-65   
ref|XP_008224392.1|  PREDICTED: putative DNA-binding protein ESCA...    217   2e-64   
ref|XP_004171657.1|  PREDICTED: putative DNA-binding protein ESCA...    217   2e-64   
ref|XP_008439362.1|  PREDICTED: putative DNA-binding protein ESCA...    217   2e-64   
ref|XP_004134419.1|  PREDICTED: putative DNA-binding protein ESCA...    217   3e-64   
gb|KGN56888.1|  hypothetical protein Csa_3G141840                       216   3e-64   
ref|XP_006606925.1|  PREDICTED: putative DNA-binding protein ESCA...    219   3e-64   
ref|XP_010918771.1|  PREDICTED: putative DNA-binding protein ESCA...    214   1e-63   
emb|CAN61523.1|  hypothetical protein VITISV_016751                     214   1e-63   Vitis vinifera
ref|XP_002271606.1|  PREDICTED: putative DNA-binding protein ESCA...    214   1e-63   Vitis vinifera
gb|ABL63119.1|  AT-hook DNA-binding protein                             213   3e-63   Catharanthus roseus [chatas]
gb|KCW61537.1|  hypothetical protein EUGRSUZ_H04257                     212   8e-63   
ref|XP_006589299.1|  PREDICTED: putative DNA-binding protein ESCA...    213   1e-62   
ref|XP_007145832.1|  hypothetical protein PHAVU_007G271800g             211   1e-62   
gb|KHN30735.1|  Putative DNA-binding protein ESCAROLA                   211   2e-62   
ref|XP_010435119.1|  PREDICTED: putative DNA-binding protein ESCA...    211   3e-62   
ref|XP_009401827.1|  PREDICTED: putative DNA-binding protein ESCA...    209   7e-62   
ref|XP_010440458.1|  PREDICTED: putative DNA-binding protein ESCA...    209   9e-62   
ref|NP_567432.1|  AT-hook motif nuclear-localized protein 20            209   1e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010026866.1|  PREDICTED: putative DNA-binding protein ESCA...    209   3e-61   
ref|XP_009379018.1|  PREDICTED: putative DNA-binding protein ESCA...    208   3e-61   
emb|CDY12779.1|  BnaC04g28620D                                          207   5e-61   
gb|AAM65129.1|  putative DNA-binding protein                            207   6e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008391057.1|  PREDICTED: putative DNA-binding protein ESCA...    207   7e-61   
ref|XP_008794313.1|  PREDICTED: putative DNA-binding protein ESCA...    207   7e-61   
ref|XP_010450033.1|  PREDICTED: putative DNA-binding protein ESCA...    207   1e-60   
ref|XP_006285829.1|  hypothetical protein CARUB_v10007306mg             206   3e-60   
ref|XP_009383960.1|  PREDICTED: putative DNA-binding protein ESCA...    203   2e-59   
ref|XP_010262897.1|  PREDICTED: putative DNA-binding protein ESCA...    206   2e-59   
ref|XP_004302076.1|  PREDICTED: putative DNA-binding protein ESCA...    204   2e-59   
ref|XP_002870310.1|  hypothetical protein ARALYDRAFT_493459             202   3e-59   
ref|XP_010257112.1|  PREDICTED: putative DNA-binding protein ESCA...    205   1e-58   
ref|XP_004139388.1|  PREDICTED: putative DNA-binding protein ESCA...    201   2e-58   
ref|XP_008456342.1|  PREDICTED: putative DNA-binding protein ESCA...    201   3e-58   
ref|XP_006588553.1|  PREDICTED: putative DNA-binding protein ESCA...    199   3e-58   
ref|XP_006350955.1|  PREDICTED: putative DNA-binding protein ESCA...    201   3e-58   
ref|XP_004249915.1|  PREDICTED: putative DNA-binding protein ESCA...    201   4e-58   
ref|XP_006414705.1|  hypothetical protein EUTSA_v10025929mg             200   4e-58   
gb|KFK22136.1|  hypothetical protein AALP_AAs47043U000100               200   4e-58   
ref|XP_009139507.1|  PREDICTED: putative DNA-binding protein ESCA...    199   9e-58   
gb|KEH42696.1|  AT hook motif DNA-binding family protein                200   1e-57   
ref|XP_007030480.1|  AT-hook motif nuclear localized protein 20         199   1e-57   
gb|KDP23697.1|  hypothetical protein JCGZ_23530                         198   2e-57   
ref|XP_010102254.1|  hypothetical protein L484_024535                   199   2e-57   
gb|KEH41146.1|  AT hook motif DNA-binding family protein                200   2e-57   
ref|XP_010940763.1|  PREDICTED: putative DNA-binding protein ESCA...    200   3e-57   
emb|CDY23160.1|  BnaA04g05990D                                          197   4e-57   
dbj|BAK02851.1|  predicted protein                                      197   5e-57   
gb|AFW74083.1|  DNA-binding protein                                     196   7e-57   
ref|XP_010935866.1|  PREDICTED: putative DNA-binding protein ESCA...    197   8e-57   
ref|XP_006846339.1|  hypothetical protein AMTR_s00012p00257450          197   9e-57   
gb|EMS64253.1|  hypothetical protein TRIUR3_00437                       197   1e-56   
ref|XP_002319649.1|  DNA-binding family protein                         196   1e-56   Populus trichocarpa [western balsam poplar]
ref|XP_009623613.1|  PREDICTED: putative DNA-binding protein ESCA...    196   2e-56   
ref|XP_004497856.1|  PREDICTED: putative DNA-binding protein ESCA...    197   2e-56   
ref|XP_011038532.1|  PREDICTED: putative DNA-binding protein ESCA...    195   3e-56   
gb|KDP40294.1|  hypothetical protein JCGZ_02292                         192   4e-56   
ref|XP_008780228.1|  PREDICTED: putative DNA-binding protein ESCA...    194   7e-56   
ref|NP_001150826.1|  DNA-binding protein                                193   7e-56   Zea mays [maize]
tpg|DAA48555.1|  TPA: hypothetical protein ZEAMMB73_420043              194   8e-56   
ref|XP_003570419.1|  PREDICTED: putative DNA-binding protein ESCA...    193   1e-55   
ref|XP_006487869.1|  PREDICTED: putative DNA-binding protein ESCA...    194   2e-55   
ref|XP_006442718.1|  hypothetical protein CICLE_v10023369mg             193   3e-55   
ref|XP_004974243.1|  PREDICTED: putative DNA-binding protein ESCA...    192   3e-55   
ref|XP_004954422.1|  PREDICTED: putative DNA-binding protein ESCA...    192   3e-55   
ref|XP_009784464.1|  PREDICTED: putative DNA-binding protein ESCA...    193   4e-55   
ref|XP_008787555.1|  PREDICTED: putative DNA-binding protein ESCA...    193   1e-54   
ref|XP_004956262.1|  PREDICTED: putative DNA-binding protein ESCA...    189   4e-54   
ref|XP_009384565.1|  PREDICTED: putative DNA-binding protein ESCA...    188   5e-54   
ref|NP_001048546.1|  Os02g0820800                                       188   8e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009386251.1|  PREDICTED: putative DNA-binding protein ESCA...    190   8e-54   
ref|XP_009372143.1|  PREDICTED: putative DNA-binding protein ESCA...    189   9e-54   
ref|XP_010694781.1|  PREDICTED: putative DNA-binding protein ESCA...    189   9e-54   
ref|XP_003536146.1|  PREDICTED: putative DNA-binding protein ESCA...    188   1e-53   
gb|EAZ06834.1|  hypothetical protein OsI_29071                          187   1e-53   Oryza sativa Indica Group [Indian rice]
emb|CAN75757.1|  hypothetical protein VITISV_028561                     189   1e-53   Vitis vinifera
emb|CBI31637.3|  unnamed protein product                                189   2e-53   
ref|XP_010552065.1|  PREDICTED: putative DNA-binding protein ESCA...    190   2e-53   
ref|XP_008370731.1|  PREDICTED: putative DNA-binding protein ESCA...    188   2e-53   
ref|XP_010658536.1|  PREDICTED: putative DNA-binding protein ESCA...    189   3e-53   
gb|KDO42746.1|  hypothetical protein CISIN_1g040245mg                   187   3e-53   
ref|XP_009373988.1|  PREDICTED: putative DNA-binding protein ESCA...    188   3e-53   
ref|NP_001062524.1|  Os08g0563200                                       186   4e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004495454.1|  PREDICTED: putative DNA-binding protein ESCA...    188   7e-53   
ref|XP_003576887.1|  PREDICTED: putative DNA-binding protein ESCA...    186   7e-53   
ref|XP_007144002.1|  hypothetical protein PHAVU_007G120900g             186   7e-53   
dbj|BAJ94293.1|  predicted protein                                      187   8e-53   
ref|XP_003556450.2|  PREDICTED: putative DNA-binding protein ESCA...    186   1e-52   
ref|XP_006601994.1|  PREDICTED: putative DNA-binding protein ESCA...    186   3e-52   
ref|XP_009351431.1|  PREDICTED: putative DNA-binding protein ESCA...    185   4e-52   
ref|XP_008388703.1|  PREDICTED: putative DNA-binding protein ESCA...    185   5e-52   
ref|XP_006827517.1|  hypothetical protein AMTR_s00009p00189120          184   5e-52   
ref|XP_002521959.1|  DNA binding protein, putative                      184   6e-52   Ricinus communis
gb|EPS65852.1|  hypothetical protein M569_08925                         184   6e-52   
ref|NP_001151240.1|  DNA-binding protein                                183   7e-52   Zea mays [maize]
ref|XP_004161914.1|  PREDICTED: putative DNA-binding protein ESCA...    183   7e-52   
ref|XP_003590930.1|  DNA-binding protein                                184   9e-52   
ref|XP_008461695.1|  PREDICTED: putative DNA-binding protein ESCA...    183   1e-51   
ref|XP_008371927.1|  PREDICTED: putative DNA-binding protein ESCA...    184   2e-51   
ref|XP_009364460.1|  PREDICTED: putative DNA-binding protein ESCA...    182   4e-51   
ref|XP_008218304.1|  PREDICTED: putative DNA-binding protein ESCA...    182   9e-51   
gb|KEH34733.1|  AT hook motif DNA-binding family protein                182   1e-50   
gb|AFK41919.1|  unknown                                                 181   1e-50   
ref|XP_004147679.1|  PREDICTED: putative DNA-binding protein ESCA...    179   2e-50   
ref|XP_010923237.1|  PREDICTED: putative DNA-binding protein ESCA...    181   3e-50   
ref|XP_010527388.1|  PREDICTED: putative DNA-binding protein ESCA...    178   1e-49   
ref|XP_006655164.1|  PREDICTED: putative DNA-binding protein ESCA...    179   1e-49   
ref|XP_007218339.1|  hypothetical protein PRUPE_ppa008610mg             179   1e-49   
ref|XP_008233653.1|  PREDICTED: putative DNA-binding protein ESCA...    179   1e-49   
ref|XP_007141404.1|  hypothetical protein PHAVU_008G192600g             178   1e-49   
ref|XP_009402946.1|  PREDICTED: putative DNA-binding protein ESCA...    179   1e-49   
ref|XP_009343806.1|  PREDICTED: putative DNA-binding protein ESCA...    179   1e-49   
ref|XP_006591349.1|  PREDICTED: putative DNA-binding protein ESCA...    178   1e-49   
ref|XP_009607803.1|  PREDICTED: putative DNA-binding protein ESCA...    179   1e-49   
ref|XP_010032377.1|  PREDICTED: putative DNA-binding protein ESCA...    179   2e-49   
ref|XP_008777391.1|  PREDICTED: putative DNA-binding protein ESCA...    178   2e-49   
ref|NP_001141263.1|  hypothetical protein                               177   3e-49   Zea mays [maize]
ref|XP_007206474.1|  hypothetical protein PRUPE_ppa018950mg             177   3e-49   
ref|XP_009409024.1|  PREDICTED: putative DNA-binding protein ESCA...    178   4e-49   
ref|XP_009123977.1|  PREDICTED: putative DNA-binding protein ESCA...    177   4e-49   
emb|CDY49327.1|  BnaA05g32890D                                          177   4e-49   
ref|XP_009611172.1|  PREDICTED: putative DNA-binding protein ESCA...    176   5e-49   
gb|KCW60423.1|  hypothetical protein EUGRSUZ_H03144                     173   8e-49   
ref|XP_010096609.1|  hypothetical protein L484_025356                   176   1e-48   
ref|XP_009774038.1|  PREDICTED: putative DNA-binding protein ESCA...    177   1e-48   
ref|XP_009757136.1|  PREDICTED: putative DNA-binding protein ESCA...    175   1e-48   
ref|XP_010907805.1|  PREDICTED: putative DNA-binding protein ESCA...    176   2e-48   
ref|XP_004503162.1|  PREDICTED: putative DNA-binding protein ESCA...    175   2e-48   
gb|KFK37871.1|  hypothetical protein AALP_AA3G040100                    174   5e-48   
emb|CDY64701.1|  BnaCnng44570D                                          174   7e-48   
ref|XP_007009270.1|  AT-hook protein of GA feedback 2                   175   9e-48   
ref|XP_006408178.1|  hypothetical protein EUTSA_v10021166mg             174   1e-47   
ref|XP_006435633.1|  hypothetical protein CICLE_v10032034mg             174   1e-47   
ref|XP_010497513.1|  PREDICTED: putative DNA-binding protein ESCA...    170   2e-47   
ref|XP_007163438.1|  hypothetical protein PHAVU_001G234600g             172   2e-47   
ref|XP_011085041.1|  PREDICTED: putative DNA-binding protein ESCA...    171   6e-47   
ref|XP_002312113.2|  hypothetical protein POPTR_0008s05890g             172   7e-47   Populus trichocarpa [western balsam poplar]
ref|XP_006847733.1|  hypothetical protein AMTR_s00149p00093420          170   1e-46   
ref|XP_004495563.1|  PREDICTED: putative DNA-binding protein ESCA...    171   1e-46   
ref|XP_004952401.1|  PREDICTED: putative DNA-binding protein ESCA...    171   1e-46   
ref|XP_010463937.1|  PREDICTED: putative DNA-binding protein ESCA...    171   1e-46   
ref|XP_010485835.1|  PREDICTED: putative DNA-binding protein ESCA...    171   1e-46   
ref|XP_010416191.1|  PREDICTED: putative DNA-binding protein ESCA...    171   1e-46   
ref|XP_002882363.1|  hypothetical protein ARALYDRAFT_477713             171   2e-46   
ref|NP_566232.1|  AT-hook motif nuclear-localized protein               171   2e-46   Arabidopsis thaliana [mouse-ear cress]
gb|ACU24276.1|  unknown                                                 169   2e-46   Glycine max [soybeans]
dbj|BAK03205.1|  predicted protein                                      170   2e-46   
ref|XP_011002630.1|  PREDICTED: putative DNA-binding protein ESCA...    171   3e-46   
gb|AAY86771.1|  putative DNA-binding protein                            170   3e-46   Noccaea caerulescens
ref|XP_011033055.1|  PREDICTED: putative DNA-binding protein ESCA...    170   4e-46   
ref|XP_003534486.1|  PREDICTED: putative DNA-binding protein ESCA...    168   5e-46   
ref|XP_002451872.1|  hypothetical protein SORBIDRAFT_04g009050          170   5e-46   Sorghum bicolor [broomcorn]
ref|XP_008803114.1|  PREDICTED: putative DNA-binding protein ESCA...    169   6e-46   
ref|NP_001146992.1|  DNA binding protein                                169   6e-46   Zea mays [maize]
ref|XP_003573204.1|  PREDICTED: putative DNA-binding protein ESCA...    169   6e-46   
ref|XP_002315208.2|  hypothetical protein POPTR_0010s20780g             170   7e-46   Populus trichocarpa [western balsam poplar]
ref|XP_006576099.1|  PREDICTED: putative DNA-binding protein ESCA...    167   7e-46   
ref|XP_002489068.1|  hypothetical protein SORBIDRAFT_0169s002010        165   1e-45   Sorghum bicolor [broomcorn]
gb|KDP44918.1|  hypothetical protein JCGZ_01418                         169   1e-45   
ref|NP_001046754.1|  Os02g0448000                                       168   1e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003568662.1|  PREDICTED: putative DNA-binding protein ESCA...    168   2e-45   
ref|XP_010934543.1|  PREDICTED: putative DNA-binding protein ESCA...    168   2e-45   
ref|XP_009384866.1|  PREDICTED: putative DNA-binding protein ESCA...    168   2e-45   
ref|XP_006649829.1|  PREDICTED: putative DNA-binding protein ESCA...    165   5e-45   
ref|XP_004163216.1|  PREDICTED: putative DNA-binding protein ESCA...    166   6e-45   
gb|KCW71795.1|  hypothetical protein EUGRSUZ_E00284                     166   6e-45   
ref|XP_010055327.1|  PREDICTED: putative DNA-binding protein ESCA...    166   6e-45   
ref|XP_010920512.1|  PREDICTED: putative DNA-binding protein ESCA...    166   8e-45   
ref|NP_001049682.1|  Os03g0270000                                       165   8e-45   Oryza sativa Japonica Group [Japonica rice]
gb|AES80473.2|  AT hook motif DNA-binding family protein                165   9e-45   
ref|XP_008229461.1|  PREDICTED: putative DNA-binding protein ESCA...    165   9e-45   
gb|AFK38460.1|  unknown                                                 165   1e-44   
ref|XP_009382863.1|  PREDICTED: putative DNA-binding protein ESCA...    166   1e-44   
ref|XP_004307477.1|  PREDICTED: putative DNA-binding protein ESCA...    166   1e-44   
ref|XP_003624255.1|  AT-hook DNA-binding protein                        166   1e-44   
ref|XP_003571267.1|  PREDICTED: putative DNA-binding protein ESCA...    165   1e-44   
ref|XP_008785537.1|  PREDICTED: putative DNA-binding protein ESCA...    166   2e-44   
ref|XP_008801621.1|  PREDICTED: putative DNA-binding protein ESCA...    165   2e-44   
gb|ABL63121.1|  AT-hook DNA-binding protein                             165   2e-44   Catharanthus roseus [chatas]
ref|XP_002524209.1|  ESC, putative                                      166   2e-44   Ricinus communis
gb|KCW77938.1|  hypothetical protein EUGRSUZ_D02188                     164   3e-44   
emb|CDP00129.1|  unnamed protein product                                165   3e-44   
ref|XP_002279677.2|  PREDICTED: putative DNA-binding protein ESCA...    163   3e-44   Vitis vinifera
ref|XP_004305833.1|  PREDICTED: putative DNA-binding protein ESCA...    163   3e-44   
ref|XP_007139682.1|  hypothetical protein PHAVU_008G050100g             163   4e-44   
ref|XP_004150655.1|  PREDICTED: putative DNA-binding protein ESCA...    164   4e-44   
gb|KGN61619.1|  hypothetical protein Csa_2G190760                       164   4e-44   
gb|AIV43385.1|  AHL protein                                             162   5e-44   
ref|XP_006363711.1|  PREDICTED: putative DNA-binding protein ESCA...    163   6e-44   
ref|XP_010053603.1|  PREDICTED: putative DNA-binding protein ESCA...    163   6e-44   
ref|XP_004490915.1|  PREDICTED: putative DNA-binding protein ESCA...    164   8e-44   
ref|XP_010558745.1|  PREDICTED: putative DNA-binding protein ESCA...    163   8e-44   
ref|XP_009103966.1|  PREDICTED: putative DNA-binding protein ESCA...    162   8e-44   
emb|CDY60321.1|  BnaCnng36000D                                          163   9e-44   
ref|XP_010102152.1|  hypothetical protein L484_021386                   162   9e-44   
dbj|BAJ98882.1|  predicted protein                                      162   1e-43   
dbj|BAK02723.1|  predicted protein                                      162   2e-43   
ref|XP_009419257.1|  PREDICTED: putative DNA-binding protein ESCA...    162   2e-43   
emb|CAN83987.1|  hypothetical protein VITISV_032602                     162   2e-43   Vitis vinifera
ref|XP_009347388.1|  PREDICTED: putative DNA-binding protein ESCA...    162   2e-43   
gb|KDO60958.1|  hypothetical protein CISIN_1g040216mg                   160   3e-43   
ref|XP_009103959.1|  PREDICTED: putative DNA-binding protein ESCA...    162   3e-43   
ref|XP_007048865.1|  AT-hook DNA-binding family protein                 160   3e-43   
ref|XP_006299205.1|  hypothetical protein CARUB_v10015351mg             162   3e-43   
ref|XP_004133943.1|  PREDICTED: putative DNA-binding protein ESCA...    160   3e-43   
ref|XP_008460731.1|  PREDICTED: putative DNA-binding protein ESCA...    161   3e-43   
ref|XP_008377132.1|  PREDICTED: putative DNA-binding protein ESCA...    161   4e-43   
ref|XP_002527105.1|  DNA binding protein, putative                      161   4e-43   Ricinus communis
emb|CDP13007.1|  unnamed protein product                                161   5e-43   
ref|XP_004153985.1|  PREDICTED: putative DNA-binding protein ESCA...    160   5e-43   
ref|XP_004145070.1|  PREDICTED: putative DNA-binding protein ESCA...    160   5e-43   
ref|XP_002281411.1|  PREDICTED: putative DNA-binding protein ESCA...    160   6e-43   Vitis vinifera
ref|XP_009377073.1|  PREDICTED: putative DNA-binding protein ESCA...    160   6e-43   
ref|XP_006437176.1|  hypothetical protein CICLE_v10032444mg             160   6e-43   
ref|XP_009402315.1|  PREDICTED: putative DNA-binding protein ESCA...    161   6e-43   
ref|XP_011086333.1|  PREDICTED: putative DNA-binding protein ESCA...    160   6e-43   
ref|XP_006647239.1|  PREDICTED: putative DNA-binding protein ESCA...    161   7e-43   
ref|XP_008460074.1|  PREDICTED: putative DNA-binding protein ESCA...    161   7e-43   
ref|XP_003538721.1|  PREDICTED: putative DNA-binding protein ESCA...    160   8e-43   
ref|XP_003539199.1|  PREDICTED: putative DNA-binding protein ESCA...    159   8e-43   
ref|XP_009377422.1|  PREDICTED: putative DNA-binding protein ESCA...    159   8e-43   
ref|XP_008356452.1|  PREDICTED: putative DNA-binding protein ESCA...    160   1e-42   
ref|XP_003552472.1|  PREDICTED: putative DNA-binding protein ESCA...    159   1e-42   
ref|XP_009776190.1|  PREDICTED: putative DNA-binding protein ESCA...    159   1e-42   
ref|XP_010940981.1|  PREDICTED: putative DNA-binding protein ESCA...    160   1e-42   
ref|XP_011070911.1|  PREDICTED: putative DNA-binding protein ESCA...    159   1e-42   
ref|XP_010269998.1|  PREDICTED: putative DNA-binding protein ESCA...    159   2e-42   
ref|XP_008364289.1|  PREDICTED: putative DNA-binding protein ESCA...    160   2e-42   
emb|CDP09327.1|  unnamed protein product                                159   2e-42   
ref|XP_009356620.1|  PREDICTED: putative DNA-binding protein ESCA...    159   2e-42   
gb|EYU41285.1|  hypothetical protein MIMGU_mgv1a025243mg                159   2e-42   
ref|XP_008791267.1|  PREDICTED: putative DNA-binding protein ESCA...    160   2e-42   
ref|XP_009597193.1|  PREDICTED: putative DNA-binding protein ESCA...    159   2e-42   
ref|XP_006851806.1|  hypothetical protein AMTR_s00041p00022450          159   2e-42   
ref|XP_010108102.1|  hypothetical protein L484_023188                   159   2e-42   
ref|XP_010691133.1|  PREDICTED: putative DNA-binding protein ESCA...    160   2e-42   
ref|XP_008465963.1|  PREDICTED: putative DNA-binding protein ESCA...    158   3e-42   
ref|XP_009799054.1|  PREDICTED: putative DNA-binding protein ESCA...    159   3e-42   
ref|XP_006355697.1|  PREDICTED: putative DNA-binding protein ESCA...    159   3e-42   
ref|XP_009391843.1|  PREDICTED: putative DNA-binding protein ESCA...    159   3e-42   
ref|XP_004509027.1|  PREDICTED: putative DNA-binding protein ESCA...    159   3e-42   
ref|XP_007220428.1|  hypothetical protein PRUPE_ppa009347mg             159   3e-42   
ref|XP_003558257.1|  PREDICTED: putative DNA-binding protein ESCA...    159   3e-42   
ref|XP_008238264.1|  PREDICTED: putative DNA-binding protein ESCA...    159   3e-42   
ref|XP_007210169.1|  hypothetical protein PRUPE_ppa019786mg             159   3e-42   
gb|KDP46909.1|  hypothetical protein JCGZ_10400                         157   3e-42   
emb|CDY53687.1|  BnaA07g37810D                                          159   3e-42   
ref|XP_008353637.1|  PREDICTED: putative DNA-binding protein ESCA...    157   3e-42   
ref|XP_003617443.1|  hypothetical protein MTR_5g091630                  157   3e-42   
ref|XP_008342359.1|  PREDICTED: putative DNA-binding protein ESCA...    157   4e-42   
ref|XP_008362336.1|  PREDICTED: putative DNA-binding protein ESCA...    157   4e-42   
ref|XP_004148482.1|  PREDICTED: putative DNA-binding protein ESCA...    157   5e-42   
emb|CDX82978.1|  BnaC01g14280D                                          159   6e-42   
gb|ACU24278.1|  unknown                                                 157   7e-42   
emb|CBI34813.3|  unnamed protein product                                156   7e-42   
ref|XP_008668970.1|  PREDICTED: putative DNA-binding protein ESCA...    158   7e-42   
ref|XP_010277406.1|  PREDICTED: putative DNA-binding protein ESCA...    157   8e-42   
tpg|DAA36260.1|  TPA: hypothetical protein ZEAMMB73_652841              159   8e-42   
ref|XP_009788952.1|  PREDICTED: putative DNA-binding protein ESCA...    155   9e-42   
ref|XP_009604907.1|  PREDICTED: putative DNA-binding protein ESCA...    158   1e-41   
ref|XP_010053390.1|  PREDICTED: putative DNA-binding protein ESCA...    157   1e-41   
ref|XP_003524711.1|  PREDICTED: putative DNA-binding protein ESCA...    157   1e-41   
ref|XP_008380207.1|  PREDICTED: putative DNA-binding protein ESCA...    156   1e-41   
ref|XP_009388608.1|  PREDICTED: putative DNA-binding protein ESCA...    158   1e-41   
gb|KDP22981.1|  hypothetical protein JCGZ_01738                         157   1e-41   
ref|XP_008786310.1|  PREDICTED: putative DNA-binding protein ESCA...    157   1e-41   
ref|XP_004491337.1|  PREDICTED: putative DNA-binding protein ESCA...    156   1e-41   
ref|XP_011093448.1|  PREDICTED: putative DNA-binding protein ESCA...    157   1e-41   
ref|XP_006339443.1|  PREDICTED: putative DNA-binding protein ESCA...    157   1e-41   
ref|XP_010104316.1|  hypothetical protein L484_023266                   157   1e-41   
ref|XP_002299584.2|  DNA-binding family protein                         157   1e-41   
ref|XP_009594477.1|  PREDICTED: putative DNA-binding protein ESCA...    155   2e-41   
ref|XP_004298711.1|  PREDICTED: putative DNA-binding protein ESCA...    157   2e-41   
emb|CDY41289.1|  BnaA01g12500D                                          157   2e-41   
ref|XP_009136213.1|  PREDICTED: putative DNA-binding protein ESCA...    158   2e-41   
ref|XP_004492894.1|  PREDICTED: putative DNA-binding protein ESCA...    156   2e-41   
gb|EYU43510.1|  hypothetical protein MIMGU_mgv1a017700mg                157   2e-41   
ref|XP_008346594.1|  PREDICTED: putative DNA-binding protein ESCA...    157   2e-41   
gb|EYU40549.1|  hypothetical protein MIMGU_mgv1a021038mg                157   2e-41   
ref|XP_004976643.1|  PREDICTED: putative DNA-binding protein ESCA...    157   2e-41   
ref|XP_009399398.1|  PREDICTED: putative DNA-binding protein ESCA...    156   2e-41   
ref|XP_007039519.1|  AT-hook DNA-binding family protein                 157   2e-41   
ref|XP_004511639.1|  PREDICTED: putative DNA-binding protein ESCA...    155   2e-41   
ref|XP_006368407.1|  DNA-binding family protein                         157   2e-41   
emb|CDX98771.1|  BnaA03g45560D                                          157   2e-41   
ref|XP_002448423.1|  hypothetical protein SORBIDRAFT_06g026940          157   2e-41   
ref|XP_002878039.1|  hypothetical protein ARALYDRAFT_906980             157   2e-41   
ref|XP_011033866.1|  PREDICTED: putative DNA-binding protein ESCA...    157   2e-41   
ref|XP_002303540.1|  DNA-binding family protein                         157   2e-41   
ref|XP_008373872.1|  PREDICTED: putative DNA-binding protein ESCA...    157   2e-41   
ref|XP_006851807.1|  hypothetical protein AMTR_s00041p00025000          157   3e-41   
ref|XP_002519826.1|  ESC, putative                                      156   3e-41   
ref|XP_006436718.1|  hypothetical protein CICLE_v10032253mg             156   3e-41   
ref|NP_191115.1|  AT-hook protein of GA feedback 2                      157   3e-41   
ref|XP_010524099.1|  PREDICTED: putative DNA-binding protein ESCA...    155   3e-41   
ref|XP_009613223.1|  PREDICTED: putative DNA-binding protein ESCA...    156   3e-41   
ref|XP_009139154.1|  PREDICTED: putative DNA-binding protein ESCA...    157   3e-41   
emb|CDX94128.1|  BnaC07g37620D                                          157   3e-41   
ref|XP_009137280.1|  PREDICTED: putative DNA-binding protein ESCA...    157   3e-41   
ref|XP_007155775.1|  hypothetical protein PHAVU_003G230600g             156   3e-41   
ref|XP_002281296.1|  PREDICTED: putative DNA-binding protein ESCA...    156   4e-41   
ref|XP_009613222.1|  PREDICTED: putative DNA-binding protein ESCA...    156   4e-41   
ref|XP_004229823.1|  PREDICTED: putative DNA-binding protein ESCA...    156   4e-41   
ref|XP_009420779.1|  PREDICTED: putative DNA-binding protein ESCA...    156   4e-41   
ref|XP_010275243.1|  PREDICTED: putative DNA-binding protein ESCA...    155   4e-41   
ref|XP_010325447.1|  PREDICTED: putative DNA-binding protein ESCA...    155   5e-41   
ref|XP_004245690.1|  PREDICTED: putative DNA-binding protein ESCA...    155   5e-41   
ref|XP_011029110.1|  PREDICTED: putative DNA-binding protein ESCA...    156   5e-41   
ref|XP_010523691.1|  PREDICTED: putative DNA-binding protein ESCA...    155   5e-41   
gb|EYU40290.1|  hypothetical protein MIMGU_mgv1a019526mg                155   5e-41   
ref|XP_008238673.1|  PREDICTED: putative DNA-binding protein ESCA...    156   5e-41   
ref|XP_009399397.1|  PREDICTED: putative DNA-binding protein ESCA...    155   5e-41   
ref|XP_002511734.1|  ESC, putative                                      155   6e-41   
ref|XP_010035901.1|  PREDICTED: putative DNA-binding protein ESCA...    154   6e-41   
ref|XP_011014152.1|  PREDICTED: putative DNA-binding protein ESCA...    155   6e-41   
ref|XP_010519962.1|  PREDICTED: putative DNA-binding protein ESCA...    155   6e-41   
gb|ABL63118.1|  AT-hook DNA-binding protein                             155   6e-41   
ref|XP_010276261.1|  PREDICTED: putative DNA-binding protein ESCA...    155   6e-41   
ref|XP_002468116.1|  hypothetical protein SORBIDRAFT_01g039840          155   7e-41   
ref|XP_011018582.1|  PREDICTED: putative DNA-binding protein ESCA...    155   7e-41   
ref|XP_003611214.1|  AT-hook DNA-binding protein                        156   8e-41   
ref|XP_010677251.1|  PREDICTED: putative DNA-binding protein ESCA...    155   8e-41   
ref|XP_009405066.1|  PREDICTED: putative DNA-binding protein ESCA...    155   9e-41   
ref|XP_008438225.1|  PREDICTED: putative DNA-binding protein ESCA...    154   9e-41   
ref|XP_004494969.1|  PREDICTED: putative DNA-binding protein ESCA...    152   9e-41   
ref|XP_010052700.1|  PREDICTED: putative DNA-binding protein ESCA...    154   9e-41   
ref|XP_004511638.1|  PREDICTED: putative DNA-binding protein ESCA...    155   1e-40   
ref|XP_003608618.1|  AT-hook DNA-binding protein                        154   1e-40   
ref|XP_008448697.1|  PREDICTED: putative DNA-binding protein ESCA...    153   1e-40   
ref|XP_004148759.1|  PREDICTED: putative DNA-binding protein ESCA...    153   1e-40   
ref|XP_007040019.1|  AT-hook DNA-binding family protein                 155   1e-40   
ref|XP_010243718.1|  PREDICTED: putative DNA-binding protein ESCA...    154   1e-40   
gb|AES90815.2|  AT hook motif DNA-binding family protein                155   1e-40   
ref|XP_009589802.1|  PREDICTED: putative DNA-binding protein ESCA...    154   1e-40   
ref|XP_008804006.1|  PREDICTED: putative DNA-binding protein ESCA...    155   1e-40   
gb|KHN22151.1|  Putative DNA-binding protein ESCAROLA                   152   1e-40   
ref|XP_009794976.1|  PREDICTED: putative DNA-binding protein ESCA...    154   1e-40   
ref|XP_003516633.1|  PREDICTED: putative DNA-binding protein ESCA...    153   1e-40   
ref|XP_008788674.1|  PREDICTED: putative DNA-binding protein ESCA...    155   1e-40   
ref|XP_002969614.1|  hypothetical protein SELMODRAFT_71342              152   1e-40   
ref|XP_006411566.1|  hypothetical protein EUTSA_v10017103mg             153   2e-40   
ref|XP_006477312.1|  PREDICTED: putative DNA-binding protein ESCA...    154   2e-40   
ref|XP_006440441.1|  hypothetical protein CICLE_v10021296mg             154   2e-40   
ref|XP_008681074.1|  PREDICTED: DNA-binding protein isoform X1          153   2e-40   
ref|NP_001152652.1|  DNA-binding protein                                153   2e-40   
ref|XP_011028186.1|  PREDICTED: putative DNA-binding protein ESCA...    154   2e-40   
ref|XP_009616004.1|  PREDICTED: putative DNA-binding protein ESCA...    153   3e-40   
ref|XP_006385649.1|  DNA-binding family protein                         154   3e-40   
gb|KDP25577.1|  hypothetical protein JCGZ_20733                         154   3e-40   
ref|XP_003581586.1|  PREDICTED: putative DNA-binding protein ESCA...    154   3e-40   
ref|XP_009762421.1|  PREDICTED: putative DNA-binding protein ESCA...    153   4e-40   
ref|XP_002320066.1|  DNA-binding family protein                         154   4e-40   
ref|XP_002301300.1|  DNA-binding family protein                         153   4e-40   
ref|XP_004300243.1|  PREDICTED: putative DNA-binding protein ESCA...    153   4e-40   
gb|AGC22550.1|  male sterility related AT-hook DNA binding protein      152   4e-40   
ref|XP_008663461.1|  PREDICTED: putative DNA-binding protein ESCA...    154   4e-40   
ref|XP_011034536.1|  PREDICTED: putative DNA-binding protein ESCA...    153   5e-40   
ref|XP_010692273.1|  PREDICTED: putative DNA-binding protein ESCA...    154   5e-40   
ref|XP_010097716.1|  hypothetical protein L484_023857                   153   6e-40   
ref|XP_001763021.1|  predicted protein                                  149   6e-40   
ref|XP_009763803.1|  PREDICTED: putative DNA-binding protein ESCA...    152   6e-40   
ref|XP_006366237.1|  PREDICTED: putative DNA-binding protein ESCA...    152   6e-40   
emb|CDP09863.1|  unnamed protein product                                152   6e-40   
ref|XP_004229513.1|  PREDICTED: putative DNA-binding protein ESCA...    152   6e-40   
ref|XP_010917984.1|  PREDICTED: putative DNA-binding protein ESCA...    152   7e-40   
ref|XP_004163877.1|  PREDICTED: putative DNA-binding protein ESCA...    151   7e-40   
ref|XP_010532413.1|  PREDICTED: putative DNA-binding protein ESCA...    153   7e-40   
ref|XP_009763802.1|  PREDICTED: putative DNA-binding protein ESCA...    152   7e-40   
ref|XP_002509637.1|  ESC, putative                                      152   7e-40   
ref|XP_008796294.1|  PREDICTED: putative DNA-binding protein ESCA...    152   7e-40   
emb|CDY02949.1|  BnaC04g25370D                                          153   8e-40   
gb|KFK23205.1|  hypothetical protein AALP_AAs54797U000100               152   9e-40   
ref|XP_011026257.1|  PREDICTED: putative DNA-binding protein ESCA...    151   9e-40   
ref|XP_002300879.2|  hypothetical protein POPTR_0002s06030g             151   9e-40   
emb|CDP17786.1|  unnamed protein product                                152   9e-40   
ref|XP_010525495.1|  PREDICTED: putative DNA-binding protein ESCA...    151   9e-40   
gb|KFK37336.1|  hypothetical protein AALP_AA4G243300                    153   9e-40   
ref|XP_007052032.1|  AT-hook motif nuclear-localized protein 22         153   1e-39   
ref|XP_004984928.1|  PREDICTED: putative DNA-binding protein ESCA...    151   1e-39   
ref|XP_006445233.1|  hypothetical protein CICLE_v10024070mg             152   1e-39   
ref|XP_009393002.1|  PREDICTED: putative DNA-binding protein ESCA...    152   1e-39   
ref|XP_010092850.1|  hypothetical protein L484_022445                   152   1e-39   
ref|XP_003516470.1|  PREDICTED: putative DNA-binding protein ESCA...    152   1e-39   
ref|XP_009418604.1|  PREDICTED: putative DNA-binding protein ESCA...    151   2e-39   
ref|XP_007158420.1|  hypothetical protein PHAVU_002G151600g             152   2e-39   
ref|XP_009130966.1|  PREDICTED: putative DNA-binding protein ESCA...    151   2e-39   
gb|KDP28740.1|  hypothetical protein JCGZ_14511                         152   2e-39   
ref|XP_003525782.1|  PREDICTED: putative DNA-binding protein ESCA...    151   2e-39   
ref|XP_004510939.1|  PREDICTED: putative DNA-binding protein ESCA...    151   2e-39   
ref|XP_011090893.1|  PREDICTED: putative DNA-binding protein ESCA...    151   2e-39   
ref|XP_002307550.2|  hypothetical protein POPTR_0005s22440g             150   2e-39   
ref|XP_006293018.1|  hypothetical protein CARUB_v10019296mg             152   3e-39   
ref|XP_006285880.1|  hypothetical protein CARUB_v10007383mg             151   3e-39   
ref|XP_001765845.1|  predicted protein                                  147   3e-39   
ref|XP_011094152.1|  PREDICTED: putative DNA-binding protein ESCA...    150   3e-39   
ref|XP_011044786.1|  PREDICTED: putative DNA-binding protein ESCA...    150   3e-39   
ref|NP_001056730.1|  Os06g0136900                                       152   3e-39   
ref|XP_008799381.1|  PREDICTED: putative DNA-binding protein ESCA...    151   3e-39   
emb|CDX78802.1|  BnaA01g08690D                                          151   3e-39   
ref|XP_011040836.1|  PREDICTED: putative DNA-binding protein ESCA...    151   3e-39   
emb|CDY54780.1|  BnaAnng13510D                                          151   3e-39   
ref|XP_011040834.1|  PREDICTED: putative DNA-binding protein ESCA...    151   4e-39   
ref|XP_006384872.1|  hypothetical protein POPTR_0004s21840g             150   4e-39   
ref|XP_007134900.1|  hypothetical protein PHAVU_010G085300g             151   4e-39   
ref|XP_010266286.1|  PREDICTED: putative DNA-binding protein ESCA...    150   4e-39   
gb|ABD65635.1|  hypothetical protein 23.t00073                          150   4e-39   
ref|XP_006410687.1|  hypothetical protein EUTSA_v10017027mg             150   4e-39   
ref|XP_007141856.1|  hypothetical protein PHAVU_008G231500g             149   5e-39   
ref|XP_002868035.1|  hypothetical protein ARALYDRAFT_493093             150   5e-39   
ref|XP_007156666.1|  hypothetical protein PHAVU_002G006900g             150   5e-39   
ref|XP_011081090.1|  PREDICTED: putative DNA-binding protein ESCA...    150   5e-39   
ref|XP_006358367.1|  PREDICTED: putative DNA-binding protein ESCA...    151   5e-39   
gb|EYU30571.1|  hypothetical protein MIMGU_mgv1a010755mg                150   5e-39   
ref|XP_006342185.1|  PREDICTED: putative DNA-binding protein ESCA...    148   5e-39   
ref|XP_010505030.1|  PREDICTED: putative DNA-binding protein ESCA...    150   5e-39   
ref|XP_006397724.1|  hypothetical protein EUTSA_v10001760mg             151   5e-39   
ref|XP_011017502.1|  PREDICTED: putative DNA-binding protein ESCA...    150   5e-39   
ref|XP_006296351.1|  hypothetical protein CARUB_v10025523mg             150   6e-39   
gb|KEH19036.1|  AT hook motif DNA-binding family protein                150   6e-39   
ref|XP_006403446.1|  hypothetical protein EUTSA_v10011142mg             150   6e-39   
ref|NP_193515.1|  putative AT-hook DNA-binding family protein           150   6e-39   
ref|XP_007155606.1|  hypothetical protein PHAVU_003G216200g             150   6e-39   
ref|XP_003549894.1|  PREDICTED: putative DNA-binding protein ESCA...    150   6e-39   
ref|XP_010065253.1|  PREDICTED: putative DNA-binding protein ESCA...    147   6e-39   
ref|XP_003517441.1|  PREDICTED: putative DNA-binding protein ESCA...    150   6e-39   
ref|XP_008354801.1|  PREDICTED: putative DNA-binding protein ESCA...    150   7e-39   
gb|KFK36425.1|  hypothetical protein AALP_AA4G122700                    150   7e-39   
ref|XP_010324605.1|  PREDICTED: putative DNA-binding protein ESCA...    150   7e-39   
ref|XP_010518160.1|  PREDICTED: putative DNA-binding protein ESCA...    150   7e-39   
ref|XP_010508171.1|  PREDICTED: putative DNA-binding protein ESCA...    150   7e-39   
ref|XP_010506485.1|  PREDICTED: putative DNA-binding protein ESCA...    150   7e-39   
emb|CDY27387.1|  BnaC04g50180D                                          150   7e-39   
ref|NP_182067.1|  AT-hook motif nuclear-localized protein 22            150   7e-39   
ref|XP_009142337.1|  PREDICTED: putative DNA-binding protein ESCA...    150   8e-39   
ref|XP_004160444.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...    149   8e-39   
ref|XP_002880179.1|  hypothetical protein ARALYDRAFT_903987             150   8e-39   
ref|XP_009621304.1|  PREDICTED: putative DNA-binding protein ESCA...    150   8e-39   
emb|CDY37040.1|  BnaA04g26180D                                          150   8e-39   
emb|CDX90445.1|  BnaA03g43360D                                          149   9e-39   
ref|XP_008453469.1|  PREDICTED: putative DNA-binding protein ESCA...    149   9e-39   
ref|XP_010531743.1|  PREDICTED: putative DNA-binding protein ESCA...    149   9e-39   
ref|XP_004306909.1|  PREDICTED: putative DNA-binding protein ESCA...    150   9e-39   
ref|XP_009133560.1|  PREDICTED: putative DNA-binding protein ESCA...    149   1e-38   
gb|KHN11964.1|  Putative DNA-binding protein ESCAROLA                   148   1e-38   
ref|XP_010504415.1|  PREDICTED: putative DNA-binding protein ESCA...    150   1e-38   
gb|KFK37136.1|  hypothetical protein AALP_AA4G217700                    149   1e-38   
ref|XP_010554616.1|  PREDICTED: putative DNA-binding protein ESCA...    150   1e-38   
ref|XP_006595755.1|  PREDICTED: putative DNA-binding protein ESCA...    148   1e-38   
ref|XP_009351025.1|  PREDICTED: putative DNA-binding protein ESCA...    149   1e-38   
gb|ABD65169.1|  hypothetical protein 40.t00056                          149   1e-38   
ref|XP_004964470.1|  PREDICTED: putative DNA-binding protein ESCA...    150   2e-38   
ref|XP_006342184.1|  PREDICTED: putative DNA-binding protein ESCA...    148   2e-38   
gb|EYU29016.1|  hypothetical protein MIMGU_mgv1a023550mg                149   2e-38   
ref|XP_009336832.1|  PREDICTED: putative DNA-binding protein ESCA...    149   2e-38   
ref|XP_002881881.1|  DNA-binding family protein                         148   2e-38   
ref|XP_009778295.1|  PREDICTED: putative DNA-binding protein ESCA...    149   2e-38   
ref|XP_008375698.1|  PREDICTED: putative DNA-binding protein ESCA...    149   2e-38   
ref|XP_009392781.1|  PREDICTED: putative DNA-binding protein ESCA...    148   2e-38   
ref|XP_010427334.1|  PREDICTED: putative DNA-binding protein ESCA...    149   2e-38   
ref|XP_004137338.1|  PREDICTED: uncharacterized protein LOC101219306    150   2e-38   
ref|XP_002279636.1|  PREDICTED: putative DNA-binding protein ESCA...    149   2e-38   
ref|XP_009142892.1|  PREDICTED: putative DNA-binding protein ESCA...    148   2e-38   
ref|XP_010516134.1|  PREDICTED: putative DNA-binding protein ESCA...    149   2e-38   
ref|XP_010933490.1|  PREDICTED: putative DNA-binding protein ESCA...    149   2e-38   
ref|NP_001053704.1|  Os04g0590200                                       149   2e-38   
emb|CDY53650.1|  BnaC04g52840D                                          147   2e-38   
ref|NP_181822.1|  AT-hook motif nuclear-localized protein 16            147   2e-38   
gb|EPS65599.1|  hypothetical protein M569_09178                         146   2e-38   
emb|CDX79838.1|  BnaA05g03180D                                          147   3e-38   
ref|XP_006296261.1|  hypothetical protein CARUB_v10025435mg             148   3e-38   
ref|XP_010516702.1|  PREDICTED: putative DNA-binding protein ESCA...    148   3e-38   
ref|XP_010509635.1|  PREDICTED: putative DNA-binding protein ESCA...    148   3e-38   



>ref|XP_010262258.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=255

 Score =   243 bits (619),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 159/214 (74%), Positives = 177/214 (83%), Gaps = 5/214 (2%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG DVAES+AQFARRRQRGVCVLSG+GAVAN
Sbjct  41   PGSKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGAVAN  100

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ L GRFEILSL G FLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  101  VTLRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTL  160

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGA--EHHGLP  447
            VAAGPVMVIAATFANATYERLP+ E++D   S G          SPP +  +  +  GLP
Sbjct  161  VAAGPVMVIAATFANATYERLPLEEEEDEAGSGGQGQLAGGAGSSPPAIGSSAQQQSGLP  220

Query  446  EPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            +P SSLP+YNL PNL PNGGQL+ HD +AW H R
Sbjct  221  DP-SSLPIYNLPPNLIPNGGQLN-HDAFAWAHAR  252



>ref|XP_002312579.2| hypothetical protein POPTR_0008s16440g, partial [Populus trichocarpa]
 gb|EEE89946.2| hypothetical protein POPTR_0008s16440g, partial [Populus trichocarpa]
Length=291

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 175/213 (82%), Gaps = 4/213 (2%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEIAGG DVAES+AQFARRRQRGVCVLSG+G+VAN
Sbjct  78   PGSKNKPKPPIFVTRDSPNALRSHVMEIAGGADVAESVAQFARRRQRGVCVLSGSGSVAN  137

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ L GRFEILSL G FLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  138  VTLRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSL  197

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPL-AGAEHHGLPE  444
            VAAGPVMVIAATFANATYERLP LEDDD   S G    Q   + SPP + +  +  GLP+
Sbjct  198  VAAGPVMVIAATFANATYERLP-LEDDDEAGSGGQGQIQSGANNSPPAIGSSGQQAGLPD  256

Query  443  PSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            P S++P+YNL PNL PNG     HD YAW H R
Sbjct  257  P-SAMPIYNLPPNLIPNGAHQLGHDAYAWAHAR  288



>ref|XP_011029905.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Populus 
euphratica]
Length=292

 Score =   241 bits (616),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 158/213 (74%), Positives = 175/213 (82%), Gaps = 4/213 (2%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEIAGG DVAES+AQFARRRQRGVCVLSG+G+VAN
Sbjct  79   PGSKNKPKPPIFVTRDSPNALRSHVMEIAGGADVAESVAQFARRRQRGVCVLSGSGSVAN  138

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ L GRFEILSL G FLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  139  VTLRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSL  198

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPL-AGAEHHGLPE  444
            VAAGPVMVIAATFANATYERLP LEDD+   S G    Q   + SPP + +  +  GLP+
Sbjct  199  VAAGPVMVIAATFANATYERLP-LEDDEEAGSGGQGQIQSGANNSPPAIGSSGQQAGLPD  257

Query  443  PSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            P S++P+YNL PNL PNG     HD YAW H R
Sbjct  258  P-SAMPIYNLPPNLIPNGAHQLGHDAYAWAHAR  289



>ref|XP_002529315.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF33084.1| DNA binding protein, putative [Ricinus communis]
Length=301

 Score =   241 bits (616),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 176/213 (83%), Gaps = 5/213 (2%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+ GG DVAE +AQFARRRQRGVCVLSG+G+VAN
Sbjct  88   PGSKNKPKPPIFVTRDSPNALRSHVMEVVGGADVAECVAQFARRRQRGVCVLSGSGSVAN  147

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ L GRFEILSL G FLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  148  VTLRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSL  207

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAG-AEHHGLPE  444
            +AAGPVMVIAATFANATYERLP LEDD+   S G    Q   + SPPP+    +  GLP+
Sbjct  208  IAAGPVMVIAATFANATYERLP-LEDDEEAASAGQGHIQGGSNNSPPPIGSTGQQPGLPD  266

Query  443  PSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            P S+LP+YNL PNL PNGGQL  HD YAW H R
Sbjct  267  P-SALPVYNLPPNLIPNGGQLG-HDAYAWAHGR  297



>ref|XP_006354520.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=285

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 155/220 (70%), Positives = 184/220 (84%), Gaps = 12/220 (5%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGGTDVA+ IAQFARRRQRGVCVLSGNG+VAN
Sbjct  66   PGSKNKPKPPIFVTRDSPNALRSHVMEVAGGTDVADCIAQFARRRQRGVCVLSGNGSVAN  125

Query  797  VTLRQPAAPGAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            VTLRQP++PGA++LQGRFEILSL G FLPGP+PPG+T LTVYLAG QGQVVGGS+VGPL+
Sbjct  126  VTLRQPSSPGAIVLQGRFEILSLTGAFLPGPAPPGSTRLTVYLAGGQGQVVGGSIVGPLI  185

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHH------  456
            AAGPVM+IAATF+NATYERLP+ E++++   R  S +Q+P + SPP L  ++        
Sbjct  186  AAGPVMIIAATFSNATYERLPLEEEEEVGGDR-PSQSQVPAENSPPTLGSSDGRPQQQHQ  244

Query  455  ---GLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
                LP+P SSLP+YN TPNL PNGGQL+ HD YAW +PR
Sbjct  245  QQHELPDP-SSLPIYNFTPNLLPNGGQLN-HDAYAWANPR  282



>ref|XP_004247701.1| PREDICTED: putative DNA-binding protein ESCAROLA [Solanum lycopersicum]
Length=286

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 183/221 (83%), Gaps = 16/221 (7%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSH+ME+AGGTDVA+ IAQFARRRQRGVCVLSGNG+VAN
Sbjct  69   PGSKNKPKPPIFVTRDSPNALRSHIMEVAGGTDVADCIAQFARRRQRGVCVLSGNGSVAN  128

Query  797  VTLRQPAAPGAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            VTLRQP++PGAV+LQGRFEILSL G FLPGP+PPG+TGLTVYLAG QGQVVGGSVVGPL+
Sbjct  129  VTLRQPSSPGAVVLQGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGPLI  188

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGG---SAAQLPIDESPPPLAGA------  465
            AAGPVM+IAATF+NATYERLP+ E++++    GG   S +Q+    SPP L         
Sbjct  189  AAGPVMIIAATFSNATYERLPLEEEEEV----GGDNPSQSQVLTGNSPPTLGSNDGRPQQ  244

Query  464  -EHHGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
             + H L +P SSLP+YN TPN+ PNGGQL+ HD YAW +PR
Sbjct  245  HQQHELHDP-SSLPIYNFTPNILPNGGQLN-HDAYAWTNPR  283



>ref|XP_007035040.1| AT-hook motif nuclear localized protein 20 [Theobroma cacao]
 gb|EOY05966.1| AT-hook motif nuclear localized protein 20 [Theobroma cacao]
Length=273

 Score =   236 bits (601),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 174/213 (82%), Gaps = 4/213 (2%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+A GTDVAESIAQFARRRQRGVCVLSG+G+VAN
Sbjct  60   PGSKNKPKPPIFVTRDSPNALRSHVMEVASGTDVAESIAQFARRRQRGVCVLSGSGSVAN  119

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ L GRFEILSL G FLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  120  VTLRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSL  179

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAE-HHGLPE  444
            +AAGPVMVIAATFANATYERLPI +D++      G   Q     SPP +  +    GLP+
Sbjct  180  IAAGPVMVIAATFANATYERLPIEDDEEAGSGGHGGQIQGGAGNSPPAIGSSGPQTGLPD  239

Query  443  PSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            P SSLP+YNL PNL  NGGQL  H+ YAW H R
Sbjct  240  P-SSLPIYNLPPNLLANGGQLG-HEAYAWAHGR  270



>ref|XP_002284519.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=260

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 156/212 (74%), Positives = 174/212 (82%), Gaps = 10/212 (5%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG DVAES+AQFARRRQRGVCVLSG+G+VAN
Sbjct  55   PGSKNKPKPPIFVTRDSPNALRSHVMEVAGGHDVAESVAQFARRRQRGVCVLSGSGSVAN  114

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ L GRFEILSL G FLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  115  VTLRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSL  174

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VAAGPV+VIAATFANATYERLP+ E+++   +   S +   I  S     G  H GLPE 
Sbjct  175  VAAGPVIVIAATFANATYERLPLEEEEEGGQAPPPSGSPPAIGSS----GGQHHSGLPE-  229

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
               LP+YNL PNL PNGGQLS HDPY+W H R
Sbjct  230  ---LPIYNLPPNLLPNGGQLS-HDPYSWAHAR  257



>ref|XP_011091221.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=241

 Score =   232 bits (591),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 175/214 (82%), Gaps = 6/214 (3%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNG+VAN
Sbjct  25   PGSKNKPKPPIFVTRDSPNALRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGSVAN  84

Query  797  VTLRQPAAPG-AVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VT+RQPAAPG AV L GRFEILSL G FLPGP+PPGATGLTVYLAG QGQVVGGSVVGPL
Sbjct  85   VTIRQPAAPGAAVALHGRFEILSLTGAFLPGPAPPGATGLTVYLAGGQGQVVGGSVVGPL  144

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAE---HHGL  450
            VAAGPVMVIAATFANATYERLP+ E+++   S              PP  G +    HG+
Sbjct  145  VAAGPVMVIAATFANATYERLPLEEEEEGGSSGQQGGGGSGGAAGSPPGMGGQQQHQHGM  204

Query  449  PEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHP  348
             +P SSLP+YNLTPNL PNGGQ++ HD Y W HP
Sbjct  205  GDP-SSLPIYNLTPNLMPNGGQMN-HDAYGWGHP  236



>ref|XP_009589526.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=379

 Score =   236 bits (602),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 182/218 (83%), Gaps = 10/218 (5%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGGTDVA+SIAQFARRRQRGVCVLSGNG+VAN
Sbjct  162  PGSKNKPKPPIFVTRDSPNSLRSHVMEVAGGTDVADSIAQFARRRQRGVCVLSGNGSVAN  221

Query  797  VTLRQPAAPGAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            VTLRQ +APGAV+LQGRFEILSL G FLPGP+PPG+TGLTVYLAG QGQVVGGSVVGPLV
Sbjct  222  VTLRQSSAPGAVVLQGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGPLV  281

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGA------EHH  456
            AAGPVM+IAATF+NATYE+LP LE+++     G   +Q+P   SPP L  +      + H
Sbjct  282  AAGPVMIIAATFSNATYEKLP-LEEEEDGGGDGSGQSQVPAGNSPPALGSSGERQPQQQH  340

Query  455  GLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYA-WQHPR  345
             LP+P +SLP+YN TPNL PNGGQL+ HD YA W  PR
Sbjct  341  ELPDP-TSLPIYNFTPNLLPNGGQLN-HDAYANWATPR  376



>ref|XP_009775204.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana sylvestris]
Length=265

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 180/218 (83%), Gaps = 12/218 (6%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN LRSHVME+AGGTDVA+SIAQFARRRQRGVCVLSGNG+VANV
Sbjct  49   GSKNKPKPPIFVTRDSPNALRSHVMEVAGGTDVADSIAQFARRRQRGVCVLSGNGSVANV  108

Query  794  TLRQPAAPGAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            TLRQP+APG V+LQGRFEILSL G FLPGP+PPG+TGLTVYLAG QGQVVGGSVVGPLV+
Sbjct  109  TLRQPSAPGVVVLQGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGPLVS  168

Query  614  agpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGA-------EHH  456
            AGPVM+IAATF+NATYERLP+ E+D   D  G S   +P   SPP L  +       + H
Sbjct  169  AGPVMIIAATFSNATYERLPLEEEDGGGDGCGQSP--VPAGNSPPALGSSGERQQQQQQH  226

Query  455  GLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYA-WQHPR  345
             LP+P +SLP+YN TPNL PNGGQL+ HD YA W  PR
Sbjct  227  ELPDP-TSLPIYNFTPNLLPNGGQLN-HDAYANWATPR  262



>ref|XP_006420137.1| hypothetical protein CICLE_v10005603mg [Citrus clementina]
 gb|ESR33377.1| hypothetical protein CICLE_v10005603mg [Citrus clementina]
Length=276

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 176/218 (81%), Gaps = 11/218 (5%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG DVAES+A FARRRQRGVCVLSG+G+VAN
Sbjct  59   PGSKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVALFARRRQRGVCVLSGSGSVAN  118

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ L GRFEILSL G FLPGPSPPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  119  VTLRQPAAPGAVVALHGRFEILSLTGAFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGQL  178

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRG---GSAAQLPIDESPPPLAGA---EH  459
            VAAGPVMVIAATFANATYERLP+ +D+++  ++G    + A    + SPP +  +     
Sbjct  179  VAAGPVMVIAATFANATYERLPLEDDEEVTGTQGQIQSTGAAANNNNSPPQIGSSGQPSS  238

Query  458  HGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
             GLP+PSS    YNL PNL PNGGQL  H+ YAW H R
Sbjct  239  AGLPDPSSL--TYNLPPNLIPNGGQL--HEAYAWAHAR  272



>ref|XP_010274873.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Nelumbo 
nucifera]
Length=352

 Score =   233 bits (593),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 178/217 (82%), Gaps = 11/217 (5%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEIAGG DVA+ +AQFARRRQRGVCVLSG+GAVAN
Sbjct  138  PGSKNKPKPPIFVTRDSPNALRSHVMEIAGGADVADCVAQFARRRQRGVCVLSGSGAVAN  197

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            +TLRQPAAPGAV+ L GRFEILSL G FLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  198  ITLRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTL  257

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLP--IDESPPPL---AGAEHH  456
            +AAGPVMVIAATFA AT+ERLP+ E++   ++  G   QLP     SPP +   +G +  
Sbjct  258  IAAGPVMVIAATFATATFERLPLDEEE---EAGSGGQGQLPGGAGSSPPAIGSSSGQQQP  314

Query  455  GLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            GLP+P SSLP++NL PNL PN GQL+ HD +AW H R
Sbjct  315  GLPDP-SSLPVFNLPPNLLPNAGQLN-HDAFAWAHAR  349



>ref|XP_006477506.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 ref|XP_006489611.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
Length=350

 Score =   233 bits (593),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 176/218 (81%), Gaps = 11/218 (5%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG DVAES+A FARRRQRGVCVLSG+G+VAN
Sbjct  133  PGSKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVALFARRRQRGVCVLSGSGSVAN  192

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ L GRFEILSL G FLPGPSPPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  193  VTLRQPAAPGAVVALHGRFEILSLTGAFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGQL  252

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRG---GSAAQLPIDESPPPLAGAEH---  459
            VAAGPVMVIAATFANATYERLP+ +D+++  ++G    + A    + SPP +  +     
Sbjct  253  VAAGPVMVIAATFANATYERLPLEDDEEVTGTQGQIQSTGAATNNNNSPPQIGSSGQPPS  312

Query  458  HGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
             GLP+PSS    YNL PNL PNGGQL  H+ YAW H R
Sbjct  313  AGLPDPSSL--TYNLPPNLIPNGGQL--HEAYAWAHAR  346



>ref|XP_011030530.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Populus 
euphratica]
Length=289

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 173/211 (82%), Gaps = 5/211 (2%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEIAGG DVAES+AQFARRRQRGVCVLSG+G+VAN
Sbjct  76   PGSKNKPKPPIFVTRDSPNALRSHVMEIAGGADVAESVAQFARRRQRGVCVLSGSGSVAN  135

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ L GRFEILSL G FLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  136  VTLRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSL  195

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPL-AGAEHHGLPE  444
            +AAGPVMVIAATFANATYERLP LEDD+   S G    Q   + SPP + +  +  GLP+
Sbjct  196  IAAGPVMVIAATFANATYERLP-LEDDEEAGSGGQGHLQSGANNSPPAIGSSGQQSGLPD  254

Query  443  PSSSLPLYNLTPNLFPNGGQLSPHDPYAWQH  351
            P SS+P+Y L PNL  +G Q   H+ YAW H
Sbjct  255  P-SSMPVY-LPPNLMQSGAQQLGHEAYAWAH  283



>ref|XP_010104063.1| hypothetical protein L484_008144 [Morus notabilis]
 gb|EXB98164.1| hypothetical protein L484_008144 [Morus notabilis]
Length=340

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 175/217 (81%), Gaps = 7/217 (3%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG DVAES+AQFARRRQRGVCVLSG+G+VAN
Sbjct  122  PGSKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGSVAN  181

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP+APGAV+ L GRFEILSL G FLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  182  VTLRQPSAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSL  241

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLA---GAEHH--  456
            VAAGPVMVIAATFANATYERLP+ +D++     GG         SP  +    G + H  
Sbjct  242  VAAGPVMVIAATFANATYERLPLDDDEEAGSGGGGHGGGGGSGGSPNAIGGGPGGQLHPP  301

Query  455  GLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            GLP+P S+LP+YNL PNL PNGG    H+PYAW H R
Sbjct  302  GLPDP-SALPVYNLPPNLVPNGGHQLGHEPYAWTHAR  337



>emb|CDO99189.1| unnamed protein product [Coffea canephora]
Length=289

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 171/212 (81%), Gaps = 13/212 (6%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG+DVAESIAQFAR+RQRGVCVLSG+G+VAN
Sbjct  86   PGSKNKPKPPIFVTRDSPNALRSHVMEVAGGSDVAESIAQFARKRQRGVCVLSGSGSVAN  145

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ L GRFEILSL G FLPGP+PPGATGLTVYLAG QGQVVGGSVVG L
Sbjct  146  VTLRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGATGLTVYLAGGQGQVVGGSVVGSL  205

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VAAGPV+VIAATFANATYERLP+ +D+D       + A        P L     H +P+P
Sbjct  206  VAAGPVLVIAATFANATYERLPLEDDEDT------TPACGGGGGGQPHLG----HAMPDP  255

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
              SLP YNLTPNL PNGGQL+ HD Y W   R
Sbjct  256  -PSLPSYNLTPNLLPNGGQLN-HDAYGWAQSR  285



>ref|XP_008801301.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=255

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 173/218 (79%), Gaps = 14/218 (6%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG D+AE IAQFARRRQRGVCVLSG GAVAN
Sbjct  42   PGSKNKPKPPIFVTRDSPNALRSHVMEVAGGADIAECIAQFARRRQRGVCVLSGTGAVAN  101

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ L+GRFEILSL GTFLPGP+PPG++GLTVYLAG QGQVVGGSVVG L
Sbjct  102  VTLRQPAAPGAVVALRGRFEILSLTGTFLPGPAPPGSSGLTVYLAGGQGQVVGGSVVGSL  161

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSR------GGSAAQLPIDESPPPLAGAEH  459
            VA+G VMV+AATFANATYERLP+ E+ +  +        G S  QLP    PP   GA  
Sbjct  162  VASGSVMVVAATFANATYERLPLEEEVEEEEEEEEEEGPGSSGGQLPC--RPPTAMGA--  217

Query  458  HGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
             GL +P SSLP+YN  PNL PNG QL  HD +AW H R
Sbjct  218  -GLADP-SSLPIYNFPPNLLPNGAQLV-HDAFAWAHAR  252



>ref|XP_007144108.1| hypothetical protein PHAVU_007G129400g, partial [Phaseolus vulgaris]
 gb|ESW16102.1| hypothetical protein PHAVU_007G129400g, partial [Phaseolus vulgaris]
Length=310

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 177/218 (81%), Gaps = 15/218 (7%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEI GG DVAES+AQFARRRQRGVCVLSG+G+VAN
Sbjct  98   PGSKNKPKPPIFVTRDSPNALRSHVMEITGGADVAESVAQFARRRQRGVCVLSGSGSVAN  157

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ L GRFEILSL GTFLPGP+PPG+TGLTVYLAG QGQV+GGSVVGPL
Sbjct  158  VTLRQPAAPGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVLGGSVVGPL  217

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPL-----AGAE-H  459
            VA GPVMVIAATFANATYERLP+ EDD+ P     SAA +    SPPPL      G +  
Sbjct  218  VATGPVMVIAATFANATYERLPLDEDDEGPS----SAAAVQGGGSPPPLGIGSGGGVQLQ  273

Query  458  HGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
             G+P+P SSLPLYNL PN+   GGQ+  H+  AW H R
Sbjct  274  GGMPDP-SSLPLYNLPPNV--GGGQVG-HEALAWAHGR  307



>gb|ABZ89182.1| putative protein [Coffea canephora]
 gb|ADZ55300.1| DNA-binding protein [Coffea arabica]
 emb|CDO99972.1| unnamed protein product [Coffea canephora]
Length=289

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 176/214 (82%), Gaps = 8/214 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+A G+D+AESIAQFARRRQRGVCVLS +G V N
Sbjct  78   PGSKNKPKPPIFVTRDSPNALRSHVMEVANGSDIAESIAQFARRRQRGVCVLSASGTVTN  137

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP+APGAVM L GRFEILSL G FLPGP+PPGATGLT+YLAG QGQVVGGSVVG L
Sbjct  138  VTLRQPSAPGAVMALHGRFEILSLTGAFLPGPAPPGATGLTIYLAGGQGQVVGGSVVGSL  197

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGA--EHHGLP  447
            VA+GPVMVIA+TF+NATYERLPI ED++   +   +  QL  + SPP  +G   +  GL 
Sbjct  198  VASGPVMVIASTFSNATYERLPIEEDEEGGGA---AQGQLGGNGSPPLGSGGAPQQGGLG  254

Query  446  EPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            +P SS+P+YNL PNL PNGGQL+ H+ +AW H R
Sbjct  255  DP-SSMPVYNLPPNLMPNGGQLN-HEAFAWAHGR  286



>ref|XP_002314642.2| hypothetical protein POPTR_0010s08500g [Populus trichocarpa]
 gb|EEF00813.2| hypothetical protein POPTR_0010s08500g [Populus trichocarpa]
Length=289

 Score =   224 bits (571),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 167/210 (80%), Gaps = 17/210 (8%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEIAGG DVAES+AQFARRRQRGVCVLSG+G+VAN
Sbjct  90   PGSKNKPKPPIFVTRDSPNALRSHVMEIAGGADVAESVAQFARRRQRGVCVLSGSGSVAN  149

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ L GRFEILSL G FLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  150  VTLRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSL  209

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +AAGPVMVIAATFANATYERLP+ +D++      GS+ Q                GLP+P
Sbjct  210  IAAGPVMVIAATFANATYERLPLEDDEEAGSGAIGSSGQ--------------QAGLPDP  255

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQH  351
             SS+P+Y L PNL  +G Q   HD YAW H
Sbjct  256  -SSMPVY-LPPNLMQSGAQQLGHDAYAWAH  283



>ref|XP_004296621.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=277

 Score =   223 bits (569),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 173/218 (79%), Gaps = 9/218 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG DVAES+AQFARRRQRGVCVLSG+G+VAN
Sbjct  59   PGSKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGSVAN  118

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ L GRFEILSL+G FLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  119  VTLRQPAAPGAVVALHGRFEILSLSGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSL  178

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLP----IDESPPPLAGAEHHG  453
            VAAGPVMV+AATFANATYERLP+ EDD+     GG  A       +  S  P      HG
Sbjct  179  VAAGPVMVVAATFANATYERLPLEEDDEAASVGGGHGASGSSPTGVGSSGGPQVLPPGHG  238

Query  452  --LPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
              LP+P SSLPLY L PNL PNGG L  HD Y W H R
Sbjct  239  GQLPDP-SSLPLYGLPPNLIPNGGPLG-HDAYPWPHSR  274



>gb|ADY38789.1| DNA-binding protein [Coffea arabica]
Length=289

 Score =   223 bits (568),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 176/214 (82%), Gaps = 8/214 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+A G+D+AESIAQFARRRQRGVCVLS +G V N
Sbjct  78   PGSKNKPKPPIFVTRDSPNALRSHVMEVANGSDIAESIAQFARRRQRGVCVLSASGTVTN  137

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP+APGAVM L GRFEILSL G FLPGP+PPGATGLT+YLAG QGQVVGGSVVG L
Sbjct  138  VTLRQPSAPGAVMALHGRFEILSLTGAFLPGPAPPGATGLTIYLAGGQGQVVGGSVVGSL  197

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGA--EHHGLP  447
            VA+GPVMVIA+TF+NATYERLPI ED++   +   +  QL  + SPP  +G   +  GL 
Sbjct  198  VASGPVMVIASTFSNATYERLPIEEDEEGGGA---AQGQLGGNGSPPLGSGGAPQQGGLG  254

Query  446  EPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            +P SS+P+Y+L PNL PNGGQL+ H+ +AW H R
Sbjct  255  DP-SSMPVYSLPPNLMPNGGQLN-HEAFAWAHGR  286



>ref|XP_009394683.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=266

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 150/217 (69%), Positives = 168/217 (77%), Gaps = 17/217 (8%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG D+AESIA FARR+QRGVCVLSG+G VAN
Sbjct  58   PGSKNKPKPPIFVTRDSPNALRSHVMEVAGGADIAESIAHFARRKQRGVCVLSGSGTVAN  117

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPA+PGAV+ L GRFEILSL GTFLPGPSPPG TGLTVYLAG QGQVVGGSVVG L
Sbjct  118  VTLRQPASPGAVVALHGRFEILSLTGTFLPGPSPPGTTGLTVYLAGGQGQVVGGSVVGSL  177

Query  620  vaagpvmVIAATFANATYERLPILEDDD-----LPDSRGGSAAQLPIDESPPPLAGAEHH  456
            +AAG VMV+A+TFANATYERLP+ E ++     LP    G  A L       P AG    
Sbjct  178  IAAGTVMVLASTFANATYERLPLEEAEESVGGGLPVQLHGGVASL------MPGAG----  227

Query  455  GLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            GLP+P S+LP+YNL PNL  NGG    HD + W H R
Sbjct  228  GLPDP-SALPIYNLPPNLAHNGGGQMGHDAFEWAHAR  263



>emb|CBI35166.3| unnamed protein product [Vitis vinifera]
Length=275

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 170/213 (80%), Gaps = 16/213 (8%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+A G+D+ ESIAQFARRRQRGVCVLS +G V N
Sbjct  74   PGSKNKPKPPIFVTRDSPNALRSHVMEVANGSDITESIAQFARRRQRGVCVLSASGTVMN  133

Query  797  VTLRQPAAP-GAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgp  624
            VTLRQP+AP GAVM L GRFEILSL G FLPGP+PPG+TGLT+YLAG Q QVVGGSVVG 
Sbjct  134  VTLRQPSAPGGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQAQVVGGSVVGS  193

Query  623  lvaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPE  444
            L+AAGPVMVIAATF+NATYERLP LED++      GSAAQ         LAG    G+ +
Sbjct  194  LIAAGPVMVIAATFSNATYERLP-LEDEE----EAGSAAQ-------EQLAGGGGGGMAD  241

Query  443  PSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            P SS+P+YNL PNL PNGGQL+ HD Y W H R
Sbjct  242  P-SSMPVYNLPPNLLPNGGQLN-HDAYGWAHGR  272



>ref|XP_006606853.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=366

 Score =   223 bits (568),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 173/224 (77%), Gaps = 23/224 (10%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG DVAES+AQFARRRQRGVCVLSG+GAVAN
Sbjct  144  PGSKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGAVAN  203

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP+APGAV+ L GRFEILSL GTFLPGP+PPGATGLTVYL G QGQVVGGSVVG L
Sbjct  204  VTLRQPSAPGAVVALHGRFEILSLTGTFLPGPAPPGATGLTVYLGGGQGQVVGGSVVGSL  263

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQ--LPIDESPP-----------  480
            VAAGPVMVIAATFANATYERLP+ E++D     GG++A     +  SPP           
Sbjct  264  VAAGPVMVIAATFANATYERLPLEEEED----DGGASAHGGSTLGGSPPGMGNSGGNGDN  319

Query  479  -PLAGAEHHGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQH  351
                     G+P+P SSL LYNL PNL PNGG    H+ +AW H
Sbjct  320  SGGGHLSSGGIPDP-SSLALYNLPPNLIPNGGH---HEAFAWAH  359



>ref|XP_010024974.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
Length=282

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 164/212 (77%), Gaps = 5/212 (2%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEIA G D+AES+AQFARRRQRGVCVLSG+G V N
Sbjct  71   PGSKNKPKPPIFVTRDSPNALRSHVMEIANGADIAESVAQFARRRQRGVCVLSGSGTVTN  130

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP APGAVM L GRFEILSL G FLPGP+PPG+TGLT+YLAG QGQVVGGSVVG L
Sbjct  131  VTLRQPTAPGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGSL  190

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VA+GPVMVIAATF+NATYERLP+ ED++    +G   +  P                P  
Sbjct  191  VASGPVMVIAATFSNATYERLPLEEDEEAGSGQGQLGSGSPPGIGGGGGQQQGGMADP--  248

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
             SS+P+YNL PNL PNGGQL+ H+ Y W H R
Sbjct  249  -SSMPVYNLPPNLLPNGGQLN-HEAYGWTHGR  278



>ref|XP_007226723.1| hypothetical protein PRUPE_ppa019745mg [Prunus persica]
 gb|EMJ27922.1| hypothetical protein PRUPE_ppa019745mg [Prunus persica]
Length=285

 Score =   218 bits (554),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 175/235 (74%), Gaps = 34/235 (14%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG DVAES+AQFARRRQRGVCVLSG+G+VAN
Sbjct  58   PGSKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGSVAN  117

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ LQGRFEILSL+G FLPGP+PPG+TGLTVYLA   GQVVGGSVVG L
Sbjct  118  VTLRQPAAPGAVVALQGRFEILSLSGAFLPGPAPPGSTGLTVYLAAGNGQVVGGSVVGSL  177

Query  620  vaagpvmVIAATFANATYERLPILEDDD----------------LPDSRGGSAAQLPIDE  489
            VAAGPVMV+AATFANATYERLP+ ED++                 P + G S AQL    
Sbjct  178  VAAGPVMVVAATFANATYERLPLEEDEEGGGSGGGGHNNGGSGNSPTAGGSSGAQLG---  234

Query  488  SPPPLAGAEHH--GLPEPSS----SLPLYNLTPNLFPNG--GQLSPHDPYAWQHP  348
                 +G   H   LP+PSS    ++  ++L PNL PNG  GQL  H+ YAW  P
Sbjct  235  -----SGGHQHQQQLPDPSSGGLPNIYSHHLPPNLIPNGGHGQLG-HEAYAWARP  283



>gb|KHN01050.1| Putative DNA-binding protein ESCAROLA [Glycine soja]
Length=295

 Score =   218 bits (555),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 172/218 (79%), Gaps = 13/218 (6%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+ GG DVAES+AQFARRRQRGVCVLSG+G+VAN
Sbjct  81   PGSKNKPKPPIFVTRDSPNTLRSHVMEVTGGADVAESVAQFARRRQRGVCVLSGSGSVAN  140

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP+APGAV+ L GRFEILSL GTFLPGP+PPG+TGLTVYL G QGQ+VGGSVVG L
Sbjct  141  VTLRQPSAPGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLTGGQGQIVGGSVVGSL  200

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLA------GAEH  459
            VAAGPVMVIAATFANATYERLP+ EDD+ P S  G  AQ      PPPL       G   
Sbjct  201  VAAGPVMVIAATFANATYERLPLDEDDEGPSSAAG--AQGGGSSPPPPLGIGSSGGGQLQ  258

Query  458  HGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
             G+P+P SS+PLYNL PN     GQ+  H+  AW H R
Sbjct  259  GGMPDP-SSMPLYNLPPN--GGVGQVG-HEALAWAHGR  292



>ref|XP_008224392.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=285

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 174/235 (74%), Gaps = 34/235 (14%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG DVAES+AQFARRRQRGVCVLSG+G+VAN
Sbjct  58   PGSKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGSVAN  117

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ LQGRFEILSL+G FLPGP+PPG+TGLTVYLA   GQVVGGSVVG L
Sbjct  118  VTLRQPAAPGAVVALQGRFEILSLSGAFLPGPAPPGSTGLTVYLAAGNGQVVGGSVVGSL  177

Query  620  vaagpvmVIAATFANATYERLPILEDDD----------------LPDSRGGSAAQLPIDE  489
            VAAGPVMV+AATFANATYERLP+ ED++                 P   G S AQL    
Sbjct  178  VAAGPVMVVAATFANATYERLPLEEDEEGGGSGGGGHNNGGSGNSPTGGGSSGAQLG---  234

Query  488  SPPPLAGAEHHG--LPEPSS----SLPLYNLTPNLFPNG--GQLSPHDPYAWQHP  348
                 +G   H   LP+PSS    ++  ++L PNL PNG  GQL  H+ YAW  P
Sbjct  235  -----SGGHQHQQLLPDPSSGGLPNIYSHHLPPNLIPNGGHGQLG-HEAYAWARP  283



>ref|XP_004171657.1| PREDICTED: putative DNA-binding protein ESCAROLA-like, partial 
[Cucumis sativus]
Length=297

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 171/215 (80%), Gaps = 9/215 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRS+V+E+A G+DVA+SIAQFAR+RQRGVCVLS  G VAN
Sbjct  85   PGSKNKPKPPIFVTRDSPNALRSYVLEVAAGSDVADSIAQFARKRQRGVCVLSATGLVAN  144

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPG+VM LQGRFEILSL G FLPGP+PPG+TGLTVYL+G QGQVVGGSVVG L
Sbjct  145  VTLRQPAAPGSVMPLQGRFEILSLTGAFLPGPAPPGSTGLTVYLSGGQGQVVGGSVVGSL  204

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPL----AGAEHHG  453
            VAAGP+MVIAATFANATYERLP LED D  +   GSA+       PP +     G    G
Sbjct  205  VAAGPIMVIAATFANATYERLP-LEDPDEHEVGSGSASHGGPRSPPPEIRATGGGQMPAG  263

Query  452  LPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHP  348
            +PEP  +LPLYNL P++ PNG QL  HD YA+  P
Sbjct  264  IPEP--TLPLYNLLPDMIPNGVQLG-HDGYAYVRP  295



>ref|XP_008439362.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Cucumis 
melo]
Length=293

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 171/215 (80%), Gaps = 9/215 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRS+V+E+A G+DVA+SIAQFAR+RQRGVCVLS  G VAN
Sbjct  81   PGSKNKPKPPIFVTRDSPNALRSYVLEVAAGSDVADSIAQFARKRQRGVCVLSATGLVAN  140

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPG+VM LQGRFEILSL G FLPGP+PPG+TGLTVYL+G QGQVVGGSVVG L
Sbjct  141  VTLRQPAAPGSVMPLQGRFEILSLTGAFLPGPAPPGSTGLTVYLSGGQGQVVGGSVVGSL  200

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPL----AGAEHHG  453
            VAAGP+MVIAATFANATYERLP LED D  +   GSA+       PP +     G    G
Sbjct  201  VAAGPIMVIAATFANATYERLP-LEDPDEHEVGSGSASHGGPRSPPPEIRATGGGQMPAG  259

Query  452  LPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHP  348
            +PEP  +LPLYNL P++ PNG QL  HD YA+  P
Sbjct  260  MPEP--TLPLYNLLPDMIPNGVQLG-HDGYAYVRP  291



>ref|XP_004134419.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
Length=300

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 171/215 (80%), Gaps = 9/215 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRS+V+E+A G+DVA+SIAQFAR+RQRGVCVLS  G VAN
Sbjct  88   PGSKNKPKPPIFVTRDSPNALRSYVLEVAAGSDVADSIAQFARKRQRGVCVLSATGLVAN  147

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPG+VM LQGRFEILSL G FLPGP+PPG+TGLTVYL+G QGQVVGGSVVG L
Sbjct  148  VTLRQPAAPGSVMPLQGRFEILSLTGAFLPGPAPPGSTGLTVYLSGGQGQVVGGSVVGSL  207

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPL----AGAEHHG  453
            VAAGP+MVIAATFANATYERLP LED D  +   GSA+       PP +     G    G
Sbjct  208  VAAGPIMVIAATFANATYERLP-LEDPDEHEVGSGSASHGGPRSPPPEIRATGGGQMPAG  266

Query  452  LPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHP  348
            +PEP  +LPLYNL P++ PNG QL  HD YA+  P
Sbjct  267  IPEP--TLPLYNLLPDMIPNGVQLG-HDGYAYVRP  298



>gb|KGN56888.1| hypothetical protein Csa_3G141840 [Cucumis sativus]
Length=303

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 171/215 (80%), Gaps = 9/215 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRS+V+E+A G+DVA+SIAQFAR+RQRGVCVLS  G VAN
Sbjct  91   PGSKNKPKPPIFVTRDSPNALRSYVLEVAAGSDVADSIAQFARKRQRGVCVLSATGLVAN  150

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPG+VM LQGRFEILSL G FLPGP+PPG+TGLTVYL+G QGQVVGGSVVG L
Sbjct  151  VTLRQPAAPGSVMPLQGRFEILSLTGAFLPGPAPPGSTGLTVYLSGGQGQVVGGSVVGSL  210

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPL----AGAEHHG  453
            VAAGP+MVIAATFANATYERLP LED D  +   GSA+       PP +     G    G
Sbjct  211  VAAGPIMVIAATFANATYERLP-LEDPDEHEVGSGSASHGGPRSPPPEIRATGGGQMPAG  269

Query  452  LPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHP  348
            +PEP  +LPLYNL P++ PNG QL  HD YA+  P
Sbjct  270  IPEP--TLPLYNLLPDMIPNGVQLG-HDGYAYVRP  301



>ref|XP_006606925.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=385

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 172/218 (79%), Gaps = 13/218 (6%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+ GG DVAES+AQFARRRQRGVCVLSG+G+VAN
Sbjct  171  PGSKNKPKPPIFVTRDSPNTLRSHVMEVTGGADVAESVAQFARRRQRGVCVLSGSGSVAN  230

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP+APGAV+ L GRFEILSL GTFLPGP+PPG+TGLTVYL G QGQ+VGGSVVG L
Sbjct  231  VTLRQPSAPGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLTGGQGQIVGGSVVGSL  290

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLA------GAEH  459
            VAAGPVMVIAATFANATYERLP+ EDD+ P S  G  AQ      PPPL       G   
Sbjct  291  VAAGPVMVIAATFANATYERLPLDEDDEGPSSAAG--AQGGGSSPPPPLGIGSSGGGQLQ  348

Query  458  HGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
             G+P+P SS+PLYNL PN     GQ+  H+  AW H R
Sbjct  349  GGMPDP-SSMPLYNLPPN--GGVGQVG-HEALAWAHGR  382



>ref|XP_010918771.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
 ref|XP_010918772.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=248

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 168/212 (79%), Gaps = 8/212 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG D+A+ IAQFARRRQRGVCVLSG GAVAN
Sbjct  41   PGSKNKPKPPIFVTRDSPNSLRSHVMEVAGGADIADCIAQFARRRQRGVCVLSGTGAVAN  100

Query  797  VTLRQ-PAAPGAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQ  A    V L GRFEILSL GTFLPGP+PPG++GLTVYLAG QGQVVGGSVVG L
Sbjct  101  VTLRQPAAPAAVVALHGRFEILSLTGTFLPGPAPPGSSGLTVYLAGGQGQVVGGSVVGSL  160

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VAAGPVMV+AATFANATYERLP+ E+++  +  GGSA  LP   SP     A   G P+P
Sbjct  161  VAAGPVMVVAATFANATYERLPLEEEEEEEEGPGGSAGHLPC-RSP----AAMGTGFPDP  215

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
             SSL +YNL PNL PNG QL  HD +AW H R
Sbjct  216  -SSLSIYNLPPNLLPNGAQLV-HDAFAWAHAR  245



>emb|CAN61523.1| hypothetical protein VITISV_016751 [Vitis vinifera]
Length=259

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 149/222 (67%), Positives = 170/222 (77%), Gaps = 18/222 (8%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+A G+D+ ESIAQFARRRQRGVCVLS +G V N
Sbjct  42   PGSKNKPKPPIFVTRDSPNALRSHVMEVANGSDITESIAQFARRRQRGVCVLSASGTVMN  101

Query  797  VTLRQPAAP-GAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgp  624
            VTLRQP+AP GAVM L GRFEILSL G FLPGP+PPG+TGLT+YLAG Q QVVGGSVVG 
Sbjct  102  VTLRQPSAPGGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQAQVVGGSVVGS  161

Query  623  lvaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPI---------DESPPPLA  471
            L+AAGPVMVIAATF+NATYERLP LED++      GSAAQ  +                 
Sbjct  162  LIAAGPVMVIAATFSNATYERLP-LEDEE----EAGSAAQEQLAGGGGGGGSPPGIGGSG  216

Query  470  GAEHHGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            G +  G+ +P SS+P+YNL PNL PNGGQL+ HD Y W H R
Sbjct  217  GQQQAGMADP-SSMPVYNLPPNLLPNGGQLN-HDAYGWAHGR  256



>ref|XP_002271606.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=291

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 149/222 (67%), Positives = 170/222 (77%), Gaps = 18/222 (8%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+A G+D+ ESIAQFARRRQRGVCVLS +G V N
Sbjct  74   PGSKNKPKPPIFVTRDSPNALRSHVMEVANGSDITESIAQFARRRQRGVCVLSASGTVMN  133

Query  797  VTLRQPAAP-GAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgp  624
            VTLRQP+AP GAVM L GRFEILSL G FLPGP+PPG+TGLT+YLAG Q QVVGGSVVG 
Sbjct  134  VTLRQPSAPGGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQAQVVGGSVVGS  193

Query  623  lvaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPI---------DESPPPLA  471
            L+AAGPVMVIAATF+NATYERLP LED++      GSAAQ  +                 
Sbjct  194  LIAAGPVMVIAATFSNATYERLP-LEDEE----EAGSAAQEQLAGGGGGGGSPPGIGGSG  248

Query  470  GAEHHGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            G +  G+ +P SS+P+YNL PNL PNGGQL+ HD Y W H R
Sbjct  249  GQQQAGMADP-SSMPVYNLPPNLLPNGGQLN-HDAYGWAHGR  288



>gb|ABL63119.1| AT-hook DNA-binding protein, partial [Catharanthus roseus]
Length=256

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 173/222 (78%), Gaps = 11/222 (5%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHV+E++GG+DVAESIA FAR+RQRGVCVLSG+G+VAN
Sbjct  32   PGSKNKPKPPIFVTRDSPNALRSHVLEVSGGSDVAESIAVFARKRQRGVCVLSGSGSVAN  91

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ L GRFEILSL+G FLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  92   VTLRQPAAPGAVVALHGRFEILSLSGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSL  151

Query  620  vaagpvmVIAATFANATYERLPILED--DDLPDSRGGSAAQLPIDESPPPLAGAEHHGLP  447
            VAAGPV++IAATFANATYERLP+ +D  D +  + G + A  P          +   G+ 
Sbjct  152  VAAGPVLIIAATFANATYERLPLEDDEEDQVSPATGATTAGQPQLGGGGGGNSSSPPGMG  211

Query  446  -------EPSSSLPLYNLTPNLFPNGGQLSPHDPY-AWQHPR  345
                   +P+SS+P+YNL PNL PNGGQL+    Y  W  PR
Sbjct  212  SSGMGAHDPNSSMPVYNLNPNLLPNGGQLNHDGGYPNWAQPR  253



>gb|KCW61537.1| hypothetical protein EUGRSUZ_H04257, partial [Eucalyptus grandis]
Length=272

 Score =   212 bits (539),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 161/206 (78%), Gaps = 5/206 (2%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEIA G D+AES+AQFARRRQRGVCVLSG+G V N
Sbjct  71   PGSKNKPKPPIFVTRDSPNALRSHVMEIANGADIAESVAQFARRRQRGVCVLSGSGTVTN  130

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP APGAVM L GRFEILSL G FLPGP+PPG+TGLT+YLAG QGQVVGGSVVG L
Sbjct  131  VTLRQPTAPGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGSL  190

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VA+GPVMVIAATF+NATYERLP+ ED++    +G   +  P                P  
Sbjct  191  VASGPVMVIAATFSNATYERLPLEEDEEAGSGQGQLGSGSPPGIGGGGGQQQGGMADP--  248

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPY  363
             SS+P+YNL PNL PNGGQL+ H+ Y
Sbjct  249  -SSMPVYNLPPNLLPNGGQLN-HEAY  272



>ref|XP_006589299.1| PREDICTED: putative DNA-binding protein ESCAROLA-like, partial 
[Glycine max]
Length=316

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 171/217 (79%), Gaps = 10/217 (5%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEI GG DVAES+AQFARRRQRGVCVLSG+G+VAN
Sbjct  101  PGSKNKPKPPIFVTRDSPNALRSHVMEITGGADVAESVAQFARRRQRGVCVLSGSGSVAN  160

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP+APGAV+ L GRFEILSL GTFLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  161  VTLRQPSAPGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSL  220

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSR-----GGSAAQLPIDESPPPLAGAEHH  456
            VAAGPVMVIAATFANATYERLP+ EDD+ P S      GG +  LP+             
Sbjct  221  VAAGPVMVIAATFANATYERLPLDEDDEGPSSMVGAQGGGGSPPLPLGIGSSGGG-QLQG  279

Query  455  GLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            G+P+P SSLPLYNL PN     GQ+  H+  AW H R
Sbjct  280  GIPDP-SSLPLYNLPPNGGGG-GQVG-HEALAWAHGR  313



>ref|XP_007145832.1| hypothetical protein PHAVU_007G271800g [Phaseolus vulgaris]
 gb|ESW17826.1| hypothetical protein PHAVU_007G271800g [Phaseolus vulgaris]
Length=268

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 153/222 (69%), Positives = 167/222 (75%), Gaps = 18/222 (8%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG DVAES+AQFARRRQRGVCVLSG+G+VAN
Sbjct  45   PGSKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGSVAN  104

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ L GRFEILSL G FLPGP+PPGATGLTVYLAG QGQVVGGSVVGPL
Sbjct  105  VTLRQPAAPGAVVALHGRFEILSLTGAFLPGPAPPGATGLTVYLAGGQGQVVGGSVVGPL  164

Query  620  vaagpvmVIAATFANATYERLPI------------LEDDDLPDSRGGSAAQLPIDESPPP  477
            VAAGPVM+IAATFANATYERLP+                 L  S  G       D     
Sbjct  165  VAAGPVMIIAATFANATYERLPLEEEDEDGGGGSVQGGSTLGGSPPGIGGGGGGDGGGSH  224

Query  476  LAGAEHHGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQH  351
            L G    G+P+P SSLPLYNL PNL  NGG    H+ +AW H
Sbjct  225  LPG----GIPDP-SSLPLYNLPPNLLSNGGGQVGHEAFAWAH  261



>gb|KHN30735.1| Putative DNA-binding protein ESCAROLA [Glycine soja]
Length=290

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 171/217 (79%), Gaps = 10/217 (5%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEI GG DVAES+AQFARRRQRGVCVLSG+G+VAN
Sbjct  75   PGSKNKPKPPIFVTRDSPNTLRSHVMEITGGADVAESVAQFARRRQRGVCVLSGSGSVAN  134

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP+APGAV+ L GRFEILSL GTFLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  135  VTLRQPSAPGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSL  194

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSR-----GGSAAQLPIDESPPPLAGAEHH  456
            VAAGPVMVIAATFANATYERLP+ EDD+ P S      GG +  LP+             
Sbjct  195  VAAGPVMVIAATFANATYERLPLDEDDEGPSSMVGAQGGGGSPPLPLGIGSSGGG-QLQG  253

Query  455  GLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            G+P+P SSLPLYNL PN     GQ+  H+  AW H R
Sbjct  254  GIPDP-SSLPLYNLPPNGGGG-GQVG-HEALAWAHGR  287



>ref|XP_010435119.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=283

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 170/216 (79%), Gaps = 14/216 (6%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHV+EI+ G+DVA++IA F+RRRQRGVCVLSG G+VAN
Sbjct  74   PGSKNKPKPPIFVTRDSPNALRSHVLEISDGSDVADTIAHFSRRRQRGVCVLSGTGSVAN  133

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQ A PG V+ LQGRFEILSL G FLPGPSPPG+TGLTVYLAGVQGQVVGGSVVGPL
Sbjct  134  VTLRQAATPGGVVSLQGRFEILSLTGAFLPGPSPPGSTGLTVYLAGVQGQVVGGSVVGPL  193

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +A G VMVIAATF+NATYERLP+ E++D     GGS       +SPP +  +    LP+P
Sbjct  194  LAIGSVMVIAATFSNATYERLPMEEEED----GGGSRPIHGGGDSPPGMGSS----LPDP  245

Query  440  S---SSLPLYNLTPNLFPNG-GQLSPHDPYAWQHPR  345
            S    S P YN+ P+L PNG GQL  H+PY W H R
Sbjct  246  SVMAGSGPGYNMPPHLIPNGAGQLG-HEPYTWVHAR  280



>ref|XP_009401827.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=270

 Score =   209 bits (533),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 164/212 (77%), Gaps = 16/212 (8%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIF+TRD+PN LRSHVME+A G DVA+ IAQFARRRQ GV VLSG GAVAN
Sbjct  70   PGSKNKPKPPIFITRDSPNALRSHVMEVAAGADVADCIAQFARRRQCGVSVLSGAGAVAN  129

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPG+V+ L GRFEILSL GTFLPGP+PPG +GL VYLAG QGQVVGG+VVG L
Sbjct  130  VTLRQPAAPGSVVALHGRFEILSLTGTFLPGPAPPGTSGLAVYLAGGQGQVVGGTVVGSL  189

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +A GPVMV+AATFA ATYERLP+ E+D+      G+ A LP       L G    GLP+P
Sbjct  190  IATGPVMVVAATFATATYERLPLEEEDEA----AGANAGLPSS-----LTG----GLPDP  236

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
             S L +Y+L PNL PNGGQL  HD  AW H R
Sbjct  237  -SLLNMYSLPPNLMPNGGQLG-HDALAWAHAR  266



>ref|XP_010440458.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=283

 Score =   209 bits (533),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 170/216 (79%), Gaps = 14/216 (6%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+ PIFVTRD+PN LRSHV+EI+ G+DVA++IA F+RRRQRGVCVLSG G+VAN
Sbjct  74   PGSKNKPKAPIFVTRDSPNALRSHVLEISDGSDVADTIAHFSRRRQRGVCVLSGTGSVAN  133

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQ AAPG V+ LQGRFEILSL G FLPGPSPPG+TGLTVYLAGVQGQVVGGSVVGPL
Sbjct  134  VTLRQAAAPGGVVSLQGRFEILSLTGAFLPGPSPPGSTGLTVYLAGVQGQVVGGSVVGPL  193

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +A G VMVIAATF+NATYERLP+ E++D     GGS       +SPP +  +    LP+P
Sbjct  194  LAIGSVMVIAATFSNATYERLPMEEEED----GGGSRPIHGGGDSPPGIGNS----LPDP  245

Query  440  S---SSLPLYNLTPNLFPNG-GQLSPHDPYAWQHPR  345
            S    S P YN+ P+L PNG GQL  H+PY W H R
Sbjct  246  SVMAGSGPGYNMPPHLIPNGAGQLG-HEPYTWVHAR  280



>ref|NP_567432.1| AT-hook motif nuclear-localized protein 20 [Arabidopsis thaliana]
 dbj|BAC43296.1| unknown protein [Arabidopsis thaliana]
 gb|AAP21231.1| At4g14465 [Arabidopsis thaliana]
 dbj|BAE99903.1| hypothetical protein [Arabidopsis thaliana]
 tpd|FAA00291.1| TPA: AT-hook motif nuclear localized protein 20 [Arabidopsis 
thaliana]
 gb|AEE83448.1| AT-hook motif nuclear-localized protein 20 [Arabidopsis thaliana]
Length=281

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 166/213 (78%), Gaps = 10/213 (5%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+ PIFVTRD+PN LRSHV+EI+ G+DVA++IA F+RRRQRGVCVLSG G+VAN
Sbjct  74   PGSKNKPKAPIFVTRDSPNALRSHVLEISDGSDVADTIAHFSRRRQRGVCVLSGTGSVAN  133

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQ AAPG V+ LQGRFEILSL G FLPGPSPPG+TGLTVYLAGVQGQVVGGSVVGPL
Sbjct  134  VTLRQAAAPGGVVSLQGRFEILSLTGAFLPGPSPPGSTGLTVYLAGVQGQVVGGSVVGPL  193

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +A G VMVIAATF+NATYERLP+ E++D     GG + Q+      PP  G+    LP+ 
Sbjct  194  LAIGSVMVIAATFSNATYERLPMEEEED-----GGGSRQIHGGGDSPPRIGSN---LPDL  245

Query  440  SS-SLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            S  + P YN+ P+L PNG     H+PY W H R
Sbjct  246  SGMAGPGYNMPPHLIPNGAGQLGHEPYTWVHAR  278



>ref|XP_010026866.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Eucalyptus 
grandis]
Length=303

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 164/217 (76%), Gaps = 7/217 (3%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN ++SHVME+A G DVAE +AQFARRRQRGVCVLSG+G VAN
Sbjct  85   PGSKNKPKPPIFVTRDSPNSMKSHVMEVASGADVAECLAQFARRRQRGVCVLSGSGTVAN  144

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ L GRFEILSL GTFLPGPSPPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  145  VTLRQPAAPGAVVALHGRFEILSLTGTFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGSL  204

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLA-----GAEHH  456
            VAAGPVMVI ATFANATYERLP+ E++D   + GG   QL      PP A          
Sbjct  205  VAAGPVMVIGATFANATYERLPLDEEEDGNTANGGGQGQLSGSGGSPPTAVSNGNNQSQQ  264

Query  455  GLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            GL    S+L LYNL P+   NG   +  D +AW H R
Sbjct  265  GLAADPSTLLLYNLPPSFHVNGTHTN-QDAHAWTHVR  300



>ref|XP_009379018.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=288

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 170/226 (75%), Gaps = 15/226 (7%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG DVAES+AQFARRRQRGVCVLSG+G+VAN
Sbjct  60   PGSKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGSVAN  119

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ L GRFEILSL+G FLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  120  VTLRQPAAPGAVVALHGRFEILSLSGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSL  179

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHG----  453
            VAAGPVMV+AATFANATYERLP+ ED++   S GG              +     G    
Sbjct  180  VAAGPVMVVAATFANATYERLPLEEDEEGGGSGGGGGGHNNGGSPTGGGSSGAQLGSGGH  239

Query  452  -----LPEPSSSLP---LYNLTPNLFPNGGQLS-PHDPYA-WQHPR  345
                 LP+PSS LP    ++L PNL PNGG     H+ YA W H R
Sbjct  240  QQQQQLPDPSSGLPNIYSHHLPPNLIPNGGHGHLGHEAYANWAHSR  285



>emb|CDY12779.1| BnaC04g28620D [Brassica napus]
Length=282

 Score =   207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 168/214 (79%), Gaps = 7/214 (3%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+ P+FVTRD+PN L SHVMEI+ G+DVA++IA F+RRRQRGVCV+SG G+VAN
Sbjct  70   PGSKNKPKAPVFVTRDSPNALHSHVMEISDGSDVADTIAHFSRRRQRGVCVISGTGSVAN  129

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQ AAPG V+ LQGRFEILSL G FLPGP+PPG+TGLTVYLAGVQGQV+GGSVVGPL
Sbjct  130  VTLRQAAAPGGVVSLQGRFEILSLTGAFLPGPAPPGSTGLTVYLAGVQGQVLGGSVVGPL  189

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VA G VMVIAATF+NATYERLPI +++D      G + Q+      PP  G+    LP+P
Sbjct  190  VAIGSVMVIAATFSNATYERLPIEDEEDGGGGAVGGSRQIHGGGDSPPGIGSS---LPDP  246

Query  440  SS-SLPLYNLTPNLFPNG-GQLSPHDPYAWQHPR  345
            S  + P YNL P+L PNG GQL  H+PY W H R
Sbjct  247  SGMAGPGYNLPPHLIPNGAGQLG-HEPYNWVHAR  279



>gb|AAM65129.1| putative DNA-binding protein [Arabidopsis thaliana]
Length=281

 Score =   207 bits (527),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 168/214 (79%), Gaps = 12/214 (6%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+ PIFVTRD+PN LRSHV+EI+ G+DVA++IA F+RRRQRGVCVLSG G+VAN
Sbjct  74   PGSKNKPKAPIFVTRDSPNALRSHVLEISDGSDVADTIAHFSRRRQRGVCVLSGTGSVAN  133

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            V LRQ AAPG V+ LQGRFEILSL G FLPGPSPPG+TGLTVYLAGVQGQVVGGSVVGPL
Sbjct  134  VXLRQAAAPGGVVSLQGRFEILSLTGAFLPGPSPPGSTGLTVYLAGVQGQVVGGSVVGPL  193

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +A G VMVIAATF+NATYERLP+ E++D     GG + Q+      PP  G+    LP+ 
Sbjct  194  LAIGSVMVIAATFSNATYERLPMEEEED-----GGGSRQIHGGGDSPPRIGSN---LPDL  245

Query  440  SS-SLPLYNLTPNLFPNG-GQLSPHDPYAWQHPR  345
            S  + P YN+ P+L PNG GQL  H+PY W H R
Sbjct  246  SGMAGPGYNMPPHLIPNGAGQLG-HEPYTWVHAR  278



>ref|XP_008391057.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=281

 Score =   207 bits (527),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 168/221 (76%), Gaps = 15/221 (7%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFV RD+PN LRSHVME+A GTDVAES+AQFARRRQRG+C+LSG+G+VAN
Sbjct  59   PGSKNKPKPPIFVXRDSPNSLRSHVMEVASGTDVAESVAQFARRRQRGMCILSGSGSVAN  118

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ L GRFEILSL+G FLPGP+PPG TGLTVYLAG QGQVVGGSV+G L
Sbjct  119  VTLRQPAAPGAVVXLHGRFEILSLSGAFLPGPAPPGFTGLTVYLAGGQGQVVGGSVMGSL  178

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPL----AGAEHH-  456
            VAAGPVMV AATFANATYERLP+ ED++     GG                  +G  HH 
Sbjct  179  VAAGPVMVXAATFANATYERLPLEEDEEGGGGGGGHNNGGSPTGGGSSGTQLGSGGHHHQ  238

Query  455  --GLPEPSSSLP---LYNLTPNLFPNG--GQLSPHDPYA-W  357
               LP+PSS LP    Y+L PNL PNG  GQL  H+ YA W
Sbjct  239  QQQLPDPSSGLPNIYSYHLPPNLIPNGGHGQLG-HEAYANW  278



>ref|XP_008794313.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=294

 Score =   207 bits (528),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 164/212 (77%), Gaps = 18/212 (8%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIF+TRD+PN LRSHVME+AGG DVAE IAQFARRRQRGVCVLSG GAVA+
Sbjct  97   PGSKNKPKPPIFITRDSPNALRSHVMEVAGGADVAECIAQFARRRQRGVCVLSGTGAVAD  156

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            V LRQPAA GAV+ L GRFEILSL G FLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  157  VALRQPAAAGAVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSL  216

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +AAGPV V+AATFANATYERLP+ ++++     GG   QLP     P   GA   GLP+P
Sbjct  217  LAAGPVTVVAATFANATYERLPLDDEEE-----GG--GQLP--GGSPTAIGA---GLPDP  264

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
             SS P+YNL  NL    G    HD +AW H R
Sbjct  265  -SSFPIYNLPANLLAQLG----HDAFAWAHVR  291



>ref|XP_010450033.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=283

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 169/216 (78%), Gaps = 14/216 (6%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+ PIFVTRD+PN LRSHV+EI+ G+DVA++IA F+RRRQRGVCVLSG G+VAN
Sbjct  74   PGSKNKPKAPIFVTRDSPNALRSHVLEISDGSDVADTIAHFSRRRQRGVCVLSGTGSVAN  133

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQ + PG V+ LQGRFEILSL G FLPGPSPPG+TGLTVYLAGVQGQVVGGSVVGPL
Sbjct  134  VTLRQASTPGGVVSLQGRFEILSLTGAFLPGPSPPGSTGLTVYLAGVQGQVVGGSVVGPL  193

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +A G VMVIAATF+NATYERLP+ E++D     GGS       +SPP +  +    LP+P
Sbjct  194  LAIGSVMVIAATFSNATYERLPMEEEED----GGGSRPIHGGGDSPPGIGNS----LPDP  245

Query  440  S---SSLPLYNLTPNLFPNG-GQLSPHDPYAWQHPR  345
            S    S P YN+ P+L PNG GQL  H+PY W H R
Sbjct  246  SVMAGSGPGYNMPPHLIPNGAGQLG-HEPYTWVHAR  280



>ref|XP_006285829.1| hypothetical protein CARUB_v10007306mg [Capsella rubella]
 gb|EOA18727.1| hypothetical protein CARUB_v10007306mg [Capsella rubella]
Length=284

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 169/217 (78%), Gaps = 15/217 (7%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+ PIFVTRD+PN LRSHV+EI+ G+DVAE+IA F+RRRQRGVCVLSG G+VAN
Sbjct  74   PGSKNKPKAPIFVTRDSPNALRSHVLEISDGSDVAETIAHFSRRRQRGVCVLSGTGSVAN  133

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQ AA G V+ LQGRFEILSL G FLPGPSPPG+TGLTVYLAGVQGQVVGGSVVGPL
Sbjct  134  VTLRQAAAAGGVVSLQGRFEILSLTGAFLPGPSPPGSTGLTVYLAGVQGQVVGGSVVGPL  193

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +A G VMVIAATF+NATYERLP+ E++D     GG + Q+      PP  G+    LP+P
Sbjct  194  LAIGSVMVIAATFSNATYERLPMEEEED-----GGGSRQVQGGGDSPPGIGSS---LPDP  245

Query  440  ---SSSLPLYNLT-PNLFPNG-GQLSPHDPYAWQHPR  345
               + + P YN+  P+L PNG GQL  H+PY W H R
Sbjct  246  PGMAGTGPGYNMAPPHLIPNGAGQLG-HEPYTWVHAR  281



>ref|XP_009383960.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=257

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 173/215 (80%), Gaps = 7/215 (3%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PP+FVTRD+PN LRSHVME+AGG+D+AESIAQFARRRQRGVCVLS  G V+N
Sbjct  43   PGSKNKPKPPVFVTRDSPNALRSHVMEVAGGSDIAESIAQFARRRQRGVCVLSCAGTVSN  102

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            V LRQP+APGAV+ L GRFEILSL GTFLPGPSPPG TGLTVYLAG QGQVVGGSVVG L
Sbjct  103  VALRQPSAPGAVVALHGRFEILSLTGTFLPGPSPPGTTGLTVYLAGGQGQVVGGSVVGSL  162

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHG-LPE  444
            +AAGPVMVIA+TFANATYERLP+ E D++P   GG    LP   + P + GA   G LP+
Sbjct  163  IAAGPVMVIASTFANATYERLPLEEGDEIPGGGGGIPEHLPGGLA-PLMPGASGPGRLPD  221

Query  443  PSSSLPLYNLTPNLFPN--GGQLSPHDPYAWQHPR  345
            P S+LP+YNL P++  +  GGQL  H+ + W H R
Sbjct  222  P-SALPIYNLPPHMAHDEVGGQLG-HEAFGWAHAR  254



>ref|XP_010262897.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=360

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 164/213 (77%), Gaps = 9/213 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPI +TR++PN LRSHV+EI+ G+DV ESIA FARRRQRGVCVLSG+G V N
Sbjct  150  PGSKNKPKPPIIITRESPNALRSHVLEISSGSDVVESIATFARRRQRGVCVLSGSGVVTN  209

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAA GAV+ L GRFEILSL+G FLP PSPPGA+GLTVYLAG QGQVVGGSVVG L
Sbjct  210  VTLRQPAASGAVITLHGRFEILSLSGAFLPAPSPPGASGLTVYLAGGQGQVVGGSVVGAL  269

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLP-IDESPPPLAGAEHHGLPE  444
            +A+GPVMVIAATFANATYERLPI    D P   G    Q   ++     ++ ++ H LP+
Sbjct  270  MASGPVMVIAATFANATYERLPI---KDEPAGEGMQLQQTSGVNSGTSGISASQSHVLPD  326

Query  443  PSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            P SSLP+YNL PNL  NG    PHD + W  PR
Sbjct  327  P-SSLPIYNLPPNLLTNGQM--PHDVF-WAPPR  355



>ref|XP_004302076.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=306

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 163/214 (76%), Gaps = 10/214 (5%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEIA G D+AES+AQFAR RQRGVCV+SG+G V N
Sbjct  91   PGSKNKPKPPIFVTRDSPNALRSHVMEIANGADIAESVAQFARARQRGVCVMSGSGTVTN  150

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP+APGAVM L GRFEILSL G FLPGP+PPGATG+T+YLAG QGQVVGGSVVGPL
Sbjct  151  VTLRQPSAPGAVMALHGRFEILSLTGAFLPGPAPPGATGMTIYLAGGQGQVVGGSVVGPL  210

Query  620  vaagpvmVIAATFANATYERLPI-LEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPE  444
            VA+GPVMVIAATF+NATYERLP+  E+DD P      A                   L +
Sbjct  211  VASGPVMVIAATFSNATYERLPLDQEEDDQP-----PAPNSGQPGGGGSSPPGIGGSLGD  265

Query  443  PSSSLP--LYNLTPNLFPNGGQLSPHDPYA-WQH  351
            P+SS+P  +YNL P+L PNGG    H+ Y+ W H
Sbjct  266  PNSSMPPGVYNLPPSLVPNGGGQLSHEAYSNWAH  299



>ref|XP_002870310.1| hypothetical protein ARALYDRAFT_493459 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46569.1| hypothetical protein ARALYDRAFT_493459 [Arabidopsis lyrata subsp. 
lyrata]
Length=273

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 166/208 (80%), Gaps = 12/208 (6%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+ PIFVTRD+PN LRSHV+EI+ G+DVAE+IA F+RRRQRGVCVLSG G+VAN
Sbjct  74   PGSKNKPKAPIFVTRDSPNALRSHVLEISDGSDVAETIAHFSRRRQRGVCVLSGTGSVAN  133

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQ AAPG V+ LQGRFEILSL G FLPGPSPPG+TGLTVYLAGVQGQVVGGSVVGPL
Sbjct  134  VTLRQAAAPGGVVSLQGRFEILSLTGAFLPGPSPPGSTGLTVYLAGVQGQVVGGSVVGPL  193

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +A G VMVIAATF+NATYERLP+ E++D     GG + Q+      PP  G+    LP+ 
Sbjct  194  LAIGSVMVIAATFSNATYERLPMEEEED-----GGGSRQIHGGGDSPPGIGSS---LPDL  245

Query  440  SS-SLPLYNLTPNLFPNG-GQLSPHDPY  363
            S  + P YN+ P+L PNG GQL  H+PY
Sbjct  246  SGMAGPGYNMPPHLIPNGAGQLG-HEPY  272



>ref|XP_010257112.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=395

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 164/208 (79%), Gaps = 9/208 (4%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI +TR++PN LRSHV+EI+ G+DVAESIA FARRRQRGVCVLSG+G V NV
Sbjct  187  GSKNKPKPPIIITRESPNALRSHVLEISSGSDVAESIATFARRRQRGVCVLSGSGIVTNV  246

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPAAPGAV+ L GRFEILSL+G FLP PSPPGATGLTVYL+G QGQVVGGSVVG LV
Sbjct  247  TLRQPAAPGAVVSLHGRFEILSLSGAFLPAPSPPGATGLTVYLSGGQGQVVGGSVVGALV  306

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLP-IDESPPPLAGAEHHGLPEP  441
            A+GPVMVIAATF NATYERLPI   +D P   G    Q   ++     ++ ++ H LP+ 
Sbjct  307  ASGPVMVIAATFTNATYERLPI---EDEPAGEGIQLQQSSGVNSGSTGISASQPHTLPD-  362

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAW  357
            SSS+P+YNL PNL PNG    PHD + W
Sbjct  363  SSSMPIYNLPPNLLPNGQM--PHDVF-W  387



>ref|XP_004139388.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 ref|XP_004156496.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 gb|KGN60776.1| hypothetical protein Csa_2G010120 [Cucumis sativus]
Length=293

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 163/214 (76%), Gaps = 12/214 (6%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PPIFVTRD+PN L+SHVMEI+ G D+AES+AQFARRRQRGV VLSG+G V NVT
Sbjct  79   SKNKPKPPIFVTRDSPNALKSHVMEISNGADIAESVAQFARRRQRGVSVLSGSGTVTNVT  138

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQP+APGAV+ LQGRFEILSL GTFLPGP+PPG+TGLT+YLAG QGQVVGGSVVGPL A
Sbjct  139  LRQPSAPGAVLALQGRFEILSLTGTFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGPLTA  198

Query  614  agpvmVIAATFANATYERLPI----LEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLP  447
            AGPVMVIAATF+NATYERLP+                +      D SP  + G    G+ 
Sbjct  199  AGPVMVIAATFSNATYERLPLEEEEEGGGVGAQGHTSAGGGGAGDGSPQGIGG----GVG  254

Query  446  EPSSSLPLYNLTPNLFPN--GGQLSPHDPYAWQH  351
            +PS+  PLYNL PNL PN  GGQL+  + Y+W H
Sbjct  255  DPSAMTPLYNLPPNLLPNGGGGQLN-QEAYSWAH  287



>ref|XP_008456342.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
Length=293

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 168/217 (77%), Gaps = 18/217 (8%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PPIFVTRD+PN L+SHVMEI+ G D+AES+AQFARRRQRGV VLSG+G V NVT
Sbjct  79   SKNKPKPPIFVTRDSPNALKSHVMEISNGADIAESVAQFARRRQRGVSVLSGSGTVTNVT  138

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQP+APGAV+ LQGRFEILSL GTFLPGP+PPG+TGLT+YLAG QGQVVGGSVVGPL A
Sbjct  139  LRQPSAPGAVLALQGRFEILSLTGTFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGPLTA  198

Query  614  agpvmVIAATFANATYERLPILEDDDLP-------DSRGGSAAQLPIDESPPPLAGAEHH  456
            AGPVMVIAATF+NATYERLP+ E+++          S GG A     D SP  + G    
Sbjct  199  AGPVMVIAATFSNATYERLPLEEEEEGGGVGAQGHTSAGGGAG----DSSPQGIGGGVGG  254

Query  455  GLPEPSSSLPLYNLTPNLFPN--GGQLSPHDPYAWQH  351
               +PS+  PLYNL PNL PN  GGQ++  + Y+W H
Sbjct  255  ---DPSAMTPLYNLPPNLLPNGGGGQMN-QEAYSWAH  287



>ref|XP_006588553.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=230

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 139/148 (94%), Gaps = 1/148 (1%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG DVAES+AQFARRRQRGVCVLSG+G+VAN
Sbjct  48   PGSKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGSVAN  107

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP+APGAV+ L GRFEILSL G FLPGP+PPGATGLTVYLAG QGQVVGGSVVG L
Sbjct  108  VTLRQPSAPGAVVALHGRFEILSLTGAFLPGPAPPGATGLTVYLAGGQGQVVGGSVVGSL  167

Query  620  vaagpvmVIAATFANATYERLPILEDDD  537
            VAAGPVMVIAATFANATYERLP+ E++D
Sbjct  168  VAAGPVMVIAATFANATYERLPLEEEED  195



>ref|XP_006350955.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=297

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 164/223 (74%), Gaps = 14/223 (6%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN LRSHVME+A G DVAESIAQFAR+RQRGVCVLS  G V NV
Sbjct  73   GSKNKPKPPIFVTRDSPNALRSHVMEVANGADVAESIAQFARKRQRGVCVLSATGTVTNV  132

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQP+APGAVM L GRFEILSL G FLPGP+PPG+TGLT+YLAG QGQVVGGSVVG LV
Sbjct  133  TLRQPSAPGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGSLV  192

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPE--  444
            A+GPVMVIA+TF+NATYERLP+ E+++   +                 +G    G  +  
Sbjct  193  ASGPVMVIASTFSNATYERLPLEEEEEGGGTAAQGQLGGGGSPPGMGGSGGGGGGQQQQG  252

Query  443  ----------PSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
                      PSS++P+YNL PNL PNGGQ++ H+ + W H R
Sbjct  253  GGGGGGMGDIPSSNMPVYNLPPNLLPNGGQMN-HEAFGWAHGR  294



>ref|XP_004249915.1| PREDICTED: putative DNA-binding protein ESCAROLA [Solanum lycopersicum]
Length=294

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 160/220 (73%), Gaps = 11/220 (5%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN LRSHVME+A G DVAESIAQFAR+RQRGVCVLS  G V NV
Sbjct  73   GSKNKPKPPIFVTRDSPNALRSHVMEVANGADVAESIAQFARKRQRGVCVLSATGTVTNV  132

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQP+APGAVM L GRFEILSL G FLPGP+PPG+TGLT+YLAG QGQVVGGSVVG LV
Sbjct  133  TLRQPSAPGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGSLV  192

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPE--  444
            A+GPVMVIA+TF+NATYERLP+ E+++                 P               
Sbjct  193  ASGPVMVIASTFSNATYERLPLEEEEEGGGPAAQGQLGGGGGSPPGMGGSGGGQQQQGGG  252

Query  443  -------PSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
                   PSS++P+YNL PNL PNGGQ++ H+ + W H R
Sbjct  253  GGGMGDIPSSNMPVYNLPPNLLPNGGQMN-HEAFGWAHGR  291



>ref|XP_006414705.1| hypothetical protein EUTSA_v10025929mg [Eutrema salsugineum]
 gb|ESQ56158.1| hypothetical protein EUTSA_v10025929mg [Eutrema salsugineum]
Length=283

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 166/216 (77%), Gaps = 10/216 (5%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+ PIFVTRD+PN LRSHVMEI+ G+DVA++IA F+RRRQRGVCVLSG G+VAN
Sbjct  70   PGSKNKPKAPIFVTRDSPNALRSHVMEISDGSDVADTIAHFSRRRQRGVCVLSGTGSVAN  129

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQ AAPG V+ LQGRFEILSL G FLPGP+PPG+TGLTVYLAGVQGQVVGGSVVG L
Sbjct  130  VTLRQAAAPGGVVSLQGRFEILSLTGAFLPGPAPPGSTGLTVYLAGVQGQVVGGSVVGSL  189

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPID---ESPPPLAGAEHHGL  450
            VA G VMVIAATF+NATYERLP +E+++   S GG      I    +SPP +A +    L
Sbjct  190  VAIGSVMVIAATFSNATYERLP-MEEENDGGSGGGDGGSRQIHGGGDSPPGIATS----L  244

Query  449  PEP-SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            P+P   + P YN+  +L PNG     H+PY W H R
Sbjct  245  PDPVGMAGPGYNIPQHLIPNGAGQLGHEPYTWVHAR  280



>gb|KFK22136.1| hypothetical protein AALP_AAs47043U000100 [Arabis alpina]
Length=285

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 166/214 (78%), Gaps = 8/214 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+ PIFVTRD+PN LRSHVMEI+ G+DVA++IA F+RRRQRGVCVLSG G VAN
Sbjct  74   PGSKNKPKAPIFVTRDSPNALRSHVMEISDGSDVADTIAHFSRRRQRGVCVLSGTGTVAN  133

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQ AAPG V+ LQGRFEILSL G FLPGP+PPG+TGLTVYLAGVQGQVVGGSVVGPL
Sbjct  134  VTLRQAAAPGGVVSLQGRFEILSLTGAFLPGPAPPGSTGLTVYLAGVQGQVVGGSVVGPL  193

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VA G VMVIAATF+NATYERLP+ E++D     G        D SPP + G+    L +P
Sbjct  194  VAIGSVMVIAATFSNATYERLPMEEEEDGGGGDGSRPIHGGGDHSPPGIGGS----LADP  249

Query  440  S-SSLPLYNLTPNLFPNG-GQLSPHDPYAWQHPR  345
            S  + P YN+  +L PNG GQL  H+PY W H R
Sbjct  250  SVMAGPGYNIPQHLMPNGSGQLG-HEPYTWVHAR  282



>ref|XP_009139507.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Brassica 
rapa]
 ref|XP_009139508.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Brassica 
rapa]
Length=279

 Score =   199 bits (506),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 167/214 (78%), Gaps = 10/214 (5%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+ P+FVTRD+PN L SHVMEI+ G+DVA++IA F+RRRQRGVCV+SG G+VAN
Sbjct  70   PGSKNKPKAPVFVTRDSPNALHSHVMEISDGSDVADTIAHFSRRRQRGVCVISGTGSVAN  129

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQ AAPG V+ LQGRFEILSL G FLPGP+PPG+TGLTVYLAGVQGQV+GGSVVGPL
Sbjct  130  VTLRQAAAPGGVVSLQGRFEILSLTGAFLPGPAPPGSTGLTVYLAGVQGQVLGGSVVGPL  189

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VA G VMVIAATF+NATYERLPI +++D        + Q+      PP  G+    LP+P
Sbjct  190  VAIGSVMVIAATFSNATYERLPIEDEEDGGGG---GSRQIHGGGDSPPGIGSS---LPDP  243

Query  440  SS-SLPLYNLTPNLFPNG-GQLSPHDPYAWQHPR  345
            S  + P YNL P+L PNG GQL  H+PY W H R
Sbjct  244  SGMAGPGYNLPPHLIPNGAGQLG-HEPYNWVHAR  276



>gb|KEH42696.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=322

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 165/214 (77%), Gaps = 8/214 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKN+P+PPIFVTRD+PN L+SHVME+AGG D+AES+AQFARRRQRGVCVLSG+G+VAN
Sbjct  101  PGSKNRPKPPIFVTRDSPNALKSHVMEVAGGADIAESVAQFARRRQRGVCVLSGSGSVAN  160

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP+APGAV+ L GRFEILSL GTFLPGP+PPG+TGLTVYLAG QGQVVGG VVG L
Sbjct  161  VTLRQPSAPGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGCVVGTL  220

Query  620  vaagpvmVIAATFANATYERLPI----LEDDDLPDSRGG-SAAQLPIDESPPPLAGAE-H  459
            VA GPVM+IAATF NATYERLP+     ++++ P+S GG          SPPP  G +  
Sbjct  221  VAVGPVMLIAATFTNATYERLPLDDDDNDNNEGPNSAGGVQGGGASTGGSPPPGIGHQLQ  280

Query  458  HGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAW  357
             GLP+PSS          L  NGGQ+  H+  AW
Sbjct  281  GGLPDPSSMPLYNLPPNLLPNNGGQMG-HEALAW  313



>ref|XP_007030480.1| AT-hook motif nuclear localized protein 20 [Theobroma cacao]
 gb|EOY10982.1| AT-hook motif nuclear localized protein 20 [Theobroma cacao]
Length=297

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 160/217 (74%), Gaps = 9/217 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKN+P+PPIFVTRD+PN LRSHVMEIA G+DVAE++A FARRRQRGVCVLSG+G V N
Sbjct  75   PGSKNRPKPPIFVTRDSPNALRSHVMEIANGSDVAETLAHFARRRQRGVCVLSGSGTVTN  134

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP+APGAVM L GRFEILSL G FLPGP+PPG+TGLT+YLAG QGQVVGG VVG L
Sbjct  135  VTLRQPSAPGAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGIVVGSL  194

Query  620  vaagpvmVIAATFANATYERLPI------LEDDDLPDSRGGSAAQLPIDESPPPLAGAEH  459
            VA+GPVM+IAATF+NATYERLP+      +         GG +   P           + 
Sbjct  195  VASGPVMIIAATFSNATYERLPLEEEEEGVSGAQGQLGGGGGSGGSPPGIGSGSGGHQQG  254

Query  458  HGLPEPSSSLPLY-NLTPNLFPNGGQLSPHDPYAWQH  351
                   S LP+Y NL PNL PNGGQLS H+ YAW H
Sbjct  255  GIGGADGSGLPVYNNLPPNLVPNGGQLS-HEAYAWAH  290



>gb|KDP23697.1| hypothetical protein JCGZ_23530 [Jatropha curcas]
Length=285

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 163/211 (77%), Gaps = 6/211 (3%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN L+SHVMEIA G+DVAES+A FAR+RQRGVCVLSG+G V N
Sbjct  79   PGSKNKPKPPIFVTRDSPNALKSHVMEIANGSDVAESLASFARKRQRGVCVLSGSGMVTN  138

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTL+QP+APGAVM L GRFEILSL G FLPGP+PPGATGLT+YLAG QGQVVGGSVVG L
Sbjct  139  VTLKQPSAPGAVMALHGRFEILSLTGAFLPGPAPPGATGLTIYLAGGQGQVVGGSVVGSL  198

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VA+GPVMVIAATF+NATYERLP+ E+++      G                    G+ +P
Sbjct  199  VASGPVMVIAATFSNATYERLPLEEEEEGGSGAQGQIGGGSGGGG----GEGSGGGMGDP  254

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHP  348
            ++S P YNL PN+ PNGGQL+  + + W+ P
Sbjct  255  ATSTPAYNLPPNMVPNGGQLN-LEGFGWRPP  284



>ref|XP_010102254.1| hypothetical protein L484_024535 [Morus notabilis]
 gb|EXB93197.1| hypothetical protein L484_024535 [Morus notabilis]
Length=292

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 162/213 (76%), Gaps = 7/213 (3%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEIA G D+A+S+AQFARRRQRGVCVLSG+G VAN
Sbjct  76   PGSKNKPKPPIFVTRDSPNALRSHVMEIANGADIADSVAQFARRRQRGVCVLSGSGTVAN  135

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP+AP AV+ L GRFEILSL G FLPGPSPPG+TGLT+YLAG QGQVVGGSVVGPL
Sbjct  136  VTLRQPSAPSAVVALHGRFEILSLTGAFLPGPSPPGSTGLTIYLAGGQGQVVGGSVVGPL  195

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VAAGPVMVIAATF+NATYERLP+ E+++                      G    G+ EP
Sbjct  196  VAAGPVMVIAATFSNATYERLPLEEEEEGGVGGSSPGIGGSGGHQ---SGGGGGGGMQEP  252

Query  440  -SSSLPLYNLTPNLFPNG--GQLSPHDPYAWQH  351
             SS +P+YNL PNL  NG  GQLS    + W H
Sbjct  253  VSSGMPVYNLAPNLLSNGAAGQLSHDQAFPWPH  285



>gb|KEH41146.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=359

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 145/223 (65%), Positives = 166/223 (74%), Gaps = 16/223 (7%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN L+SHVME++ G DVAES+AQFARRRQRGVCVLSG+G+VAN
Sbjct  133  PGSKNKPKPPIFVTRDSPNSLKSHVMEVSSGADVAESVAQFARRRQRGVCVLSGSGSVAN  192

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ L GRF+ILSL G FLPGP+PPGATGLTVYLAG QGQVVGGSVVGPL
Sbjct  193  VTLRQPAAPGAVVALHGRFDILSLTGAFLPGPAPPGATGLTVYLAGGQGQVVGGSVVGPL  252

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGA--------  465
            +AAGPVMVIAATFANATYERLP+ ED++     G                          
Sbjct  253  IAAGPVMVIAATFANATYERLPLEEDEEDGGGGGVHGGHQVAGGGGNSSPPGIGSSGGGG  312

Query  464  -----EHHGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQH  351
                 +   LP+P SS+PLYNL PNL PNGG +  H+ + W H
Sbjct  313  GGGHMQSSHLPDP-SSMPLYNLPPNLLPNGGHVG-HEAFPWPH  353



>ref|XP_010940763.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=355

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 164/212 (77%), Gaps = 22/212 (10%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN L SHVME+AGG DVA+SIAQFARRRQRGVCVLSG G VAN
Sbjct  161  PGSKNKPKPPIFVTRDSPNSLHSHVMEVAGGADVADSIAQFARRRQRGVCVLSGAGVVAN  220

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            V LRQPAAPGAV+ L GRFEILSL GTFLPGPSPPG+TGLTVYLAG QGQVVGGSVVGPL
Sbjct  221  VGLRQPAAPGAVVALHGRFEILSLTGTFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGPL  280

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +AAG VMV+A+TFANA+YERLP LE+++ P        QLP   +     G+ H GLP+P
Sbjct  281  IAAGSVMVVASTFANASYERLP-LEEEEGP-------GQLPGGSALGMAGGSGHGGLPDP  332

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
             S+LP++NL             HD +AW H R
Sbjct  333  -SALPIFNLG------------HDAFAWAHAR  351



>emb|CDY23160.1| BnaA04g05990D [Brassica napus]
Length=279

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 167/214 (78%), Gaps = 10/214 (5%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+ P+FVTRD+PN L SHVMEI+ G+DVA++IA F+RRRQRGVCV+SG G+VAN
Sbjct  70   PGSKNKPKAPVFVTRDSPNALHSHVMEISDGSDVADTIAHFSRRRQRGVCVISGTGSVAN  129

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQ AAPG V+ LQGRFEILSL G FLPGP+PPG+TGLTVYLAGVQGQV+GGSVVGPL
Sbjct  130  VTLRQAAAPGGVVSLQGRFEILSLTGAFLPGPAPPGSTGLTVYLAGVQGQVLGGSVVGPL  189

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VA G VMVIAATF+NATYERLPI +++D        + Q+      PP  G+    LP+P
Sbjct  190  VAIGSVMVIAATFSNATYERLPIEDEEDGGGG---GSRQIHGGGDSPPGIGSS---LPDP  243

Query  440  SS-SLPLYNLTPNLFPNG-GQLSPHDPYAWQHPR  345
            S  + P YNL P+L PNG GQL  H+P+ W H R
Sbjct  244  SGMAGPGYNLPPHLIPNGAGQLG-HEPFNWVHAR  276



>dbj|BAK02851.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=287

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 158/204 (77%), Gaps = 21/204 (10%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PPIFVTRD+PN LRSHVME+AGG DVAESIA F+RRRQRGVCVLSG G VA+V 
Sbjct  81   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESIAHFSRRRQRGVCVLSGAGTVADVA  140

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQPAAPGAV+ L+GRFEILSL GTFLPGPSPPG+TGLTVYLAG QGQVVGGSVVG L A
Sbjct  141  LRQPAAPGAVVALRGRFEILSLTGTFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGALTA  200

Query  614  agpvmVIAATFANATYERLPI---LEDDDLPDSRG----GSAAQLPIDESPPPLAGAEHH  456
            AGPVMVIA+TFANATYERLP+    ED  L  +R     GS   L     PP +AG    
Sbjct  201  AGPVMVIASTFANATYERLPLDDAEEDHQLEAARRHGAPGSGVAL-----PPMMAG----  251

Query  455  GLPEPSS-SLPLYNLTPNLFPNGG  387
               +PS+  +P+Y + PNL P GG
Sbjct  252  ---DPSAPGMPMYGVPPNLMPGGG  272



>gb|AFW74083.1| DNA-binding protein [Zea mays]
Length=245

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 166/213 (78%), Gaps = 20/213 (9%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PPIFVTRD+PN LRSHVME+AGG DVA++IAQF+RRRQRGVCVLSG G VANV L
Sbjct  45   KNKPKPPIFVTRDSPNALRSHVMEVAGGADVADAIAQFSRRRQRGVCVLSGAGTVANVAL  104

Query  788  RQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplvaa  612
            RQP+AP AV+ L+GRFEILSL GTFLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L+AA
Sbjct  105  RQPSAPTAVVALRGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTLIAA  164

Query  611  gpvmVIAATFANATYERLPILEDDDLPD---SRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            GPVMVIA+TFANATYERLP+ E+D+ P    + GG A          PL G    G+ +P
Sbjct  165  GPVMVIASTFANATYERLPLEEEDEGPAPPMASGGGAD---------PLMGG-GLGIADP  214

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPY-AWQHPR  345
             S+LP++NL     P+ GQL   D + +W HPR
Sbjct  215  -SALPMFNLP----PSNGQLGGGDGFPSWAHPR  242



>ref|XP_010935866.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=314

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 163/213 (77%), Gaps = 3/213 (1%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG DVA++IA F+RRRQRGVCVLSG G VAN
Sbjct  100  PGSKNKPKPPIFVTRDSPNALRSHVMEVAGGADVADAIAHFSRRRQRGVCVLSGAGTVAN  159

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            V LRQPAAPGAV+ L GRFEILSL GTFLPGPSPPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  160  VALRQPAAPGAVVALHGRFEILSLTGTFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGSL  219

Query  620  vaagpvmVIAATFANATYERLPI-LEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPE  444
            +AAGPVMV+A+TFANATYERLP+   D +     G         ES P +AG    G   
Sbjct  220  IAAGPVMVVASTFANATYERLPLEGGDHEEEGGPGEGGPGPLPGESVPGMAGGGGPGGLP  279

Query  443  PSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
              S+LP++NL PNL   G QL  HD +AW H R
Sbjct  280  DPSALPMFNLPPNLALGGAQLG-HDAFAWAHAR  311



>ref|XP_006846339.1| hypothetical protein AMTR_s00012p00257450 [Amborella trichopoda]
 gb|ERN08014.1| hypothetical protein AMTR_s00012p00257450 [Amborella trichopoda]
Length=284

 Score =   197 bits (500),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 158/213 (74%), Gaps = 19/213 (9%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PPI +TR++PN LRSHV+E+AGG DVAES+A FARRRQRGVCVLSG+G VANVTL
Sbjct  80   KNKPKPPIIITRESPNALRSHVLEVAGGADVAESVAAFARRRQRGVCVLSGSGVVANVTL  139

Query  788  RQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplvaa  612
            RQPAAPGAV+ L GRFEILSL+G FLP PSPP ATGLTVYLAG QGQVVGGSVVG LVA+
Sbjct  140  RQPAAPGAVVTLHGRFEILSLSGAFLPAPSPPAATGLTVYLAGGQGQVVGGSVVGALVAS  199

Query  611  gpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP---  441
            GPVMVIAATF+NATYERLP+  DDD   S  G           P   G E      P   
Sbjct  200  GPVMVIAATFSNATYERLPL--DDDAESSAQGQLT--------PAAHGGEQGSSVVPGSM  249

Query  440  --SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHP  348
               S +P+YNL PNL PN GQL PHD Y W  P
Sbjct  250  GLQSEMPVYNLPPNLMPN-GQL-PHDVY-WTPP  279



>gb|EMS64253.1| hypothetical protein TRIUR3_00437 [Triticum urartu]
Length=285

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 160/205 (78%), Gaps = 18/205 (9%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG DVAESIA F+RRRQRGVCVL G G VA+
Sbjct  76   PGSKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESIAHFSRRRQRGVCVLRGAGTVAD  135

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            V LRQP+APGAV+ L+GRFEILSL GTFLPGPSPPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  136  VALRQPSAPGAVVALRGRFEILSLTGTFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGAL  195

Query  620  vaagpvmVIAATFANATYERLPI--LEDD----DLPDSRGGSAAQLPIDESPPPLAGAEH  459
             AAGPVMVIA+TFANATYERLP+   E+D    +     G   A  P+   PP +AG   
Sbjct  196  TAAGPVMVIASTFANATYERLPLDDAEEDHHQLEAARRHGAPGAGAPL---PPMMAG---  249

Query  458  HGLPEPSSS-LPLYNLTPNLFPNGG  387
                +PS++ +P+Y + PNL P GG
Sbjct  250  ----DPSAAGMPMYGVPPNLMPGGG  270



>ref|XP_002319649.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE95572.1| DNA-binding family protein [Populus trichocarpa]
Length=284

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 163/212 (77%), Gaps = 10/212 (5%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN L+SHVMEIA G+D+AE++A FAR+RQRGVCVLSG+G V N
Sbjct  79   PGSKNKPKPPIFVTRDSPNALKSHVMEIASGSDIAENLACFARKRQRGVCVLSGSGMVTN  138

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTL+QP+A GAVM L GRFEILSL G FLPGP+PPGATGLT+YLAG QGQVVGGSVVG L
Sbjct  139  VTLKQPSASGAVMALHGRFEILSLTGAFLPGPAPPGATGLTIYLAGGQGQVVGGSVVGSL  198

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VA+GPVMVIAATF+NATYERLP+ ++++      G                    G+ +P
Sbjct  199  VASGPVMVIAATFSNATYERLPLEDEEEGSGGAQGQLGGGNGSGE------GNGGGMGDP  252

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            ++S+P+Y L PN+ PN GQL+ H+ Y W H R
Sbjct  253  ATSMPVYQL-PNMVPN-GQLN-HEGYGWAHGR  281



>ref|XP_009623613.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
 ref|XP_009623614.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=297

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 164/222 (74%), Gaps = 13/222 (6%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN LRSHVME+A G DVAESIAQFAR+RQRGVCVLS  G V NV
Sbjct  74   GSKNKPKPPIFVTRDSPNALRSHVMEVANGADVAESIAQFARKRQRGVCVLSATGTVTNV  133

Query  794  TLRQPAAPG-AVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            TLRQP+APG AVM L GRFEILSL G FLPGP+PPG+TGLT+YLAG QGQVVGGSVVGPL
Sbjct  134  TLRQPSAPGSAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGPL  193

Query  620  vaagpvmVIAATFANATYERLPI----------LEDDDLPDSRGGSAAQLPIDESPPPLA  471
            VA+GPVMVIA+TF+NATYERLP+           +        GGS   +          
Sbjct  194  VASGPVMVIASTFSNATYERLPLEEEEEGSGQAAQGQLGGGGGGGSPPGMGGSGGGGAQQ  253

Query  470  GAEHHGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
                 G+ +PSS++ +YNL PNL PNGGQL+ H+ +AW H R
Sbjct  254  QGGGGGMGDPSSNMSVYNLPPNLLPNGGQLN-HEAFAWAHGR  294



>ref|XP_004497856.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cicer 
arietinum]
Length=333

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 149/234 (64%), Positives = 170/234 (73%), Gaps = 24/234 (10%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN L+SHVME+AGG DVAES+AQFARRRQRGVCVLSG+G+VAN
Sbjct  98   PGSKNKPKPPIFVTRDSPNSLKSHVMEVAGGADVAESVAQFARRRQRGVCVLSGSGSVAN  157

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPA PGAV+ L GRFEILSL G FLPGP+PPGATGLTVYL+G QGQVVGGSVVG L
Sbjct  158  VTLRQPAVPGAVVALHGRFEILSLTGAFLPGPAPPGATGLTVYLSGGQGQVVGGSVVGSL  217

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEH------  459
            +AAGPVMVIAATFANATYERLP+ E+++     GG    +          G  +      
Sbjct  218  IAAGPVMVIAATFANATYERLPLEEEEEEDVGGGGGGGGISAVHGGHVGVGGGNSSPSHG  277

Query  458  -------------HGLPEPSSSLPLYNLTPNLFPNGGQL--SPHDPYA-WQHPR  345
                          GLP+P SSLPLYNL  NL  NGGQ+    H+ +A W H R
Sbjct  278  IGSSGGGGGVHMQGGLPDP-SSLPLYNLPTNLVHNGGQVGGGHHEAFASWPHGR  330



>ref|XP_011038532.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=284

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 163/212 (77%), Gaps = 10/212 (5%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN L+SHVMEIA G+D+AE++A FAR+RQRGVCVLSG+G V N
Sbjct  79   PGSKNKPKPPIFVTRDSPNALKSHVMEIANGSDIAENLACFARKRQRGVCVLSGSGMVTN  138

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTL+QP+A GAVM L GRFEILSL G FLPGP+PPGATGLT+YLAG QGQVVGGSVVG L
Sbjct  139  VTLKQPSASGAVMALHGRFEILSLTGAFLPGPAPPGATGLTIYLAGGQGQVVGGSVVGSL  198

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VA+GPVM+IAATF+NATYERLP+ ++++      G                    G+ +P
Sbjct  199  VASGPVMIIAATFSNATYERLPLEDEEEGSGGAQGQLGGGNGSGE------GNGGGMGDP  252

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            ++S+P+Y L PN+ PN GQL+ H+ Y W H R
Sbjct  253  ATSMPVYQL-PNMVPN-GQLN-HEGYGWAHGR  281



>gb|KDP40294.1| hypothetical protein JCGZ_02292 [Jatropha curcas]
Length=189

 Score =   192 bits (487),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 153/188 (81%), Gaps = 4/188 (2%)
 Frame = -3

Query  902  MEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTLRQPAAPGAVM-LQGRFEILSLA  726
            ME+ GG DVAES+AQFARRRQRGVCVLSG+G+VANVTLRQPAAPGAV+ L GRFEILSL 
Sbjct  1    MEVVGGADVAESVAQFARRRQRGVCVLSGSGSVANVTLRQPAAPGAVVALHGRFEILSLT  60

Query  725  GTFLPGPSPPGATGLTvylagvqgqvvggsvvgplvaagpvmVIAATFANATYERLPILE  546
            G FLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L+AAGPVMVIAATFANATYERLP+ +
Sbjct  61   GAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLIAAGPVMVIAATFANATYERLPLED  120

Query  545  DDDLPDSRGGSAAQLPIDESPPPLAGA-EHHGLPEPSSSLPLYNLTPNLFPNGGQLSPHD  369
            D++   S G    Q   + SPPP+  + +  GLP+P S+LP+YNL PNL PNG QL  HD
Sbjct  121  DEEAAGSGGQGQIQGGANNSPPPIGNSGQQSGLPDP-SALPVYNLPPNLMPNGAQLG-HD  178

Query  368  PYAWQHPR  345
             +AW H R
Sbjct  179  AFAWAHTR  186



>ref|XP_008780228.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=268

 Score =   194 bits (492),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 161/212 (76%), Gaps = 22/212 (10%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIF+TRD+PN L SHVME+ GG DVA++IAQFARRRQRGVCVLSG G VAN
Sbjct  74   PGSKNKPKPPIFITRDSPNALHSHVMEVQGGADVADAIAQFARRRQRGVCVLSGAGIVAN  133

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            V LRQP+APG+V+ L GRFEILSL GTFLPGPSPPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  134  VALRQPSAPGSVVALHGRFEILSLTGTFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGSL  193

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +AAGPVMV+A+TFANATYERLP LE+++ P        QLP   +     G    GLP+P
Sbjct  194  IAAGPVMVVASTFANATYERLP-LEEEEGP-------GQLPGGSALGMAGGTGPGGLPDP  245

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
             S+LP++NL             HD +AW H R
Sbjct  246  -SALPIFNLG------------HDAFAWAHAR  264



>ref|NP_001150826.1| DNA-binding protein [Zea mays]
 gb|ACG40573.1| DNA-binding protein [Zea mays]
Length=245

 Score =   193 bits (490),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 165/213 (77%), Gaps = 20/213 (9%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PPIFVTRD+PN LRSHVME+AGG DVA++IAQF+RRRQRGVCVLSG G VANV L
Sbjct  45   KNKPKPPIFVTRDSPNALRSHVMEVAGGADVADAIAQFSRRRQRGVCVLSGAGTVANVAL  104

Query  788  RQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplvaa  612
            RQP+AP AV+ L+GRFEILSL GTFLPGP+P G+TGLTVYLAG QGQVVGGSVVG L+AA
Sbjct  105  RQPSAPTAVVALRGRFEILSLTGTFLPGPAPXGSTGLTVYLAGGQGQVVGGSVVGTLIAA  164

Query  611  gpvmVIAATFANATYERLPILEDDDLPD---SRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            GPVMVIA+TFANATYERLP+ E+D+ P    + GG A          PL G    G+ +P
Sbjct  165  GPVMVIASTFANATYERLPLEEEDEGPAPPMASGGGAD---------PLMGG-GLGIADP  214

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPY-AWQHPR  345
             S+LP++NL     P+ GQL   D + +W HPR
Sbjct  215  -SALPMFNLP----PSNGQLGGGDGFPSWAHPR  242



>tpg|DAA48555.1| TPA: hypothetical protein ZEAMMB73_420043 [Zea mays]
 tpg|DAA48556.1| TPA: hypothetical protein ZEAMMB73_420043 [Zea mays]
 tpg|DAA48557.1| TPA: hypothetical protein ZEAMMB73_420043 [Zea mays]
 tpg|DAA48558.1| TPA: hypothetical protein ZEAMMB73_420043 [Zea mays]
Length=269

 Score =   194 bits (492),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 166/225 (74%), Gaps = 20/225 (9%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG DVAESIA FARRRQRGVCVLSG G VA+
Sbjct  47   PGSKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESIAHFARRRQRGVCVLSGAGTVAD  106

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            V LRQPAAPGAV+ L+GRFEILSL GTFLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  107  VALRQPAAPGAVVALRGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTL  166

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
             AAGPVMV+A+TFANATYERLP+ + D+ P   G  AAQLP              G+ +P
Sbjct  167  TAAGPVMVMASTFANATYERLPLDDADEEP--AGQQAAQLPPGPG--GGQPMVMGGMADP  222

Query  440  SSSLPLY----NLTPNLFPNGG---------QLSPHDPYAWQHPR  345
             S++P++     + P+L P G          QL  HD  AW H R
Sbjct  223  -SAVPMFGGAGGVPPSLMPAGAAAASSGAGLQLG-HDRLAWAHAR  265



>ref|XP_003570419.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brachypodium 
distachyon]
Length=261

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 150/186 (81%), Gaps = 9/186 (5%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PPIFVTRD+PN LRSHVME+AGG DVA++IA F+RRRQRGVCVLSG G VANV 
Sbjct  56   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVADAIAHFSRRRQRGVCVLSGAGTVANVA  115

Query  791  LRQPAAPG--AVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            LRQP+APG   V L GRFEILSL GTFLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L 
Sbjct  116  LRQPSAPGGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGALT  175

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLP-EP  441
            AAGPVMVIA+TFANATYERLP+ E+D+ P   GG        E    +AG   HG+P +P
Sbjct  176  AAGPVMVIASTFANATYERLPLEEEDEGPVQGGGGV------EQQLGMAGGHGHGVPVDP  229

Query  440  SSSLPL  423
            S+++P+
Sbjct  230  SAAMPM  235



>ref|XP_006487869.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|KDO35907.1| hypothetical protein CISIN_1g022331mg [Citrus sinensis]
Length=299

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 159/217 (73%), Gaps = 7/217 (3%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN L+SHVMEIA G DVAE++A FARRRQRGVCVLSG+G V N
Sbjct  81   PGSKNKPKPPIFVTRDSPNALKSHVMEIANGADVAETLANFARRRQRGVCVLSGSGTVTN  140

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP+ P AVM + GRFEILSL G FLPGP+PPG+TGLT+YLAG QGQVVGGSVVG L
Sbjct  141  VTLRQPSDPSAVMAIHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGSL  200

Query  620  vaagpvmVIAATFANATYERLPILEDDD-----LPDSRGGSAAQLPIDESPPPLAGAEHH  456
            VA+GPVMVIAATF+NATYERLP+ E+++          GG              AG    
Sbjct  201  VASGPVMVIAATFSNATYERLPLDEEEEGGAGAQGPLGGGGGGGSGSSGGGGGGAGGGGG  260

Query  455  GLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            G+ +PS      NL PNL  NGGQLS H+ Y W H R
Sbjct  261  GIGDPSGMGVYNNLPPNLVANGGQLS-HEAYGWAHGR  296



>ref|XP_006442718.1| hypothetical protein CICLE_v10023369mg [Citrus clementina]
 gb|ESR55958.1| hypothetical protein CICLE_v10023369mg [Citrus clementina]
Length=299

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 159/217 (73%), Gaps = 7/217 (3%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN L+SHVMEIA G DVAE++A FARRRQRGVCVLSG+G V N
Sbjct  81   PGSKNKPKPPIFVTRDSPNALKSHVMEIANGADVAETLANFARRRQRGVCVLSGSGTVTN  140

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP+ P A+M + GRFEILSL G FLPGP+PPG+TGLT+YLAG QGQVVGGSVVG L
Sbjct  141  VTLRQPSDPSAIMAIHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGSL  200

Query  620  vaagpvmVIAATFANATYERLPILEDDD-----LPDSRGGSAAQLPIDESPPPLAGAEHH  456
            VA+GPVMVIAATF+NATYERLP+ E+++          GG              AG    
Sbjct  201  VASGPVMVIAATFSNATYERLPLDEEEEGGAGAQGPLGGGGGGGSGSSGGGGGGAGGGGG  260

Query  455  GLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            G+ +PS      NL PNL  NGGQLS H+ Y W H R
Sbjct  261  GIGDPSGMGVYNNLPPNLVANGGQLS-HEAYGWAHGR  296



>ref|XP_004974243.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X1 [Setaria italica]
 ref|XP_004974244.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X2 [Setaria italica]
 ref|XP_004974245.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X3 [Setaria italica]
 ref|XP_004974246.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X4 [Setaria italica]
Length=260

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 146/220 (66%), Positives = 165/220 (75%), Gaps = 17/220 (8%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG DVAESIA FARRRQRGVCVLSG G V +
Sbjct  45   PGSKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESIAHFARRRQRGVCVLSGAGTVTD  104

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            V LRQPAAPGAV+ L+GRFEILSL GTFLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  105  VALRQPAAPGAVVALRGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTL  164

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
             AAGPVMVIA+TFANATYERLP+   D+  +   G AAQLP              G+ +P
Sbjct  165  TAAGPVMVIASTFANATYERLPL---DEAEEESAGQAAQLPPGPG---GGPPLMGGMADP  218

Query  440  SSSLPLY-NLTPNLFPNGG-------QLSPHDPYAWQHPR  345
             S++P++  + PNL P GG       QL  HD  AW H R
Sbjct  219  -SAMPMFGGVPPNLMPGGGGASGAGLQLG-HDGLAWAHAR  256



>ref|XP_004954422.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Setaria 
italica]
Length=274

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 162/211 (77%), Gaps = 18/211 (9%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PPIFVTRD+PN LRSHVME+AGG DVA++IAQF+RRRQRGVCVLSG G VANV 
Sbjct  77   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVADAIAQFSRRRQRGVCVLSGAGTVANVA  136

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQP+APGAV+ L GRFEILSL GTFLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L+A
Sbjct  137  LRQPSAPGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLIA  196

Query  614  agpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPSS  435
            AGPVMVIA+TFANATYERLP+ E++           + P    P PL G   HG+ +P S
Sbjct  197  AGPVMVIASTFANATYERLPLDEEE-----------EGPAPPMPDPLMGG-GHGIADP-S  243

Query  434  SLPLYNLTPNLFPNGGQLSPHDPYAW-QHPR  345
            +LP++NL P+   NG        + W  HPR
Sbjct  244  ALPMFNLPPS---NGQLGGGDGGFPWAAHPR  271



>ref|XP_009784464.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009784466.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009784467.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Nicotiana 
sylvestris]
Length=296

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 161/221 (73%), Gaps = 12/221 (5%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN LRSHVME+A G DVAESIAQFAR+RQRGVCVLS  G V NV
Sbjct  74   GSKNKPKPPIFVTRDSPNALRSHVMEVANGADVAESIAQFARKRQRGVCVLSATGTVTNV  133

Query  794  TLRQPAAPG-AVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            TLRQP+APG AVM L GRFEILSL G FLPGP+PPG+TGLT+YLAG QGQVVGGSVVGPL
Sbjct  134  TLRQPSAPGSAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVGPL  193

Query  620  vaagpvmVIAATFANATYER---------LPILEDDDLPDSRGGSAAQLPIDESPPPLAG  468
            VA+GPVMVIA+TF+NATYER                 L    GG +              
Sbjct  194  VASGPVMVIASTFSNATYERLPLEEEEEGGGQAAQGQLGGGGGGGSPPGMGGSGGGRAQQ  253

Query  467  AEHHGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
                G+ +PSS++P+YNL PNL PNGGQL+ H+ +AW H R
Sbjct  254  GGGGGMGDPSSNMPVYNLPPNLLPNGGQLN-HEAFAWAHGR  293



>ref|XP_008787555.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=349

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 160/212 (75%), Gaps = 3/212 (1%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN LRSHVME+AGG DVA++IAQFARRRQRGVCVLSG G VAN 
Sbjct  136  GSKNKPKPPIFVTRDSPNALRSHVMEVAGGADVADAIAQFARRRQRGVCVLSGAGTVANA  195

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
             LRQPAAPGAV+ L GRFEILSL GTFLPGPSPPG+TGLTVYLAG QGQVVGGSVVG L+
Sbjct  196  ALRQPAAPGAVVALHGRFEILSLTGTFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGSLI  255

Query  617  aagpvmVIAATFANATYER-LPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            AAGPVMV+A+TFANATYER     E+++     G          S P +AG    G    
Sbjct  256  AAGPVMVVASTFANATYERLPLEEEEEEEEGVPGEGGPGPLPGGSLPGMAGGGGPGGLPD  315

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
             SSLP++NL PNL  NG Q   HD +AW H R
Sbjct  316  PSSLPIFNLPPNLALNGAQFG-HDAFAWTHAR  346



>ref|XP_004956262.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Setaria 
italica]
Length=256

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 134/148 (91%), Gaps = 1/148 (1%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG DVAESIA+FARRRQRGVCVLSG G VA+
Sbjct  47   PGSKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESIARFARRRQRGVCVLSGAGTVAD  106

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            V LRQPAAPGAV+ L+G FEILSL GTFLPGPSPPGATGLTVYLAG QGQVVGG VVG L
Sbjct  107  VALRQPAAPGAVVALRGLFEILSLTGTFLPGPSPPGATGLTVYLAGGQGQVVGGIVVGSL  166

Query  620  vaagpvmVIAATFANATYERLPILEDDD  537
             AAGPVMV+A+TFANATYERLP+ E+ D
Sbjct  167  TAAGPVMVMASTFANATYERLPLDEEVD  194



>ref|XP_009384565.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384566.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=237

 Score =   188 bits (477),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 156/212 (74%), Gaps = 20/212 (9%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+ PIF+TRD+PN LRSHVME+AGG DVAE IAQFARRRQ GV VLSG G VAN
Sbjct  41   PGSKNKPKAPIFITRDSPNVLRSHVMEVAGGADVAECIAQFARRRQCGVSVLSGVGTVAN  100

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPGAV+ + GRFEILSL GTFLPGP+ PG+TGLTVYLAG Q QV+GGSVVG L
Sbjct  101  VTLRQPAAPGAVVTMHGRFEILSLTGTFLPGPALPGSTGLTVYLAGEQCQVLGGSVVGSL  160

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +A GPVMV+A TF NATYERLP+  ++++ +   GS   L +D                 
Sbjct  161  LATGPVMVVATTFGNATYERLPLEGEEEVEEEEAGSGGGL-LDP----------------  203

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
             S L +YNL PNL P+GGQL+ HD  A  H R
Sbjct  204  -SLLSMYNLPPNLIPDGGQLA-HDAIARAHAR  233



>ref|NP_001048546.1| Os02g0820800 [Oryza sativa Japonica Group]
 dbj|BAD22878.1| DNA-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAD23110.1| DNA-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAF10460.1| Os02g0820800 [Oryza sativa Japonica Group]
 gb|EAY88054.1| hypothetical protein OsI_09483 [Oryza sativa Indica Group]
Length=266

 Score =   188 bits (478),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 156/190 (82%), Gaps = 11/190 (6%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PPIFVTRD+PN LRSHVME+AGG DVA++IAQF+RRRQRGVCVLSG G VANV 
Sbjct  67   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVADAIAQFSRRRQRGVCVLSGAGTVANVA  126

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQP+APGAV+ L GRFEILSL GTFLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L+A
Sbjct  127  LRQPSAPGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGSLIA  186

Query  614  agpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPSS  435
            AGPVMVIA+TFANATYERLP      L +   GS   +P   + P +AG   HG+ +P S
Sbjct  187  AGPVMVIASTFANATYERLP------LEEEEEGSGPPMP-GGAEPLMAGG--HGIADP-S  236

Query  434  SLPLYNLTPN  405
            +LP++NL P+
Sbjct  237  ALPMFNLPPS  246



>ref|XP_009386251.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=317

 Score =   190 bits (482),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 170/212 (80%), Gaps = 6/212 (3%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PPIFVTRD+P+ LRSHVME++GG DVA+SIAQFARRRQR VCVLSG+G V NV L
Sbjct  105  KNKPKPPIFVTRDSPSALRSHVMEVSGGADVADSIAQFARRRQRAVCVLSGSGTVVNVAL  164

Query  788  RQPAAPG-AVMLQGRFEILSLAGTFL--PGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            RQPAAPG AV L+GRFEILS+ GTFL  PGPSPPG+TGLTVYLAG QGQVVGGSVVGPL+
Sbjct  165  RQPAAPGAAVALRGRFEILSVTGTFLPGPGPSPPGSTGLTVYLAGGQGQVVGGSVVGPLI  224

Query  617  aagpvmVIAATFANATYERLPIL-EDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            AAGPVMV+A+TFANATYERLP++ E+++ PDS GG+  QLP  E      G    GLP+ 
Sbjct  225  AAGPVMVMASTFANATYERLPLVQEEEEGPDSGGGATGQLPGGEPQLMAGGGGSGGLPD-  283

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
             S+LP+ NL PNL PN   +  H+P+ W H R
Sbjct  284  HSALPILNLPPNLAPNVAHVG-HEPFGWAHAR  314



>ref|XP_009372143.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=305

 Score =   189 bits (481),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 163/217 (75%), Gaps = 12/217 (6%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEI+ G D+A S+AQFARRRQRGVCV+SG+G V N
Sbjct  84   PGSKNKPKPPIFVTRDSPNALRSHVMEISNGADIANSVAQFARRRQRGVCVMSGSGTVTN  143

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP+APGAVM L GRFEILSL G FLPGP+PPG+TG+T+YLAG QGQVVGGSVVGPL
Sbjct  144  VTLRQPSAPGAVMALHGRFEILSLTGAFLPGPAPPGSTGMTIYLAGGQGQVVGGSVVGPL  203

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VA+GPVMVIAATF NATYERLP+ E++   +  GG  +            G    G+ +P
Sbjct  204  VASGPVMVIAATFTNATYERLPLEEEE---EQAGGGTSSGTAAGGAGSPPGIGGGGMGDP  260

Query  440  SSSLPLYNLTPNLFPNGG---QLSPHDPYA----WQH  351
            ++   +YN  PNL PNGG   QLS HD  A    W H
Sbjct  261  AALAGVYNFPPNLLPNGGGQTQLS-HDQQAAYSSWAH  296



>ref|XP_010694781.1| PREDICTED: putative DNA-binding protein ESCAROLA [Beta vulgaris 
subsp. vulgaris]
Length=301

 Score =   189 bits (481),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 164/222 (74%), Gaps = 17/222 (8%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PPIFVTRD+PN LRSHVME+AGG DVA+SIA FARRRQRGVCV+S  GAV  VT+
Sbjct  75   KNKPKPPIFVTRDSPNALRSHVMEVAGGADVADSIANFARRRQRGVCVISAAGAVTGVTI  134

Query  788  RQPAA-PG---AVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            RQP+A PG    V L GRFEILSL G FLPGP+PPG+TGLTVYLAG QGQVVGGSVVGPL
Sbjct  135  RQPSAGPGGATVVALHGRFEILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGPL  194

Query  620  vaagpvmVIAATFANATYERLPIL-EDDDLPDSRGGSAAQLP--IDESPPPLAGAEHHGL  450
            +AAGPVMVIAATF+NATYERLP+  ++D+ P   GG++   P    +        +H   
Sbjct  195  IAAGPVMVIAATFSNATYERLPLEDQEDEQPGQVGGASGSPPGHQQQQQQQQQQQQHSMG  254

Query  449  PEPSSSLPLYNLTPNLFPN---------GGQLSPHDPYAWQH  351
             +PSS+L +YNL PNL PN         GGQ+S H+ Y W H
Sbjct  255  GDPSSALGMYNLPPNLLPNGGGSSGGGGGGQIS-HEAYGWNH  295



>ref|XP_003536146.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=280

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 163/215 (76%), Gaps = 17/215 (8%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGS+NKP+PPIFVTRD+PN LRSHVMEIA G D+A+ +AQFARRRQRGV +LSG+G V N
Sbjct  69   PGSRNKPKPPIFVTRDSPNALRSHVMEIAVGADIADCVAQFARRRQRGVSILSGSGTVVN  128

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            V LRQP APGAVM L GRF+ILSL G+FLPGPSPPGATGLT+YLAG QGQ+VGG VVGPL
Sbjct  129  VNLRQPTAPGAVMALHGRFDILSLTGSFLPGPSPPGATGLTIYLAGGQGQIVGGGVVGPL  188

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VAAGPV+V+AATF+NATYERLP LEDDD     GG     P +++  P          E 
Sbjct  189  VAAGPVLVMAATFSNATYERLP-LEDDDQEQHGGGGGGGSPQEKTGGP---------GEA  238

Query  440  SSSLPLY--NLTPNL-FPNGGQLSPHDPYA--WQH  351
            SSS+ +Y  N+ P+L  PNG  L+ H+ Y+  W H
Sbjct  239  SSSISVYNNNVPPSLGLPNGQHLN-HEAYSSPWGH  272



>gb|EAZ06834.1| hypothetical protein OsI_29071 [Oryza sativa Indica Group]
Length=236

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 139/167 (83%), Gaps = 8/167 (5%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PPIFVTRD+PN LRSHVME+AGG DVAESIA FARRRQRGVCVLSG G V +V 
Sbjct  46   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESIAHFARRRQRGVCVLSGAGTVTDVA  105

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQPAAP AV+ L+GRFEILSL GTFLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L A
Sbjct  106  LRQPAAPSAVVALRGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTLTA  165

Query  614  agpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPL  474
            AGPVMVIA+TFANATYERLP+ ++D    + GG  A       PPPL
Sbjct  166  AGPVMVIASTFANATYERLPLDQEDQEEAAAGGMMA-------PPPL  205



>emb|CAN75757.1| hypothetical protein VITISV_028561 [Vitis vinifera]
Length=293

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 161/210 (77%), Gaps = 15/210 (7%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PPI +T+++PN LRSHV+EI+ G+D+AESIA FA+RR RGV VLS +G V NVT
Sbjct  85   SKNKPKPPIVITKESPNALRSHVLEISSGSDIAESIANFAQRRHRGVSVLSASGIVNNVT  144

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQPAAPG V+ LQGRFEILSL+G FLP PSPPGATGLTVYLAG QGQVVGGSVVG L+A
Sbjct  145  LRQPAAPGGVITLQGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGSVVGALMA  204

Query  614  agpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLP----IDESPPPLAGAEHHGLP  447
            +GPV+VIAATF+NAT+ERLP+   +D P + G    Q+P    ++      +  + HGL 
Sbjct  205  SGPVIVIAATFSNATFERLPL---EDEPANEG---IQMPQTSGVNSGTGGTSAPQSHGLV  258

Query  446  EPSSSLPLYNLTPNLFPNGGQLSPHDPYAW  357
            +P SS+P+YN  PNL PNG    PHD + W
Sbjct  259  DP-SSMPIYNJPPNLLPNGQM--PHDVF-W  284



>emb|CBI31637.3| unnamed protein product [Vitis vinifera]
Length=300

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 160/207 (77%), Gaps = 9/207 (4%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PPI +T+++PN LRSHV+EI+ G+D+AESIA FA+RR RGV VLS +G V NVT
Sbjct  92   SKNKPKPPIVITKESPNALRSHVLEISSGSDIAESIANFAQRRHRGVSVLSASGIVNNVT  151

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQPAAPG V+ LQGRFEILSL+G FLP PSPPGATGLTVYLAG QGQVVGGSVVG L+A
Sbjct  152  LRQPAAPGGVITLQGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGSVVGALMA  211

Query  614  agpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLP-IDESPPPLAGAEHHGLPEPS  438
            +GPV+VIAATF+NAT+ERLP+   +D P + G    Q   ++      +  + HGL +P 
Sbjct  212  SGPVIVIAATFSNATFERLPL---EDEPANEGIQMPQTSGVNSGTGGTSAPQSHGLVDP-  267

Query  437  SSLPLYNLTPNLFPNGGQLSPHDPYAW  357
            SS+P+YNL PNL PNG    PHD + W
Sbjct  268  SSMPIYNLPPNLLPNGQM--PHDVF-W  291



>ref|XP_010552065.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=368

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 160/220 (73%), Gaps = 19/220 (9%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PP+ VTRD+PN LRSHVMEI+GG+D+A+ IA F+RRRQRGVCVLSG G+V+N
Sbjct  156  PGSKNKPKPPVIVTRDSPNALRSHVMEISGGSDIADVIADFSRRRQRGVCVLSGTGSVSN  215

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            +TLRQPAAPG V+ L GRF+ILSL G FLPGP+PPG+TGLTVYLAGVQGQVVGGSVVG L
Sbjct  216  ITLRQPAAPGGVVALHGRFDILSLTGAFLPGPAPPGSTGLTVYLAGVQGQVVGGSVVGQL  275

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VAAG VM++AATF+NATYE+LPI E++D  + R       P  ES           LP+P
Sbjct  276  VAAGSVMIVAATFSNATYEKLPIEEEEDGDNRRQIRGESQPGIES----------SLPDP  325

Query  440  SSSLPLYNLT---PNLFPN-----GGQLSPHDPYAWQHPR  345
            ++ L         P++FPN     G      +PY W H R
Sbjct  326  TAELAGSGFGVQPPHMFPNGGGGGGIGHLGLEPYTWVHAR  365



>ref|XP_008370731.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=304

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 160/215 (74%), Gaps = 9/215 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEI+ G D+A S+AQFARRRQRGVCV+SG+G V N
Sbjct  84   PGSKNKPKPPIFVTRDSPNALRSHVMEISNGADIANSVAQFARRRQRGVCVMSGSGTVTN  143

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP+APGAVM L GRFEILSL G FLPGP+PPG+TG+T+YLAG QGQVVGGSVVGPL
Sbjct  144  VTLRQPSAPGAVMALHGRFEILSLTGAFLPGPAPPGSTGMTIYLAGGQGQVVGGSVVGPL  203

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VA+GPVMVIAATF NATYERLP+ E++   +  GG  +            G    G+ +P
Sbjct  204  VASGPVMVIAATFTNATYERLPLEEEE---EQAGGGTSSGTAAGGAGSPPGIGGGGMGDP  260

Query  440  SSSLPLYNLTPNLFPNGGQLS-PHDPYA----WQH  351
            ++   +YN  PNL  NGGQ    HD  A    W H
Sbjct  261  AALAGVYNFPPNLLSNGGQTQLSHDQQAAYSSWAH  295



>ref|XP_010658536.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=327

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 160/207 (77%), Gaps = 9/207 (4%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PPI +T+++PN LRSHV+EI+ G+D+AESIA FA+RR RGV VLS +G V NVT
Sbjct  119  SKNKPKPPIVITKESPNALRSHVLEISSGSDIAESIANFAQRRHRGVSVLSASGIVNNVT  178

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQPAAPG V+ LQGRFEILSL+G FLP PSPPGATGLTVYLAG QGQVVGGSVVG L+A
Sbjct  179  LRQPAAPGGVITLQGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGSVVGALMA  238

Query  614  agpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLP-IDESPPPLAGAEHHGLPEPS  438
            +GPV+VIAATF+NAT+ERLP+   +D P + G    Q   ++      +  + HGL +P 
Sbjct  239  SGPVIVIAATFSNATFERLPL---EDEPANEGIQMPQTSGVNSGTGGTSAPQSHGLVDP-  294

Query  437  SSLPLYNLTPNLFPNGGQLSPHDPYAW  357
            SS+P+YNL PNL PNG    PHD + W
Sbjct  295  SSMPIYNLPPNLLPNGQM--PHDVF-W  318



>gb|KDO42746.1| hypothetical protein CISIN_1g040245mg, partial [Citrus sinensis]
Length=271

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 159/217 (73%), Gaps = 28/217 (13%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG DVAES+A FARRRQRGVCVLSG+G+VAN
Sbjct  73   PGSKNKPKPPIFVTRDSPNSLRSHVMEVAGGADVAESVALFARRRQRGVCVLSGSGSVAN  132

Query  797  VTLRQPAAPGAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            VTLRQPAAPGAV+                  +  G+TGLTVYLAG QGQVVGGSVVG LV
Sbjct  133  VTLRQPAAPGAVV------------------ALHGSTGLTVYLAGGQGQVVGGSVVGQLV  174

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRG---GSAAQLPIDESPPPLAGAEH---H  456
            AAGPVMVIAATFANATYERLP+ +D+++  ++G    + A    + SPP +  +      
Sbjct  175  AAGPVMVIAATFANATYERLPLEDDEEVTGTQGQIQSTGAATNNNNSPPQIGSSGQPPSA  234

Query  455  GLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            GLP+PSS    YNL PNL PNGGQL  H+ YAW H R
Sbjct  235  GLPDPSSL--TYNLPPNLIPNGGQL--HEAYAWAHAR  267



>ref|XP_009373988.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=305

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 162/217 (75%), Gaps = 12/217 (6%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEI+ G D+A S+AQFARRRQRGVCV+SG+G V N
Sbjct  84   PGSKNKPKPPIFVTRDSPNALRSHVMEISNGADIANSVAQFARRRQRGVCVMSGSGTVTN  143

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP APGAVM L GRFEILSL G FLPGP+PPG+TG+T+YLAG QGQVVGGSVVGPL
Sbjct  144  VTLRQPFAPGAVMALHGRFEILSLTGAFLPGPAPPGSTGMTIYLAGGQGQVVGGSVVGPL  203

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VA+GPVMVIAATF NATYERLP+ E++   +  GG  +            G    G+ +P
Sbjct  204  VASGPVMVIAATFTNATYERLPLEEEE---EQAGGGTSSGTAAGGAGSPPGIGGGGMGDP  260

Query  440  SSSLPLYNLTPNLFPNGG---QLSPHDPYA----WQH  351
            ++   +YN  PNL PNGG   QLS HD  A    W H
Sbjct  261  AALAGVYNFPPNLLPNGGGQTQLS-HDQQAAYSSWAH  296



>ref|NP_001062524.1| Os08g0563200 [Oryza sativa Japonica Group]
 dbj|BAD09624.1| putative SAP1 protein [Oryza sativa Japonica Group]
 dbj|BAF24438.1| Os08g0563200 [Oryza sativa Japonica Group]
 dbj|BAG98967.1| unnamed protein product [Oryza sativa Japonica Group]
Length=235

 Score =   186 bits (471),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 151/210 (72%), Gaps = 26/210 (12%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PPIFVTRD+PN LRSHVME+AGG DVAESIA FARRRQRGVCVLSG G V +V 
Sbjct  44   SKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESIAHFARRRQRGVCVLSGAGTVTDVA  103

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQPAAP AV+ L+GRFEILSL GTFLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L A
Sbjct  104  LRQPAAPSAVVALRGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTLTA  163

Query  614  agpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPSS  435
            AGPVMVIA+TFANATYERLP+ ++++        AA   +   PP +AGA          
Sbjct  164  AGPVMVIASTFANATYERLPLDQEEE-------EAAAGGMMAPPPLMAGAA---------  207

Query  434  SLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
                    P LF  GG +      AW H R
Sbjct  208  -------DPLLF--GGGMHDAGLAAWHHAR  228



>ref|XP_004495454.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cicer 
arietinum]
Length=338

 Score =   188 bits (478),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 133/143 (93%), Gaps = 1/143 (1%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKN+P+PPIFVTRD+PN L+SHVME+AGG D+AES+AQFAR+RQRGVCVLSG+G+VAN
Sbjct  113  PGSKNRPKPPIFVTRDSPNALKSHVMEVAGGADIAESVAQFARKRQRGVCVLSGSGSVAN  172

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP+APGAV+ L GRFEILSL GTFLPGP+PPG+TGLTVYLAG QGQVVGG VVG L
Sbjct  173  VTLRQPSAPGAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGCVVGTL  232

Query  620  vaagpvmVIAATFANATYERLPI  552
            VA GPVM+I+ATF NATYERLP+
Sbjct  233  VAVGPVMLISATFTNATYERLPL  255



>ref|XP_003576887.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brachypodium 
distachyon]
Length=262

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 153/204 (75%), Gaps = 20/204 (10%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME++ G D+A+SIA F+RRRQRGVCVLSG GAVA+
Sbjct  42   PGSKNKPKPPIFVTRDSPNALRSHVMEVSSGADIADSIAHFSRRRQRGVCVLSGAGAVAD  101

Query  797  VTLRQPAAPG--AVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgp  624
            V LRQPAAPG   V L+GRFEILSL GTFLPGPSPPG+TGLTVYLAG QGQVVGGSVVG 
Sbjct  102  VALRQPAAPGGAVVALRGRFEILSLTGTFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGT  161

Query  623  lvaagpvmVIAATFANATYERLPILEDDDLPDSRG--------GSAAQLPIDESPPPLAG  468
            L AAGPVMVIA+TFANATYERLP+  DD+  + R         GS  Q+      PP+  
Sbjct  162  LTAAGPVMVIASTFANATYERLPL--DDEAEEDRHELAGRGVPGSTGQM--APGVPPMMM  217

Query  467  AEHHGLPEPSSSLPLYNLTPNLFP  396
             +H      S+ + +Y L  +L P
Sbjct  218  GDH------SAGMSMYGLPASLMP  235



>ref|XP_007144002.1| hypothetical protein PHAVU_007G120900g [Phaseolus vulgaris]
 gb|ESW15996.1| hypothetical protein PHAVU_007G120900g [Phaseolus vulgaris]
Length=278

 Score =   186 bits (473),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 160/215 (74%), Gaps = 20/215 (9%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEIA G D+ + + QFARRRQRGV +LSG+GAV N
Sbjct  70   PGSKNKPKPPIFVTRDSPNALRSHVMEIASGADITDCVLQFARRRQRGVSILSGSGAVVN  129

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP APGAVM L GRF+ILSL G+FLPGPSPPGATGLT+YLAG QGQ+VGG VVGPL
Sbjct  130  VTLRQPTAPGAVMALHGRFDILSLTGSFLPGPSPPGATGLTIYLAGGQGQIVGGGVVGPL  189

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VAAGPV+++AATF+NATYERLP+ EDD      GGS   +                  E 
Sbjct  190  VAAGPVLIMAATFSNATYERLPLEEDDQEQGGGGGSPPGMGGGPG-------------EA  236

Query  440  SSSLPLY--NLTPNL-FPNGGQLSPHDPY--AWQH  351
            SSS+ +Y  N+ P+L  PNG Q++ H+ Y  AW H
Sbjct  237  SSSISVYNNNVPPSLGGPNGQQVN-HEAYSSAWGH  270



>dbj|BAJ94293.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=322

 Score =   187 bits (476),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 156/218 (72%), Gaps = 10/218 (5%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI +TR++PN LRSHV+EIA G D+ E++A FARRRQRGV VLSG+G V NV
Sbjct  101  GSKNKPKPPIIITRESPNTLRSHVLEIASGADIMEAVATFARRRQRGVSVLSGSGVVGNV  160

Query  794  TLRQPAAP--GAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            TLRQPAAP    V L GRFEILSL+G FLP P PPGATGL VYLAG QGQVVGG+V+G L
Sbjct  161  TLRQPAAPPGSVVTLHGRFEILSLSGAFLPSPCPPGATGLAVYLAGGQGQVVGGTVIGEL  220

Query  620  vaagpvmVIAATFANATYERLPILED---DDLPDSRGGSAAQLPIDESPPPLAGAEHH--  456
            VA+GPVMV+AATF+NATYERLP+ E+   +    + G    QLP   +P    G      
Sbjct  221  VASGPVMVVAATFSNATYERLPLAEEEPGEAAVAATGSDGMQLPDVPAPGGNGGMGAAVG  280

Query  455  --GLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHP  348
              GL +P SS+P YNL PNL PNGG   PHD +    P
Sbjct  281  VPGLTDP-SSMPFYNLPPNLMPNGGGQMPHDVFGSFRP  317



>ref|XP_003556450.2| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=277

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 156/215 (73%), Gaps = 19/215 (9%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEIA G D+A+ +AQFARR QRGV +LSG+G V N
Sbjct  68   PGSKNKPKPPIFVTRDSPNALRSHVMEIAAGADIADCVAQFARRLQRGVSILSGSGTVVN  127

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VT+RQP APGAVM L GRF+ILSL G+FLPGPSPPGATGLT+YLAG QG VVGG VVGPL
Sbjct  128  VTIRQPTAPGAVMALHGRFDILSLTGSFLPGPSPPGATGLTIYLAGGQGHVVGGGVVGPL  187

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +AAGPV+++AATF+NATYERLP LEDDD     GG +                     E 
Sbjct  188  LAAGPVLLMAATFSNATYERLP-LEDDDQEHGGGGGSPPGITGGP------------GEA  234

Query  440  SSSLPLY--NLTPNLFPNGGQLSPHDPYA---WQH  351
            SSS+ +Y  N+ PNL  + GQ   H+ Y+   W H
Sbjct  235  SSSISVYNNNVPPNLGLSNGQHLNHEAYSSSPWVH  269



>ref|XP_006601994.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=302

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 153/210 (73%), Gaps = 5/210 (2%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI +T+++PN LRSHV+EIA G+DVAESIA FA RR RGV VLSG+G VANV
Sbjct  90   GSKNKPKPPIVITKESPNALRSHVLEIASGSDVAESIAAFANRRHRGVSVLSGSGIVANV  149

Query  794  TLRQPAAP-GAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPAAP G + L GRFEILSL+G FLP PSP GATGLTVYLAG QGQVVGG+V G LV
Sbjct  150  TLRQPAAPAGVITLHGRFEILSLSGAFLPSPSPSGATGLTVYLAGGQGQVVGGNVAGSLV  209

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            A+GPVMVIAATFANATYERLP LEDD   +       Q    +        +  GL E  
Sbjct  210  ASGPVMVIAATFANATYERLP-LEDDQGEEEMQVQQQQQQQQQQQQQQQQQQSQGLGE-Q  267

Query  437  SSLPLYNLTPNLFPNGGQLSPHDPYAWQHP  348
             S+P+YNL PNL  N GQ  PHD + W  P
Sbjct  268  VSMPMYNLPPNLLHN-GQNMPHDVF-WGAP  295



>ref|XP_009351431.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=310

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 158/208 (76%), Gaps = 9/208 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PP+ +T+++PN LRSHV+EI+ G+D+ +SIA F++RR RGV VLSG+G VAN
Sbjct  101  PGSKNKPKPPVVITKESPNALRSHVLEISSGSDIVDSIATFSQRRHRGVSVLSGSGIVAN  160

Query  797  VTLRQPAAP-GAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAP G + L GRFEILSL+G FLP PSPPGATGLTVYLAG QGQVVGG+V+G L
Sbjct  161  VTLRQPAAPTGVITLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGTVMGAL  220

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VA+GPV+VIAATF NATYERLP+ E+            Q+P ++    +      G+ E 
Sbjct  221  VASGPVIVIAATFTNATYERLPLEEEQGGE-----GGMQIPQEQQQSGVNSGS-RGVGEN  274

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAW  357
            +S++ +YNL PNL  NGGQ+ PHD + W
Sbjct  275  ASAMAVYNLPPNLLANGGQI-PHDVF-W  300



>ref|XP_008388703.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=304

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 161/215 (75%), Gaps = 9/215 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEI+ G D+A+S+AQFARRRQRGVCV+SG+G V N
Sbjct  84   PGSKNKPKPPIFVTRDSPNALRSHVMEISSGADIADSVAQFARRRQRGVCVMSGSGTVIN  143

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP+APGAVM L GRFEIL L G FLPGP+ PG+TGLT+YLAG QGQVVGGSVVGPL
Sbjct  144  VTLRQPSAPGAVMALHGRFEILYLTGAFLPGPALPGSTGLTIYLAGGQGQVVGGSVVGPL  203

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VA+GPVMVIAATF+NATYERLP+ E++   +  GG  +            G    G+ +P
Sbjct  204  VASGPVMVIAATFSNATYERLPLEEEE---EQTGGGTSSGTAAGGAGSPPGIGGGGMGDP  260

Query  440  SSSLPLYNLTPNLFPNGGQ----LSPHDPY-AWQH  351
            ++   +YNL  N+ PNGGQ    L     Y +W H
Sbjct  261  AALAGIYNLPSNMLPNGGQAQLSLDQQAAYSSWAH  295



>ref|XP_006827517.1| hypothetical protein AMTR_s00009p00189120 [Amborella trichopoda]
 gb|ERM94933.1| hypothetical protein AMTR_s00009p00189120 [Amborella trichopoda]
Length=262

 Score =   184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 130/141 (92%), Gaps = 1/141 (1%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PPI +TRD+PN LRSHVME+A G+DVAES+A FARRRQRGVCVLSG+G VANVT
Sbjct  90   SKNKPKPPIIITRDSPNALRSHVMEVASGSDVAESVAAFARRRQRGVCVLSGSGVVANVT  149

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQPAAPGA++ L GRFEILSL+G FLPGP+PPGATGLTVYLAG QGQVVGG VVG LVA
Sbjct  150  LRQPAAPGAIVTLHGRFEILSLSGAFLPGPAPPGATGLTVYLAGGQGQVVGGCVVGALVA  209

Query  614  agpvmVIAATFANATYERLPI  552
            +GPVMV+AATFANATYERLP+
Sbjct  210  SGPVMVVAATFANATYERLPL  230



>ref|XP_002521959.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF40363.1| DNA binding protein, putative [Ricinus communis]
Length=299

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 158/210 (75%), Gaps = 4/210 (2%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN L+SHVMEIA G+D+AES+A FAR++QRGVCVLSG+G V NV
Sbjct  86   GSKNKPKPPIFVTRDSPNALKSHVMEIANGSDIAESLACFARKKQRGVCVLSGSGMVTNV  145

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TL+QP+APGAVM L GRFEILSL G FLPGP+PPGATGLT+YLAG QGQVVGGSVVG L 
Sbjct  146  TLKQPSAPGAVMALHGRFEILSLTGAFLPGPAPPGATGLTIYLAGGQGQVVGGSVVGSLT  205

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            A GPVMVIAATF+NATYERL  LE+++   S GG         S     G         +
Sbjct  206  ATGPVMVIAATFSNATYERL-PLEEEEEGGSGGGQGQLGGGGGSSEGGGGGSGGIGEPGA  264

Query  437  SSLPLYNLTPNL-FPNGGQLSPHDPYAWQH  351
            S+ P YNL PNL  PNGGQL+  D Y W H
Sbjct  265  SAPPGYNLPPNLQVPNGGQLN-LDAYGWAH  293



>gb|EPS65852.1| hypothetical protein M569_08925, partial [Genlisea aurea]
Length=268

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 131/148 (89%), Gaps = 2/148 (1%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHV+E++GG+D+AE IA ++RRRQRGVCVLS NG V N
Sbjct  74   PGSKNKPKPPIFVTRDSPNALRSHVLEVSGGSDIAECIAHYSRRRQRGVCVLSANGTVTN  133

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            V +RQP+APG+VM L G FEILSL G+FLPGP+PPG+TGLTVYLA  +G+VVGG+VVG L
Sbjct  134  VKIRQPSAPGSVMALHGSFEILSLTGSFLPGPAPPGSTGLTVYLAAGRGEVVGGTVVGSL  193

Query  620  vaagpvmVIAATFANATYERLPILEDDD  537
            +A G VMVIA+TFANATYERLP+ ED++
Sbjct  194  IAVGQVMVIASTFANATYERLPV-EDEE  220



>ref|NP_001151240.1| DNA-binding protein [Zea mays]
 ref|XP_008677349.1| PREDICTED: DNA-binding protein isoform X1 [Zea mays]
 gb|ACG42099.1| DNA-binding protein [Zea mays]
 gb|AFW61669.1| DNA-binding protein [Zea mays]
Length=265

 Score =   183 bits (465),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 135/150 (90%), Gaps = 1/150 (1%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVME+AGG DVAESIA FARRRQRGVCVLSG G V +
Sbjct  46   PGSKNKPKPPIFVTRDSPNALRSHVMEVAGGADVAESIAHFARRRQRGVCVLSGAGTVTD  105

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            V LRQP APGAV+ L+GRFEILS+ GTFLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L
Sbjct  106  VALRQPTAPGAVVALRGRFEILSITGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTL  165

Query  620  vaagpvmVIAATFANATYERLPILEDDDLP  531
            +AAGPVMV+A+TFANATYERLP+ + ++ P
Sbjct  166  IAAGPVMVMASTFANATYERLPLDDAEEDP  195



>ref|XP_004161914.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
Length=269

 Score =   183 bits (465),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 156/212 (74%), Gaps = 9/212 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PP+ VT+++P+ LRSHV+EI  G+D+ ESI+ FA+RRQRGV VLSGNG VAN
Sbjct  61   PGSKNKPKPPVVVTKESPDALRSHVLEIGSGSDIVESISNFAQRRQRGVSVLSGNGVVAN  120

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLR P A G V+ LQGRF+ILSL+G FLP P+PPGATGLTVYLAG QGQVVGG VVG L
Sbjct  121  VTLRHPGASGGVITLQGRFDILSLSGAFLPAPAPPGATGLTVYLAGGQGQVVGGIVVGAL  180

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VA GPV+VIAATF NAT+ERLP+ +++     + G++      +S     G +     +P
Sbjct  181  VATGPVIVIAATFTNATFERLPLEDEEVAAGDKSGTSQNNSTSQS----MGEQQQQQQQP  236

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
              S+ +YN+TPNL  N GQ+S HD   W  PR
Sbjct  237  --SMGVYNMTPNLVTN-GQVSSHD-MIWSLPR  264



>ref|XP_003590930.1| DNA-binding protein [Medicago truncatula]
 gb|AES61181.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=305

 Score =   184 bits (467),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 161/220 (73%), Gaps = 16/220 (7%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIF+TRD+PN LRSHVME+A GTD+++SI QFAR+RQRG+C+LS +G V NV
Sbjct  82   GSKNKPKPPIFITRDSPNALRSHVMEVATGTDISDSIVQFARKRQRGICILSASGTVVNV  141

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            +LRQP  PGAV+ L GRF+ILSL G+ LPGPSPPGATGLT+YL+G QGQVVGG VVGPLV
Sbjct  142  SLRQPTGPGAVVALPGRFDILSLTGSVLPGPSPPGATGLTIYLSGGQGQVVGGGVVGPLV  201

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGL---P  447
            AAGPVM++AATF+NATYERLP+ + DD    +GG       DESP   AG     +    
Sbjct  202  AAGPVMLMAATFSNATYERLPVEDGDDQEGHQGGGGD----DESPTRAAGMGQLAIGSVG  257

Query  446  EPSSSLPLY-NLTPNL-FPNGGQ---LSPHDPYA---WQH  351
            E SS  P Y N+  NL   NGGQ   L+ H+ Y    W H
Sbjct  258  EGSSIPPGYNNVGGNLGVSNGGQQQLLNNHEAYNNSPWGH  297



>ref|XP_008461695.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
 ref|XP_008461696.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
 ref|XP_008461697.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
Length=267

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 154/212 (73%), Gaps = 11/212 (5%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PP+ VT+++P+ LRSHV+EI  G+D+ ESI+ FA+RRQRGV VLSGNG VAN
Sbjct  61   PGSKNKPKPPVVVTKESPDALRSHVLEIGSGSDIVESISNFAQRRQRGVSVLSGNGVVAN  120

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLR P A G V+ LQGRF+ILSL+G FLP P+PPGATGLTVYLAG QGQVVGG VVG L
Sbjct  121  VTLRHPGASGGVITLQGRFDILSLSGAFLPAPAPPGATGLTVYLAGGQGQVVGGIVVGAL  180

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VA GPV+VIAATF NAT+ERLP+ +++     + G++      +S     G +    P  
Sbjct  181  VATGPVIVIAATFTNATFERLPLEDEEVAAGDKSGTSQNNSTSQS----MGEQQQQPP--  234

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
              S+ +YN+ PNL  N GQ+S HD   W  PR
Sbjct  235  --SMGVYNMAPNLVAN-GQVSSHD-MIWSLPR  262



>ref|XP_008371927.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=322

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 156/219 (71%), Gaps = 23/219 (11%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPI +T+++PN LRSHV+EI+ G+D+ +SIA FA+RR RGV VLSG+G VAN
Sbjct  103  PGSKNKPKPPIVITKESPNALRSHVLEISSGSDIVDSIATFAQRRHRGVSVLSGSGIVAN  162

Query  797  VTLRQPAAP-GAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAP G + L GRFEILS++G FLP PSPPGATGLTVYLAG QGQVVGG+V+G L
Sbjct  163  VTLRQPAAPTGVITLHGRFEILSMSGAFLPSPSPPGATGLTVYLAGGQGQVVGGTVMGAL  222

Query  620  vaagpvmVIAATFANATYERLPI-----------LEDDDLPDSRGGSAAQLPIDESPPPL  474
            VA+GPVMVIAATF NATYERLP+           LE      S   SA            
Sbjct  223  VASGPVMVIAATFTNATYERLPLEEEQGGEEGMQLEQQQQQQSGVNSAGT---------G  273

Query  473  AGAEHHGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAW  357
            A +   GL E +S++ +YNL  NL  NGGQ+ PHD + W
Sbjct  274  ANSNSQGLGEHTSAMAVYNLPSNLLANGGQI-PHDIF-W  310



>ref|XP_009364460.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=299

 Score =   182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 132/143 (92%), Gaps = 1/143 (1%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEI+ G D+A+S+AQFARRRQRGVCV+SG+G V N
Sbjct  84   PGSKNKPKPPIFVTRDSPNALRSHVMEISSGADIADSVAQFARRRQRGVCVMSGSGTVIN  143

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP+APGAVM L GRFEILSL G FLPGP+ PG+TGLT+YLAG QGQVVGGSVVGPL
Sbjct  144  VTLRQPSAPGAVMALHGRFEILSLTGAFLPGPALPGSTGLTIYLAGGQGQVVGGSVVGPL  203

Query  620  vaagpvmVIAATFANATYERLPI  552
            VA+GPVMVIAATF+NATYERLP+
Sbjct  204  VASGPVMVIAATFSNATYERLPL  226



>ref|XP_008218304.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=304

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 165/215 (77%), Gaps = 9/215 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEI+ G D+A+S+A+FAR RQRGVCVLSG+G V N
Sbjct  84   PGSKNKPKPPIFVTRDSPNALRSHVMEISNGADIADSVARFARTRQRGVCVLSGSGTVTN  143

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VT+RQ +  G+VM L GRFEILSL G FLPGP+PPG+TG+T+YLAGVQGQVVGGSVVGPL
Sbjct  144  VTIRQTSPAGSVMALHGRFEILSLTGAFLPGPAPPGSTGMTIYLAGVQGQVVGGSVVGPL  203

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VA+GPVMVIAATF+NATYERLP+ E++++  +  G AA        PP  G    G+ +P
Sbjct  204  VASGPVMVIAATFSNATYERLPLEEEEEVGGNNSGQAAG---GAGSPPGIGGSGGGMGDP  260

Query  440  SSSLPLYNLTPNLFPN-GGQLSPHDPYA----WQH  351
            S  + +YNL PN+ PN GGQ   HD  A    W H
Sbjct  261  SMGVGVYNLQPNMLPNGGGQALSHDQGAAYSSWAH  295



>gb|KEH34733.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=313

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 154/217 (71%), Gaps = 16/217 (7%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PPI +T+++PN LRSHV+EI+ G+DVAESIA FA RR RGV VLSG+G VANVTL
Sbjct  89   KNKPKPPIVITKESPNALRSHVLEISSGSDVAESIATFANRRHRGVSVLSGSGIVANVTL  148

Query  788  RQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplvaa  612
            RQPAAPG V+ L GRFEILSL+G FLP PSP GATGLTVYLAG QGQVVGGSV GPLVA+
Sbjct  149  RQPAAPGGVITLHGRFEILSLSGAFLPPPSPAGATGLTVYLAGGQGQVVGGSVAGPLVAS  208

Query  611  gpvmVIAATFANATYERLPILEDDDLPDSR------------GGSAAQLPIDESPPPLAG  468
            GPVMVIAATFANATYERLP+ ++    D                + A      S   L  
Sbjct  209  GPVMVIAATFANATYERLPLEDEQGGGDQEEMQVQVQQSGVDSATVAAAVTSTSSQGLEL  268

Query  467  AEHHGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAW  357
             EHH   +   S+P+YNL PNL  NG Q+ PHD + W
Sbjct  269  GEHHQQLQ-QVSMPMYNLPPNLLHNGTQM-PHDVF-W  302



>gb|AFK41919.1| unknown [Medicago truncatula]
Length=305

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 160/220 (73%), Gaps = 16/220 (7%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIF+TRD+PN LRSHVME+A GTD+++SI QFAR+RQRG+C+LS +G V NV
Sbjct  82   GSKNKPKPPIFITRDSPNALRSHVMEVATGTDISDSIVQFARKRQRGICILSASGTVVNV  141

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            +LRQP  PGAV+ L GRF+ILSL G+ LPGPSPPGATGLT+YL+G QGQVVGG VVGPLV
Sbjct  142  SLRQPTGPGAVVALPGRFDILSLTGSVLPGPSPPGATGLTIYLSGGQGQVVGGGVVGPLV  201

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGL---P  447
            AAGPVM++AATF+NATYERLP+ + DD    +GG       DE P   AG     +    
Sbjct  202  AAGPVMLMAATFSNATYERLPVEDGDDQEGHQGGGGD----DEFPTRAAGMGQLAIGSVG  257

Query  446  EPSSSLPLY-NLTPNL-FPNGGQ---LSPHDPYA---WQH  351
            E SS  P Y N+  NL   NGGQ   L+ H+ Y    W H
Sbjct  258  EGSSIPPGYNNVGGNLGVSNGGQQQLLNNHEAYNNSPWGH  297



>ref|XP_004147679.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 gb|KGN50570.1| hypothetical protein Csa_5G182750 [Cucumis sativus]
Length=269

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 155/212 (73%), Gaps = 9/212 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PP+ VT+++P+ LRSHV+EI  G+D+ ESI+ FA+RRQRGV VL GNG VAN
Sbjct  61   PGSKNKPKPPVVVTKESPDALRSHVLEIGSGSDIVESISNFAQRRQRGVSVLGGNGVVAN  120

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLR P A G V+ LQGRF+ILSL+G FLP P+PPGATGLTVYLAG QGQVVGG VVG L
Sbjct  121  VTLRHPGASGGVITLQGRFDILSLSGAFLPAPAPPGATGLTVYLAGGQGQVVGGIVVGAL  180

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VA GPV+VIAATF NAT+ERLP+ +++     + G++      +S     G +     +P
Sbjct  181  VATGPVIVIAATFTNATFERLPLEDEEVAAGDKSGTSQNNSTSQS----MGEQQQQQQQP  236

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
              S+ +YN+TPNL  N GQ+S H+   W  PR
Sbjct  237  --SMGVYNMTPNLVTN-GQVSSHE-MIWSLPR  264



>ref|XP_010923237.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=312

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 160/219 (73%), Gaps = 12/219 (5%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PPI +TR++PN LRSHV+EIA GTD+ ++IA FARRRQRG+ +LSG+G V NVT
Sbjct  91   SKNKPKPPIIITRESPNALRSHVLEIASGTDIMDAIAVFARRRQRGISILSGSGVVTNVT  150

Query  791  LRQPAA-PGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            LRQPAA PGAV+ L GRFEILSL+G FLP PSPPGATGLTVYLAG QGQVVGGSVVG LV
Sbjct  151  LRQPAAPPGAVVTLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGSVVGELV  210

Query  617  aagpvmVIAATFANATYERLPI-LEDDDLPDSRGGSAAQLPIDESPPPLAGA-----EHH  456
            A+G VMVIAATF NA YERLP+  E+ +     GG      + +SPP   G+      H 
Sbjct  211  ASGQVMVIAATFTNAIYERLPLGDEEAEATAPPGGGEGMAALQQSPPGGNGSASQQTSHV  270

Query  455  GLP--EPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
            G    +PS   PLYNL PNL PN GQ++ H+ +    PR
Sbjct  271  GSAAVDPSLMPPLYNLPPNLLPN-GQMT-HEVFGAWAPR  307



>ref|XP_010527388.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=265

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 155/214 (72%), Gaps = 23/214 (11%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN LRS+VMEI GG+DVA+ IA F+RRRQRGVCVLSG G+VANV
Sbjct  68   GSKNKPKPPIFVTRDSPNALRSNVMEITGGSDVADVIANFSRRRQRGVCVLSGTGSVANV  127

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQP APG V+ L GRF+ILSL G FLPGP+PPG+TGLTVYLAG QGQVVGGSVVGPLV
Sbjct  128  TLRQPTAPGGVVALHGRFDILSLTGAFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGPLV  187

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            AAG VMVIAATF+NATYERLPI E++D               +    LAG    G+P   
Sbjct  188  AAGSVMVIAATFSNATYERLPIEEEED-------GGGAAAAGQDATALAGTG-FGVPP--  237

Query  437  SSLPLYNLTPNLFPN---GGQLSPHDPYAWQHPR  345
                     P++FPN   GG    H+PY W H R
Sbjct  238  ---------PHMFPNGRGGGGQLGHEPYTWVHAR  262



>ref|XP_006655164.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Oryza 
brachyantha]
Length=303

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 154/205 (75%), Gaps = 12/205 (6%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PPI +TR++PN LRSHV+EIAGG D+ E++  FARRRQRGV VLSG+G VANVTL
Sbjct  98   KNKPKPPIIITRESPNALRSHVLEIAGGADIMEAVTTFARRRQRGVSVLSGSGVVANVTL  157

Query  788  RQPAA-PGAV-MLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            RQPAA PGAV  L GRFEILSL+G FLP P PPGATGL VYLAG QGQVVGG+VVG L+A
Sbjct  158  RQPAAPPGAVATLHGRFEILSLSGAFLPSPCPPGATGLAVYLAGGQGQVVGGTVVGELLA  217

Query  614  agpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPSS  435
            +GPVMVIAATF+NATYERLP+ ED+        S    P        A     GLP+P +
Sbjct  218  SGPVMVIAATFSNATYERLPLAEDE--------SGEGPPGGNGGRGAAAGGAPGLPDP-T  268

Query  434  SLPLYNLTPNLFPN-GGQLSPHDPY  363
            S+P YNL PNL PN GGQ++ HD +
Sbjct  269  SMPFYNLPPNLMPNGGGQMAVHDVF  293



>ref|XP_007218339.1| hypothetical protein PRUPE_ppa008610mg [Prunus persica]
 gb|EMJ19538.1| hypothetical protein PRUPE_ppa008610mg [Prunus persica]
Length=325

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 150/201 (75%), Gaps = 5/201 (2%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPI +T+++PN LRSHV+EI+ G+D+ +SIA FA+RR RGV VLSG+G VAN
Sbjct  105  PGSKNKPKPPIIITKESPNALRSHVLEISSGSDIVDSIATFAQRRHRGVSVLSGSGIVAN  164

Query  797  VTLRQPAAP-GAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLR PAAP G + L GRFEILSL+G FLP PSPPGATGLTVYLAG QGQVVGG+V+G L
Sbjct  165  VTLRHPAAPSGVITLHGRFEILSLSGAFLPSPSPPGATGLTVYLAGGQGQVVGGTVMGAL  224

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAG----AEHHG  453
            VA+GPVMV+AATF NATYERLP+ ++            Q    +S    AG    +   G
Sbjct  225  VASGPVMVVAATFTNATYERLPLEDEQAGEGGMQVQQQQQQQQQSGVNSAGTGGNSGSQG  284

Query  452  LPEPSSSLPLYNLTPNLFPNG  390
            L E +SS+ +YNL PNL PNG
Sbjct  285  LVEHTSSMAIYNLPPNLLPNG  305



>ref|XP_008233653.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=326

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 151/206 (73%), Gaps = 14/206 (7%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPI +T+++PN LRSHV+EI+ G+D+ +SIA FA+RR RGV VLSG+G VAN
Sbjct  105  PGSKNKPKPPIIITKESPNALRSHVLEISSGSDIVDSIATFAQRRHRGVSVLSGSGIVAN  164

Query  797  VTLRQPAAP-GAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLR PAAP G + L GRFEILSL+G FLP PSPPGATGLTVYLAG QGQVVGG+V+G L
Sbjct  165  VTLRHPAAPSGVITLHGRFEILSLSGAFLPSPSPPGATGLTVYLAGGQGQVVGGTVMGAL  224

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAE-------  462
            VA+GPVMVIAATF NATYERLP LED+   +   G     P  +     +G         
Sbjct  225  VASGPVMVIAATFTNATYERLP-LEDEQAGE---GGMQVQPQQQQHQQQSGVNSAGTGGN  280

Query  461  --HHGLPEPSSSLPLYNLTPNLFPNG  390
                GL E +SS+ +YNL PNL PNG
Sbjct  281  SGSQGLGEHTSSMAIYNLPPNLLPNG  306



>ref|XP_007141404.1| hypothetical protein PHAVU_008G192600g [Phaseolus vulgaris]
 gb|ESW13398.1| hypothetical protein PHAVU_008G192600g [Phaseolus vulgaris]
Length=283

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 146/189 (77%), Gaps = 8/189 (4%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PP+ +T+++PN LRSH++EI+GG+DVAE IA FA RR RGV VLSGNG V NVTL
Sbjct  81   KNKPKPPVVITKESPNALRSHILEISGGSDVAECIATFATRRHRGVSVLSGNGVVTNVTL  140

Query  788  RQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplvaa  612
            RQPAAPG V+ LQGRFEILSL+G FLP PSPP ATG+TVYLAG QGQVVGGSVVGPL+A+
Sbjct  141  RQPAAPGGVITLQGRFEILSLSGAFLPAPSPPEATGITVYLAGGQGQVVGGSVVGPLIAS  200

Query  611  gpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPSSS  432
            GPVMV+AATFANATYERLP+ E+    D +     +     +PPP  G +   +P     
Sbjct  201  GPVMVVAATFANATYERLPLEEEQGEEDMQ--EVNEGGGGGTPPPSQGDQQPQVP-----  253

Query  431  LPLYNLTPN  405
            +P+YNL PN
Sbjct  254  MPVYNLVPN  262



>ref|XP_009402946.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=312

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 153/200 (77%), Gaps = 9/200 (5%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKPRPPI +TR++P+ LRSHV+E+A GTD+ +++A FARRRQRGVC+L+G+G V +VT
Sbjct  94   SKNKPRPPIIITRESPSALRSHVLEVASGTDIMDAVAAFARRRQRGVCILNGSGVVTDVT  153

Query  791  LRQPAAPGAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplvaa  612
            LRQP APG V L GR EIL+L+G FLP PSPPGATGLTVYLAG  GQVVGG+VVG LVA+
Sbjct  154  LRQPGAPGVVTLHGRLEILALSGAFLPAPSPPGATGLTVYLAGGHGQVVGGNVVGELVAS  213

Query  611  gpvmVIAATFANATYERLPILEDDDL-----PDSRGGSAAQLPIDESPPPLAGAEH-HGL  450
            GPVM++AATF+NATYE+LP++ ++       P + G    Q P D      + ++  HG 
Sbjct  214  GPVMMVAATFSNATYEQLPLVVEEPATAVAPPSTEG--LPQNPCDSGVGVRSSSQQPHGG  271

Query  449  PEPSSSLPLYNLTPNLFPNG  390
             +P +++PLYNL PNL PNG
Sbjct  272  WDP-AAMPLYNLPPNLLPNG  290



>ref|XP_009343806.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=322

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 155/212 (73%), Gaps = 7/212 (3%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPI +T+++PN LRSHV+EI+ G+D+ +SIA FA+RR RGV VLSG G VAN
Sbjct  101  PGSKNKPKPPIVITKESPNALRSHVLEISSGSDIVDSIATFAQRRHRGVSVLSGTGIVAN  160

Query  797  VTLRQPAAP-GAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAP G + L GRFEILS++G FLP PSPPGATGLTVYLAG QGQVVGG+V+G L
Sbjct  161  VTLRQPAAPTGLITLHGRFEILSMSGAFLPSPSPPGATGLTVYLAGGQGQVVGGTVMGAL  220

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAG----AEHHG  453
            VA+GPVMVIAATF NATYERLP+ E+            Q    +S    AG    +   G
Sbjct  221  VASGPVMVIAATFTNATYERLPLEEEQGGEGGMQLEQQQQQQQQSGVNSAGTGANSSSQG  280

Query  452  LPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAW  357
            L E +S++ +YNL  NL  NGGQ+ P D + W
Sbjct  281  LGEHTSAMAVYNLPSNLLANGGQI-PQDIF-W  310



>ref|XP_006591349.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=289

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 149/201 (74%), Gaps = 11/201 (5%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PPI +T+++PN LRSHV+EI  G+DVAESIA FA RR RGV VLSG+G VANVTL
Sbjct  86   KNKPKPPIVITKESPNALRSHVLEITSGSDVAESIAAFANRRHRGVSVLSGSGIVANVTL  145

Query  788  RQPAAP-GAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplvaa  612
            RQPAAP G + L GRFEILSL+G FLP PSPPGATGLTVYLAG QGQVVGG+V G LVA+
Sbjct  146  RQPAAPAGVITLHGRFEILSLSGAFLPSPSPPGATGLTVYLAGGQGQVVGGTVAGSLVAS  205

Query  611  gpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPSSS  432
            GPVMVIAATFANATYERLP LED+   +        + + +        +  GL E   S
Sbjct  206  GPVMVIAATFANATYERLP-LEDEQGEEG-------MQVQQQQQQQQQQQSQGLGE-QVS  256

Query  431  LPLYNLTPNLFPNGGQLSPHD  369
            +P+YNL PNL  N GQ  PHD
Sbjct  257  MPMYNLPPNLLHN-GQNMPHD  276



>ref|XP_009607803.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=319

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 153/208 (74%), Gaps = 12/208 (6%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI VT+++PN LRSHV+EI  G+D+ ESIA FA RR RGV VLSG+G V NV
Sbjct  112  GSKNKPKPPIVVTKESPNSLRSHVLEIKSGSDIVESIATFAHRRGRGVSVLSGSGIVTNV  171

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPAA G V+ L GRFEILSL+G FLP PSPPGATGLTVYLAG QGQVVGG+VVG L+
Sbjct  172  TLRQPAAAGGVITLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGSQGQVVGGNVVGELM  231

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPE-P  441
            A+GPVMVIAATF NAT+ERLP+ E+    ++  G   Q PI      +      G+ + P
Sbjct  232  ASGPVMVIAATFTNATFERLPLEEE----NASEGMQMQTPITSG---VNTGNSGGMDDTP  284

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAW  357
            +SS+ +YN+  N+ PNG    PHD + W
Sbjct  285  ASSMSMYNMPTNVLPNGQM--PHDVF-W  309



>ref|XP_010032377.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 ref|XP_010032378.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 ref|XP_010032379.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 gb|KCW51782.1| hypothetical protein EUGRSUZ_J01233 [Eucalyptus grandis]
Length=345

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 158/229 (69%), Gaps = 30/229 (13%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKPRPPI VT+++PN LRSH++EI+ G+D+AESIA FA+RR RGV VLSG+G V NVTL
Sbjct  121  KNKPRPPIVVTKESPNSLRSHILEISSGSDIAESIANFAQRRHRGVSVLSGSGIVTNVTL  180

Query  788  RQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplvaa  612
            RQP APG V+ LQGRFEILSL G FLP PSPPGATGLTVYL+G QGQVVGG+ VGPLVA+
Sbjct  181  RQPTAPGGVIALQGRFEILSLNGAFLPAPSPPGATGLTVYLSGGQGQVVGGTAVGPLVAS  240

Query  611  gpvmVIAATFANATYERLPI---LEDDDLPDSRGGSAAQLPIDESPPPLAGAEH------  459
            GPVMV+AATF+NATYE+LP+    E+ ++    GG   QL      P  AG  H      
Sbjct  241  GPVMVVAATFSNATYEQLPVEDEAEEANVAVGDGGETMQL-----QPTSAGMSHPGNSGS  295

Query  458  --------HGLP---EPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
                     GL      SSS+P++ L PNL PNG     HD + W  PR
Sbjct  296  HNSGSQSSQGLANQHHASSSMPMFTLPPNLMPNG---QVHDMF-WATPR  340



>ref|XP_008777391.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=317

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 157/219 (72%), Gaps = 16/219 (7%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PPI +TR++PN LRSHV+EIA GTD+ ++IA FARRRQRGV +LSG+G V +VT
Sbjct  90   SKNKPKPPIIITRESPNALRSHVLEIASGTDIMDAIAVFARRRQRGVSILSGSGVVTDVT  149

Query  791  LRQPAAP--GAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            LRQPAAP    V L GRFEILSL+G FLP PSPPGATGLTVYLAG QGQV GG VVG LV
Sbjct  150  LRQPAAPPGAVVTLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVAGGKVVGELV  209

Query  617  aagpvmVIAATFANATYERLPI----LEDDDLPDSRGGSAAQLPIDESPPPLAG-----A  465
            A+GPVMVIAATF NATYERLP+     +      + GG+     + +SPP   G     +
Sbjct  210  ASGPVMVIAATFTNATYERLPLGDEEADAAAGAAAPGGAEGMAALQQSPPGGNGSASQQS  269

Query  464  EHHGLP--EPSSSLPLYNLTPNLFPNGGQLSPHDPY-AW  357
             H GL   +PSS  PLYNL PNL PNG    PH+ + AW
Sbjct  270  SHGGLAAVDPSSMPPLYNLPPNLLPNGQM--PHEVFGAW  306



>ref|NP_001141263.1| hypothetical protein [Zea mays]
 gb|ACF85898.1| unknown [Zea mays]
 gb|ACF88117.1| unknown [Zea mays]
 gb|AFW71087.1| hypothetical protein ZEAMMB73_730676 [Zea mays]
Length=309

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 151/207 (73%), Gaps = 13/207 (6%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI +TRD+ N LR+HVME+A G D++ESI  FARRRQRGVCVLSG G V NV
Sbjct  103  GSKNKPKPPIIITRDSANTLRTHVMEVASGCDISESITAFARRRQRGVCVLSGAGTVTNV  162

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPA+ GAV+ L GRFEILSL+G+FLP P+PP ATGLTVYLAG QGQVVGGSVVG L 
Sbjct  163  TLRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLTVYLAGGQGQVVGGSVVGALT  222

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            AAGPV+++AA+FANA YERLP+ EDD L       AAQ   D S   LAGA+  G  +PS
Sbjct  223  AAGPVVIMAASFANAVYERLPLEEDDML-------AAQAQAD-SAGILAGAQLAGAVDPS  274

Query  437  SSLPLYNLTPNLFPNGGQLSPHDPYAW  357
                   L PNL  N  Q+ P   Y W
Sbjct  275  L---FQGLPPNLMCN-VQMPPEAAYGW  297



>ref|XP_007206474.1| hypothetical protein PRUPE_ppa018950mg [Prunus persica]
 gb|EMJ07673.1| hypothetical protein PRUPE_ppa018950mg [Prunus persica]
Length=305

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 165/215 (77%), Gaps = 9/215 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIFVTRD+PN LRSHVMEI+ G D+A+S+A+FAR RQRGVCVLSG+G V N
Sbjct  85   PGSKNKPKPPIFVTRDSPNALRSHVMEISNGADIADSVARFARTRQRGVCVLSGSGTVTN  144

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VT+RQ +  G+VM L GRFEILSL G FLPGP+PPG+TG+T+YLAGVQGQVVGGSVVGPL
Sbjct  145  VTIRQASPAGSVMALHGRFEILSLTGAFLPGPAPPGSTGMTIYLAGVQGQVVGGSVVGPL  204

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VA+GPVMVIAATF+NATYERLP+ E++++    G ++ Q       PP  G    G+ +P
Sbjct  205  VASGPVMVIAATFSNATYERLPLEEEEEV---GGNNSGQAAGGGGSPPGIGGSGGGMGDP  261

Query  440  SSSLPLYNLTPNLFPN-GGQLSPHDPYA----WQH  351
            S  + +YNL PN+ PN GGQ   HD  A    W H
Sbjct  262  SIGVGVYNLQPNMLPNGGGQALSHDQGAAYSSWAH  296



>ref|XP_009409024.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409025.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409026.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409027.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409028.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409029.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=318

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 163/218 (75%), Gaps = 17/218 (8%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PP+ +TR+ PN LRSHV+EI+ G DV +++A FARRRQRGV +LSG+G V +
Sbjct  95   PGSKNKPKPPVIITRENPNALRSHVLEISSGADVMDAMATFARRRQRGVFILSGSGVVTD  154

Query  797  VTLRQPAA-PGAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP A PG + L GRF+ILSL+G FLP PSPPGATGLTVYL+G QGQVVGG+V+G L
Sbjct  155  VTLRQPGAPPGVITLPGRFDILSLSGAFLPAPSPPGATGLTVYLSGGQGQVVGGNVIGEL  214

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGG--SAAQLPIDESP-------PPLAG  468
            +A+GPVMVIAATF+NATYERLP+  DD+ P + G       + + +SP        P + 
Sbjct  215  IASGPVMVIAATFSNATYERLPL--DDEEPAAAGAMPGTEGIQLQQSPGVSEGGGRPFSR  272

Query  467  AEHHGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPY-AW  357
              H GL +P SS+PLYNL P+L PNG   +PH+ + AW
Sbjct  273  QPHAGL-DP-SSMPLYNLPPDLPPNG--QTPHEVFGAW  306



>ref|XP_009123977.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=314

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 134/154 (87%), Gaps = 9/154 (6%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN L+SHVMEIA GTDV E++A FARRRQRG+C+LSGNG VANV
Sbjct  90   GSKNKPKPPIFVTRDSPNALKSHVMEIASGTDVIETLATFARRRQRGICILSGNGTVANV  149

Query  794  TLRQPAA------PG---AVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvg  642
            TLRQP+A      PG    + LQGRFEILSL G+FLPGP+PPG+TGLT+YLA  QGQ+VG
Sbjct  150  TLRQPSAATVPVPPGGAAVLALQGRFEILSLTGSFLPGPAPPGSTGLTIYLASGQGQIVG  209

Query  641  gsvvgplvaagpvmVIAATFANATYERLPILEDD  540
            GSVVGPL+AAGPVM+IAATF+NATYERLP+ E++
Sbjct  210  GSVVGPLMAAGPVMLIAATFSNATYERLPLDEEE  243



>emb|CDY49327.1| BnaA05g32890D [Brassica napus]
Length=314

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 134/154 (87%), Gaps = 9/154 (6%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN L+SHVMEIA GTDV E++A FARRRQRG+C+LSGNG VANV
Sbjct  90   GSKNKPKPPIFVTRDSPNALKSHVMEIASGTDVIETLATFARRRQRGICILSGNGTVANV  149

Query  794  TLRQPAA---PG------AVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvg  642
            TLRQP+A   PG       + LQGRFEILSL G+FLPGP+PPG+TGLT+YLA  QGQ+VG
Sbjct  150  TLRQPSAATVPGPPGGAAVLALQGRFEILSLTGSFLPGPAPPGSTGLTIYLASGQGQIVG  209

Query  641  gsvvgplvaagpvmVIAATFANATYERLPILEDD  540
            GSVVGPL+AAGPVM+IAATF+NATYERLP+ E++
Sbjct  210  GSVVGPLMAAGPVMLIAATFSNATYERLPLDEEE  243



>ref|XP_009611172.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=286

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 128/143 (90%), Gaps = 2/143 (1%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKN+P+ PIFVTRD+PN LRSHVME+A G DVAESIAQFAR+RQRGVCVLS +G V N
Sbjct  72   PGSKNRPKSPIFVTRDSPNTLRSHVMEVANGADVAESIAQFARKRQRGVCVLSASGTVTN  131

Query  797  VTLRQPAAPG-AVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgp  624
            VTLRQP+APG AVM L GRFEILSL G FLPGP+PPG+TGLT+YLAG QGQVVGG VVG 
Sbjct  132  VTLRQPSAPGTAVMALHGRFEILSLTGAFLPGPAPPGSTGLTIYLAGGQGQVVGGIVVGS  191

Query  623  lvaagpvmVIAATFANATYERLP  555
            LVA+GPVMVIA+TF+NATYERLP
Sbjct  192  LVASGPVMVIASTFSNATYERLP  214



>gb|KCW60423.1| hypothetical protein EUGRSUZ_H03144 [Eucalyptus grandis]
Length=199

 Score =   173 bits (439),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 145/197 (74%), Gaps = 7/197 (4%)
 Frame = -3

Query  917  LRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTLRQPAAPGAVM-LQGRFE  741
            ++SHVME+A G DVAE +AQFARRRQRGVCVLSG+G VANVTLRQPAAPGAV+ L GRFE
Sbjct  1    MKSHVMEVASGADVAECLAQFARRRQRGVCVLSGSGTVANVTLRQPAAPGAVVALHGRFE  60

Query  740  ILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplvaagpvmVIAATFANATYER  561
            ILSL GTFLPGPSPPG+TGLTVYLAG QGQVVGGSVVG LVAAGPVMVI ATFANATYER
Sbjct  61   ILSLTGTFLPGPSPPGSTGLTVYLAGGQGQVVGGSVVGSLVAAGPVMVIGATFANATYER  120

Query  560  LPILEDDDLPDSRGGSAAQLPIDESPPPLA-----GAEHHGLPEPSSSLPLYNLTPNLFP  396
            LP+ E++D   + GG   QL      PP A          GL    S+L LYNL P+   
Sbjct  121  LPLDEEEDGNTANGGGQGQLSGSGGSPPTAVSNGNNQSQQGLAADPSTLLLYNLPPSFHV  180

Query  395  NGGQLSPHDPYAWQHPR  345
            NG   +  D +AW H R
Sbjct  181  NGTHTN-QDAHAWTHVR  196



>ref|XP_010096609.1| hypothetical protein L484_025356 [Morus notabilis]
 gb|EXB65277.1| hypothetical protein L484_025356 [Morus notabilis]
Length=309

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 151/217 (70%), Gaps = 18/217 (8%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PPI +T+++PN LRSHV+EI+ G+D+ ESIA FA+RR RGV VLSG+G V NVTL
Sbjct  88   KNKPKPPIVITKESPNALRSHVLEISSGSDIVESIAAFAQRRHRGVSVLSGSGIVTNVTL  147

Query  788  RQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplvaa  612
            RQPAAPG V+ L GRFEILSL+G FLP PSPPGATGLTVYL+G QGQVVGG+V G LVA+
Sbjct  148  RQPAAPGGVLTLHGRFEILSLSGAFLPSPSPPGATGLTVYLSGGQGQVVGGAVAGALVAS  207

Query  611  gpvmVIAATFANATYERLPI-----------LEDDDLPDSRGGSAAQLPI-DESPPPLAG  468
            GPV+VI ATF NATYERLPI           +       S   ++   PI  E  PP   
Sbjct  208  GPVIVIGATFTNATYERLPIEEEGGGEGSPSMPVQQQQQSGANNSGGTPISSEQQPPQQQ  267

Query  467  AEHHGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAW  357
             +  G P P    P+YNL PNL PN GQ  PHD + W
Sbjct  268  QQQQGSPVP----PMYNLPPNLMPNNGQNMPHDMF-W  299



>ref|XP_009774038.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana sylvestris]
Length=323

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 154/207 (74%), Gaps = 10/207 (5%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI VT+++PN LRSHV+EI  G+D+ ESIA FA RR RGV VLSG+G V NV
Sbjct  116  GSKNKPKPPIVVTKESPNSLRSHVLEIKSGSDIIESIATFAHRRGRGVSVLSGSGIVTNV  175

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPAA G V+ L GRFEILSL+G FLP PSPPGATGLTVYLAG QGQVVGG+VVG L+
Sbjct  176  TLRQPAAAGGVITLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGSQGQVVGGNVVGELM  235

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            A+GPVMVIAATF NAT+E+LP LE++++ +   G   Q P+  S      +      +P 
Sbjct  236  ASGPVMVIAATFTNATFEKLP-LEEENVSE---GMQMQTPVT-SGVNTGNSGSMADTQP-  289

Query  437  SSLPLYNLTPNLFPNGGQLSPHDPYAW  357
            SS+P+YNL  N+ PNG    PHD + W
Sbjct  290  SSMPMYNLPTNVLPNGQM--PHDVF-W  313



>ref|XP_009757136.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana sylvestris]
Length=286

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 127/143 (89%), Gaps = 2/143 (1%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPIF+TRD+PN LRSH+ME+A G DVAESIAQFAR+RQRGVCVLS +G V N
Sbjct  72   PGSKNKPKPPIFMTRDSPNALRSHIMEVANGADVAESIAQFARKRQRGVCVLSASGTVTN  131

Query  797  VTLRQPAAPG-AVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgp  624
            VTLRQP+ PG AVM L GRFEILSL G FLPGP+PPG+T LT+YLAG QGQVVGG VVG 
Sbjct  132  VTLRQPSVPGTAVMALHGRFEILSLTGAFLPGPAPPGSTDLTIYLAGGQGQVVGGRVVGS  191

Query  623  lvaagpvmVIAATFANATYERLP  555
            LVA+GPVMVIA+TF+NATYERLP
Sbjct  192  LVASGPVMVIASTFSNATYERLP  214



>ref|XP_010907805.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=318

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 157/220 (71%), Gaps = 17/220 (8%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PPI +TR++PN LRSHV+EIA GTD+ ++IA FARRRQRGV +LSG+G V +VT
Sbjct  90   SKNKPKPPIIITRESPNALRSHVLEIASGTDIMDAIAVFARRRQRGVSILSGSGVVTDVT  149

Query  791  LRQPAAP--GAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            LRQPAAP    V L GRFEILSL+G FLP PSPPGATGLTVYLAG QGQVVGG V+G LV
Sbjct  150  LRQPAAPPGAVVTLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGRVMGELV  209

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSR-----GGSAAQLPIDESPPPLAGAEHH-  456
            A+GPVMVIAATF NA YERLP+ +++    +      GG+     + +SPP   G+    
Sbjct  210  ASGPVMVIAATFTNAIYERLPLGDEEAEAAAAEVAAPGGAEGMATLQQSPPGGHGSASQQ  269

Query  455  ----GLP--EPSSSLPLYNLTPNLFPNGGQLSPHDPY-AW  357
                GL   +PSS   LYNL PNL PNG    PH+ + AW
Sbjct  270  SSFGGLAAVDPSSMPALYNLPPNLLPNGQM--PHEVFGAW  307



>ref|XP_004503162.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cicer 
arietinum]
Length=308

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPI +T+++PN LRSHV+EI  G+DVAESIA FA RR RGV VLSG+G VAN
Sbjct  80   PGSKNKPKPPIVITKESPNALRSHVLEIISGSDVAESIAAFANRRHRGVSVLSGSGIVAN  139

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPG V+ L GRFEILSL+G FLP PSPPGATGLTVYLAG QGQVVGGSV G L
Sbjct  140  VTLRQPAAPGGVITLHGRFEILSLSGAFLPSPSPPGATGLTVYLAGGQGQVVGGSVAGSL  199

Query  620  vaagpvmVIAATFANATYERLPILEDDD  537
            +A+GPVMVIAATFANATYERLP LED+ 
Sbjct  200  IASGPVMVIAATFANATYERLP-LEDEQ  226



>gb|KFK37871.1| hypothetical protein AALP_AA3G040100 [Arabis alpina]
Length=312

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 159/223 (71%), Gaps = 13/223 (6%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN L+SHVMEIA GTDV E++A FARRRQRG+C+LSGNG VANV
Sbjct  87   GSKNKPKPPIFVTRDSPNALKSHVMEIASGTDVIETLATFARRRQRGICILSGNGTVANV  146

Query  794  TLRQPAA--------PGAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvgg  639
            TLRQP+            + LQGRFEILSL G+FLPGP+PPG+TGLT+YLAG QGQVVGG
Sbjct  147  TLRQPSTAAAAAPGGAAVLALQGRFEILSLTGSFLPGPAPPGSTGLTIYLAGGQGQVVGG  206

Query  638  svvgplvaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEH  459
            SVVGPL+AAGPVM+IAATF+NATYERLP+ E++      GGS   +P          +  
Sbjct  207  SVVGPLMAAGPVMLIAATFSNATYERLPLEEEEAAERGGGGSGGVVPGQLGGGGSPLSSG  266

Query  458  HGLPEPSSSLPLYNLTPNLFPN-----GGQLSPHDPYAWQHPR  345
             G  + +  LP+YN+  NL  N     GGQ+S  + Y W   R
Sbjct  267  GGGGDGNQGLPVYNMPGNLVSNGGGGGGGQMSGQEAYGWAQAR  309



>emb|CDY64701.1| BnaCnng44570D [Brassica napus]
Length=311

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 132/150 (88%), Gaps = 9/150 (6%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN L+SHVMEIA GTDV E++A FARRRQRG+C+LSGNG VANV
Sbjct  87   GSKNKPKPPIFVTRDSPNALKSHVMEIASGTDVIETLATFARRRQRGICILSGNGTVANV  146

Query  794  TLRQPAA---PG------AVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvg  642
            TLRQP+A   PG       + LQGRFEILSL G+FLPGP+PPG+TGLT+YLAG QGQ+VG
Sbjct  147  TLRQPSAATVPGPPGGAAVLALQGRFEILSLTGSFLPGPAPPGSTGLTIYLAGGQGQIVG  206

Query  641  gsvvgplvaagpvmVIAATFANATYERLPI  552
            GSVVGPL+AAGPVM+IAATF+NATYERLP+
Sbjct  207  GSVVGPLMAAGPVMLIAATFSNATYERLPL  236



>ref|XP_007009270.1| AT-hook protein of GA feedback 2 [Theobroma cacao]
 gb|EOY18080.1| AT-hook protein of GA feedback 2 [Theobroma cacao]
Length=339

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 151/210 (72%), Gaps = 14/210 (7%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPI +T+++PN LRSHV+EI  G+D+AE IA FA+RR RGV VLSG+G V N
Sbjct  112  PGSKNKPKPPIVITKESPNSLRSHVLEITSGSDIAECIANFAQRRHRGVSVLSGSGIVTN  171

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPG V+ L GRFEILSL+G FLP PSPPGATGLTVYLAG QGQVVGGSV+G L
Sbjct  172  VTLRQPAAPGGVITLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGSVIGAL  231

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDES-------------PP  480
            +A+GPVMVIAATF NA YERLPI +++   +  GG    + + +                
Sbjct  232  IASGPVMVIAATFTNAVYERLPIEDENGGEEGGGGGGEGIGVQQQVNHSNNNGGGGGGNS  291

Query  479  PLAGAEHHGLPEPSSSLPLYNLTPNLFPNG  390
              + ++  G  +   S+PLYNL PNL PNG
Sbjct  292  GSSQSQGLGHEQEGGSIPLYNLPPNLLPNG  321



>ref|XP_006408178.1| hypothetical protein EUTSA_v10021166mg [Eutrema salsugineum]
 gb|ESQ49631.1| hypothetical protein EUTSA_v10021166mg [Eutrema salsugineum]
Length=315

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 131/154 (85%), Gaps = 9/154 (6%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN L+SHVMEIA GTDV E++A FARRRQRG+C+LSGNG VANV
Sbjct  87   GSKNKPKPPIFVTRDSPNALKSHVMEIASGTDVIETLATFARRRQRGICILSGNGTVANV  146

Query  794  TLRQ---------PAAPGAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvg  642
            TLRQ         P     + LQGRFEILSL G+FLPGP+PPG+TGLT+YLAG QGQVVG
Sbjct  147  TLRQPSSAAVAAAPGGAAVLALQGRFEILSLTGSFLPGPAPPGSTGLTIYLAGGQGQVVG  206

Query  641  gsvvgplvaagpvmVIAATFANATYERLPILEDD  540
            GSVVGPL+AAGPVM+IAATF+NATYERLP+ E+D
Sbjct  207  GSVVGPLMAAGPVMLIAATFSNATYERLPLEEED  240



>ref|XP_006435633.1| hypothetical protein CICLE_v10032034mg [Citrus clementina]
 ref|XP_006486403.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|ESR48873.1| hypothetical protein CICLE_v10032034mg [Citrus clementina]
Length=338

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 156/221 (71%), Gaps = 17/221 (8%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPI +T+++PN LRSHV+EI  GTD+ ESIA FA+RR RGV +LSG+G V N
Sbjct  111  PGSKNKPKPPIVITKESPNSLRSHVLEITSGTDIVESIANFAQRRHRGVSILSGSGIVTN  170

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            V+LRQPAAPG ++ L GRFEILSL+G FLP PSPPGATGLTVYLAG QGQVVGG+V+G L
Sbjct  171  VSLRQPAAPGGLITLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGTVMGAL  230

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPP------------  477
            +A+GPVMVIAATF NATYERLP+ +++D+  S+           +               
Sbjct  231  MASGPVMVIAATFTNATYERLPMEDEEDMGQSQSLQQQGNGNGGTNSGGGGSGAGGGQSQ  290

Query  476  -LAGAEHHGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAW  357
             L G +H G    +  +P+YNL PNL PNG    PHD + W
Sbjct  291  VLGGGDHQGGGTTTMPMPIYNLPPNLMPNGQM--PHDVF-W  328



>ref|XP_010497513.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Camelina 
sativa]
Length=198

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 128/149 (86%), Gaps = 9/149 (6%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN L+SHVMEIA GTDV E++A FARRRQRG+C+LSGNG VANV
Sbjct  50   GSKNKPKPPIFVTRDSPNALKSHVMEIASGTDVIETLATFARRRQRGICILSGNGTVANV  109

Query  794  TLRQPAA---------PGAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvg  642
            TLRQP+             + LQGRFEILSL G+FLPGP+PPG+TGLT+YLAG QGQVVG
Sbjct  110  TLRQPSTATVAAAPGGAAVLALQGRFEILSLTGSFLPGPAPPGSTGLTIYLAGGQGQVVG  169

Query  641  gsvvgplvaagpvmVIAATFANATYERLP  555
            GSVVGPL+AAGPVM+IAATF+NATYERLP
Sbjct  170  GSVVGPLMAAGPVMLIAATFSNATYERLP  198



>ref|XP_007163438.1| hypothetical protein PHAVU_001G234600g [Phaseolus vulgaris]
 gb|ESW35432.1| hypothetical protein PHAVU_001G234600g [Phaseolus vulgaris]
Length=287

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 148/205 (72%), Gaps = 12/205 (6%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PPI +T+++PN LRSHV+EIA G+DVAESIA FA RR RGV VLSG+G V NVTL
Sbjct  83   KNKPKPPIVITKESPNALRSHVLEIASGSDVAESIAAFANRRHRGVSVLSGSGIVTNVTL  142

Query  788  RQPAAP-GAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplvaa  612
            RQPAAP G + L GRFEILSL+G FLP PSPPGATGL+VYLAG QGQVVGG+V G LVA+
Sbjct  143  RQPAAPTGVITLHGRFEILSLSGAFLPSPSPPGATGLSVYLAGGQGQVVGGTVAGSLVAS  202

Query  611  gpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPSSS  432
            GPVMVIAATFANATYERLP+ E+    + +     Q             +  GL E   S
Sbjct  203  GPVMVIAATFANATYERLPLEEEQGEEEMQVQQQQQQ--------QPQQQSQGLGE-QVS  253

Query  431  LPLYNLTPNLFPNGGQLSPHDPYAW  357
            + +YNL PNL  N GQ  PHD Y W
Sbjct  254  MAMYNLPPNLLHN-GQNMPHDVY-W  276



>ref|XP_011085041.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=299

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 146/197 (74%), Gaps = 9/197 (5%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PPI +T+++PN LRSHV+EIA G+DV ESI+ FARRR  GV VLSG+G V +V L
Sbjct  91   KNKPKPPILITKESPNALRSHVLEIASGSDVLESISTFARRRHCGVSVLSGSGIVTDVRL  150

Query  788  RQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplvaa  612
            RQPAAPG V+ LQGRFE+LSL+G FLP P+PPGATGL VYLAG QGQVVGG+V G LVA+
Sbjct  151  RQPAAPGGVISLQGRFEMLSLSGVFLPEPAPPGATGLAVYLAGGQGQVVGGTVAGALVAS  210

Query  611  gpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLP---EP  441
            GPVMVIAATF NA YERLP+  +D+         ++L ++    P  G   HGL    + 
Sbjct  211  GPVMVIAATFTNAVYERLPL--EDEAASEGTRLESKLGVNAGASPSHG---HGLAADHQS  265

Query  440  SSSLPLYNLTPNLFPNG  390
             S+ PLYNL PNL PNG
Sbjct  266  KSTAPLYNLPPNLLPNG  282



>ref|XP_002312113.2| hypothetical protein POPTR_0008s05890g [Populus trichocarpa]
 gb|EEE89480.2| hypothetical protein POPTR_0008s05890g [Populus trichocarpa]
Length=336

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 156/218 (72%), Gaps = 21/218 (10%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PP+ +T+++PN LRSHV+EI+ G+D+ +SIA F+ RR  GV +LSG+G V NV
Sbjct  118  GSKNKPKPPVVITKESPNSLRSHVLEISSGSDIVDSIANFSHRRHHGVSILSGSGIVDNV  177

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPAAPG V+ L GRFEILSL+G+FLP PSPPGAT LTVYLAG QGQVVGG+V+G LV
Sbjct  178  TLRQPAAPGGVITLHGRFEILSLSGSFLPAPSPPGATRLTVYLAGAQGQVVGGTVMGELV  237

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDES----------PPPLAG  468
            AAGPVMVIAATF+NATYERLP+ E +     + G   Q  +D S              +G
Sbjct  238  AAGPVMVIAATFSNATYERLPLEEQE-----QEGMQLQQQVDSSGTNNGNAAAGGGNNSG  292

Query  467  AE-HHGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAW  357
             +   GL E   S+P++NL PNL PNG    PHD + W
Sbjct  293  TQSSQGLGE-HGSIPVFNLPPNLLPNGQM--PHDVF-W  326



>ref|XP_006847733.1| hypothetical protein AMTR_s00149p00093420 [Amborella trichopoda]
 gb|ERN09314.1| hypothetical protein AMTR_s00149p00093420 [Amborella trichopoda]
Length=272

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 150/205 (73%), Gaps = 17/205 (8%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PP+ +TR++ N LR+H++E+  G DV E +A +ARRRQRGVC+LSG GAV NV+L
Sbjct  75   KNKPKPPVIITRESANTLRAHILEVGAGCDVGECVATYARRRQRGVCILSGTGAVTNVSL  134

Query  788  RQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplvaa  612
            RQPAA GA++ L GRFEILSL+G+FLP P+PPGAT LTV+LAG QGQVVGGSVVG LVAA
Sbjct  135  RQPAAAGAIVTLHGRFEILSLSGSFLPPPAPPGATSLTVFLAGGQGQVVGGSVVGALVAA  194

Query  611  gpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPSSS  432
            GPV+VIAA+FAN  YERLPI ED++ P         L I    PP++ A      +P+S 
Sbjct  195  GPVIVIAASFANVAYERLPI-EDEEPP---------LQIQ---PPVSQASATHFSDPNSG  241

Query  431  LPLYNLTPNLFPNGGQLSPHDPYAW  357
            LP YNL PN+     QL P D + W
Sbjct  242  LPFYNLPPNMV--NCQL-PVDSHGW  263



>ref|XP_004495563.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cicer 
arietinum]
Length=303

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 127/145 (88%), Gaps = 1/145 (1%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIF+TRD+PN LRSHVME++ G+D+++ I QFAR+RQRG+C+LS  G V NV
Sbjct  86   GSKNKPKPPIFITRDSPNALRSHVMEVSTGSDISDCILQFARKRQRGICILSATGTVLNV  145

Query  794  TLRQPAAPGA-VMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            +LRQP  PGA V+L GRF+ILSL G+ LPGPSPPGATGLT+YL+G QGQVVGG VVG LV
Sbjct  146  SLRQPTTPGAVVVLSGRFDILSLTGSVLPGPSPPGATGLTIYLSGGQGQVVGGGVVGSLV  205

Query  617  aagpvmVIAATFANATYERLPILED  543
            AAGPVM++AATF+NATYERLP+ E+
Sbjct  206  AAGPVMLMAATFSNATYERLPVEEN  230



>ref|XP_004952401.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Setaria 
italica]
Length=318

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 145/208 (70%), Gaps = 9/208 (4%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI +TRD+ N LR+HVME+AGG D++ESI  FARRRQRGVCVLSG G V NV
Sbjct  108  GSKNKPKPPIIITRDSANTLRTHVMEVAGGCDISESITAFARRRQRGVCVLSGAGTVTNV  167

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPA+ GAV+ L GRFEILSL+G+FLP P+PP ATGLTVYLAG QGQVVGGSVVG L 
Sbjct  168  TLRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLTVYLAGGQGQVVGGSVVGALT  227

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            AAGPV+++AA+FANA YERLP+ EDD L       AAQ   D +       +   L    
Sbjct  228  AAGPVVIMAASFANAVYERLPLEEDDML-------AAQAQADSAGILAGAQQAAQLAGSV  280

Query  437  SSLPLYNLTPNLFPNGGQLSPHDPYAWQ  354
                   L PNL  N  QL P   Y W 
Sbjct  281  DPSLFQGLPPNLLGN-VQLPPESAYGWN  307



>ref|XP_010463937.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
 ref|XP_010485834.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Camelina 
sativa]
Length=315

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 129/150 (86%), Gaps = 9/150 (6%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN L+SHVMEIA GTDV E++A FARRRQRG+C+LSGNG VANV
Sbjct  87   GSKNKPKPPIFVTRDSPNALKSHVMEIASGTDVIETLATFARRRQRGICILSGNGTVANV  146

Query  794  TLRQPAA---------PGAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvg  642
            TLRQP+             + LQGRFEILSL G+FLPGP+PPG+TGLT+YLAG QGQVVG
Sbjct  147  TLRQPSTATVAAAPGGAAVLALQGRFEILSLTGSFLPGPAPPGSTGLTIYLAGGQGQVVG  206

Query  641  gsvvgplvaagpvmVIAATFANATYERLPI  552
            GSVVGPL+AAGPVM+IAATF+NATYERLP+
Sbjct  207  GSVVGPLMAAGPVMLIAATFSNATYERLPL  236



>ref|XP_010485835.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Camelina 
sativa]
Length=315

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 129/150 (86%), Gaps = 9/150 (6%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN L+SHVMEIA GTDV E++A FARRRQRG+C+LSGNG VANV
Sbjct  87   GSKNKPKPPIFVTRDSPNALKSHVMEIASGTDVIETLATFARRRQRGICILSGNGTVANV  146

Query  794  TLRQPAA---------PGAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvg  642
            TLRQP+             + LQGRFEILSL G+FLPGP+PPG+TGLT+YLAG QGQVVG
Sbjct  147  TLRQPSTATVAAAPGGAAVLALQGRFEILSLTGSFLPGPAPPGSTGLTIYLAGGQGQVVG  206

Query  641  gsvvgplvaagpvmVIAATFANATYERLPI  552
            GSVVGPL+AAGPVM+IAATF+NATYERLP+
Sbjct  207  GSVVGPLMAAGPVMLIAATFSNATYERLPL  236



>ref|XP_010416191.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=315

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 129/150 (86%), Gaps = 9/150 (6%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN L+SHVMEIA GTDV E++A FARRRQRG+C+LSGNG VANV
Sbjct  87   GSKNKPKPPIFVTRDSPNALKSHVMEIASGTDVIETLATFARRRQRGICILSGNGTVANV  146

Query  794  TLRQPAA---------PGAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvg  642
            TLRQP+             + LQGRFEILSL G+FLPGP+PPG+TGLT+YLAG QGQVVG
Sbjct  147  TLRQPSTATVAAAPGGAAVLALQGRFEILSLTGSFLPGPAPPGSTGLTIYLAGGQGQVVG  206

Query  641  gsvvgplvaagpvmVIAATFANATYERLPI  552
            GSVVGPL+AAGPVM+IAATF+NATYERLP+
Sbjct  207  GSVVGPLMAAGPVMLIAATFSNATYERLPL  236



>ref|XP_002882363.1| hypothetical protein ARALYDRAFT_477713 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58622.1| hypothetical protein ARALYDRAFT_477713 [Arabidopsis lyrata subsp. 
lyrata]
Length=314

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 129/150 (86%), Gaps = 9/150 (6%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN L+SHVMEIA GTDV E++A FARRRQRG+C+LSGNG VANV
Sbjct  88   GSKNKPKPPIFVTRDSPNALKSHVMEIASGTDVIETLATFARRRQRGICILSGNGTVANV  147

Query  794  TLRQPAA---------PGAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvg  642
            TLRQP+             + LQGRFEILSL G+FLPGP+PPG+TGLT+YLAG QGQVVG
Sbjct  148  TLRQPSTAAVAAAPGGAAVLALQGRFEILSLTGSFLPGPAPPGSTGLTIYLAGGQGQVVG  207

Query  641  gsvvgplvaagpvmVIAATFANATYERLPI  552
            GSVVGPL+AAGPVM+IAATF+NATYERLP+
Sbjct  208  GSVVGPLMAAGPVMLIAATFSNATYERLPL  237



>ref|NP_566232.1| AT-hook motif nuclear-localized protein [Arabidopsis thaliana]
 gb|AAF04888.1|AC011437_3 hypothetical protein [Arabidopsis thaliana]
 gb|AAM62794.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AAO64817.1| At3g04570 [Arabidopsis thaliana]
 dbj|BAF00160.1| hypothetical protein [Arabidopsis thaliana]
 tpd|FAA00290.1| TPA: AT-hook motif nuclear localized protein 19 [Arabidopsis 
thaliana]
 gb|AEE74098.1| AT-hook motif nuclear-localized protein [Arabidopsis thaliana]
Length=315

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 129/150 (86%), Gaps = 9/150 (6%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN L+SHVMEIA GTDV E++A FARRRQRG+C+LSGNG VANV
Sbjct  88   GSKNKPKPPIFVTRDSPNALKSHVMEIASGTDVIETLATFARRRQRGICILSGNGTVANV  147

Query  794  TLRQPAA---------PGAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvg  642
            TLRQP+             + LQGRFEILSL G+FLPGP+PPG+TGLT+YLAG QGQVVG
Sbjct  148  TLRQPSTAAVAAAPGGAAVLALQGRFEILSLTGSFLPGPAPPGSTGLTIYLAGGQGQVVG  207

Query  641  gsvvgplvaagpvmVIAATFANATYERLPI  552
            GSVVGPL+AAGPVM+IAATF+NATYERLP+
Sbjct  208  GSVVGPLMAAGPVMLIAATFSNATYERLPL  237



>gb|ACU24276.1| unknown [Glycine max]
Length=254

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 148/191 (77%), Gaps = 4/191 (2%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PP+ +TR++ N LR+H++E++ G DV ES+A +AR+RQRG+CVLSG+G V NVT
Sbjct  65   SKNKPKPPVIITRESANTLRAHILEVSTGCDVFESVATYARKRQRGICVLSGSGTVTNVT  124

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQPAA GAV+ L GRFEILSL+G+FLP P+PPGAT LTV+L G QGQVVGG+VVGPLVA
Sbjct  125  LRQPAAAGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTVFLGGGQGQVVGGNVVGPLVA  184

Query  614  agpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPSS  435
            +GPV+VIA++F N  YERLP+ ED+ +   +G S+A     +    ++   ++  P+PSS
Sbjct  185  SGPVIVIASSFTNVAYERLPLDEDESMQMQQGQSSAGDGSGDHGGGVS---NNSFPDPSS  241

Query  434  SLPLYNLTPNL  402
             LP +NL  N+
Sbjct  242  GLPFFNLPLNM  252



>dbj|BAK03205.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=309

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 150/212 (71%), Gaps = 17/212 (8%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI +TRD+ N LR+HVME+AGG D++ESI  FARRRQRGVCVLSG G V NV
Sbjct  97   GSKNKPKPPIIITRDSANTLRTHVMEVAGGCDISESITAFARRRQRGVCVLSGAGTVTNV  156

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPA+ GAV+ L GRFEILSL+G+FLP P+PP ATGLTVYLAG +GQVVGG+VVG L 
Sbjct  157  TLRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLTVYLAGGKGQVVGGTVVGSLT  216

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHH-----G  453
            AAGPV+++AA+FANA YERLP+ ED+ L       AAQ   D +   LA  +       G
Sbjct  217  AAGPVVIMAASFANAVYERLPLEEDELL-------AAQGQADSNGMLLAAGQQASQMAGG  269

Query  452  LPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAW  357
              +PS       L PNL  N  QL P   Y W
Sbjct  270  DVDPSL---FEGLPPNLLGN-VQLPPEAGYRW  297



>ref|XP_011002630.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=336

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 153/224 (68%), Gaps = 27/224 (12%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI +T+++PN L SHVMEI+ G+D+ ESIA F+ RR RGV +LSG+G V NV
Sbjct  112  GSKNKPKPPIVITKESPNSLHSHVMEISSGSDIVESIATFSHRRHRGVSILSGSGIVNNV  171

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPAAPG V+ L GRFEILSL+G+FLP PSPPGATGLTVYLAG QGQVVGG+V+G L+
Sbjct  172  TLRQPAAPGGVITLHGRFEILSLSGSFLPAPSPPGATGLTVYLAGGQGQVVGGTVMGELI  231

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDE-----------------  489
            AAGPVMVIAATF+NATYERLP+ E +     + G   Q  ++                  
Sbjct  232  AAGPVMVIAATFSNATYERLPLEEQE-----QEGMQLQQQVNSPGTNNGNAAAGGGASSG  286

Query  488  SPPPLAGAEHHGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAW  357
                 A     GL E   S+P YNL PNL PNG    PHD + W
Sbjct  287  GGNNSATQSSQGLGE-HVSIPGYNLPPNLLPNG--QVPHDMF-W  326



>gb|AAY86771.1| putative DNA-binding protein [Noccaea caerulescens]
Length=312

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 155/223 (70%), Gaps = 15/223 (7%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN L+SHVMEIA GTDV E++A FARRRQRG+C+LSGNG VANV
Sbjct  89   GSKNKPKPPIFVTRDSPNALKSHVMEIASGTDVIETLATFARRRQRGICILSGNGTVANV  148

Query  794  TLRQ---------PAAPGAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvg  642
            TLRQ         P     + LQGRFEILSL G+FLPGP+PPG+TGLT+YLAG QGQVVG
Sbjct  149  TLRQPSSAAVAAAPGGAAVLALQGRFEILSLTGSFLPGPAPPGSTGLTIYLAGGQGQVVG  208

Query  641  gsvvgplvaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAE  462
            GSVVGPL+AAGPVM+IAATF+NATYERLP+ E++            +P          + 
Sbjct  209  GSVVGPLMAAGPVMLIAATFSNATYERLPLEEEEAAERGG--GGGSVPGQLGGGGSPLSS  266

Query  461  HHGLPEPSSSLPLYNLTPNLFPN----GGQLSPHDPYAWQHPR  345
              G  + +  LP+YN+  NL  N    GGQ+S  + Y W   R
Sbjct  267  GGGGGDGNQGLPVYNMPGNLVSNGGGGGGQMSGQEAYGWAQAR  309



>ref|XP_011033055.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
 ref|XP_011033132.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=334

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 154/217 (71%), Gaps = 19/217 (9%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PP+ +T+++PN LRSHV+EI+ G+D+ +SIA F+ RR  GV +LSG+G V NV
Sbjct  116  GSKNKPKPPVVITKESPNSLRSHVLEISSGSDIVDSIANFSHRRHHGVSILSGSGIVDNV  175

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPAAPG V+ L GRFEILSL+G+FLP PSPPGAT LTVYLAG QGQVVGG+V+G LV
Sbjct  176  TLRQPAAPGGVITLHGRFEILSLSGSFLPAPSPPGATRLTVYLAGAQGQVVGGTVMGELV  235

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            AAGPVMVIAATF+NATYERLP+ E +     + G   Q  ++ S      A   G   P 
Sbjct  236  AAGPVMVIAATFSNATYERLPLEEQE-----QEGMQLQQQVNSSGTNNGNAAAGGGNNPG  290

Query  437  S----------SLPLYNLTPNLFPNGGQLSPHDPYAW  357
            +          S+P++NL PNL PNG    PHD + W
Sbjct  291  TQSSQCLGEHGSIPVFNLPPNLLPNGQM--PHDVF-W  324



>ref|XP_003534486.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X1 [Glycine max]
 ref|XP_006587787.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X2 [Glycine max]
 ref|XP_006587788.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X3 [Glycine max]
Length=270

 Score =   168 bits (426),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 148/191 (77%), Gaps = 4/191 (2%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PP+ +TR++ N LR+H++E++ G DV ES+A +AR+RQRG+CVLSG+G V NVT
Sbjct  65   SKNKPKPPVIITRESANTLRAHILEVSTGCDVFESVATYARKRQRGICVLSGSGTVTNVT  124

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQPAA GAV+ L GRFEILSL+G+FLP P+PPGAT LTV+L G QGQVVGG+VVGPLVA
Sbjct  125  LRQPAAAGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTVFLGGGQGQVVGGNVVGPLVA  184

Query  614  agpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPSS  435
            +GPV+VIA++F N  YERLP+ ED+ +   +G S+A     +    ++   ++  P+PSS
Sbjct  185  SGPVIVIASSFTNVAYERLPLDEDESMQMQQGQSSAGDGSGDHGGGVS---NNSFPDPSS  241

Query  434  SLPLYNLTPNL  402
             LP +NL  N+
Sbjct  242  GLPFFNLPLNM  252



>ref|XP_002451872.1| hypothetical protein SORBIDRAFT_04g009050 [Sorghum bicolor]
 gb|EES04848.1| hypothetical protein SORBIDRAFT_04g009050 [Sorghum bicolor]
Length=327

 Score =   170 bits (430),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 128/148 (86%), Gaps = 1/148 (1%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI +TRD+ N LR+HVME+AGG D++ESI  FARRRQRGVCVLSG G V NV
Sbjct  115  GSKNKPKPPIIITRDSANTLRTHVMEVAGGCDISESITAFARRRQRGVCVLSGAGTVTNV  174

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPA+ GAV+ L GRFEILSL+G+FLP P+PP ATGLTVYLAG QGQVVGGSVVG L 
Sbjct  175  TLRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLTVYLAGGQGQVVGGSVVGALT  234

Query  617  aagpvmVIAATFANATYERLPILEDDDL  534
            AAGPV+++AA+FANA YERLP+ EDD L
Sbjct  235  AAGPVVIMAASFANAVYERLPLEEDDML  262



>ref|XP_008803114.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=318

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 158/217 (73%), Gaps = 16/217 (7%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PP+ +TR++PN LRSHV+EIA GTD+ ++IA FARRRQRG+ +LSG+G V NVTL
Sbjct  94   KNKPKPPVIITRESPNALRSHVLEIASGTDIMDAIAVFARRRQRGMSILSGSGVVTNVTL  153

Query  788  RQPAA-PGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            RQPAA PGAV+ L GRFEILSL+G FLP PS PGA+GLTVYLAG QGQ+VGGSVVG LVA
Sbjct  154  RQPAAPPGAVVTLHGRFEILSLSGAFLPAPSLPGASGLTVYLAGRQGQMVGGSVVGELVA  213

Query  614  agpvmVIAATFANATYERLPILEDDDLPD---------SRGGSAAQLPIDESPPPLAGAE  462
            +GPVMVIAATFANA YERLP+ +++             S G S  Q P       L    
Sbjct  214  SGPVMVIAATFANAIYERLPLGDEEPEAAAAAAAAPPGSEGVSLQQSPRANGGSSLQ-QS  272

Query  461  HHGL-PEPSSSLPLYNLTPNLFPNGGQLSPHDPY-AW  357
            H G+  +PSS  PLYNL PNL P+  QL PHD + AW
Sbjct  273  HGGMGVDPSSLPPLYNLPPNLLPS-SQL-PHDVFGAW  307



>ref|NP_001146992.1| DNA binding protein [Zea mays]
 gb|ACG24948.1| DNA binding protein [Zea mays]
 gb|AFW65915.1| DNA binding protein [Zea mays]
Length=320

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI +TRD+ N LR+HVME+AGG D++ES+  FARRRQRGVCVLSG G V NV
Sbjct  109  GSKNKPKPPIIITRDSANTLRTHVMEVAGGCDISESVTAFARRRQRGVCVLSGAGTVTNV  168

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPA+ GAV+ L GRFEILSL+G+FLP P+PP ATGLTVYLAG QGQVVGGSVVG L 
Sbjct  169  TLRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLTVYLAGGQGQVVGGSVVGALT  228

Query  617  aagpvmVIAATFANATYERLPILEDDDL  534
            AAGPV+V+AA+FANA YERLP LEDDDL
Sbjct  229  AAGPVVVMAASFANAVYERLP-LEDDDL  255



>ref|XP_003573204.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brachypodium 
distachyon]
Length=312

 Score =   169 bits (428),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 133/159 (84%), Gaps = 2/159 (1%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI +TRD+ N LR+HVME+AGG D++ESI  FARRRQRGVCVLSG G V NV
Sbjct  105  GSKNKPKPPIIITRDSANTLRTHVMEVAGGCDISESITAFARRRQRGVCVLSGAGTVTNV  164

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPA+ GAV+ L GRFEILSL+G+FLP P+PP ATGLTVYLAG QGQVVGGSVVG L 
Sbjct  165  TLRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLTVYLAGGQGQVVGGSVVGALT  224

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQL  501
            AAGPV+++AA+FANA YERLP LED+DL    G S A +
Sbjct  225  AAGPVVIMAASFANAVYERLP-LEDEDLLAQGGDSGAGM  262



>ref|XP_002315208.2| hypothetical protein POPTR_0010s20780g [Populus trichocarpa]
 gb|EEF01379.2| hypothetical protein POPTR_0010s20780g [Populus trichocarpa]
Length=336

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 152/224 (68%), Gaps = 27/224 (12%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI +T+++PN L SHV+EI+ G+D+ ESIA F+ RR RGV +LSG+G V NV
Sbjct  112  GSKNKPKPPIVITKESPNSLHSHVLEISSGSDIVESIATFSHRRHRGVSILSGSGIVNNV  171

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPAAPG V+ L GRFEILSL+G+FLP PSPPGATGLTVYLAG QGQVVGG+V+G L+
Sbjct  172  TLRQPAAPGGVITLHGRFEILSLSGSFLPAPSPPGATGLTVYLAGGQGQVVGGTVMGELI  231

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDE-----------------  489
            AAGPVMVIAATF+NATYERLP+ E +     + G   Q  ++                  
Sbjct  232  AAGPVMVIAATFSNATYERLPLEEQE-----QEGMQLQQQVNSPGTNNGNAAAGGGASSG  286

Query  488  SPPPLAGAEHHGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAW  357
                       GL E   S+P YNL PNL PNG    PHD + W
Sbjct  287  GGNNSVTQSSQGLGE-HVSIPGYNLPPNLLPNG--QVPHDMF-W  326



>ref|XP_006576099.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=255

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 133/157 (85%), Gaps = 6/157 (4%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            S+NKP+PP+ VT+++PN L SH++EI+GG+DVAE IA FA RR RGV VLSG+G V NVT
Sbjct  67   SRNKPKPPVVVTKESPNALHSHILEISGGSDVAECIATFATRRHRGVSVLSGSGVVTNVT  126

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQPAAPG V+ LQGRFEILSL+G FLP PSPP ATGLTVYLAG +GQVVGGSVVGPLVA
Sbjct  127  LRQPAAPGGVITLQGRFEILSLSGAFLPAPSPPEATGLTVYLAGGEGQVVGGSVVGPLVA  186

Query  614  agpvmVIAATFANATYERLPILED----DDLPDSRGG  516
            +GPVMV+AATFANATYERLP LED    +D+PD   G
Sbjct  187  SGPVMVVAATFANATYERLP-LEDEQGEEDMPDVNEG  222



>ref|XP_002489068.1| hypothetical protein SORBIDRAFT_0169s002010 [Sorghum bicolor]
 gb|EES20328.1| hypothetical protein SORBIDRAFT_0169s002010 [Sorghum bicolor]
Length=199

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 122/134 (91%), Gaps = 1/134 (1%)
 Frame = -3

Query  965  NKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTLR  786
            NKP PPIFVTRD+PN LRSHVME+AGG DVA++IAQF+RRRQRGVCVLSG G VANV LR
Sbjct  1    NKPNPPIFVTRDSPNALRSHVMEVAGGADVADAIAQFSRRRQRGVCVLSGAGTVANVALR  60

Query  785  QPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplvaag  609
            QP+AP AV+ L GRFEILSL GTFLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L+AAG
Sbjct  61   QPSAPTAVVALHGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGTLIAAG  120

Query  608  pvmVIAATFANATY  567
            PVMVIA+TFANATY
Sbjct  121  PVMVIASTFANATY  134



>gb|KDP44918.1| hypothetical protein JCGZ_01418 [Jatropha curcas]
Length=341

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 157/229 (69%), Gaps = 34/229 (15%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PP+ +T+++PN LRSHV+EI+ G+D+AESI+ FA+RR RGV +LSG+G V N
Sbjct  115  PGSKNKPKPPVVITKESPNSLRSHVLEISSGSDIAESISNFAQRRHRGVSILSGSGIVTN  174

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPG V+ L GRFEILSL+G+FLP PSPPGATGLTVYLAG QGQVVGG+VVG L
Sbjct  175  VTLRQPAAPGGVITLHGRFEILSLSGSFLPAPSPPGATGLTVYLAGGQGQVVGGTVVGQL  234

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQ---------------------  504
            VAAGPVMVIAATF+NAT+ERLP+ E+ D    +                           
Sbjct  235  VAAGPVMVIAATFSNATFERLPLEEEQDGQQLQQQQQVTSGTNAAAAGGSSGSGGSGGAN  294

Query  503  LPIDESPPPLAGAEHHGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAW  357
                +S  P+A A          S+P++NL PNL PNG    PH+ + W
Sbjct  295  NSGSQSSQPIAEA---------GSMPVFNLPPNLLPNGQM--PHEVF-W  331



>ref|NP_001046754.1| Os02g0448000 [Oryza sativa Japonica Group]
 dbj|BAD28974.1| putative DNA-binding protein AT-hook 2 [Oryza sativa Japonica 
Group]
 dbj|BAF08668.1| Os02g0448000 [Oryza sativa Japonica Group]
 gb|EAY85693.1| hypothetical protein OsI_07061 [Oryza sativa Indica Group]
 gb|EAZ22891.1| hypothetical protein OsJ_06576 [Oryza sativa Japonica Group]
Length=316

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 132/153 (86%), Gaps = 2/153 (1%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI +TRD+ N LR+HVME+AGG D++ESI  FARRRQRGVCVLSG G V NV
Sbjct  105  GSKNKPKPPIIITRDSANTLRTHVMEVAGGCDISESITTFARRRQRGVCVLSGAGTVTNV  164

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPA+ GAV+ L GRFEILSL+G+FLP P+PP ATGLTVYLAG QGQVVGGSVVG L 
Sbjct  165  TLRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLTVYLAGGQGQVVGGSVVGALT  224

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRG  519
            AAGPV+++AA+FANA YERLP LEDD+L  ++G
Sbjct  225  AAGPVVIMAASFANAVYERLP-LEDDELLAAQG  256



>ref|XP_003568662.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brachypodium 
distachyon]
Length=321

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 156/219 (71%), Gaps = 13/219 (6%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PPI +TR++PN LRSHV+EIA G D+ +++A FARRRQRGV VLSG+G V NVTL
Sbjct  99   KNKPKPPIIITRESPNTLRSHVLEIASGADIMDAVATFARRRQRGVSVLSGSGVVGNVTL  158

Query  788  RQPAA-PGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            RQPAA PGAV+ L GRFEILSL+G FLP P PPGATGL VYLAG QGQVVGG+VVG LVA
Sbjct  159  RQPAAPPGAVVTLHGRFEILSLSGAFLPSPCPPGATGLAVYLAGGQGQVVGGTVVGELVA  218

Query  614  agpvmVIAATFANATYERLPILED-------DDLPDSRGG--SAAQLPIDESPPPLAGAE  462
            +GP+MV+AATF+NATYERLP++++       D +P    G     + P            
Sbjct  219  SGPIMVVAATFSNATYERLPLVDEELAAATGDAVPTGSDGMQQLPEGPPPPGAGGNGAVM  278

Query  461  HHGLPEPSSSLPLY-NLTPNLFPNGGQLSPHDPYAWQHP  348
              GLP  S+S+P Y +L PNL PN GQ+  HD +A   P
Sbjct  279  GGGLPPDSASMPFYSSLPPNLIPN-GQMPQHDVFASFRP  316



>ref|XP_010934543.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=319

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 156/207 (75%), Gaps = 4/207 (2%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI +TRD+ N LRSHVMEIA G D+A+S+A FAR RQRGVC+L G+G V NV
Sbjct  107  GSKNKPKPPIIITRDSANALRSHVMEIASGCDIADSVATFARHRQRGVCILGGSGTVTNV  166

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPA PG+V+ L GRFEILSL+G+FLP P+PP ATGLT+YLAG QGQVVGGSVVG L+
Sbjct  167  TLRQPATPGSVVALHGRFEILSLSGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGALI  226

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            A+GPV+++AA+F NA YERLP+ E++ LP      +  L + +SPP     +   LP+P+
Sbjct  227  ASGPVVIMAASFGNAVYERLPLDEEEPLPVPGPLGSPGL-VGQSPPQQQQQQQQLLPDPN  285

Query  437  SSLPLYNLTPNLFPNGGQLSPHDPYAW  357
            + L  + L PNL  N  QL P DPY W
Sbjct  286  APL-FHGLPPNLVLNNVQL-PADPYGW  310



>ref|XP_009384866.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384867.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=322

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 151/217 (70%), Gaps = 19/217 (9%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PP+ +TR++PN LRSHV+EI  GTD+ ++IA FARRRQRGV +LSG+G V NVT
Sbjct  102  SKNKPKPPVIITRESPNALRSHVLEIVSGTDIMDAIAVFARRRQRGVSILSGSGVVTNVT  161

Query  791  LRQPAAP--GAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            LRQPAAP    + L GRFEILS++G FLP PSPPGATGLTVYLAG QGQVVGG V G LV
Sbjct  162  LRQPAAPPGSVITLHGRFEILSVSGAFLPAPSPPGATGLTVYLAGGQGQVVGGVVAGELV  221

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSR----GGSAAQL-----PIDESPPPLAGA  465
            A+GPV++IAATFANATYERLP+   DD P++     G    QL              +  
Sbjct  222  ASGPVLIIAATFANATYERLPL--GDDEPEAAAAPPGSEEMQLLQSPGGDGAGGGSSSHQ  279

Query  464  EHHGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPY-AW  357
             H GL   ++  PL+N  P+L PNG    PH+ + AW
Sbjct  280  LHAGL---ATDPPLFNPPPSLLPNGQM--PHEVFGAW  311



>ref|XP_006649829.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Oryza 
brachyantha]
Length=260

 Score =   165 bits (418),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 139/179 (78%), Gaps = 10/179 (6%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PP+ VTR++PN +RSHV+EIA G D+ E+IA F+RRRQRGV VLSG+GAV NVT
Sbjct  56   SKNKPKPPVVVTRESPNAMRSHVLEIASGADIVEAIAGFSRRRQRGVSVLSGSGAVTNVT  115

Query  791  LRQPAAPG--AVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            LRQPA  G  AV L+GRFEILS++G FLP P+PPGATGL VYLAG QGQVVGGSV+G L+
Sbjct  116  LRQPAGTGAAAVALRGRFEILSMSGAFLPAPAPPGATGLAVYLAGGQGQVVGGSVMGELI  175

Query  617  aagpvmVIAATFANATYERLPILEDDD---LPDSRGGSAAQLPIDES-----PPPLAGA  465
            A+GPVMVIAATF NATYERLP+ ++ +   +     G+AAQ+    S     PPP+  A
Sbjct  176  ASGPVMVIAATFGNATYERLPLDQEGEEGAVLSGSEGAAAQMEQQSSGGAVVPPPMYAA  234



>ref|XP_004163216.1| PREDICTED: putative DNA-binding protein ESCAROLA-like, partial 
[Cucumis sativus]
Length=277

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 146/212 (69%), Gaps = 13/212 (6%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+ PI VTRD+P+ L +HV+EI GG DVA+SI QF  RRQRGVCVLSG+G V +
Sbjct  74   PGSKNKPKSPIIVTRDSPHTLSTHVIEIVGGADVADSINQFCCRRQRGVCVLSGSGTVVD  133

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VT+RQ A  GAV+ L+GRFEILS++G+FLPG  PP +TGLTVYLAG QGQV+GG+VVGPL
Sbjct  134  VTVRQSAGSGAVIQLRGRFEILSVSGSFLPGRDPPCSTGLTVYLAGGQGQVIGGTVVGPL  193

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +A GPV++IAATFANATYERLP+    +  + R  S A     E   P        LP P
Sbjct  194  LAGGPVILIAATFANATYERLPLQHHHNY-EEREVSPATTSAGELEEP--------LPYP  244

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
                 +Y+L P   PN       D YAW H R
Sbjct  245  RIETSIYDLIP---PNNNNNHALDGYAWTHDR  273



>gb|KCW71795.1| hypothetical protein EUGRSUZ_E00284 [Eucalyptus grandis]
Length=281

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 140/189 (74%), Gaps = 7/189 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PP+ +TR++ N LR+H++E+  G DV E +A +ARRRQRGVC+LSG+G V N
Sbjct  73   PGSKNKPKPPVIITRESANTLRAHILEVGSGCDVFECVAMYARRRQRGVCILSGSGTVTN  132

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            V+LRQPAA GAV+ L GRFEILSL+G+FLP P+PPGAT LTV+LAG QGQVVGGSVVG L
Sbjct  133  VSLRQPAAAGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTVFLAGGQGQVVGGSVVGEL  192

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
             AAGPV+VIAA+F N  YERLP+ E+D           Q P  + P     A  +  P+P
Sbjct  193  TAAGPVIVIAASFTNVAYERLPLDEEDQQ------LHMQPPASQPPSGPGAAAGNSYPDP  246

Query  440  SSSLPLYNL  414
            SS LP +NL
Sbjct  247  SSGLPFFNL  255



>ref|XP_010055327.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
Length=282

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 140/189 (74%), Gaps = 7/189 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PP+ +TR++ N LR+H++E+  G DV E +A +ARRRQRGVC+LSG+G V N
Sbjct  74   PGSKNKPKPPVIITRESANTLRAHILEVGSGCDVFECVAMYARRRQRGVCILSGSGTVTN  133

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            V+LRQPAA GAV+ L GRFEILSL+G+FLP P+PPGAT LTV+LAG QGQVVGGSVVG L
Sbjct  134  VSLRQPAAAGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTVFLAGGQGQVVGGSVVGEL  193

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
             AAGPV+VIAA+F N  YERLP+ E+D           Q P  + P     A  +  P+P
Sbjct  194  TAAGPVIVIAASFTNVAYERLPLDEEDQQ------LHMQPPASQPPSGPGAAAGNSYPDP  247

Query  440  SSSLPLYNL  414
            SS LP +NL
Sbjct  248  SSGLPFFNL  256



>ref|XP_010920512.1| PREDICTED: putative DNA-binding protein ESCAROLA [Elaeis guineensis]
Length=320

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 159/212 (75%), Gaps = 10/212 (5%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PPI +TR++PN LRSHV+EIA GTD+ +++A FARRRQRGV +LSG+G V NVTL
Sbjct  100  KNKPKPPIIITRESPNSLRSHVLEIASGTDIMDAVAVFARRRQRGVSILSGSGVVTNVTL  159

Query  788  RQPAAP--GAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            RQPAAP    V L GRFEILSL+G FLP PSPPGA+GLTVYLAG QGQVVGGSVVG LVA
Sbjct  160  RQPAAPPGAVVTLHGRFEILSLSGAFLPPPSPPGASGLTVYLAGGQGQVVGGSVVGELVA  219

Query  614  agpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESP----PPLAGAEHHGL-  450
            +GPVMVIAATF NAT+ERLP+ +++    +    +  +P+  SP       +   H G+ 
Sbjct  220  SGPVMVIAATFTNATFERLPLGDEEPEVAAAPPGSEGMPLQPSPGANGVSSSQQSHGGMG  279

Query  449  PEPSSSLPLYNLTPNLFPNGGQLSPHDPY-AW  357
             +PSS  PLYNL PNL PN GQL PHD + AW
Sbjct  280  TDPSSMPPLYNLPPNLLPN-GQL-PHDVFGAW  309



>ref|NP_001049682.1| Os03g0270000 [Oryza sativa Japonica Group]
 gb|AAP06862.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAP06928.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF95202.1| DNA-binding protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11596.1| Os03g0270000 [Oryza sativa Japonica Group]
 gb|EAY89405.1| hypothetical protein OsI_10910 [Oryza sativa Indica Group]
 dbj|BAG88018.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97544.1| unnamed protein product [Oryza sativa Japonica Group]
Length=258

 Score =   165 bits (417),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 139/179 (78%), Gaps = 10/179 (6%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PP+ VTR++PN +RSHV+EIA G D+ E+IA F+RRRQRGV VLSG+GAV NVT
Sbjct  54   SKNKPKPPVVVTRESPNAMRSHVLEIASGADIVEAIAGFSRRRQRGVSVLSGSGAVTNVT  113

Query  791  LRQPAAPG--AVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            LRQPA  G  AV L+GRFEILS++G FLP P+PPGATGL VYLAG QGQVVGGSV+G L+
Sbjct  114  LRQPAGTGAAAVALRGRFEILSMSGAFLPAPAPPGATGLAVYLAGGQGQVVGGSVMGELI  173

Query  617  aagpvmVIAATFANATYERLPILEDDD---LPDSRGGSAAQLPIDES-----PPPLAGA  465
            A+GPVMVIAATF NATYERLP+ ++ +   +     G+AAQ+    S     PPP+  A
Sbjct  174  ASGPVMVIAATFGNATYERLPLDQEGEEGAVLSGSEGAAAQMEQQSSGGAVVPPPMYAA  232



>gb|AES80473.2| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=269

 Score =   165 bits (417),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 145/191 (76%), Gaps = 6/191 (3%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PP+ +TR++ N LR+H++E++ G DV +S+A +AR+RQRG+CVLSG+G V NVT
Sbjct  66   SKNKPKPPVIITRESANTLRAHILEVSSGCDVFDSVATYARKRQRGICVLSGSGTVTNVT  125

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQPAA G+V+ L GRFEILSL+G+FLP P+PPGAT L+V+L G QGQVVGG+VVGPLVA
Sbjct  126  LRQPAAAGSVVTLHGRFEILSLSGSFLPPPAPPGATSLSVFLGGGQGQVVGGNVVGPLVA  185

Query  614  agpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPSS  435
            +GPV+VIA++F N  YERLP+ ED+ L   +G S+A               ++  P+PSS
Sbjct  186  SGPVIVIASSFTNVAYERLPLDEDESLQMQQGQSSA-----GGGGGGGDGVNNSFPDPSS  240

Query  434  SLPLYNLTPNL  402
             LP +NL  N+
Sbjct  241  GLPFFNLPLNM  251



>ref|XP_008229461.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=266

 Score =   165 bits (417),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 146/211 (69%), Gaps = 19/211 (9%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI VTRD+ N LR+H ME++ G DV+ES+  FARR+QRG+C+LSG+G V NV
Sbjct  69   GSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVSESLTNFARRKQRGICILSGSGCVTNV  128

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPA+ GA++ L GRFEILSL G+ LP P+PPG TGLT+YLAG QGQVVGGSVVG L+
Sbjct  129  TLRQPASSGAIVTLHGRFEILSLLGSILPPPAPPGITGLTIYLAGAQGQVVGGSVVGALI  188

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            A+GPV+++AA+F NAT++RLP+ ED+         AA L   +         HH L    
Sbjct  189  ASGPVVIMAASFMNATFDRLPLDEDE--------VAAALQNQQ----YQNGRHHHLDISD  236

Query  437  SSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
                LY L PNL  NG    P + Y+W   R
Sbjct  237  ----LYGLPPNLLTNGN--VPPEVYSWASGR  261



>gb|AFK38460.1| unknown [Medicago truncatula]
Length=269

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 145/191 (76%), Gaps = 6/191 (3%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PP+ +TR++ N LR+H++E++ G DV +S+A +AR+RQRG+CVLSG+G V NVT
Sbjct  66   SKNKPKPPVIITRESANTLRAHILEVSSGCDVFDSVATYARKRQRGICVLSGSGTVTNVT  125

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQPAA G+V+ L GRFEILSL+G+FLP P+PPGAT L+V+L G QGQVVGG+VVGPLVA
Sbjct  126  LRQPAAAGSVVTLHGRFEILSLSGSFLPPPAPPGATSLSVFLGGGQGQVVGGNVVGPLVA  185

Query  614  agpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPSS  435
            +GPV+VIA++F N  YERLP+ ED+ L   +G S+A               ++  P+PSS
Sbjct  186  SGPVIVIASSFTNVAYERLPLDEDESLQMQQGQSSA-----GGGGGGGDGVNNSFPDPSS  240

Query  434  SLPLYNLTPNL  402
             LP +NL  N+
Sbjct  241  GLPFFNLPLNM  251



>ref|XP_009382863.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382873.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=309

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 155/207 (75%), Gaps = 9/207 (4%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI +TR++ N LRSHVMEIAGG D+ ESIA FA RR RGVC+LSG+G V NV
Sbjct  101  GSKNKPKPPIIITRESANVLRSHVMEIAGGCDIVESIATFACRRHRGVCILSGSGTVVNV  160

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPA+P AV+ L GRFEILSL+G+FLP P+PP ATGLT+YLAG QGQ+VGGSVVG L+
Sbjct  161  TLRQPASPSAVVTLHGRFEILSLSGSFLPPPAPPAATGLTIYLAGGQGQIVGGSVVGALI  220

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            A+ PV+++AA+F NA YERLP+ E++ L   +GG  +   + +SPPP        L +P+
Sbjct  221  ASSPVIIMAASFGNAAYERLPLDEEEPLQAQQGGLGSPGLVGQSPPP-----QQQLLDPN  275

Query  437  SSLPLYNLTPNLFPNGGQLSPHDPYAW  357
            + L L+ L PNL  N  QL P + Y W
Sbjct  276  NPL-LHGLPPNLL-NNVQL-PAEAYGW  299



>ref|XP_004307477.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=320

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 128/148 (86%), Gaps = 1/148 (1%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PPI +T+++PN LRSHV+EI+ G+D+ +SIA FA+RR RGV VLSG+G V+N
Sbjct  98   PGSKNKPKPPIIITKESPNALRSHVLEISSGSDIVDSIATFAQRRHRGVSVLSGSGIVSN  157

Query  797  VTLRQPAAP-GAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAP G + L GRFEILSL G FLP PSPPGA+GLTVYL G QGQVVGG+VVGPL
Sbjct  158  VTLRQPAAPSGVITLHGRFEILSLNGAFLPAPSPPGASGLTVYLGGGQGQVVGGTVVGPL  217

Query  620  vaagpvmVIAATFANATYERLPILEDDD  537
            VA+GPVM+IAATF NATYERLP+ E+ +
Sbjct  218  VASGPVMIIAATFTNATYERLPLEEESN  245



>ref|XP_003624255.1| AT-hook DNA-binding protein [Medicago truncatula]
Length=316

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 145/191 (76%), Gaps = 6/191 (3%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PP+ +TR++ N LR+H++E++ G DV +S+A +AR+RQRG+CVLSG+G V NVT
Sbjct  113  SKNKPKPPVIITRESANTLRAHILEVSSGCDVFDSVATYARKRQRGICVLSGSGTVTNVT  172

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQPAA G+V+ L GRFEILSL+G+FLP P+PPGAT L+V+L G QGQVVGG+VVGPLVA
Sbjct  173  LRQPAAAGSVVTLHGRFEILSLSGSFLPPPAPPGATSLSVFLGGGQGQVVGGNVVGPLVA  232

Query  614  agpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPSS  435
            +GPV+VIA++F N  YERLP+ ED+ L   +G S+A               ++  P+PSS
Sbjct  233  SGPVIVIASSFTNVAYERLPLDEDESLQMQQGQSSA-----GGGGGGGDGVNNSFPDPSS  287

Query  434  SLPLYNLTPNL  402
             LP +NL  N+
Sbjct  288  GLPFFNLPLNM  298



>ref|XP_003571267.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brachypodium 
distachyon]
Length=285

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 146/192 (76%), Gaps = 11/192 (6%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN LRSHVME+AGG D+A++IA FARRRQRGVCVLSG G VA+V
Sbjct  68   GSKNKPKPPIFVTRDSPNALRSHVMEVAGGADIADAIAAFARRRQRGVCVLSGAGTVADV  127

Query  794  TLRQPAAPGAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
             LRQPAA   V L+GRFEILSL GTFLPGP+PPG+TGLTVYLAG QGQVVGGSVVG L A
Sbjct  128  ALRQPAAGSVVALRGRFEILSLTGTFLPGPAPPGSTGLTVYLAGGQGQVVGGSVVGALTA  187

Query  614  agpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPSS  435
            AGPVMVIA+TFANATYERLP+ E D       G    +P    PP       H     +S
Sbjct  188  AGPVMVIASTFANATYERLPLDEVDAAGAEEDGHGNGMP----PP-------HSEATMAS  236

Query  434  SLPLYNLTPNLF  399
             +P++ + P++F
Sbjct  237  MMPVHGVDPSMF  248



>ref|XP_008785537.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=317

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 155/218 (71%), Gaps = 15/218 (7%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PPI +T+++PN LRSHV+EIA GTD+ +++A FARRRQRG+ +LSG+G V NVT
Sbjct  91   SKNKPKPPIIITKESPNALRSHVLEIASGTDIMDAVAVFARRRQRGISILSGSGVVTNVT  150

Query  791  LRQPAAP--GAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            LRQPAAP    V L GRFEILSL+G FLP PSP  +TGLTVY AG QGQVVGGSVVG LV
Sbjct  151  LRQPAAPPGTVVTLHGRFEILSLSGAFLPEPSPTVSTGLTVYFAGGQGQVVGGSVVGELV  210

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRG---GSAAQLPIDESPPPLAGA-----E  462
            A+GPVMVIAATF NA YERLP+ +++          G+     + +SPP   G+      
Sbjct  211  ASGPVMVIAATFTNAMYERLPLGDEEAEETEAAPPRGAEGMAALQQSPPGGNGSASQQTS  270

Query  461  HHG--LPEPSSSLPLYNLTPNLFPNGGQLSPHDPY-AW  357
            H G    +PS   PLYNL PNL PN GQ++ H+ + AW
Sbjct  271  HAGSAAADPSLMPPLYNLPPNLLPN-GQMT-HEVFGAW  306



>ref|XP_008801621.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
 ref|XP_008801622.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
 ref|XP_008801623.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=320

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 154/212 (73%), Gaps = 10/212 (5%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PPI +TR++PN LRSHV+EIA GTD+ +++A FARRRQRGV +LSG+G V NVTL
Sbjct  100  KNKPKPPIIITRESPNALRSHVLEIASGTDIMDAVAVFARRRQRGVSILSGSGVVTNVTL  159

Query  788  RQPAAP--GAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            RQPAAP    V L GRFEILSL+G FLP PSPPGA+GLTVYLAG QGQVVGGSVVG LVA
Sbjct  160  RQPAAPPGAVVTLHGRFEILSLSGAFLPPPSPPGASGLTVYLAGGQGQVVGGSVVGELVA  219

Query  614  agpvmVIAATFANATYERLPILEDDD----LPDSRGGSAAQLPIDESPPPLAGAEHHGL-  450
            +GPVMVIAATF NATYERLP+ +++      P    G   Q     +    +   H G+ 
Sbjct  220  SGPVMVIAATFTNATYERLPLGDEESEAAAAPPGSEGMPLQQSPGGNGGSSSQQSHGGMG  279

Query  449  PEPSSSLPLYNLTPNLFPNGGQLSPHDPY-AW  357
             +P S  PLYNL PNL PN GQL PHD +  W
Sbjct  280  ADPGSMPPLYNLPPNLLPN-GQL-PHDVFGVW  309



>gb|ABL63121.1| AT-hook DNA-binding protein [Catharanthus roseus]
Length=302

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 145/197 (74%), Gaps = 5/197 (3%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PPI +T+++PN LRSHV+EI+ G+DV E I+ FA RR RGV VLSG+G V NV+L
Sbjct  97   KNKPKPPIIITKESPNALRSHVLEISNGSDVVECISTFALRRHRGVSVLSGSGIVNNVSL  156

Query  788  RQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplvaa  612
            RQPAAPG V+ L GRFEILSL+G+FLP PSPPGATGLTVYLAG QGQVVGG+VVG LVA+
Sbjct  157  RQPAAPGGVVTLHGRFEILSLSGSFLPAPSPPGATGLTVYLAGGQGQVVGGTVVGSLVAS  216

Query  611  gpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPSSS  432
            GPVMVIAATF NATYERLP+ E+     +   +             A ++ HG+ +   S
Sbjct  217  GPVMVIAATFTNATYERLPLEEEATATATDAAAEGGGGGTSG----AASQSHGMADDPVS  272

Query  431  LPLYNLTPNLFPNGGQL  381
               Y+L PNL PNG ++
Sbjct  273  PNFYSLPPNLVPNGQEV  289



>ref|XP_002524209.1| ESC, putative [Ricinus communis]
 gb|EEF38133.1| ESC, putative [Ricinus communis]
Length=342

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 149/225 (66%), Gaps = 28/225 (12%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNK +PPI VT+++PN LRSHV+EI+ GTD+  SI+ FA+RR RGV +LSG+G V N
Sbjct  118  PGSKNKLKPPIVVTKESPNALRSHVLEISSGTDIVGSISNFAQRRHRGVSILSGSGIVTN  177

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAAPG V+ L GRFEILSL G+FLP PSPPGAT LTVYLAG QGQVVGG+V+G L
Sbjct  178  VTLRQPAAPGGVITLHGRFEILSLLGSFLPPPSPPGATTLTVYLAGGQGQVVGGTVMGQL  237

Query  620  vaagpvmVIAATFANATYERLPILEDD-----------------DLPDSRGGSAAQLPID  492
            VAAGPVMVIAATF NAT+ERLP+ E +                 +               
Sbjct  238  VAAGPVMVIAATFTNATFERLPLEEQEQEGMQLQQQVTSGTNNSNTAGGGSSGGGDGNNS  297

Query  491  ESPPPLAGAEHHGLPEPSSSLPLYNLTPNLFPNGGQLSPHDPYAW  357
             S    A AEH        S+P+YNL PNL PNG    PH+ + W
Sbjct  298  GSQSSQAMAEH-------GSMPVYNLPPNLLPNGQM--PHEVF-W  332



>gb|KCW77938.1| hypothetical protein EUGRSUZ_D02188, partial [Eucalyptus grandis]
Length=277

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 141/189 (75%), Gaps = 13/189 (7%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PP+ +TR++ N LR+H++E+  G DV + IA +ARRRQRG+CVLSG G V N
Sbjct  83   PGSKNKPKPPVIITRESANSLRAHILEVGNGCDVFDCIATYARRRQRGICVLSGTGTVTN  142

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            V+LRQPAA G+V+ L GRFEILSL+G+FLP P+PPGAT LT++LAG QGQVVGGSVVG L
Sbjct  143  VSLRQPAAAGSVVTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGEL  202

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +A+GPV+VIAA+F N  YERLP+ E++           Q+ +  +    +G  H   P+P
Sbjct  203  IASGPVIVIAASFTNVAYERLPLEEEE-----------QIQMQAAAAAASGG-HSPFPDP  250

Query  440  SSSLPLYNL  414
            SS LP +NL
Sbjct  251  SSGLPFFNL  259



>emb|CDP00129.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PPI +T+++PN LRSHV+EI+ G DVAE IA FA+RR RGV VLSG+G V NVTL
Sbjct  132  KNKPKPPIVITKESPNALRSHVLEISSGNDVAECIAAFAQRRHRGVSVLSGSGIVTNVTL  191

Query  788  RQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplvaa  612
            RQPAAPG V+ L GRFEILSL+G FLP PSPPGATGLTVYLAG QGQVVGG+VVGPL+A+
Sbjct  192  RQPAAPGGVITLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGTVVGPLMAS  251

Query  611  gpvmVIAATFANATYERLPILED  543
            GPVMVIAATF NATYERLP+ E+
Sbjct  252  GPVMVIAATFTNATYERLPLEEE  274



>ref|XP_002279677.2| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=268

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 144/207 (70%), Gaps = 19/207 (9%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI +TRD+ N LR+H ME++ G DV+ES+A FARR+QRG+C+LSG+G V NV
Sbjct  71   GSKNKPKPPIIITRDSANALRAHAMEVSSGCDVSESLANFARRKQRGICILSGSGCVTNV  130

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPA+ GA++ L GRFEILSL G+ LP P+PPG TGLT+YLAG QGQVVGG VVG L+
Sbjct  131  TLRQPASSGAIVTLHGRFEILSLLGSILPPPAPPGITGLTIYLAGAQGQVVGGGVVGALI  190

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            A+GPV V+AA+F NAT++RLP L+DD++  +      Q              HH +    
Sbjct  191  ASGPVFVMAASFMNATFDRLP-LDDDEVTTAVQSQHYQ-----------NGRHHHIDMSD  238

Query  437  SSLPLYNLTPNLFPNGGQLSPHDPYAW  357
                LY + PNL  NG  L   + Y+W
Sbjct  239  ----LYGIPPNLLTNGTMLP--EIYSW  259



>ref|XP_004305833.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=266

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 144/211 (68%), Gaps = 19/211 (9%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI VTRD+ N LR+H ME++ G DV+ES+  FARR+QRG+C+LSG+G V NV
Sbjct  69   GSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVSESLTNFARRKQRGICILSGSGCVTNV  128

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPA+ GA++ L GRFEILSL G+ LP P+PPG TGLT+YLAG QGQVVGG VVG L+
Sbjct  129  TLRQPASSGAIVTLHGRFEILSLLGSILPPPAPPGITGLTIYLAGAQGQVVGGGVVGALI  188

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            A+GPV+++AA+F NAT++RLP+ ED+         AA L   +         HH L    
Sbjct  189  ASGPVVIMAASFMNATFDRLPLDEDE--------VAAALQNQQ----YQNGRHHHLDMSD  236

Query  437  SSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
                 Y L PNL  NG    P + Y+W   R
Sbjct  237  ----FYGLPPNLLTNGN--VPPEVYSWASGR  261



>ref|XP_007139682.1| hypothetical protein PHAVU_008G050100g [Phaseolus vulgaris]
 gb|ESW11676.1| hypothetical protein PHAVU_008G050100g [Phaseolus vulgaris]
Length=271

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 145/193 (75%), Gaps = 3/193 (2%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PP+ +TR++ N LR+H++E++ G DV +S+A +AR+RQRG+CVLSG+G V N
Sbjct  63   PGSKNKPKPPVIITRESANTLRAHILEVSSGCDVFDSVATYARKRQRGICVLSGSGTVTN  122

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAA GAV+ L GRFEILSL+G+FLP P+PPGAT LTV+L G QGQVVGG+VVGPL
Sbjct  123  VTLRQPAAAGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTVFLGGGQGQVVGGNVVGPL  182

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            VA+GPV+VIA++F N  YERLP+ E+D +        +      S     G  ++  P+P
Sbjct  183  VASGPVIVIASSFTNVAYERLPLDEEDSM--QMQQGQSSAGGGGSGGGGGGVSNNSFPDP  240

Query  440  SSSLPLYNLTPNL  402
            SS LP +NL  N+
Sbjct  241  SSGLPFFNLPLNM  253



>ref|XP_004150655.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
Length=281

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 145/212 (68%), Gaps = 13/212 (6%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNK + PI VTRD+P+ L +HV+EI GG DVA+SI QF  RRQRGVCVLSG+G V +
Sbjct  78   PGSKNKRKSPIIVTRDSPHTLSTHVIEIVGGADVADSINQFCCRRQRGVCVLSGSGTVVD  137

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VT+RQ A  GAV+ L+GRFEILS++G+FLPG  PP +TGLTVYLAG QGQV+GG+VVGPL
Sbjct  138  VTVRQSAGSGAVIQLRGRFEILSVSGSFLPGRDPPCSTGLTVYLAGGQGQVIGGTVVGPL  197

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +A GPV++IAATFANATYERLP+    +  + R  S A     E   P        LP P
Sbjct  198  LAGGPVILIAATFANATYERLPLQHHHNY-EEREVSPATTSAGELEEP--------LPYP  248

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
                 +Y+L P   PN       D YAW H R
Sbjct  249  RIETSIYDLIP---PNNNNNHALDGYAWTHDR  277



>gb|KGN61619.1| hypothetical protein Csa_2G190760 [Cucumis sativus]
Length=285

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 145/212 (68%), Gaps = 13/212 (6%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNK + PI VTRD+P+ L +HV+EI GG DVA+SI QF  RRQRGVCVLSG+G V +
Sbjct  82   PGSKNKRKSPIIVTRDSPHTLSTHVIEIVGGADVADSINQFCCRRQRGVCVLSGSGTVVD  141

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VT+RQ A  GAV+ L+GRFEILS++G+FLPG  PP +TGLTVYLAG QGQV+GG+VVGPL
Sbjct  142  VTVRQSAGSGAVIQLRGRFEILSVSGSFLPGRDPPCSTGLTVYLAGGQGQVIGGTVVGPL  201

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +A GPV++IAATFANATYERLP+    +  + R  S A     E   P        LP P
Sbjct  202  LAGGPVILIAATFANATYERLPLQHHHNY-EEREVSPATTSAGELEEP--------LPYP  252

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
                 +Y+L P   PN       D YAW H R
Sbjct  253  RIETSIYDLIP---PNNNNNHALDGYAWTHDR  281



>gb|AIV43385.1| AHL protein [Triticum aestivum]
Length=256

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 136/175 (78%), Gaps = 10/175 (6%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PP+ VTR++PN +RSHV+EIA G D+ E+IA F+RRRQRGV VLSG+GAV NVTL
Sbjct  54   KNKPKPPVVVTRESPNAMRSHVLEIASGADIVEAIAAFSRRRQRGVSVLSGSGAVTNVTL  113

Query  788  RQPAAPG--AVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            RQPA  G  AV L+GRFEILSL+G FLP P+PPGATGL VYLAG QGQVVGGSV+G L+A
Sbjct  114  RQPAGTGAAAVALRGRFEILSLSGAFLPAPAPPGATGLAVYLAGGQGQVVGGSVMGELLA  173

Query  614  agpvmVIAATFANATYERLPILEDDD---LPDSRGGSAAQLPIDES-----PPPL  474
            +GPVMVIAATF NATYERLP+ +D +   +     G+A QL    S     PPP+
Sbjct  174  SGPVMVIAATFGNATYERLPLDQDAEEGAVLSGSEGAATQLEQQGSGGAAVPPPM  228



>ref|XP_006363711.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=293

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 126/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI +TRD+ N LR+HVMEIA G D+ ESI+ FARRRQRGVC++SG G V NV
Sbjct  83   GSKNKPKPPIIITRDSANALRTHVMEIADGCDIMESISNFARRRQRGVCIMSGTGIVTNV  142

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
             LRQPA+PGA++ L GRFEILSLAG+FLP P+PP  +GLT+YLAG QGQVVGGSVVG L+
Sbjct  143  NLRQPASPGAIVTLHGRFEILSLAGSFLPPPAPPTTSGLTIYLAGGQGQVVGGSVVGALM  202

Query  617  aagpvmVIAATFANATYERLPILEDD  540
            A+GPV++++A+F+NA YERLP+ ED+
Sbjct  203  ASGPVVIMSASFSNAAYERLPLEEDN  228



>ref|XP_010053603.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
Length=289

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 141/189 (75%), Gaps = 13/189 (7%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PP+ +TR++ N LR+H++E+  G DV + IA +ARRRQRG+CVLSG G V N
Sbjct  83   PGSKNKPKPPVIITRESANSLRAHILEVGNGCDVFDCIATYARRRQRGICVLSGTGTVTN  142

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            V+LRQPAA G+V+ L GRFEILSL+G+FLP P+PPGAT LT++LAG QGQVVGGSVVG L
Sbjct  143  VSLRQPAAAGSVVTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGEL  202

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +A+GPV+VIAA+F N  YERLP+ E++           Q+ +  +    +G  H   P+P
Sbjct  203  IASGPVIVIAASFTNVAYERLPLEEEE-----------QIQMQAAAAAASGG-HSPFPDP  250

Query  440  SSSLPLYNL  414
            SS LP +NL
Sbjct  251  SSGLPFFNL  259



>ref|XP_004490915.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cicer 
arietinum]
Length=309

 Score =   164 bits (414),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 150/214 (70%), Gaps = 11/214 (5%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PP+ +T++TPN LRSH+MEI+GG+D+AE IA FA RR RGV VLSG G V NVTL
Sbjct  95   KNKPKPPVVITKETPNALRSHIMEISGGSDIAECIANFANRRHRGVSVLSGTGVVTNVTL  154

Query  788  RQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplvaa  612
            RQP APG V+ L GRF+ILSL+G FLP PSPP ATGLTVYLAGVQGQVVGG VVG LVA+
Sbjct  155  RQPTAPGGVISLPGRFDILSLSGAFLPPPSPPEATGLTVYLAGVQGQVVGGMVVGSLVAS  214

Query  611  gpvmVIAATFANATYERLPI------LEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGL  450
            GPVM++AATFANATYERLP+       E++++      +  +          +G   HGL
Sbjct  215  GPVMIVAATFANATYERLPLEDEEQQGEEENIQQENNNNNNEGGSGSGSASGSGVTSHGL  274

Query  449  PEPSSSLPLYNLTPNLFPNGGQLSPHDPYAWQHP  348
             E      ++N+ PNL  NGG    HD + W+ P
Sbjct  275  GEQQQ---VFNMNPNLMGNGGHNVAHDVF-WRPP  304



>ref|XP_010558745.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=300

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 154/223 (69%), Gaps = 23/223 (10%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PPIFVTRD+PN L+SHVMEIA G+DV E++A FARRRQRGVC+LSGNG VANVT
Sbjct  84   SKNKPKPPIFVTRDSPNALKSHVMEIASGSDVVETLATFARRRQRGVCILSGNGTVANVT  143

Query  791  LRQPAAP-------------GAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgq  651
            LRQP++              G + L GRFEILS+ G+FLPGP+PPG+TGLT+YLAG QGQ
Sbjct  144  LRQPSSTPAAGGGGGAVGAGGVMALHGRFEILSMTGSFLPGPAPPGSTGLTIYLAGGQGQ  203

Query  650  vvggsvvgplvaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLA  471
            +VGGSVVGPL+AAGPVM+IAATF+NATYERLP+ E+++     G           P    
Sbjct  204  IVGGSVVGPLMAAGPVMLIAATFSNATYERLPLEEEEERAGGGGPGQLAGGGGSPPSGGD  263

Query  470  GAEHHGLPEPSSSLPLYNLTPNLFPNGG-QLSPHDPYAWQHPR  345
            G +          LP+YNL  NL   GG Q+S  D Y W   R
Sbjct  264  GNQ---------GLPVYNLPGNLVNGGGEQISSQDAYGWSQTR  297



>ref|XP_009103966.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Brassica 
rapa]
 ref|XP_009103967.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Brassica 
rapa]
Length=263

 Score =   162 bits (410),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 146/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+ P+ VT+++PN L+SHV+EIA G DVAES+  FARRR RGV VLSG+G V NVT
Sbjct  56   SKNKPKNPVVVTKESPNSLQSHVLEIATGADVAESLNAFARRRGRGVSVLSGSGLVTNVT  115

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGP-SPPGATGLTvylagvqgqvvggsvvgplv  618
            LRQPAA G V+ L+G+FEILS+ G FLP   SP  A GLT+YLAG QGQV+GG V GPL+
Sbjct  116  LRQPAASGGVVSLRGQFEILSMCGAFLPTSGSPAAAAGLTIYLAGAQGQVLGGGVAGPLI  175

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            A+GPV+VIAATF NA++ERLPI ++   P      A +   D++     G E        
Sbjct  176  ASGPVIVIAATFCNASFERLPIEDEQQQPQVE--EAKEKENDDNKSGNDGTEE-------  226

Query  437  SSLPLYNLTPNLFPNGGQLSPHDPYAWQHP  348
            S  P+YN+TPN  PNG Q++ HD + W  P
Sbjct  227  SMQPMYNMTPNFMPNGHQMAQHDVF-WGAP  255



>emb|CDY60321.1| BnaCnng36000D [Brassica napus]
Length=296

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 145/209 (69%), Gaps = 11/209 (5%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+ P+ VT+++PN L+SHV+EIA G DVAES+  FARRR RGV VLSG+G V NVT
Sbjct  90   SKNKPKNPVVVTKESPNSLQSHVLEIATGADVAESLNAFARRRGRGVSVLSGSGLVTNVT  149

Query  791  LRQPAAPGAVMLQGRFEILSLAGTFLPGP-SPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQPAA G V L+G+FEILS+ G FLP   SP  A GLT+YLAG QGQV+GG V GPL+A
Sbjct  150  LRQPAASGVVSLRGQFEILSMCGAFLPTSGSPAAAAGLTIYLAGAQGQVLGGGVAGPLIA  209

Query  614  agpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPSS  435
            +GPV+VIAATF NA++ERLP  ++   P      A +   D++     G E        S
Sbjct  210  SGPVIVIAATFCNASFERLPFEDEQQQPQVE--EAKEKENDDNKSGNDGTE-------GS  260

Query  434  SLPLYNLTPNLFPNGGQLSPHDPYAWQHP  348
              P+YN+TPN+ PNG Q++ HD + W  P
Sbjct  261  MQPMYNMTPNVMPNGHQIAQHDVF-WGAP  288



>ref|XP_010102152.1| hypothetical protein L484_021386 [Morus notabilis]
 gb|EXB92402.1| hypothetical protein L484_021386 [Morus notabilis]
Length=267

 Score =   162 bits (410),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 146/211 (69%), Gaps = 19/211 (9%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI VTRD+ N LR+H ME++ G DV+ES+A FARR+QRG+C+LSG+G V NV
Sbjct  69   GSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVSESLANFARRKQRGICILSGSGCVTNV  128

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQP + GA++ L GRFEILSL G+ LP P+PPG TGLT+YLAG QGQVVGGSVVG LV
Sbjct  129  TLRQPTSSGAIVTLHGRFEILSLLGSVLPPPAPPGITGLTIYLAGAQGQVVGGSVVGTLV  188

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            A+GPV+++AA+F NAT++RLP L++D++  +      Q            A HH    P 
Sbjct  189  ASGPVVIMAASFMNATFDRLP-LDEDEVTAALQNQHYQ-----------NARHH----PL  232

Query  437  SSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
                LY +  NL  NG    P + Y+W   R
Sbjct  233  DVSDLYGMPHNLLTNGNM--PPEMYSWASCR  261



>dbj|BAJ98882.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95519.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=256

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PP+ VTR++PN +RSHV+EIA G D+ E+IA F+RRRQRGV VLSG+GAV NVTL
Sbjct  54   KNKPKPPVVVTRESPNAMRSHVLEIASGADIVEAIAAFSRRRQRGVSVLSGSGAVTNVTL  113

Query  788  RQPAAPG--AVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            RQPA  G  AV L+GRFEILSL+G FLP P+PPGATGL VYLAG QGQVVGGSV+G L+A
Sbjct  114  RQPAGTGAAAVALRGRFEILSLSGAFLPAPAPPGATGLAVYLAGGQGQVVGGSVMGELLA  173

Query  614  agpvmVIAATFANATYERLPILEDDD  537
             GPVMVIAATF NATYERLP+ +D +
Sbjct  174  CGPVMVIAATFGNATYERLPLDQDAE  199



>dbj|BAK02723.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=312

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 150/217 (69%), Gaps = 15/217 (7%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PP+ +TR++ N LR+H++E+  G DV E I+ +A RRQRGVCVLSG+G V N
Sbjct  94   PGSKNKPKPPVIITRESANTLRAHILEVGSGCDVFECISTYACRRQRGVCVLSGSGIVTN  153

Query  797  VTLRQPAAP--GAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgp  624
            VTLRQP+AP    V L GRFEILSL+G+FLP P+PPGAT LT++LAG QGQVVGG+VVG 
Sbjct  154  VTLRQPSAPAGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGNVVGA  213

Query  623  lvaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPE  444
            L AAGPV+VIAA+FAN  YERLP LED++ P +  G   Q P D  P     A   G+P 
Sbjct  214  LYAAGPVIVIAASFANVAYERLP-LEDEEAPPATAGMQMQQPSDADP----AAGMGGVPF  268

Query  443  P----SSSLPLYNLTPNLFPNGG---QLSP-HDPYAW  357
            P    ++ LP +N  P     GG   QL P  D + W
Sbjct  269  PPDPSAAGLPFFNQLPLNNMTGGPGSQLPPGADGHGW  305



>ref|XP_009419257.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=300

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 146/206 (71%), Gaps = 12/206 (6%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PPI +T ++P+ LRSHV+EIAGGTD+ +++A FARRRQ GVC+LSG G V NVT
Sbjct  94   SKNKPKPPIIITTESPSALRSHVLEIAGGTDIMDAVATFARRRQCGVCILSGRGVVTNVT  153

Query  791  LRQPAA-PGAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQP A PG ++L GRFEILSL+G FLP PSPPGATGLT+YLAG QGQVVGG+V+G LV+
Sbjct  154  LRQPGAPPGVIVLHGRFEILSLSGAFLPEPSPPGATGLTIYLAGGQGQVVGGNVMGELVS  213

Query  614  agpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPSS  435
             G VMVIAATF+NATYERLP+ E++            + + +S     G           
Sbjct  214  LGTVMVIAATFSNATYERLPLEEEEPAAAGAPPGTEAIKLQQSQRGDGGV----------  263

Query  434  SLPLYNLTPNLFPNGGQLSPHDPYAW  357
            S PLYNL  NL PN G++S     AW
Sbjct  264  STPLYNLPLNLSPN-GEMSIEAFGAW  288



>emb|CAN83987.1| hypothetical protein VITISV_032602 [Vitis vinifera]
Length=282

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 144/193 (75%), Gaps = 8/193 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PP+ +TR++ N LR+H++E+  G DV + +A +ARRRQRG+CVLSG+G V N
Sbjct  77   PGSKNKPKPPVIITRESANTLRAHILEVGNGCDVFDCVATYARRRQRGICVLSGSGTVTN  136

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            V++RQPAA GA++ L GRFEILSL+G+FLP P+PPGAT LT++LAG QGQVVGGSVVG L
Sbjct  137  VSIRQPAAAGAILTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGEL  196

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
             AAGPV+VIAA+F N  YERLP+ E++ L         Q  + +S     G  ++  P+P
Sbjct  197  TAAGPVIVIAASFTNVAYERLPLDEEEPL-------QMQQQVPQSSGGGGGGINNPFPDP  249

Query  440  SSSLPLYNLTPNL  402
            S+ LP +NL  N+
Sbjct  250  SAGLPFFNLPLNM  262



>ref|XP_009347388.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=293

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 141/193 (73%), Gaps = 1/193 (1%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PP+ +TR++ N LR+H++E+  G DV + +A +ARRRQRG+C+LSG+G V N
Sbjct  78   PGSKNKPKPPVIITRESANTLRAHILEVGNGCDVFDCVATYARRRQRGICILSGSGTVTN  137

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAA GAV+ L GRFEILSL+G+FLP P+PPGAT LT++LAG QGQVVGGSVVG L
Sbjct  138  VTLRQPAAVGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGEL  197

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
             AAGPV+VIA++F N  YERLP+ E++ L       +             G  ++  P+P
Sbjct  198  TAAGPVIVIASSFTNVAYERLPLDEEEQLQVQDPQGSGGSGGGGGGVGGGGVGNNPFPDP  257

Query  440  SSSLPLYNLTPNL  402
            SS LP +NL  N+
Sbjct  258  SSGLPFFNLPLNM  270



>gb|KDO60958.1| hypothetical protein CISIN_1g040216mg [Citrus sinensis]
Length=265

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 145/208 (70%), Gaps = 20/208 (10%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI VTRD+ N LR+H ME++ G DV+ES+A FARR+QRG+C+LSG+G V NV
Sbjct  67   GSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVSESLANFARRKQRGICILSGSGCVTNV  126

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPA  G+++ L GRFEILSL G+ LP P+PPG TGLT+YLAG QGQVVGG VVG L+
Sbjct  127  TLRQPATSGSIVTLHGRFEILSLLGSILPPPAPPGITGLTIYLAGAQGQVVGGVVVGALI  186

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            A+GPV+++AA+F NAT++RLP L+DD+L  +      Q            + HH L    
Sbjct  187  ASGPVVIMAASFMNATFDRLP-LDDDELAAAMQNQHYQ-----------NSRHHHLDISD  234

Query  437  SSLPLYNLTP-NLFPNGGQLSPHDPYAW  357
                L+ L P NL  NG    P + YAW
Sbjct  235  ----LHGLPPQNLLTNGTM--PPEIYAW  256



>ref|XP_009103959.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Brassica 
rapa]
 ref|XP_009103960.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Brassica 
rapa]
 ref|XP_009103961.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Brassica 
rapa]
 ref|XP_009103963.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Brassica 
rapa]
 ref|XP_009103964.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Brassica 
rapa]
 ref|XP_009103965.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Brassica 
rapa]
Length=298

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 146/210 (70%), Gaps = 12/210 (6%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+ P+ VT+++PN L+SHV+EIA G DVAES+  FARRR RGV VLSG+G V NVT
Sbjct  91   SKNKPKNPVVVTKESPNSLQSHVLEIATGADVAESLNAFARRRGRGVSVLSGSGLVTNVT  150

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGP-SPPGATGLTvylagvqgqvvggsvvgplv  618
            LRQPAA G V+ L+G+FEILS+ G FLP   SP  A GLT+YLAG QGQV+GG V GPL+
Sbjct  151  LRQPAASGGVVSLRGQFEILSMCGAFLPTSGSPAAAAGLTIYLAGAQGQVLGGGVAGPLI  210

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            A+GPV+VIAATF NA++ERLPI ++   P      A +   D++     G E        
Sbjct  211  ASGPVIVIAATFCNASFERLPIEDEQQQPQVE--EAKEKENDDNKSGNDGTEE-------  261

Query  437  SSLPLYNLTPNLFPNGGQLSPHDPYAWQHP  348
            S  P+YN+TPN  PNG Q++ HD + W  P
Sbjct  262  SMQPMYNMTPNFMPNGHQMAQHDVF-WGAP  290



>ref|XP_007048865.1| AT-hook DNA-binding family protein [Theobroma cacao]
 gb|EOX93022.1| AT-hook DNA-binding family protein [Theobroma cacao]
Length=257

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 146/207 (71%), Gaps = 19/207 (9%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI +TRD+ N LR+H +E++ G DV ES+A FARR+QRG+CVLSG+G V NV
Sbjct  60   GSKNKPKPPIIITRDSANALRAHALEVSSGCDVNESLANFARRKQRGICVLSGSGCVTNV  119

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPA+ GA++ L GR+EILSL G+ LP P+PPG TGLT+YLAG QGQVVGG VVG L+
Sbjct  120  TLRQPASSGAIVTLHGRYEILSLLGSILPPPAPPGITGLTIYLAGAQGQVVGGGVVGALI  179

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            A+GPV+V+AA+F NAT++RLP L+DD++       AA +P          A HH L    
Sbjct  180  ASGPVLVMAASFMNATFDRLP-LDDDEV-------AAAMPNQYH----QNARHHHLDISD  227

Query  437  SSLPLYNLTPNLFPNGGQLSPHDPYAW  357
                LY +  NL  NG    P + Y+W
Sbjct  228  ----LYGMPQNLITNGTM--PPEIYSW  248



>ref|XP_006299205.1| hypothetical protein CARUB_v10015351mg [Capsella rubella]
 gb|EOA32103.1| hypothetical protein CARUB_v10015351mg [Capsella rubella]
Length=318

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 9/145 (6%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPIFVTRD+PN L+SHVMEIA GTDV E++A FARRRQRG+C+LSGNG VANV
Sbjct  88   GSKNKPKPPIFVTRDSPNALKSHVMEIASGTDVIETLATFARRRQRGICILSGNGTVANV  147

Query  794  TLRQPAA---------PGAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvg  642
            TLRQP+             + LQGRFEILSL G+FLPGP+PPG+TGLT+YLAG QGQVVG
Sbjct  148  TLRQPSTAAVAAAPGGAAVLALQGRFEILSLTGSFLPGPAPPGSTGLTIYLAGGQGQVVG  207

Query  641  gsvvgplvaagpvmVIAATFANATY  567
            GSVVGPL+AAGPVM+IAATF+NATY
Sbjct  208  GSVVGPLMAAGPVMLIAATFSNATY  232



>ref|XP_004133943.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 ref|XP_004155773.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 gb|KGN56642.1| hypothetical protein Csa_3G127050 [Cucumis sativus]
Length=254

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 145/201 (72%), Gaps = 19/201 (9%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PP+ +TR++ N LR+H++E+  G DV +S+A +AR+RQRGVC+LSG GAV N
Sbjct  55   PGSKNKPKPPVIITRESANTLRAHILEVNTGCDVFDSVATYARKRQRGVCILSGTGAVTN  114

Query  797  VTLRQPAAP-GAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQP++  GA+ L GRFEILSL G+FLP P+PPGAT LT++LAG QGQ+VGG+VVG L
Sbjct  115  VTLRQPSSTGGAITLPGRFEILSLTGSFLPPPAPPGATSLTIFLAGGQGQIVGGNVVGSL  174

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +A+GPV+VIA++F N  YERLP+ E                 +E PP   G+  +  P+P
Sbjct  175  IASGPVIVIASSFTNVAYERLPLDE-----------------EEQPPNGGGSLSNPFPDP  217

Query  440  SSSLPLYNL-TPNLFPNGGQL  381
            S  LPL+N+ + N+  N  QL
Sbjct  218  SVGLPLFNMPSSNMAGNQNQL  238



>ref|XP_008460731.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Cucumis 
melo]
Length=283

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 148/212 (70%), Gaps = 12/212 (6%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+ PI VTRD+P+ L +H++EI GG DVAESI QF  RRQRGVCVLSG+G V +
Sbjct  79   PGSKNKPKSPIIVTRDSPHALSTHLIEIVGGADVAESINQFCCRRQRGVCVLSGSGTVVD  138

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQ AA  AV+ L+GRFEILS++G+FLPG +PPG+TGLTVYLAG QGQV+GG+VVGPL
Sbjct  139  VTLRQSAASAAVIQLRGRFEILSVSGSFLPGRAPPGSTGLTVYLAGGQGQVIGGTVVGPL  198

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
            +A GPVM++AATFANATYERLP L+D    + R  S A     E   P     +  +   
Sbjct  199  LAGGPVMLVAATFANATYERLP-LQDHHNCEEREASPAATSAGEVEEPPPPPPYPRM---  254

Query  440  SSSLPLYNLTPNLFPNGGQLSPHDPYAWQHPR  345
                 +Y+L   + PN       D YAW H R
Sbjct  255  --ETSIYDL---IAPNNNH--GLDGYAWAHER  279



>ref|XP_008377132.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=293

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 139/193 (72%), Gaps = 1/193 (1%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PP+ +TR++ N LR+H++E+  G DV + +A +ARRRQRG+C+LSG+G V N
Sbjct  78   PGSKNKPKPPVIITRESANTLRAHILEVGNGCDVFDCVATYARRRQRGICILSGSGTVTN  137

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAA GAV+ L GRFEILSL+G+FLP P+PPGAT LT++LAG QGQVVGGSVVG L
Sbjct  138  VTLRQPAAVGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGEL  197

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
              AGPV+VIA++F N  YERLP+ E++ L       +                ++  P+P
Sbjct  198  TTAGPVIVIASSFTNVAYERLPLDEEEQLQVQDPQGSGGTGGGGGGVGGVSVGNNPFPDP  257

Query  440  SSSLPLYNLTPNL  402
            SS LP +NL  N+
Sbjct  258  SSGLPFFNLPLNM  270



>ref|XP_002527105.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF35268.1| DNA binding protein, putative [Ricinus communis]
Length=279

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI VTRD+ N LR+H ME++ G DV+ES+A FARRRQRG+CVLSG+G V NV
Sbjct  68   GSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVSESLANFARRRQRGICVLSGSGCVTNV  127

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPA+ GA++ L GRFEILSL G+ LP P+PPG TGLT+YLAG QGQVVGG VVG L+
Sbjct  128  TLRQPASSGAIVTLHGRFEILSLLGSILPPPAPPGITGLTIYLAGAQGQVVGGGVVGALI  187

Query  617  aagpvmVIAATFANATYERLPILEDD  540
            A+GPV+++AA+F NAT++RLP+ ED+
Sbjct  188  ASGPVVIMAASFMNATFDRLPLDEDE  213



>emb|CDP13007.1| unnamed protein product [Coffea canephora]
Length=297

 Score =   161 bits (407),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 143/195 (73%), Gaps = 5/195 (3%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PP+ +TR++ N LR+H++E+  G D+ + ++ +ARRRQRG+C+LSG+G V NV+
Sbjct  85   SKNKPKPPVIITRESANTLRAHILEVGNGCDIFDCVSSYARRRQRGICILSGSGTVTNVS  144

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQPAA G+++ L GRFEILSL+G+FLP P+PPGAT LT++LAG QGQVVGGSVVG L A
Sbjct  145  LRQPAAAGSIVTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGELTA  204

Query  614  agpvmVIAATFANATYERLPILEDDDL----PDSRGGSAAQLPIDESPPPLAGAEHHGLP  447
            AGPV+VIAA+F N  YERLP+ ED+ L    P S+ GS A            G   H  P
Sbjct  205  AGPVIVIAASFTNVAYERLPLDEDEQLQIQPPVSQAGSVAAAGGGGGGGGGGGVSSHAFP  264

Query  446  EPSSSLPLYNLTPNL  402
            +PSS LP +NL  N+
Sbjct  265  DPSSGLPFFNLPLNM  279



>ref|XP_004153985.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 ref|XP_004160698.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 gb|KGN46273.1| hypothetical protein Csa_6G079180 [Cucumis sativus]
Length=253

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 148/199 (74%), Gaps = 8/199 (4%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PP+ +TR++ N LR+H++E+ GG DV E++A +ARRRQRG+CVLSG+G V NV
Sbjct  60   GSKNKPKPPVIITRESANTLRAHILEVGGGCDVFEAVAGYARRRQRGICVLSGSGIVNNV  119

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            +LRQPAA G+V+ LQGRFEILSL+G+FLP P+PPGAT LT++LAG QGQVVGG+VVG L+
Sbjct  120  SLRQPAAAGSVLTLQGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGNVVGALI  179

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            A+GPV+VIA++F+N  YERLP L+++++P       A     +         ++  P+ S
Sbjct  180  ASGPVIVIASSFSNVAYERLP-LDEEEMP-----MQAGGGDGDGGEGGGEGHNNPFPDAS  233

Query  437  SSLPLYNLTPNLFPNGGQL  381
            S LP  NL  N+ PN  Q 
Sbjct  234  SGLPFLNLPMNM-PNQNQF  251



>ref|XP_004145070.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
Length=253

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 147/199 (74%), Gaps = 8/199 (4%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PP+ +TR++ N LR+H++E+ GG DV E++A +ARRRQRG+CVLSG+G V NV
Sbjct  60   GSKNKPKPPVIITRESANTLRAHILEVGGGCDVFEAVAGYARRRQRGICVLSGSGIVNNV  119

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            +LRQPAA G+V+ LQGRFEILSL+G+FLP P+PPGAT LT++LAG QGQVVGG+VVG L+
Sbjct  120  SLRQPAAAGSVLTLQGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGNVVGALI  179

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            A+GPV+VIA++F+N  YERLP L+++++P       A               ++  P+ S
Sbjct  180  ASGPVIVIASSFSNVAYERLP-LDEEEMP-----MQAGGGGGGGGEGGGEGHNNPFPDAS  233

Query  437  SSLPLYNLTPNLFPNGGQL  381
            S LP  NL  N+ PN  Q 
Sbjct  234  SGLPFLNLPMNM-PNQNQF  251



>ref|XP_002281411.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=282

 Score =   160 bits (406),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 144/193 (75%), Gaps = 8/193 (4%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKN+P+PP+ +TR++ N LR+H++E+  G DV + +A +ARRRQRG+CVLSG+G V N
Sbjct  77   PGSKNRPKPPVIITRESANTLRAHILEVGNGCDVFDCVATYARRRQRGICVLSGSGTVTN  136

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            V++RQPAA GA++ L GRFEILSL+G+FLP P+PPGAT LT++LAG QGQVVGGSVVG L
Sbjct  137  VSIRQPAAAGAILTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGEL  196

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
             AAGPV+VIAA+F N  YERLP+ E++ L         Q  + +S     G  ++  P+P
Sbjct  197  TAAGPVIVIAASFTNVAYERLPLDEEEPL-------QMQQQVPQSSGGGGGGINNPFPDP  249

Query  440  SSSLPLYNLTPNL  402
            S+ LP +NL  N+
Sbjct  250  SAGLPFFNLPLNM  262



>ref|XP_009377073.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=293

 Score =   160 bits (406),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 139/193 (72%), Gaps = 1/193 (1%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PP+ +TR++ N LR+H++E+  G DV + +A +ARRRQRG+C+LSG+G V N
Sbjct  78   PGSKNKPKPPVIITRESANTLRAHILEVGNGCDVFDCVATYARRRQRGICILSGSGTVTN  137

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAA GAV+ L GRFEILSL+G+FLP P+PPGAT LT++LAG QGQVVGGSVVG L
Sbjct  138  VTLRQPAAVGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGEL  197

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEP  441
             A GPV+VIA++F N  YERLP+ E++ L       +             G  ++  P P
Sbjct  198  TAVGPVIVIASSFTNVAYERLPLDEEEQLQVQDPQGSGGSGGGGGGVGGGGVGNNPFPYP  257

Query  440  SSSLPLYNLTPNL  402
            SS LP +NL  N+
Sbjct  258  SSGLPFFNLPLNM  270



>ref|XP_006437176.1| hypothetical protein CICLE_v10032444mg [Citrus clementina]
 ref|XP_006484853.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|ESR50416.1| hypothetical protein CICLE_v10032444mg [Citrus clementina]
Length=265

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 145/208 (70%), Gaps = 20/208 (10%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI VTRD+ N LR+H ME++ G DV+ES+A FARR+QRG+C+LSG+G V NV
Sbjct  67   GSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVSESLANFARRKQRGMCILSGSGCVTNV  126

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPA  G+++ L GRFEILSL G+ LP P+PPG TGLT+YLAG QGQVVGG VVG L+
Sbjct  127  TLRQPATSGSIVTLHGRFEILSLLGSILPPPAPPGITGLTIYLAGAQGQVVGGVVVGALI  186

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            A+GPV+++AA+F NAT++RLP L+DD+L  +      Q            + HH L    
Sbjct  187  ASGPVVIMAASFMNATFDRLP-LDDDELAAAMQNQHYQ-----------NSRHHHLDISD  234

Query  437  SSLPLYNLTP-NLFPNGGQLSPHDPYAW  357
                L+ L P NL  NG    P + YAW
Sbjct  235  ----LHGLPPQNLLTNGTM--PPEIYAW  256



>ref|XP_009402315.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=319

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = -3

Query  968  KNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVTL  789
            KNKP+PP+ +TR++PN LRSHV+EIA GTD+ +++  FARRRQRG+ +LSG G V NVTL
Sbjct  98   KNKPKPPVIITRESPNALRSHVLEIASGTDIMDAVTVFARRRQRGLSILSGTGVVTNVTL  157

Query  788  RQPAAP--GAVMLQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            RQPAAP    V L GRFEILSL+G FLP PSPPGATGLTVYLAG QGQVVGGSVVG LVA
Sbjct  158  RQPAAPPGTVVSLHGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGSVVGELVA  217

Query  614  agpvmVIAATFANATYERLPILEDD  540
            +GPVM+IAATF NATYERLP+ E++
Sbjct  218  SGPVMIIAATFTNATYERLPLGEEE  242



>ref|XP_011086333.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=279

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 146/201 (73%), Gaps = 15/201 (7%)
 Frame = -3

Query  971  SKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANVT  792
            SKNKP+PP+ +TR++ N LR+H++E++ G DV E++A +AR+RQRG+CVLSG G V NV+
Sbjct  69   SKNKPKPPVIITRESANTLRAHILEVSSGCDVFEAVATYARKRQRGICVLSGTGTVNNVS  128

Query  791  LRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplva  615
            LRQPAA G+V+ L GRFEILSL+G+FLP P+PPGAT LT+YLAG QGQVVGG+VVG L+A
Sbjct  129  LRQPAAAGSVVTLHGRFEILSLSGSFLPPPAPPGATSLTIYLAGGQGQVVGGNVVGALIA  188

Query  614  agpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESP------PPLAGAEHHG  453
            +GPV++IAA+F N  YERLP+ E++ L         Q P+ + P          G   H 
Sbjct  189  SGPVIIIAASFTNVAYERLPLDEEEAL-------QMQPPVSQPPRGGGGGGGSGGVGGHQ  241

Query  452  LPEPSSSLPLYNLTPNLFPNG  390
             P+PS  LP +NL  N+ PNG
Sbjct  242  FPDPSLGLPFFNLPLNM-PNG  261



>ref|XP_006647239.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Oryza 
brachyantha]
Length=323

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 129/153 (84%), Gaps = 2/153 (1%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI +TRD+ N LR+HVME+AGG  ++ SI  FARRRQRGVCVLSG G V NV
Sbjct  111  GSKNKPKPPIIITRDSANTLRTHVMEVAGGGGISASIQTFARRRQRGVCVLSGAGTVTNV  170

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPA+ GAV+ L GRFEILSL+G+FLP P+PP ATGLTVYLAG QGQVVGGSVVG L 
Sbjct  171  TLRQPASQGAVVALHGRFEILSLSGSFLPPPAPPEATGLTVYLAGGQGQVVGGSVVGALT  230

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRG  519
            AAGPV+++AA FANA YERLP LEDD+L  ++G
Sbjct  231  AAGPVVIMAAPFANAVYERLP-LEDDELLAAQG  262



>ref|XP_008460074.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
Length=322

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 148/199 (74%), Gaps = 8/199 (4%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PP+ +TR++ N LR+H++E+ GG DV E++A +ARRRQRG+CVLSG+G V NV
Sbjct  129  GSKNKPKPPVIITRESANTLRAHILEVGGGCDVFEAVAGYARRRQRGICVLSGSGIVNNV  188

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            +LRQPAA G+V+ LQGRFEILSL+G+FLP P+PPGAT LT++LAG QGQVVGG+VVG L+
Sbjct  189  SLRQPAAAGSVLTLQGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGNVVGALI  248

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            A+GPV+VIA++F+N  YERLP L+++++P       A     +         ++  P+ S
Sbjct  249  ASGPVIVIASSFSNVAYERLP-LDEEEMP-----MQAGGGDGDGGEGGGEGHNNPFPDAS  302

Query  437  SSLPLYNLTPNLFPNGGQL  381
            S LP  NL  N+ PN  Q 
Sbjct  303  SGLPFLNLPMNM-PNQNQF  320



>ref|XP_003538721.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=298

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI +TRD+ N L++HVME+A G D+ ES++ FARRRQRGVC++SG G V NV
Sbjct  86   GSKNKPKPPIIITRDSANALKTHVMEVADGCDIVESVSAFARRRQRGVCIMSGTGTVTNV  145

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPA+ GAV+ L GRFEILSLAG+FLP P+PP A+GLT+YLAG QGQVVGGSVVG L+
Sbjct  146  TLRQPASSGAVVTLHGRFEILSLAGSFLPPPAPPEASGLTIYLAGGQGQVVGGSVVGALI  205

Query  617  aagpvmVIAATFANATYERLPILEDDD  537
            A+GPV++++A+F+NA YERLP LED++
Sbjct  206  ASGPVVIMSASFSNAAYERLP-LEDEE  231



>ref|XP_003539199.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=250

 Score =   159 bits (402),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 144/192 (75%), Gaps = 15/192 (8%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PP+ +TR++ N LR+H++E+A G DV ES+A +ARRRQRG+C+LSG+G V NV
Sbjct  56   GSKNKPKPPVIITRESANTLRAHILEVANGCDVFESVASYARRRQRGICILSGSGTVTNV  115

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            +LRQPA+ GAV+ L GRFEILSL G+FLP P+PPGAT L++YLAG QGQVVGGSVVG L+
Sbjct  116  SLRQPASAGAVVTLHGRFEILSLTGSFLPPPAPPGATSLSIYLAGGQGQVVGGSVVGELI  175

Query  617  aagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLPIDESPPPLAGAEHHGLPEPS  438
            AAGPV+V+AA+F N  YERLP+ E+++  +  G              +AG   +  P+PS
Sbjct  176  AAGPVIVMAASFTNVAYERLPLEEEEEQVEISG--------------VAGNNSNPFPDPS  221

Query  437  SSLPLYNLTPNL  402
            S LP +NL  N+
Sbjct  222  SGLPFFNLPMNV  233



>ref|XP_009377422.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=245

 Score =   159 bits (402),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = -3

Query  974  GSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVANV  795
            GSKNKP+PPI VTRD+ N LR+H ME++ G DV+ES+  FARR+QRG+C+LSG+G V NV
Sbjct  66   GSKNKPKPPIIVTRDSANALRAHAMEVSSGCDVSESLTHFARRKQRGICILSGSGCVTNV  125

Query  794  TLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgplv  618
            TLRQPA+ GA++ L GRFEILSL G+ LP P+PPG TGLT+YLAG QGQVVGG VVG L+
Sbjct  126  TLRQPASSGAIVTLHGRFEILSLLGSILPPPAPPGITGLTIYLAGAQGQVVGGGVVGALI  185

Query  617  aagpvmVIAATFANATYERLPILEDD  540
            A+GPV+++AA+F NAT++RLP+ ED+
Sbjct  186  ASGPVVIMAASFMNATFDRLPLDEDE  211



>ref|XP_008356452.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=290

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 142/197 (72%), Gaps = 12/197 (6%)
 Frame = -3

Query  977  PGSKNKPRPPIFVTRDTPNGLRSHVMEIAGGTDVAESIAQFARRRQRGVCVLSGNGAVAN  798
            PGSKNKP+PP+ +TR++ N LR+H++E+  G DV + +A +ARRRQRG+C+LSG+G V N
Sbjct  78   PGSKNKPKPPVIITRESANTLRAHILEVGNGCDVFDCVATYARRRQRGICILSGSGTVTN  137

Query  797  VTLRQPAAPGAVM-LQGRFEILSLAGTFLPGPSPPGATGLTvylagvqgqvvggsvvgpl  621
            VTLRQPAA GAV+ L GRFEILSL+G+FLP P+PPGAT LT++LAG QGQVVGGSVVG L
Sbjct  138  VTLRQPAAAGAVVTLHGRFEILSLSGSFLPPPAPPGATSLTIFLAGGQGQVVGGSVVGEL  197

Query  620  vaagpvmVIAATFANATYERLPILEDDDLPDSRGGSAAQLP----IDESPPPLAGAEHHG  453
             AAGPV+VIA++F N  YERLP+ E++ L         Q+P                ++ 
Sbjct  198  TAAGPVIVIASSFTNVAYERLPLDEEEQL-------QVQVPQGSGGSGGGGGGGSVGNNP  250

Query  452  LPEPSSSLPLYNLTPNL  402
             P+PSS LP +NL  N+
Sbjct  251  FPDPSSGLPFFNLPLNM  267



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2195854201911