BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18441_g1_i2 len=1709 path=[1:0-71 130:72-1708]

Length=1709
                                                                      Score     E

ref|XP_009594676.1|  PREDICTED: uncharacterized protein LOC104091107    482   4e-161   
ref|XP_009779684.1|  PREDICTED: uncharacterized protein LOC104228834    455   1e-150   
ref|XP_006365645.1|  PREDICTED: uncharacterized protein LOC102595855    454   2e-150   
ref|XP_004233403.1|  PREDICTED: uncharacterized protein LOC101255360    442   6e-145   
ref|XP_011099301.1|  PREDICTED: uncharacterized protein LOC105177...    386   4e-124   
emb|CDP02383.1|  unnamed protein product                                384   6e-124   
ref|XP_010262109.1|  PREDICTED: uncharacterized protein LOC104600707    382   5e-122   
gb|ABK94444.1|  unknown                                                 380   6e-122   Populus trichocarpa [western balsam poplar]
ref|XP_002531481.1|  ubiquitin-protein ligase, putative                 379   9e-122   Ricinus communis
ref|XP_006384227.1|  hypothetical protein POPTR_0004s10560g             379   2e-121   
ref|XP_011099300.1|  PREDICTED: uncharacterized protein LOC105177...    380   2e-121   
ref|XP_011046771.1|  PREDICTED: uncharacterized protein LOC105141...    377   9e-121   
ref|XP_011046770.1|  PREDICTED: E3 ubiquitin-protein ligase brl2 ...    374   8e-119   
ref|XP_002305970.2|  zinc finger family protein                         368   7e-118   Populus trichocarpa [western balsam poplar]
gb|EYU44279.1|  hypothetical protein MIMGU_mgv1a027065mg                366   5e-117   
ref|XP_008230418.1|  PREDICTED: uncharacterized protein LOC103329696    361   6e-114   
ref|XP_010660521.1|  PREDICTED: BRCT domain-containing protein At...    356   2e-112   
ref|XP_002279145.3|  PREDICTED: BRCT domain-containing protein At...    356   3e-112   Vitis vinifera
gb|KDP24355.1|  hypothetical protein JCGZ_25651                         357   6e-112   
emb|CBI16878.3|  unnamed protein product                                352   4e-111   
ref|XP_007217229.1|  hypothetical protein PRUPE_ppa005340mg             343   6e-108   
gb|KGN57738.1|  hypothetical protein Csa_3G271310                       341   3e-106   
ref|XP_010552264.1|  PREDICTED: uncharacterized protein LOC104822671    339   4e-106   
ref|XP_010029463.1|  PREDICTED: uncharacterized protein LOC104419...    338   1e-105   
gb|KDO58898.1|  hypothetical protein CISIN_1g011171mg                   338   2e-105   
ref|XP_010029462.1|  PREDICTED: uncharacterized protein LOC104419...    337   3e-105   
ref|XP_008341848.1|  PREDICTED: uncharacterized protein LOC103404...    336   3e-104   
ref|XP_008341849.1|  PREDICTED: uncharacterized protein LOC103404...    335   6e-104   
ref|XP_010415273.1|  PREDICTED: E3 ubiquitin-protein ligase RNF8-...    333   7e-104   
ref|XP_010511631.1|  PREDICTED: E3 ubiquitin-protein ligase RNF8-...    330   1e-102   
ref|XP_010470615.1|  PREDICTED: E3 ubiquitin-protein ligase RNF8-...    328   4e-102   
ref|XP_006302233.1|  hypothetical protein CARUB_v10020256mg             328   6e-102   
ref|NP_176889.1|  RING-finger and BRCT domain-containing protein        326   2e-101   Arabidopsis thaliana [mouse-ear cress]
emb|CDY12624.1|  BnaA02g12920D                                          321   3e-99    
ref|XP_009127529.1|  PREDICTED: uncharacterized protein LOC103852378    316   2e-97    
gb|KHN28366.1|  BRCT domain-containing protein                          314   1e-96    
ref|XP_002887108.1|  zinc finger family protein                         313   3e-96    
ref|XP_009371063.1|  PREDICTED: uncharacterized protein LOC103960332    315   3e-96    
ref|XP_006391481.1|  hypothetical protein EUTSA_v10018524mg             313   3e-96    
emb|CDY54118.1|  BnaC02g45430D                                          308   7e-95    
ref|XP_010100918.1|  BRCT domain-containing protein                     312   9e-95    
ref|XP_006659394.1|  PREDICTED: uncharacterized protein LOC102704439    308   1e-93    
ref|NP_001061801.1|  Os08g0414200                                       306   8e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011099302.1|  PREDICTED: uncharacterized protein LOC105177...    304   8e-93    
ref|XP_010666051.1|  PREDICTED: uncharacterized protein LOC104883...    301   4e-91    
ref|XP_004145658.1|  PREDICTED: uncharacterized protein LOC101213123    300   7e-91    
gb|EPS69307.1|  zinc finger family protein                              297   9e-91    
ref|XP_009401325.1|  PREDICTED: uncharacterized protein LOC103985377    299   2e-90    
ref|XP_010913594.1|  PREDICTED: uncharacterized protein LOC105039215    300   2e-90    
ref|NP_001148993.1|  ubiquitin-protein ligase/ zinc ion binding p...    298   3e-90    Zea mays [maize]
ref|XP_008667743.1|  PREDICTED: hypothetical protein isoform X2         296   4e-89    
gb|ACG44968.1|  ubiquitin-protein ligase/ zinc ion binding protein      291   1e-87    Zea mays [maize]
gb|KFK41119.1|  hypothetical protein AALP_AA2G088200                    285   2e-85    
ref|XP_008667741.1|  PREDICTED: hypothetical protein isoform X1         280   5e-83    
gb|KFK41118.1|  hypothetical protein AALP_AA2G088200                    274   1e-80    
ref|XP_011099303.1|  PREDICTED: uncharacterized protein LOC105177...    266   2e-78    
ref|XP_004507249.1|  PREDICTED: uncharacterized protein LOC101495587    251   1e-72    
ref|XP_007151461.1|  hypothetical protein PHAVU_004G048500g             248   2e-71    
gb|ABR16284.1|  unknown                                                 221   2e-61    Picea sitchensis
ref|XP_008461601.1|  PREDICTED: uncharacterized protein LOC103500164    216   1e-60    
ref|XP_003574477.1|  PREDICTED: uncharacterized protein LOC100840339    221   2e-60    
ref|XP_006430843.1|  hypothetical protein CICLE_v10011421mg             218   2e-59    
ref|XP_007021832.1|  Zinc finger family protein / BRCT domain-con...    217   3e-59    
ref|XP_006482402.1|  PREDICTED: BRCT domain-containing protein At...    213   5e-58    
dbj|BAJ93149.1|  predicted protein                                      211   5e-56    
ref|NP_001141455.1|  hypothetical protein                               199   4e-55    Zea mays [maize]
ref|XP_004973423.1|  PREDICTED: uncharacterized protein LOC101764105    203   3e-54    
gb|EMT11059.1|  hypothetical protein F775_08253                         204   6e-54    
gb|EEC83574.1|  hypothetical protein OsI_29232                          205   2e-53    Oryza sativa Indica Group [Indian rice]
ref|XP_002459851.1|  hypothetical protein SORBIDRAFT_02g012355          192   2e-53    Sorghum bicolor [broomcorn]
ref|XP_010666057.1|  PREDICTED: uncharacterized protein LOC104883...    197   6e-53    
ref|XP_002444326.1|  hypothetical protein SORBIDRAFT_07g020200          197   3e-52    Sorghum bicolor [broomcorn]
gb|KCW56381.1|  hypothetical protein EUGRSUZ_I02107                     190   2e-51    
ref|XP_006603959.1|  PREDICTED: uncharacterized protein LOC100815034    187   1e-48    
gb|KEH25278.1|  zinc finger, C3HC4 type (RING finger) protein, pu...    185   4e-48    
ref|XP_006844201.1|  hypothetical protein AMTR_s00006p00265240          185   6e-48    
ref|XP_008782114.1|  PREDICTED: uncharacterized protein LOC103701730    185   7e-48    
gb|KEH25277.1|  zinc finger, C3HC4 type (RING finger) protein, pu...    181   9e-47    
ref|XP_007021833.1|  Zinc finger family protein / BRCT domain-con...    159   5e-39    
ref|XP_004173036.1|  PREDICTED: uncharacterized LOC101213123            143   2e-35    
gb|KCW56380.1|  hypothetical protein EUGRSUZ_I02105                     139   7e-34    
ref|XP_010030803.1|  PREDICTED: DNA repair protein RAD5-like            138   1e-33    
ref|XP_010029458.1|  PREDICTED: BRCT domain-containing protein At...    129   1e-31    
ref|XP_010029459.1|  PREDICTED: BRCT domain-containing protein At...    127   3e-31    
emb|CAN65241.1|  hypothetical protein VITISV_025050                     134   3e-30    Vitis vinifera
gb|EMS48159.1|  hypothetical protein TRIUR3_05608                       130   1e-28    
gb|AFK42608.1|  unknown                                                 121   4e-27    
gb|AGW47710.1|  putative BRCT protein                                   112   2e-25    
ref|XP_002975153.1|  hypothetical protein SELMODRAFT_415214             113   2e-23    
ref|XP_002977557.1|  hypothetical protein SELMODRAFT_417401             100   2e-19    
ref|XP_010429211.1|  PREDICTED: BRCT domain-containing protein At...  89.4    4e-15    
ref|XP_006286902.1|  hypothetical protein CARUB_v10000047mg           89.4    4e-15    
ref|XP_009616220.1|  PREDICTED: BRCT domain-containing protein At...  89.0    6e-15    
ref|XP_010456981.1|  PREDICTED: BRCT domain-containing protein At...  84.7    6e-15    
ref|XP_010429204.1|  PREDICTED: BRCT domain-containing protein At...  88.6    6e-15    
ref|XP_010652234.1|  PREDICTED: BRCT domain-containing protein At...  88.6    7e-15    
ref|XP_010652233.1|  PREDICTED: BRCT domain-containing protein At...  88.2    8e-15    
ref|XP_009790562.1|  PREDICTED: BRCT domain-containing protein At...  88.2    1e-14    
emb|CAN62071.1|  hypothetical protein VITISV_036193                   87.4    1e-14    Vitis vinifera
ref|XP_010424668.1|  PREDICTED: BRCT domain-containing protein At...  87.4    2e-14    
ref|XP_010556700.1|  PREDICTED: BRCT domain-containing protein At...  87.0    2e-14    
ref|NP_192120.4|  transcription coactivator protein                   86.7    3e-14    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011079572.1|  PREDICTED: BRCT domain-containing protein At...  85.5    5e-14    
gb|AFW62168.1|  hypothetical protein ZEAMMB73_939706                  78.2    7e-14    
ref|XP_010542843.1|  PREDICTED: BRCT domain-containing protein At...  84.0    2e-13    
ref|XP_010542844.1|  PREDICTED: BRCT domain-containing protein At...  84.0    2e-13    
emb|CDX90952.1|  BnaA03g26320D                                        83.2    3e-13    
ref|XP_009102821.1|  PREDICTED: BRCT domain-containing protein At...  83.2    3e-13    
gb|EYU46798.1|  hypothetical protein MIMGU_mgv1a000275mg              82.8    4e-13    
ref|XP_006355860.1|  PREDICTED: BRCT domain-containing protein At...  82.8    4e-13    
emb|CDX91805.1|  BnaC03g31070D                                        82.0    6e-13    
gb|KFK30769.1|  hypothetical protein AALP_AA6G023800                  82.4    7e-13    
ref|XP_009778218.1|  PREDICTED: BRCT domain-containing protein At...  81.6    9e-13    
ref|XP_009616157.1|  PREDICTED: BRCT domain-containing protein At...  81.6    9e-13    
emb|CDP07711.1|  unnamed protein product                              81.6    1e-12    
ref|XP_010921524.1|  PREDICTED: BRCT domain-containing protein At...  81.3    1e-12    
ref|XP_006396410.1|  hypothetical protein EUTSA_v10028365mg           80.5    2e-12    
ref|XP_010679354.1|  PREDICTED: BRCT domain-containing protein At...  80.1    3e-12    
ref|XP_010679355.1|  PREDICTED: BRCT domain-containing protein At...  80.1    3e-12    
ref|XP_008451492.1|  PREDICTED: BRCT domain-containing protein At...  79.7    4e-12    
ref|XP_003057818.1|  predicted protein                                79.3    5e-12    
ref|XP_010259356.1|  PREDICTED: BRCT domain-containing protein At...  79.3    5e-12    
ref|XP_008650963.1|  PREDICTED: uncharacterized protein LOC100216...  79.3    6e-12    
ref|XP_006444467.1|  hypothetical protein CICLE_v100245902mg          75.1    7e-12    
ref|XP_010038278.1|  PREDICTED: BRCT domain-containing protein At...  79.0    7e-12    
ref|XP_006349254.1|  PREDICTED: BRCT domain-containing protein At...  78.6    9e-12    
ref|XP_008781324.1|  PREDICTED: LOW QUALITY PROTEIN: BRCT domain-...  78.6    1e-11    
ref|XP_008369115.1|  PREDICTED: BRCT domain-containing protein At...  77.8    1e-11    
ref|XP_010321873.1|  PREDICTED: BRCT domain-containing protein At...  77.8    1e-11    
ref|XP_009378696.1|  PREDICTED: BRCT domain-containing protein At...  77.8    2e-11    
ref|XP_009378697.1|  PREDICTED: BRCT domain-containing protein At...  77.4    2e-11    
ref|XP_002515302.1|  DNA replication regulator dpb11, putative        77.4    2e-11    Ricinus communis
gb|KDO87037.1|  hypothetical protein CISIN_1g000734mg                 77.0    2e-11    
gb|KGN45004.1|  hypothetical protein Csa_7G407570                     77.0    3e-11    
gb|KDO87036.1|  hypothetical protein CISIN_1g000734mg                 77.0    3e-11    
ref|XP_006492314.1|  PREDICTED: BRCT domain-containing protein At...  77.0    3e-11    
ref|XP_006492315.1|  PREDICTED: BRCT domain-containing protein At...  77.0    3e-11    
ref|XP_004136156.1|  PREDICTED: uncharacterized protein LOC101219784  76.6    4e-11    
gb|EAY89682.1|  hypothetical protein OsI_11217                        76.6    4e-11    Oryza sativa Indica Group [Indian rice]
ref|NP_001049876.1|  Os03g0304400                                     76.3    4e-11    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003535960.2|  PREDICTED: BRCT domain-containing protein At...  75.9    6e-11    
ref|XP_008451493.1|  PREDICTED: BRCT domain-containing protein At...  75.9    7e-11    
ref|XP_003591424.1|  BRCT domain-containing protein                   75.5    9e-11    
ref|XP_009616158.1|  PREDICTED: BRCT domain-containing protein At...  75.5    9e-11    
gb|KEH43208.1|  DNA replication regulator dpb11, putative             75.5    9e-11    
gb|KHN30648.1|  BRCT domain-containing protein                        75.5    9e-11    
ref|XP_004301808.1|  PREDICTED: uncharacterized protein LOC101306440  75.1    1e-10    
ref|XP_009414151.1|  PREDICTED: BRCT domain-containing protein At...  75.1    1e-10    
ref|XP_006855301.1|  hypothetical protein AMTR_s00057p00057240        75.1    1e-10    
ref|XP_008235221.1|  PREDICTED: BRCT domain-containing protein At...  74.7    1e-10    
ref|XP_011042232.1|  PREDICTED: BRCT domain-containing protein At...  74.3    2e-10    
ref|XP_002301504.2|  BRCT domain-containing family protein            74.3    2e-10    Populus trichocarpa [western balsam poplar]
ref|XP_008654787.1|  PREDICTED: BRCT domain-containing protein At...  74.3    2e-10    
ref|XP_008654782.1|  PREDICTED: BRCT domain-containing protein At...  73.9    2e-10    
ref|XP_008654775.1|  PREDICTED: BRCT domain-containing protein At...  73.9    2e-10    
ref|XP_008654789.1|  PREDICTED: BRCT domain-containing protein At...  73.9    3e-10    
ref|XP_003518848.2|  PREDICTED: BRCT domain-containing protein At...  73.9    3e-10    
gb|KHN08647.1|  BRCT domain-containing protein                        73.9    3e-10    
ref|XP_004495912.1|  PREDICTED: BRCT domain-containing protein At...  73.6    3e-10    
ref|XP_004495911.1|  PREDICTED: BRCT domain-containing protein At...  73.6    3e-10    
ref|XP_002960239.1|  hypothetical protein SELMODRAFT_437359           72.8    5e-10    
ref|XP_002500112.1|  predicted protein                                72.8    6e-10    Micromonas commoda
ref|XP_006649951.1|  PREDICTED: uncharacterized protein LOC102719748  72.8    7e-10    
ref|XP_002452280.1|  hypothetical protein SORBIDRAFT_04g022946        67.0    7e-10    Sorghum bicolor [broomcorn]
ref|XP_007199477.1|  hypothetical protein PRUPE_ppa027200mg           72.4    8e-10    
ref|XP_004958775.1|  PREDICTED: BRCT domain-containing protein At...  72.4    8e-10    
ref|XP_004958776.1|  PREDICTED: BRCT domain-containing protein At...  72.4    8e-10    
ref|XP_002967474.1|  hypothetical protein SELMODRAFT_408510           71.6    1e-09    
ref|XP_003559756.1|  PREDICTED: BRCT domain-containing protein At...  72.0    1e-09    
ref|XP_004987034.1|  PREDICTED: BRCT domain-containing protein At...  71.6    1e-09    
ref|XP_007145159.1|  hypothetical protein PHAVU_007G215300g           71.2    2e-09    
emb|CEF98729.1|  BRCT domain                                          70.9    2e-09    
ref|XP_003080343.1|  dna topoisomerase ii binding protein 1 (IC)      70.5    3e-09    
ref|XP_010095304.1|  BRCT domain-containing protein                   70.5    3e-09    
ref|XP_002500078.1|  predicted protein                                68.6    9e-09    Micromonas commoda
ref|XP_002491567.1|  Protein implicated in Mms22-dependent DNA re...  68.6    1e-08    Komagataella phaffii GS115
ref|XP_002467987.1|  hypothetical protein SORBIDRAFT_01g037650        65.9    1e-08    Sorghum bicolor [broomcorn]
gb|EMT01350.1|  BRCT domain-containing protein                        68.6    1e-08    
ref|XP_011041441.1|  PREDICTED: BRCT domain-containing protein At...  68.2    1e-08    
ref|XP_011042233.1|  PREDICTED: BRCT domain-containing protein At...  67.8    2e-08    
ref|XP_002141698.1|  PHD / zinc finger (C3HC4 type) family protein    66.2    5e-08    Cryptosporidium muris RN66
ref|XP_003057852.1|  predicted protein                                66.2    5e-08    
gb|EAZ41167.1|  hypothetical protein OsJ_25663                        66.2    7e-08    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060709.2|  Os07g0689900                                     66.2    7e-08    Oryza sativa Japonica Group [Japonica rice]
gb|EAR92090.2|  C3HC4 type (RING finger) zinc finger protein          65.5    7e-08    Tetrahymena thermophila SB210
ref|XP_001012335.1|  hypothetical protein TTHERM_00106910             65.5    8e-08    Tetrahymena thermophila
gb|EPS63240.1|  hypothetical protein M569_11549                       65.9    8e-08    
gb|EAZ05222.1|  hypothetical protein OsI_27420                        65.9    9e-08    Oryza sativa Indica Group [Indian rice]
gb|EMT12543.1|  BRCT domain-containing protein                        64.7    2e-07    
ref|XP_001759692.1|  predicted protein                                64.3    2e-07    
ref|XP_001751236.1|  predicted protein                                62.8    6e-07    
ref|XP_008807766.1|  PREDICTED: uncharacterized protein LOC103720028  62.8    7e-07    
ref|XP_007051075.1|  Transcription coactivators, putative             62.0    1e-06    
ref|XP_008467824.1|  PREDICTED: PHD and RING finger domain-contai...  62.0    1e-06    
gb|KFM80629.1|  PHD and RING finger domain-containing protein 1       62.0    1e-06    
emb|CDP17228.1|  unnamed protein product                              61.6    2e-06    
ref|XP_011087472.1|  PREDICTED: chromodomain-helicase-DNA-binding...  61.2    2e-06    
gb|KDO81739.1|  hypothetical protein CISIN_1g003346mg                 61.2    2e-06    
emb|CEF98880.1|  Phox/Bem1p                                           61.2    2e-06    
ref|XP_003080553.1|  Myosin class II heavy chain (ISS)                60.8    2e-06    
ref|XP_004230275.1|  PREDICTED: uncharacterized protein LOC101264764  60.8    2e-06    
dbj|GAA94968.1|  hypothetical protein E5Q_01623                       60.8    3e-06    
ref|XP_005104626.1|  PREDICTED: DNA topoisomerase 2-binding prote...  61.2    3e-06    
gb|KDO81736.1|  hypothetical protein CISIN_1g003346mg                 60.8    3e-06    
ref|XP_006472161.1|  PREDICTED: uncharacterized protein LOC102611...  60.8    3e-06    
ref|XP_009759809.1|  PREDICTED: nucleolin-like isoform X1             60.8    3e-06    
ref|XP_002882430.1|  hypothetical protein ARALYDRAFT_477858           60.8    3e-06    
ref|XP_009759811.1|  PREDICTED: chromodomain-helicase-DNA-binding...  60.5    3e-06    
ref|XP_009759812.1|  PREDICTED: uncharacterized protein LOC104212...  60.5    3e-06    
ref|XP_010228722.1|  PREDICTED: ABC transporter F family member 4...  60.5    4e-06    
ref|XP_010228723.1|  PREDICTED: ABC transporter F family member 4...  60.1    4e-06    
gb|KFY62720.1|  hypothetical protein V496_04435                       60.1    4e-06    
ref|XP_006344715.1|  PREDICTED: uncharacterized protein LOC102592...  60.1    4e-06    
gb|KFY90315.1|  hypothetical protein V498_06048                       60.1    4e-06    
ref|XP_625456.1|  2x PHD domain containing protein                    60.1    4e-06    Cryptosporidium parvum Iowa II
ref|XP_665508.1|  KIAA1453 protein                                    60.1    5e-06    Cryptosporidium hominis TU502
ref|XP_006433493.1|  hypothetical protein CICLE_v10000286mg           60.1    5e-06    
gb|KHG02838.1|  PHD and RING finger domain-containing 1               59.7    5e-06    
ref|XP_447336.1|  hypothetical protein                                59.7    6e-06    [Candida] glabrata CBS 138
ref|XP_006855347.1|  hypothetical protein AMTR_s00057p00103590        59.7    6e-06    
gb|EEE65531.1|  hypothetical protein OsJ_20986                        59.7    6e-06    Oryza sativa Japonica Group [Japonica rice]
gb|EEC80403.1|  hypothetical protein OsI_22555                        59.7    6e-06    Oryza sativa Indica Group [Indian rice]
ref|NP_001057395.1|  Os06g0283200                                     59.3    7e-06    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010245441.1|  PREDICTED: uncharacterized protein LOC104588...  59.3    7e-06    
gb|KFX88186.1|  hypothetical protein V490_07779                       59.3    7e-06    
ref|XP_006606546.1|  PREDICTED: uncharacterized protein LOC100797...  59.3    8e-06    
gb|KFY00480.1|  hypothetical protein O988_03282                       59.3    8e-06    
gb|KHN20268.1|  PHD and RING finger domain-containing protein 1       59.3    8e-06    
gb|KFY46003.1|  hypothetical protein V495_02714                       59.3    8e-06    
gb|EPB82463.1|  hypothetical protein HMPREF1544_10802                 58.2    9e-06    
gb|EYU37248.1|  hypothetical protein MIMGU_mgv1a001925mg              58.9    1e-05    
gb|KFY23511.1|  hypothetical protein V493_05815                       58.9    1e-05    
gb|EZG55363.1|  RING finger protein                                   57.4    1e-05    
ref|XP_010245438.1|  PREDICTED: uncharacterized protein LOC104588...  58.9    1e-05    
ref|XP_010464100.1|  PREDICTED: uncharacterized protein LOC104744710  58.5    1e-05    
ref|XP_009618260.1|  PREDICTED: uncharacterized protein LOC104110464  58.5    1e-05    
ref|NP_001049869.1|  Os03g0302200                                     58.5    1e-05    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006296950.1|  hypothetical protein CARUB_v10012943mg           58.5    2e-05    
gb|EAY89669.1|  hypothetical protein OsI_11202                        58.2    2e-05    Oryza sativa Indica Group [Indian rice]
ref|XP_009134838.1|  PREDICTED: uncharacterized protein LOC103859105  58.2    2e-05    
emb|CDX74135.1|  BnaA03g29120D                                        58.2    2e-05    
gb|KHG01528.1|  Topors                                                58.2    2e-05    
gb|KHG01529.1|  Topors                                                58.2    2e-05    
ref|XP_002320980.2|  BRCT domain-containing family protein            58.2    2e-05    Populus trichocarpa [western balsam poplar]
ref|XP_009538188.1|  hypothetical protein PHYSODRAFT_531258           57.8    2e-05    
ref|NP_187218.1|  RING/U-box protein                                  58.2    2e-05    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004135770.1|  PREDICTED: uncharacterized protein LOC101205950  57.8    2e-05    
gb|KGK40701.1|  hypothetical protein JL09_g88                         57.8    2e-05    
gb|KFY82197.1|  hypothetical protein V500_10740                       57.8    2e-05    
gb|KFZ24097.1|  hypothetical protein V502_01431                       57.8    2e-05    
gb|KGN66028.1|  hypothetical protein Csa_1G568570                     57.8    2e-05    
ref|XP_010430648.1|  PREDICTED: uncharacterized protein LOC104714842  57.8    2e-05    
ref|XP_004165905.1|  PREDICTED: uncharacterized protein LOC101229320  57.8    2e-05    
emb|CDW79707.1|  ring u-box protein                                   57.8    2e-05    
gb|EMT05198.1|  PHD and RING finger domain-containing protein 1       57.8    2e-05    
ref|XP_002278421.2|  PREDICTED: uncharacterized protein LOC100240780  57.8    2e-05    Vitis vinifera
ref|XP_010486029.1|  PREDICTED: uncharacterized protein LOC104764234  57.8    3e-05    
gb|KGN64085.1|  hypothetical protein Csa_1G039990                     57.4    3e-05    
gb|KEF56218.1|  hypothetical protein A1O9_07799                       57.4    3e-05    
ref|XP_004508644.1|  PREDICTED: uncharacterized protein LOC101504311  57.4    3e-05    
gb|ELT90028.1|  hypothetical protein CAPTEDRAFT_225496                57.8    3e-05    
gb|KDP31395.1|  hypothetical protein JCGZ_11771                       57.4    3e-05    
gb|KFH07296.1|  PHD-finger domain-containing protein                  57.8    3e-05    
ref|XP_001017095.1|  hypothetical protein TTHERM_00193420             57.4    3e-05    Tetrahymena thermophila
ref|XP_010677616.1|  PREDICTED: DNA topoisomerase 2-binding prote...  57.4    3e-05    
emb|CDY14653.1|  BnaC05g19100D                                        57.0    3e-05    
ref|XP_009419805.1|  PREDICTED: uncharacterized protein LOC103999709  57.0    3e-05    
gb|KFY78206.1|  hypothetical protein V499_02581                       57.4    3e-05    
gb|KFZ07143.1|  hypothetical protein V501_06734                       57.4    3e-05    
gb|EPR61557.1|  PHD-finger domain-containing protein                  57.4    4e-05    
ref|XP_006408044.1|  hypothetical protein EUTSA_v10020032mg           57.4    4e-05    
gb|KHN16082.1|  PHD and RING finger domain-containing protein 1       57.0    4e-05    
emb|CDY05191.1|  BnaC05g46120D                                        57.0    4e-05    
ref|XP_007514491.1|  predicted protein                                57.4    4e-05    
ref|XP_004171857.1|  PREDICTED: uncharacterized protein LOC101229274  56.6    4e-05    
gb|KFG61775.1|  PHD-finger domain-containing protein                  57.4    4e-05    
ref|XP_008887386.1|  PHD-finger domain-containing protein             57.4    4e-05    
ref|XP_010031211.1|  PREDICTED: uncharacterized protein LOC104421...  57.0    4e-05    
ref|XP_008450580.1|  PREDICTED: uncharacterized protein LOC103492...  57.0    4e-05    
gb|KFH05724.1|  PHD-finger domain-containing protein                  57.4    4e-05    
ref|XP_008450577.1|  PREDICTED: uncharacterized protein LOC103492...  57.0    4e-05    
ref|XP_010031194.1|  PREDICTED: uncharacterized protein LOC104421...  57.0    4e-05    
ref|XP_004302260.1|  PREDICTED: uncharacterized protein LOC101295635  57.0    4e-05    
ref|XP_010031202.1|  PREDICTED: uncharacterized protein LOC104421...  56.6    4e-05    
ref|XP_008245723.1|  PREDICTED: uncharacterized protein LOC103343...  56.6    5e-05    
emb|CEG01794.1|  Zinc finger, PHD-finger                              56.2    5e-05    
ref|XP_003345940.1|  hypothetical protein SMAC_06341                  56.6    5e-05    
ref|XP_004137609.1|  PREDICTED: uncharacterized protein LOC101204928  55.8    5e-05    
gb|KEH32064.1|  PHD-finger protein, putative                          56.6    5e-05    
ref|XP_007916083.1|  putative brct domain-containing protein          56.6    5e-05    
ref|XP_008454700.1|  PREDICTED: uncharacterized protein LOC103495032  56.2    5e-05    
gb|EMS64591.1|  PHD and RING finger domain-containing protein 1       56.6    6e-05    
gb|EPZ33259.1|  DNA-repair protein, UmuC-like domain-containing p...  56.2    6e-05    
ref|XP_008245716.1|  PREDICTED: uncharacterized protein LOC103343...  56.2    6e-05    
ref|XP_002438317.1|  hypothetical protein SORBIDRAFT_10g012093        53.1    6e-05    
gb|EJY84471.1|  zf-C3HC4 domain containing protein                    55.8    6e-05    
ref|XP_002418106.1|  DNA repair protein, putative; cell cycle che...  56.2    7e-05    
ref|XP_010106695.1|  PHD and RING finger domain-containing protein 1  56.2    7e-05    
ref|XP_007144980.1|  hypothetical protein PHAVU_007G199500g           56.2    7e-05    
gb|EPZ35823.1|  hypothetical protein O9G_005806                       55.8    7e-05    
gb|EIF49952.1|  brct domain-containing protein                        56.2    8e-05    
ref|XP_011092130.1|  PREDICTED: uncharacterized protein LOC105172...  55.8    8e-05    
gb|KEH24497.1|  poxvirus Ag35 surface protein                         55.8    9e-05    
ref|XP_010094016.1|  PHD and RING finger domain-containing protein 1  56.2    9e-05    
ref|XP_007031087.1|  RING/U-box protein, putative isoform 2           55.8    9e-05    
ref|XP_011092132.1|  PREDICTED: chromodomain-helicase-DNA-binding...  55.8    1e-04    
ref|XP_007144981.1|  hypothetical protein PHAVU_007G199500g           55.8    1e-04    
gb|ESS33164.1|  PHD-finger domain-containing protein                  55.8    1e-04    
ref|XP_007031086.1|  RING/U-box protein, putative isoform 1           55.8    1e-04    
ref|XP_003626181.1|  PHD and RING finger domain-containing protein    55.8    1e-04    
ref|XP_011091797.1|  PREDICTED: DNA topoisomerase 2-binding prote...  55.8    1e-04    
ref|XP_011091798.1|  PREDICTED: DNA topoisomerase 2-binding prote...  55.8    1e-04    
ref|XP_003345201.1|  hypothetical protein SMAC_07877                  55.8    1e-04    
ref|XP_011091796.1|  PREDICTED: DNA topoisomerase 2-binding prote...  55.8    1e-04    
ref|XP_010238216.1|  PREDICTED: uncharacterized protein LOC100830...  54.7    1e-04    
gb|EJY85929.1|  RING/U-box protein                                    55.5    1e-04    
ref|XP_011092129.1|  PREDICTED: uncharacterized protein LOC105172...  55.5    1e-04    
gb|EJY68133.1|  zf-C3HC4 multi-domain protein                         55.5    1e-04    
ref|XP_011092128.1|  PREDICTED: uncharacterized protein LOC105172...  55.5    1e-04    
dbj|BAJ93998.1|  predicted protein                                    55.5    1e-04    
ref|XP_003083334.1|  Chromatin remodeling complex WSTF-ISWI, larg...  55.1    1e-04    
ref|XP_010905690.1|  PREDICTED: uncharacterized protein LOC105032814  55.5    1e-04    
gb|KFY43995.1|  hypothetical protein V494_01704                       55.5    1e-04    
emb|CAB91702.2|  conserved hypothetical protein                       55.5    1e-04    
ref|NP_001169632.1|  uncharacterized protein LOC100383513             55.5    1e-04    
ref|XP_009854513.1|  hypothetical protein NEUTE1DRAFT_88033           55.5    1e-04    
gb|EEE67857.1|  hypothetical protein OsJ_25665                        55.5    1e-04    
emb|CDJ84644.1|  Zinc finger domain containing protein                55.5    1e-04    
ref|XP_003578180.1|  PREDICTED: uncharacterized protein LOC100830...  55.1    1e-04    
ref|XP_957563.2|  hypothetical protein NCU03924                       55.5    1e-04    
gb|EMS49193.1|  PHD and RING finger domain-containing protein 1       55.5    1e-04    
ref|XP_007379657.1|  hypothetical protein PUNSTDRAFT_140961           55.5    1e-04    
ref|XP_004494555.1|  PREDICTED: bromodomain adjacent to zinc fing...  55.5    1e-04    
ref|XP_006658989.1|  PREDICTED: WASH complex subunit FAM21C-like      55.5    1e-04    
gb|AIB05819.1|  PHD transcription factor                              55.5    1e-04    
ref|XP_010674155.1|  PREDICTED: uncharacterized protein LOC104890385  55.1    1e-04    
gb|ELR07557.1|  hypothetical protein GMDG_08472                       55.1    1e-04    
ref|XP_007208714.1|  hypothetical protein PRUPE_ppa001439mg           55.1    1e-04    
ref|XP_006649949.1|  PREDICTED: uncharacterized protein LOC102719000  55.1    2e-04    
emb|CDF87827.1|  BN860_15368g1_1                                      55.1    2e-04    
gb|KDP23423.1|  hypothetical protein JCGZ_23256                       55.1    2e-04    
gb|EMT16085.1|  PHD and RING finger domain-containing protein 1       55.1    2e-04    
ref|NP_001063280.1|  Os09g0440200                                     54.7    2e-04    
ref|XP_008388500.1|  PREDICTED: uncharacterized protein LOC103450876  55.1    2e-04    
ref|XP_007832061.1|  hypothetical protein PFICI_05289                 55.1    2e-04    
ref|XP_007337874.1|  hypothetical protein AURDEDRAFT_156754           55.1    2e-04    
ref|XP_006472849.1|  PREDICTED: DNA topoisomerase 2-binding prote...  55.1    2e-04    
gb|EEC82727.1|  hypothetical protein OsI_27422                        54.3    2e-04    
ref|XP_006472850.1|  PREDICTED: DNA topoisomerase 2-binding prote...  55.1    2e-04    
emb|CBI39562.3|  unnamed protein product                              54.3    2e-04    
ref|XP_008658881.1|  PREDICTED: uncharacterized protein LOC100383...  55.1    2e-04    
ref|XP_008652772.1|  PREDICTED: uncharacterized protein LOC103632816  54.7    2e-04    
ref|XP_009382511.1|  PREDICTED: uncharacterized protein LOC103970457  54.7    2e-04    
ref|XP_001978950.1|  GG10942                                          55.1    2e-04    
emb|CDH17887.1|  uncharacterized protein ZBAI_09675                   54.7    2e-04    
ref|XP_002168922.2|  PREDICTED: uncharacterized protein LOC100210907  54.3    2e-04    
ref|XP_002367696.1|  PHD-zinc finger (C3HC4 type) protein, putative   54.7    2e-04    
dbj|GAA83659.1|  DNA repair protein Rtt107                            54.7    2e-04    
ref|XP_003559755.2|  PREDICTED: uncharacterized protein LOC100840...  54.7    2e-04    
ref|XP_004956931.1|  PREDICTED: uncharacterized protein LOC101759397  54.3    3e-04    
gb|EHA26638.1|  hypothetical protein ASPNIDRAFT_170122                54.3    3e-04    
gb|EKC24368.1|  DNA topoisomerase 2-binding protein 1                 54.3    3e-04    
emb|CAK96185.1|  unnamed protein product                              54.3    3e-04    
ref|XP_001389185.2|  BRCT domain protein                              54.3    3e-04    
ref|XP_001460147.1|  hypothetical protein                             51.2    3e-04    
ref|XP_010233631.1|  PREDICTED: uncharacterized protein LOC100840...  54.3    3e-04    
ref|XP_010144579.1|  PREDICTED: DNA topoisomerase 2-binding prote...  54.3    3e-04    
ref|XP_004984651.1|  PREDICTED: transcriptional regulator ATRX ho...  53.9    3e-04    
ref|XP_007362232.1|  hypothetical protein DICSQDRAFT_152742           54.3    3e-04    
ref|XP_002319493.2|  PHD finger family protein                        53.9    3e-04    
ref|XP_011106388.1|  hypothetical protein H072_396                    53.9    3e-04    
gb|KGN47574.1|  hypothetical protein Csa_6G361360                     53.9    3e-04    
gb|EAA29196.3|  hypothetical protein NCU09503                         54.3    3e-04    
ref|XP_004930821.1|  PREDICTED: LOW QUALITY PROTEIN: PHD and RING...  54.3    3e-04    
ref|XP_009979334.1|  PREDICTED: E3 ubiquitin-protein ligase Topors    53.9    3e-04    
ref|XP_005707922.1|  hypothetical protein Gasu_13660                  53.1    3e-04    
ref|XP_007776656.1|  hypothetical protein W97_00552                   53.9    4e-04    
emb|CBJ48949.1|  conserved unknown protein                            53.9    4e-04    
gb|EWC48348.1|  hypothetical protein DRE_02117                        53.9    4e-04    
gb|EFA74868.1|  hypothetical protein PPL_11902                        53.1    4e-04    
ref|XP_008870587.1|  hypothetical protein H310_07077                  52.8    4e-04    
ref|XP_011036921.1|  PREDICTED: uncharacterized protein LOC105134272  53.5    4e-04    
ref|XP_006382430.1|  hypothetical protein POPTR_0005s020902g          53.5    5e-04    
emb|CDH57315.1|  brct domain-containing protein                       53.5    5e-04    
gb|KFO86411.1|  DNA topoisomerase 2-binding protein 1                 53.1    5e-04    
ref|XP_004206190.1|  PREDICTED: uncharacterized protein LOC100204904  53.5    5e-04    
ref|XP_011117828.1|  hypothetical protein AOL_s00006g217              53.5    6e-04    
ref|XP_456416.2|  DEHA2A01782p                                        53.1    6e-04    
ref|XP_008921510.1|  PREDICTED: E3 ubiquitin-protein ligase Topors    53.1    6e-04    
ref|XP_009147209.1|  PREDICTED: uncharacterized protein LOC103870797  53.1    6e-04    
ref|XP_006697444.1|  hypothetical protein CTHT_0071800                53.1    7e-04    
ref|XP_007846927.1|  brct domain protein                              53.1    7e-04    
ref|XP_002108687.1|  hypothetical protein TRIADDRAFT_51872            53.1    7e-04    
ref|XP_002102239.1|  GD19604                                          53.1    7e-04    
ref|XP_011023741.1|  PREDICTED: uncharacterized protein LOC105125...  52.8    7e-04    
ref|XP_010017629.1|  PREDICTED: E3 ubiquitin-protein ligase Topors    53.1    7e-04    
gb|KFP26008.1|  E3 ubiquitin-protein ligase Topors                    52.8    7e-04    
ref|XP_002098034.1|  GE24161                                          53.1    8e-04    
gb|EMC77277.1|  E3 ubiquitin-protein ligase Topor                     52.8    8e-04    
ref|XP_003112034.1|  CRE-MUS-101 protein                              52.8    8e-04    
gb|KFV12481.1|  E3 ubiquitin-protein ligase Topors                    52.8    8e-04    
ref|XP_008118558.1|  PREDICTED: E3 ubiquitin-protein ligase Topor...  52.8    8e-04    
ref|XP_011023740.1|  PREDICTED: uncharacterized protein LOC105125...  52.8    8e-04    
emb|CDR39401.1|  CYFA0S03e02894g1_1                                   52.8    8e-04    
ref|XP_002512479.1|  splicing factor, arginine/serine-rich 2,rnap...  52.8    8e-04    
ref|XP_010201478.1|  PREDICTED: E3 ubiquitin-protein ligase Topors    52.8    9e-04    
ref|XP_003227235.2|  PREDICTED: E3 ubiquitin-protein ligase Topor...  52.8    0.001    
gb|KCW60540.1|  hypothetical protein EUGRSUZ_H03278                   52.8    0.001    
ref|XP_005499261.1|  PREDICTED: E3 ubiquitin-protein ligase Topor...  52.8    0.001    
emb|CCF45974.1|  BRCA1 C Terminus domain-containing protein           52.8    0.001    
ref|XP_004829629.1|  hypothetical protein BEWA_028120                 52.4    0.001    
ref|XP_008866259.1|  hypothetical protein H310_03948                  52.4    0.001    
gb|KGU32258.1|  hypothetical protein MGM_01600                        52.8    0.001    
emb|CDQ99452.1|  unnamed protein product                              50.4    0.001    
ref|XP_009900434.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  52.8    0.001    
ref|XP_001324571.1|  FHA domain containing protein                    51.6    0.001    
ref|XP_010024107.1|  PREDICTED: uncharacterized protein LOC104414656  52.4    0.001    
ref|XP_007272587.1|  brct domain-containing protein                   52.4    0.001    



>ref|XP_009594676.1| PREDICTED: uncharacterized protein LOC104091107 [Nicotiana tomentosiformis]
Length=510

 Score =   482 bits (1240),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 267/521 (51%), Positives = 339/521 (65%), Gaps = 39/521 (7%)
 Frame = +1

Query  1     GKGHRKVKGHRL*KTAIQISARVAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMS  180
              + H+KV+GH            + GME V+ATVSGY GTERFNLIKLI K+G +YVG+M+
Sbjct  7     NRRHKKVRGH----------LPIRGMESVIATVSGYHGTERFNLIKLIDKSGASYVGSMN  56

Query  181   VSITHLVCWRFEGRKFELAKKSRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLL  360
              S THLVCWRFEG+K+ELAK  + + I+NHRW+EDCIK+GRR+PE PY  QCGQEVGP+L
Sbjct  57    QSTTHLVCWRFEGKKYELAKTFKMS-IINHRWVEDCIKEGRRLPEAPYASQCGQEVGPIL  115

Query  361   MNITQVGEGNQSSGCNH-KEPQIDTEVEEYFPD------------PDIAKPKSRKKMKNR  501
             ++IT   E   S   NH KEP I  E EE F              P++ K K R + K+ 
Sbjct  116   LDITLFSE---SKPLNHSKEPAILIESEEDFNSWTDSTLLKENLSPELVKHKDRPRRKSN  172

Query  502   S--LKCDRNLSSRFDHYDSSMSGSWRMETEELSPEPAVFLKPKKGSMGLPETSLKRRRLV  675
                L  D   S  +   + S+ GS R E EEL+  P+ FLKPKK S    ETS + RRLV
Sbjct  173   DSILNKDHPSSIIYCSGEHSLQGSRRTEIEELNFPPSAFLKPKKRSSEFAETSRRSRRLV  232

Query  676   KKNIS-DVLEI-SDSEELSPQIRTLPEHESAMQSNSANIGRHDHTSNNSQTTRISCPEDH  849
             KKNIS D++EI S SE+ S Q++ L EHE+  QS + ++   + +  N   +  SC +  
Sbjct  233   KKNISGDLVEIISGSEKQSLQLQALREHETLAQSYNLDVEMPEISMINRHGSGFSCHQSE  292

Query  850   TN----GIEVPGDTEEVLNVTIG-ETLENEGALASPFKSPLEQRRIVDVDQKEDENCVKL  1014
             T     G++  G+TE    +  G + L  EG  ++   +  E R  VD  Q E +   K+
Sbjct  293   TEPSRIGVDGTGETEVNRLLDNGNQCLHAEGISSNLTGNGQEPRLAVDEVQNETDKTCKV  352

Query  1015  PTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSIT  1194
              TS ALSCVICWTDFSSSRG+LPCGHRFCFSCIQ+WA+ M S  K STCPLCK  F +IT
Sbjct  353   STSTALSCVICWTDFSSSRGVLPCGHRFCFSCIQTWANHMASSRKASTCPLCKASFVAIT  412

Query  1195  KVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLI  1374
             KV DA P+DQKIYSQTIP + P  +IY+LP+ ETS F +NP+  PVCC+CS REP +LL+
Sbjct  413   KVDDAIPADQKIYSQTIPDNNPEMNIYILPEVETSRFRSNPSRTPVCCRCSCREPADLLV  472

Query  1375  NCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYRRIW  1497
              CH+C+T CIH+YCLDPPL PWTC+HC+D QR    YRR W
Sbjct  473   KCHLCETLCIHSYCLDPPLLPWTCMHCKDLQR---LYRRSW  510



>ref|XP_009779684.1| PREDICTED: uncharacterized protein LOC104228834 [Nicotiana sylvestris]
Length=510

 Score =   455 bits (1170),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 250/499 (50%), Positives = 322/499 (65%), Gaps = 29/499 (6%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GME V+ATVSGY GTERFNLIKLI K+G +YVG+M+ S THLVCWRF+G+K+ELAKK 
Sbjct  19    IQGMESVIATVSGYHGTERFNLIKLIDKSGASYVGSMNQSTTHLVCWRFDGKKYELAKKF  78

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNH-KEPQ  423
             + + I+NHRW+EDCIK+GRR+PE PYT QCGQEVGP++++IT   E  Q    NH KEP 
Sbjct  79    KMS-IINHRWVEDCIKEGRRLPEGPYTFQCGQEVGPIMLDITLFSESKQ---LNHSKEPA  134

Query  424   IDTEVEEYFPD------------PDIAKPKSR--KKMKNRSLKCDRNLSSRFDHYDSSMS  561
             I  E E  F              P++ K K R  +K    +L  D   SS +   + S+ 
Sbjct  135   ILIESEADFNSWTDSTLLKENLSPELVKHKDRPRRKSNGNNLNKDHPSSSIYCSSEHSLQ  194

Query  562   GSWRMETEELSPEPAVFLKPKKGSMGLPETSLKRRRLVKKNIS-DVLEI-SDSEELSPQI  735
              S R + EEL+   + FLKPK GS    ETS +  RLVK NIS D++EI S SE+ S ++
Sbjct  195   CSRRTQIEELNFPSSAFLKPKNGSSEFAETSRRSSRLVKTNISGDLVEIISGSEKQSLRL  254

Query  736   RTLPEHESAMQSNSANIGRHDHTSNNSQTTRISCPEDHTN----GIEVPGDTEEVLNVTI  903
             + L E E+  Q  + ++   + +  N   +  S  +        G++  G+TE    +  
Sbjct  255   QALRERETLAQIYNLDVEMPEISMINRHGSDFSFHQSEAGPSRIGVDGTGETEVNRLLDN  314

Query  904   G-ETLENEGALASPFKSPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLL  1080
             G + L+ EG  ++   +  E    VD  Q E +N  K+ TS  LSCVICWTDFSSSRG+L
Sbjct  315   GNQCLDAEGTSSNLRGNGQEPCLAVDEVQNETDNTCKVSTSTTLSCVICWTDFSSSRGVL  374

Query  1081  PCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRP  1260
             PCGHRFCFSCIQ+WA+ M S  K STCPLCK  F +ITKV DA  +DQKIYSQTIP + P
Sbjct  375   PCGHRFCFSCIQTWANHMASSRKVSTCPLCKASFVAITKVDDAITADQKIYSQTIPDNNP  434

Query  1261  GTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPW  1440
               +IY+LP+ ETS F  NP+  PVCC+CS REP +LL+ CH+C+T CIH+YCLDPPL PW
Sbjct  435   EMNIYILPEVETSRFRTNPSRTPVCCRCSCREPADLLVKCHLCETLCIHSYCLDPPLLPW  494

Query  1441  TCIHCQDYQRRFETYRRIW  1497
             TC+HC D QR    YRR W
Sbjct  495   TCMHCTDLQR---LYRRSW  510



>ref|XP_006365645.1| PREDICTED: uncharacterized protein LOC102595855 [Solanum tuberosum]
Length=510

 Score =   454 bits (1168),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 248/498 (50%), Positives = 326/498 (65%), Gaps = 29/498 (6%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GME V+ATVSGY GTERFNLIKLI K+G +YVG+M+ SITHLVCWRFEG+K+ELAKK 
Sbjct  21    IRGMESVIATVSGYHGTERFNLIKLIDKSGASYVGSMNQSITHLVCWRFEGKKYELAKKF  80

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNH-KEPQ  423
             + + IVNH+W+EDCIK+GRR+PE PYT QCGQEVGPL+++     E  Q    NH K+P 
Sbjct  81    KMS-IVNHKWVEDCIKEGRRLPEAPYTFQCGQEVGPLMLDSKLFTETIQ---LNHSKKPA  136

Query  424   IDTEVEE--------------YFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMS  561
             I  E +E               FP+    K + R+K K   +  D   SS++   + S+ 
Sbjct  137   IHIESDEDFNSWTDSTLLKENLFPEMGKYKDRPRRKAKANIMNEDHPSSSKYCSNEHSLQ  196

Query  562   GSWRMETEELS-PEPAVFLKPKKGSMGLPETSLKRRRLVKKNIS-DVLEI-SDSEELSPQ  732
             GS R+E EEL+ P  A F+  K+ S    ETS + RRL+KKNIS D+LEI S SE+   +
Sbjct  197   GSHRIEIEELNFPSSASFISNKRSS-EFSETSCRSRRLMKKNISGDLLEIISGSEKQRFR  255

Query  733   IRTLPEHESAMQSNSANIGRHDHTSNNSQTTRISCPEDHTNGIEVPGDTEEVLNVTIG--  906
              +T  E E++ Q ++ ++   + + NN   +  +C +   + I++ G  E  +N  +   
Sbjct  256   RQTRQELETSAQFSNLDVEMPEVSVNNRHGSGFNCYQSEPSRIDLDGIEETEVNRPLDNG  315

Query  907   -ETLENEGALASPFKSPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLP  1083
              ++L+ E A ++   +  E    +D  Q E +N  K  TS ALSCVICWTDFSSSRG+LP
Sbjct  316   DQSLQIESASSNLTGNRQEPCPAIDEVQNETDNTCKASTSTALSCVICWTDFSSSRGVLP  375

Query  1084  CGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPG  1263
             CGHRFCFSCIQ+WA+ M S  K STCPLCK  F +I KV DA P+DQ+IY+QTIP+  P 
Sbjct  376   CGHRFCFSCIQTWANHMASSRKVSTCPLCKASFVAIRKVDDAIPADQRIYTQTIPEQNPV  435

Query  1264  TDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWT  1443
              DIY+LP+G T   P+N    PVCCQCS REPE+LL+ CH+C+T CIH+YCLDPPL PWT
Sbjct  436   MDIYILPEGVTPRLPSNSTRTPVCCQCSCREPEDLLVKCHLCETLCIHSYCLDPPLFPWT  495

Query  1444  CIHCQDYQRRFETYRRIW  1497
             C HC+D QR    Y R W
Sbjct  496   CTHCKDLQR---LYHRNW  510



>ref|XP_004233403.1| PREDICTED: uncharacterized protein LOC101255360 [Solanum lycopersicum]
Length=558

 Score =   442 bits (1137),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 244/497 (49%), Positives = 324/497 (65%), Gaps = 26/497 (5%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GME V+ATVSGY GTERFNLIKLI K+G +YVG+M+ SITHLVCWRFEG+K+ELAKK 
Sbjct  68    IRGMESVIATVSGYHGTERFNLIKLIDKSGASYVGSMNQSITHLVCWRFEGKKYELAKKF  127

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQI  426
             + + I+NH+W+E+CIK+GRR+PE PYT QCGQ+VGPL+++ T + E  Q +    K+P I
Sbjct  128   KMS-IINHKWVENCIKEGRRLPEAPYTFQCGQDVGPLMLDSTLLIETIQLNL--SKKPAI  184

Query  427   DTEVEEYFPD------------PDIAKPKSRKKMK-NRSLKC-DRNLSSRFDHYDSSMSG  564
               E EE F              P++ K K +++ K N ++K  D   SS++   + S+ G
Sbjct  185   HIESEEDFNSWTDSTLLKENLFPEMGKYKDKRRRKSNVNIKNKDHPSSSKYCSDEHSLQG  244

Query  565   SWRMETEELSPEPAVFLKPKKGSMGLPETSLKRRRLVKKNIS-DVLEI-SDSEELSPQIR  738
             S R+E E+L+   +   K  K S    ETS + RRL+KKNIS D+LEI S S + S QI+
Sbjct  245   SHRVEIEDLNLASSASRKSNKRSSEFCETSRRSRRLMKKNISGDLLEITSGSGKHSLQIQ  304

Query  739   TLPEHESAMQSNSANIGRHDHTSNNSQTTRISCPEDHTNGIEVPGDTEEVLNVTI---GE  909
                E E++ Q  + ++   + + NN   +  SC +     I++ G  E  +N  +    +
Sbjct  305   ARQELETSAQFYNLDVEMPEFSVNNRHGSGFSCYQSEPIRIDLDGIEETEVNRPLDSGNQ  364

Query  910   TLENEGALASPFKSPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCG  1089
              L+ E A +    +  E    +D  Q E +N  K  TS  LSCVICWTDFSSSRG+LPCG
Sbjct  365   NLQTESASSDLTGNRQEPCPAIDEVQNETDNTCKASTSTTLSCVICWTDFSSSRGVLPCG  424

Query  1090  HRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTD  1269
             HRFCFSCIQ+WA+ M S  K STCPLCK  F +I KV DA P+DQKIY+QTIP+  P  D
Sbjct  425   HRFCFSCIQTWANHMASSRKVSTCPLCKASFVAIRKVDDAIPADQKIYTQTIPEKNPEMD  484

Query  1270  IYLLPDGE-TSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTC  1446
             IY+LP+G  T   P+N +  PVCCQCS +EPE+LL+ CH+C+T CIH+YCLDPPL PWTC
Sbjct  485   IYILPEGVITPRLPSNSSRTPVCCQCSCQEPEDLLVKCHLCETLCIHSYCLDPPLFPWTC  544

Query  1447  IHCQDYQRRFETYRRIW  1497
              HC+D QR    Y R W
Sbjct  545   THCKDLQR---LYGRNW  558



>ref|XP_011099301.1| PREDICTED: uncharacterized protein LOC105177754 isoform X2 [Sesamum 
indicum]
Length=501

 Score =   386 bits (992),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 234/497 (47%), Positives = 306/497 (62%), Gaps = 35/497 (7%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GME ++ATVSGY G ERFNLI+LI++ G +YVG+M+ S+THLVCW+FEGRK+ELAKK 
Sbjct  9     LKGMESILATVSGYHGAERFNLIRLISRTGASYVGSMNQSVTHLVCWKFEGRKYELAKKL  68

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGC----NHK  414
             +   IVNHRWIE+C+KKG+RV E PYT Q G+E GPL +++ ++G    S+      N K
Sbjct  69    K-IKIVNHRWIEECVKKGKRVSEEPYTSQSGEETGPLCLDV-RLGINPTSARSRALKNTK  126

Query  415   EPQIDTEVEEYF-------------PDPDIAKP-----KSRKKMKNRSLKCDRNLSSRFD  540
             EP ID E E  +             P P   +      +S +K   RSL+ D   SSR+ 
Sbjct  127   EPVIDIECEGIYDRAWTELLLFDEDPFPQQRQNGRRSNRSARKAIERSLRKDCPSSSRY-  185

Query  541   HYDSSMSGSWRMETEELSPE-PAVFLKPKKGSMGLPETSLKRRRLVKKNIS--DVLEISD  711
                 + SG   ME EE S   PA   + +K +   PE+  K RRLVKK IS  D L  S+
Sbjct  186   -CLETPSGPTVMELEEASTSLPAYSCRQRKRNSISPESQGKGRRLVKKRISMDDWLLTSN  244

Query  712   SEELSPQIRTLPEHE-SAMQSNSANIGRHDHTSNNSQTTRISCPEDHTNGIEVPGDTEEV  888
              EE   +   LPE+  S + S+S+++ R D    N + +   C     +  +     EE 
Sbjct  245   VEEYK-EDNVLPENNFSRILSDSSDVER-DQGLPNGRISDARCFLSGQDDGDGCDGLEEN  302

Query  889   LNVTIGETLEN-EGALASPFKSPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSS  1065
              +V  G    +   A +S  ++  E +   + D  + +   +LP S   SCVICWTDFSS
Sbjct  303   EDVNAGNLNPHIHVAQSSLLETSDELKVAANEDFIDVDPGSRLPASSEFSCVICWTDFSS  362

Query  1066  SRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTI  1245
             +RG+LPCGHRFCFSCIQ+WAD M SR KTSTCPLCK  F  ITKV DA  SDQKIYSQ+I
Sbjct  363   TRGVLPCGHRFCFSCIQNWADHMASRKKTSTCPLCKASFICITKVEDAVSSDQKIYSQSI  422

Query  1246  PQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDP  1425
             P D   TD+Y+LPD ET   P+NP+   VCC+C SREPE+LLI C+ CQTRC+H+YCLDP
Sbjct  423   PHDHSKTDLYILPD-ETCGPPSNPSA-IVCCRCFSREPEDLLIRCNFCQTRCVHSYCLDP  480

Query  1426  PLHPWTCIHCQDYQRRF  1476
              L PW C+HC+D Q  +
Sbjct  481   LLLPWICVHCKDLQMLY  497



>emb|CDP02383.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   384 bits (987),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 226/479 (47%), Positives = 294/479 (61%), Gaps = 25/479 (5%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME VVATV+GY G ERFNLIKLI+ AGGNYVG MS S+THLVCW+++G K++LA++   T
Sbjct  1     MENVVATVTGYTGLERFNLIKLISLAGGNYVGRMSRSVTHLVCWKYDGTKYKLARQF-ET  59

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQIDTE  435
              +VNH+WIEDCIK+GRR+PE PYT+QCGQ+VGPL + I        S    H   Q D  
Sbjct  60    LVVNHQWIEDCIKEGRRLPEDPYTLQCGQQVGPLSITIP-----FSSDVVRHPRLQNDRN  114

Query  436   VEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEEL-SPEPAVF  612
              E  FP+ + ++ + ++K+   S K + + +S +   +       R E E L SP+  +F
Sbjct  115   -ENLFPELEESRHRLKRKISEGSPKQENSSASTYRSTEPYSPSVQREEIEVLHSPQHPIF  173

Query  613   LKPKKGSMGLPETSLK--RRRLVKKNIS-DVLEI-SDSEE-LSPQIRTLPEHESAMQSNS  777
             L  KKG     ETS +  +RRLVKKN   + L+I SDSEE +S Q     ++ S   SNS
Sbjct  174   LSQKKGKSASLETSRRSRKRRLVKKNTRRETLDIISDSEEEISRQKDFHEQYCSGAVSNS  233

Query  778   ANIGRHDHTSNNSQTTRISCPEDHTNGIEVPGDTEEVLNVT-IGETLENEGALASPFKSP  954
             +  G     S      R++C  D T        TE + N+  I +  +N   +      P
Sbjct  234   SVQGEECRLS-----ARVTC--DSTGYQSGQKRTEALTNMQDIDDIHDNILDVNVASSYP  286

Query  955   LEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQM  1134
             +      D +  + E   +LPTS  LSCVICWT+FS++RG+LPCGHRFCFSCIQSWAD  
Sbjct  287   VID---ADANGNDIEQSTRLPTSTELSCVICWTEFSATRGVLPCGHRFCFSCIQSWADHA  343

Query  1135  VSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPAN  1314
              S  KTSTCPLCK  F  ITKV +A  SDQKIYSQT+P D P   IY+L  GET   P++
Sbjct  344   ASSRKTSTCPLCKASFVIITKVDNAVSSDQKIYSQTVPHDDPRMGIYILDGGETPSIPSS  403

Query  1315  PAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYRR  1491
              +  PVCC CS REPE+LL  C VCQ + +H +CLDPP  PW C +C+D QR +  YRR
Sbjct  404   SSGAPVCCHCSCREPEDLLERCDVCQIQRVHIFCLDPPAFPWICANCKDLQRLY-LYRR  461



>ref|XP_010262109.1| PREDICTED: uncharacterized protein LOC104600707 [Nelumbo nucifera]
Length=529

 Score =   382 bits (981),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 221/531 (42%), Positives = 306/531 (58%), Gaps = 62/531 (12%)
 Frame = +1

Query  40    KTAIQISARVAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEG  219
             ++ +   + + GM  VVATVSGY G+ERF LIKLI + G NYVG M+ S THLVCW+FEG
Sbjct  13    RSNLHGDSTIRGMGSVVATVSGYHGSERFKLIKLINQTGANYVGTMTRSTTHLVCWKFEG  72

Query  220   RKFELAKKSRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLL-----------MN  366
             RK+++A+ S  T IV+H W EDC+K+G+R+PE PY +QCGQ+VGPL+           + 
Sbjct  73    RKYDMAR-SFGTLIVSHSWFEDCLKEGKRLPERPYIMQCGQKVGPLMWKAPVFAGKETLF  131

Query  367   ITQVGEG--NQSSGCNHKEPQIDTE-------VEEYFPDPDIAKPKSRKKMKNRSLKCDR  519
              ++ G+   + ++ C   +  ++          ++  P  +  K  S    K++  K  +
Sbjct  132   TSKRGKAFKDLTNVCEDTDELVEMAWTNSHLLTQKLLPRLEERKGSSLVTQKSKGQKTSK  191

Query  520   NLSSRFD--HYDSSMSGSWRMETEELSPEPAVFLKPKKG-------SMGLPETSLKRRRL  672
                S  +   ++  +SG   M+ +E SP P++F K  K        S     T+ K RRL
Sbjct  192   QYRSGTEDCSFEPLLSGMVGMQ-QESSPHPSLFSKRHKTNVVSAVESTSAAGTTRKSRRL  250

Query  673   VKKNISD-VLEISDSEELSPQIRTLPEHESAMQSNSANIGRHDHTSNNSQTTR----ISC  837
             VKKN S  ++E +D            E E  +   S NI   +H SN+S   R    ++ 
Sbjct  251   VKKNASGGIVETADLN---------FEKEFYLTETSYNI---NHASNDSNALRNENSLAA  298

Query  838   PE-----DHTNG-IEVPGDTEEVLNVTIGETLENEGALASPFKSPLEQRRIVDVDQKEDE  999
              E     +H NG +E   D  E+ ++ +  +L+    L  P +    +    D+++  +E
Sbjct  299   QEANNKREHGNGELENLEDISELNDMDVSNSLDRVRELVLPTQERTSENVCPDIEKNLNE  358

Query  1000  N--------CVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTS  1155
                        +LPTS  LSCVICWTDFSS+RG+LPCGHRFC+SCIQSWAD MVSR K S
Sbjct  359   EFEDVLSGETGELPTSTDLSCVICWTDFSSTRGVLPCGHRFCYSCIQSWADHMVSRRKVS  418

Query  1156  TCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVC  1335
             TCPLCK  F SITKV DA  SDQKIYSQTIP     TD++L PD E S+F A P +  VC
Sbjct  419   TCPLCKATFVSITKVDDAASSDQKIYSQTIPYASGATDVFLYPDREMSNFGAQPLVVSVC  478

Query  1336  CQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
              +C  REPE+LLI CH+CQ+RC+H+YCLDPPL PWTC HC+     + + R
Sbjct  479   FKCRFREPEDLLITCHLCQSRCVHSYCLDPPLVPWTCDHCRGLGMLYHSIR  529



>gb|ABK94444.1| unknown [Populus trichocarpa]
Length=482

 Score =   380 bits (976),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 218/508 (43%), Positives = 297/508 (58%), Gaps = 63/508 (12%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME VVATVSGY G+ERFNLIKLI+++G +YVGAMS S THLVCW+FEGRK+ELA K  +T
Sbjct  1     MESVVATVSGYHGSERFNLIKLISQSGASYVGAMSNSTTHLVCWKFEGRKYELASKF-DT  59

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLM---NITQVGEGNQ--------SSG  402
              +VNHRW+E+C+K+G+RVPE+PY ++ GQEVGPL++   N+ ++G  N+        S+ 
Sbjct  60    LVVNHRWVEECVKQGKRVPEYPYMLESGQEVGPLVLDVPNVDKLGSLNKKRKPLSDKSNN  119

Query  403   CNHKEPQI-DTEVEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRME  579
             C   E +I D + E    D  +A               D  L +   H  SS + S R E
Sbjct  120   CEDSERRIVDVDCE----DSGLAAWS------------DSFLLNDVKHGGSSYNSS-RHE  162

Query  580   TEELSPEPAVFLKPKKGSMG-----LPETSLKRRRLVKKNIS-DVLE--ISDSEELSPQI  735
               ++ P    F++ ++ +       L E S K RRL+KKNI+ D LE  +SDS++    +
Sbjct  163   ESDIVPNMH-FVRGRRNTFSNTGSTLAEPSRKGRRLMKKNIARDNLETLLSDSDQEWHPV  221

Query  736   RTLPEHESAMQSNSANIGRHDHTSNNSQTTRISCPEDHTNGIEVPGDTEEVLN-------  894
             R    + S   +      R         T+ ++   +  + +E   + EE  +       
Sbjct  222   RLNKNNNSKSTAKRTGCKRKLDIFEAEVTSDVAVINNRGSAVESLDEIEEGTHWNHLPVS  281

Query  895   ----------VTIGETLENEGALASPFKSPLEQRRIVDVDQKEDENCVKLPTSPALSCVI  1044
                       +T  E  ++ G+ A    +     ++ D+DQ E  +  +LP    LSCVI
Sbjct  282   EYSNSFPEGALTASEIADSSGSAAENLNA-----KVKDMDQFE--SVARLPAPAELSCVI  334

Query  1045  CWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQ  1224
             CWT+FSS+RG+LPCGHRFC+SCIQ WAD M SR + STCPLCK GF+ ITKV DA  SDQ
Sbjct  335   CWTEFSSTRGVLPCGHRFCYSCIQEWADHMASRRRISTCPLCKAGFSIITKVEDAATSDQ  394

Query  1225  KIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCI  1404
             KIYSQTIP      D++     E + F A P+   VCC+C SREPE+LLI CH+C+TRCI
Sbjct  395   KIYSQTIPHASSTVDVFFSMLQEQNKFGAEPSFGSVCCECRSREPEDLLIRCHLCETRCI  454

Query  1405  HAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
             H+YCLDPPL PW C HC+D Q  +   R
Sbjct  455   HSYCLDPPLSPWICTHCKDLQMLYHHNR  482



>ref|XP_002531481.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF30905.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=460

 Score =   379 bits (973),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 223/495 (45%), Positives = 280/495 (57%), Gaps = 60/495 (12%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GMEKVVATVSGY GTERFNLIKLI+ +G +YVGAMS SITHL+CW+FEGRK+ELA K 
Sbjct  5     IEGMEKVVATVSGYHGTERFNLIKLISHSGASYVGAMSRSITHLLCWKFEGRKYELAMKF  64

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQI  426
             + T IVNHRWIEDCIK+G+RV EHPY +Q G EVGPLL+ +  + +         K    
Sbjct  65    KETIIVNHRWIEDCIKQGKRVSEHPYMLQSGSEVGPLLLEVPIIDKNRNCKALLDKFSIF  124

Query  427   -DTEVEEYFPD-PDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPE  600
              D+E  +Y  D  D +  +      N+ L                M G  ++  +     
Sbjct  125   EDSERRDYGKDCRDSSGDEGTSTYSNKRL----------------MRGKRKIFYD-----  163

Query  601   PAVFLKPKKGSMGLPETSLKRRRLVKKNIS-DVLEIS--DSEELSPQIRTLPEHESAMQS  771
                      G+  L + S   RRL+KKN+  D LEI   DS+     I  L E+  A  S
Sbjct  164   --------IGNTSLTKPSCDGRRLMKKNLGRDNLEIGILDSDNECHPIIPLDENSDAATS  215

Query  772   ----------NSANIGRHDHTSNNSQTTRISCPED-----HTNGIEVPGDTEEVLNVTIG  906
                       N+  IG    ++ N++ +R    ++       N +  P +T     VT  
Sbjct  216   SEFEDHKRTVNTFEIGTASDSALNTEASRYEAFDNIEEISGRNYMPAPENTSSYPEVT--  273

Query  907   ETLENEGALASPFKSPLEQRRIVDVDQKEDENCVK-LPTSPALSCVICWTDFSSSRGLLP  1083
                    A+ +P+  P  Q      D      C+  LPTS  LSCVICWTDFSS RG+LP
Sbjct  274   -------AVDTPYGCPAIQNLAGKNDDVSQSECISGLPTSVELSCVICWTDFSSIRGVLP  326

Query  1084  CGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPG  1263
             CGHRFC+SCIQ+WAD M+SRGK STCPLCK  F SITKV DA  SDQKIYSQTIP D   
Sbjct  327   CGHRFCYSCIQNWADHMISRGKISTCPLCKTSFVSITKVEDAATSDQKIYSQTIPCDSST  386

Query  1264  TDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWT  1443
             T+I +L D   + F    ++  VC +C  REPE+LLI+C  C  RCIH YCLDPPL PWT
Sbjct  387   TNILMLHD-RANRFGVESSLATVCGECCCREPEDLLISCDHCHIRCIHIYCLDPPLIPWT  445

Query  1444  CIHCQDYQRRFETYR  1488
             CI C+D QR +   R
Sbjct  446   CIQCKDLQRLYYHAR  460



>ref|XP_006384227.1| hypothetical protein POPTR_0004s10560g [Populus trichocarpa]
 gb|ERP62024.1| hypothetical protein POPTR_0004s10560g [Populus trichocarpa]
Length=482

 Score =   379 bits (973),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 217/508 (43%), Positives = 296/508 (58%), Gaps = 63/508 (12%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME VVATVSGY G+ERFNLIKLI+++G +YVGAMS S THLVCW+FEGRK+ELA K  +T
Sbjct  1     MESVVATVSGYHGSERFNLIKLISQSGASYVGAMSNSTTHLVCWKFEGRKYELASKF-DT  59

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLM---NITQVGEGNQ--------SSG  402
              +VNHRW+E+C+K+G+RVPE+PY ++ GQEVGPL++   N+ ++G  N+        S+ 
Sbjct  60    LVVNHRWVEECVKQGKRVPEYPYMLESGQEVGPLVLDVPNVDKLGSLNKKRKPLSDKSNN  119

Query  403   CNHKEPQI-DTEVEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRME  579
             C   E +I D + E    D  +A               D    +   H  SS + S R E
Sbjct  120   CEDSERRIVDVDCE----DSGLAAWS------------DSFFLNDVKHGGSSYNSS-RHE  162

Query  580   TEELSPEPAVFLKPKKGSMG-----LPETSLKRRRLVKKNIS-DVLE--ISDSEELSPQI  735
               ++ P    F++ ++ +       L E S K RRL+KKNI+ D LE  +SDS++    +
Sbjct  163   ESDIVPNMH-FVRGRRNTFSNTGSTLAEPSRKGRRLMKKNIARDNLETVLSDSDQEWHPV  221

Query  736   RTLPEHESAMQSNSANIGRHDHTSNNSQTTRISCPEDHTNGIEVPGDTEEVLN-------  894
             R    + S   +      R         T+ ++   +  + +E   + EE  +       
Sbjct  222   RLNKNNNSKSTAKRTGCKRKLDIFEAEVTSDVAVINNRGSAVESLDEIEEGTHWNHLPVS  281

Query  895   ----------VTIGETLENEGALASPFKSPLEQRRIVDVDQKEDENCVKLPTSPALSCVI  1044
                       +T  E  ++ G+ A    +     ++ D+DQ E  +  +LP    LSCVI
Sbjct  282   EYSNSFPEGALTASEIADSSGSAAENLNA-----KVKDMDQFE--SVARLPAPAELSCVI  334

Query  1045  CWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQ  1224
             CWT+FSS+RG+LPCGHRFC+SCIQ WAD M SR + STCPLCK GF+ ITKV DA  SDQ
Sbjct  335   CWTEFSSTRGVLPCGHRFCYSCIQEWADHMASRRRISTCPLCKAGFSIITKVEDAATSDQ  394

Query  1225  KIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCI  1404
             KIYSQTIP      D++     E + F A P+   VCC+C SREPE+LLI CH+C+TRCI
Sbjct  395   KIYSQTIPHASSTVDVFFSMLQEQNKFGAEPSFGSVCCECRSREPEDLLIRCHLCETRCI  454

Query  1405  HAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
             H+YCLDPPL PW C HC+D Q  +   R
Sbjct  455   HSYCLDPPLSPWICTHCKDLQMLYHHNR  482



>ref|XP_011099300.1| PREDICTED: uncharacterized protein LOC105177754 isoform X1 [Sesamum 
indicum]
Length=507

 Score =   380 bits (975),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 234/503 (47%), Positives = 306/503 (61%), Gaps = 41/503 (8%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GME ++ATVSGY G ERFNLI+LI++ G +YVG+M+ S+THLVCW+FEGRK+ELAKK 
Sbjct  9     LKGMESILATVSGYHGAERFNLIRLISRTGASYVGSMNQSVTHLVCWKFEGRKYELAKKL  68

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQ------CGQEVGPLLMNITQVGEGNQSSGC-  405
             +   IVNHRWIE+C+KKG+RV E PYT Q       G+E GPL +++ ++G    S+   
Sbjct  69    K-IKIVNHRWIEECVKKGKRVSEEPYTSQRYSELWNGEETGPLCLDV-RLGINPTSARSR  126

Query  406   ---NHKEPQIDTEVEEYF-------------PDPDIAKP-----KSRKKMKNRSLKCDRN  522
                N KEP ID E E  +             P P   +      +S +K   RSL+ D  
Sbjct  127   ALKNTKEPVIDIECEGIYDRAWTELLLFDEDPFPQQRQNGRRSNRSARKAIERSLRKDCP  186

Query  523   LSSRFDHYDSSMSGSWRMETEELSPE-PAVFLKPKKGSMGLPETSLKRRRLVKKNIS--D  693
              SSR+     + SG   ME EE S   PA   + +K +   PE+  K RRLVKK IS  D
Sbjct  187   SSSRY--CLETPSGPTVMELEEASTSLPAYSCRQRKRNSISPESQGKGRRLVKKRISMDD  244

Query  694   VLEISDSEELSPQIRTLPEHE-SAMQSNSANIGRHDHTSNNSQTTRISCPEDHTNGIEVP  870
              L  S+ EE   +   LPE+  S + S+S+++ R D    N + +   C     +  +  
Sbjct  245   WLLTSNVEEYK-EDNVLPENNFSRILSDSSDVER-DQGLPNGRISDARCFLSGQDDGDGC  302

Query  871   GDTEEVLNVTIGETLEN-EGALASPFKSPLEQRRIVDVDQKEDENCVKLPTSPALSCVIC  1047
                EE  +V  G    +   A +S  ++  E +   + D  + +   +LP S   SCVIC
Sbjct  303   DGLEENEDVNAGNLNPHIHVAQSSLLETSDELKVAANEDFIDVDPGSRLPASSEFSCVIC  362

Query  1048  WTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQK  1227
             WTDFSS+RG+LPCGHRFCFSCIQ+WAD M SR KTSTCPLCK  F  ITKV DA  SDQK
Sbjct  363   WTDFSSTRGVLPCGHRFCFSCIQNWADHMASRKKTSTCPLCKASFICITKVEDAVSSDQK  422

Query  1228  IYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIH  1407
             IYSQ+IP D   TD+Y+LPD ET   P+NP+   VCC+C SREPE+LLI C+ CQTRC+H
Sbjct  423   IYSQSIPHDHSKTDLYILPD-ETCGPPSNPSA-IVCCRCFSREPEDLLIRCNFCQTRCVH  480

Query  1408  AYCLDPPLHPWTCIHCQDYQRRF  1476
             +YCLDP L PW C+HC+D Q  +
Sbjct  481   SYCLDPLLLPWICVHCKDLQMLY  503



>ref|XP_011046771.1| PREDICTED: uncharacterized protein LOC105141284 isoform X2 [Populus 
euphratica]
Length=482

 Score =   377 bits (968),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 213/508 (42%), Positives = 295/508 (58%), Gaps = 63/508 (12%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME VVATVSGY G+ERFNLIKLI+++G +YVGAMS S THLVCW+FEGRK+ELA K  +T
Sbjct  1     MESVVATVSGYHGSERFNLIKLISQSGASYVGAMSNSTTHLVCWKFEGRKYELASKF-DT  59

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLM---NITQVGEGN--------QSSG  402
              +VNHRW+E+C+K+G+RVPE+PY ++ GQEVGPL++   N+ ++G  N        +S+ 
Sbjct  60    LVVNHRWVEECVKQGKRVPEYPYMLESGQEVGPLVLDVPNVDKLGSLNKKRKPLSDKSNN  119

Query  403   CNHKEPQI-DTEVEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRME  579
             C   E +I D + E    D  +A   +   + +         SSR +  D  ++      
Sbjct  120   CEDSERRIVDVDCE----DSGLAAWSNSFLLNDVKHGGSSYNSSRHEESDIVLNMH----  171

Query  580   TEELSPEPAVFLKPKKGSM-----GLPETSLKRRRLVKKNIS-DVLE--ISDSEELSPQI  735
                       F++ ++ +       L E S K RRL+KKN++ D LE  +SDS++    +
Sbjct  172   ----------FVRGRRHTFSNTGSALAEPSRKGRRLMKKNVARDNLETVLSDSDQEWHPV  221

Query  736   RTLPEHESAMQSNSANIGRHDHTSNNSQTTRISCPEDHTNGIEVPGDTEEVLN-------  894
             R    + S   +      R         T+ I+   +  + +E   D EE  +       
Sbjct  222   RLYTNNNSKSTAKRTGCKRKLDIFEAEVTSDIAVTNNRGSAVESLDDIEEGTHWNHLPVS  281

Query  895   ----------VTIGETLENEGALASPFKSPLEQRRIVDVDQKEDENCVKLPTSPALSCVI  1044
                       +T  E  ++ G+ A    +     ++ D+DQ   E+  +LP    LSCVI
Sbjct  282   EYSNSCPEGALTASEIADSSGSAAENLNA-----KVKDIDQF--ESVARLPVPAELSCVI  334

Query  1045  CWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQ  1224
             CWT+FSS+RG+LPCGHRFC+SCIQ WA+ M SR + STCPLCK GF+ ITKV DA  SDQ
Sbjct  335   CWTEFSSTRGVLPCGHRFCYSCIQEWANHMASRRRISTCPLCKAGFSIITKVEDAATSDQ  394

Query  1225  KIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCI  1404
             KIYSQTIP      D++     E + F + P+  PVCC+C SREPE+LLI CH+C+TRCI
Sbjct  395   KIYSQTIPHASSTVDVFFGMLQEQNKFGSVPSFGPVCCECRSREPEDLLIRCHLCETRCI  454

Query  1405  HAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
             H+YCLDPPL PW C HC+D Q  +   R
Sbjct  455   HSYCLDPPLSPWICTHCKDLQMLYHHNR  482



>ref|XP_011046770.1| PREDICTED: E3 ubiquitin-protein ligase brl2 isoform X1 [Populus 
euphratica]
Length=531

 Score =   374 bits (960),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 220/539 (41%), Positives = 302/539 (56%), Gaps = 76/539 (14%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME VVATVSGY G+ERFNLIKLI+++G +YVGAMS S THLVCW+FEGRK+ELA K  +T
Sbjct  1     MESVVATVSGYHGSERFNLIKLISQSGASYVGAMSNSTTHLVCWKFEGRKYELASKF-DT  59

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLM---NITQVGEGNQ--------SSG  402
              +VNHRW+E+C+K+G+RVPE+PY ++ GQEVGPL++   N+ ++G  N+        S+ 
Sbjct  60    LVVNHRWVEECVKQGKRVPEYPYMLESGQEVGPLVLDVPNVDKLGSLNKKRKPLSDKSNN  119

Query  403   CNHKEPQI-DTEVEE----------YFPD-----PDIAKPKSRKKMKNRSLKCDRNL---  525
             C   E +I D + E+             D     PD+ K  S             +    
Sbjct  120   CEDSERRIVDVDCEDSGLAAWSNSFLLNDVKSLVPDVGKNNSNLYKSKLKKAKKPSKQEN  179

Query  526   --SSRFDHYDSSMSGSWRMETEELSPEPAV-----------FLKPKKGSM-----GLPET  651
               SSR  + D + SG   +E    S   +            F++ ++ +       L E 
Sbjct  180   CSSSRCFYQDPTFSGLVGLEHGGSSYNSSRHEESDIVLNMHFVRGRRHTFSNTGSALAEP  239

Query  652   SLKRRRLVKKNIS-DVLE--ISDSEELSPQIRTLPEHESAMQSNSANIGRHDHTSNNSQT  822
             S K RRL+KKN++ D LE  +SDS++    +R    + S   +      R         T
Sbjct  240   SRKGRRLMKKNVARDNLETVLSDSDQEWHPVRLYTNNNSKSTAKRTGCKRKLDIFEAEVT  299

Query  823   TRISCPEDHTNGIEVPGDTEEVLN-----------------VTIGETLENEGALASPFKS  951
             + I+   +  + +E   D EE  +                 +T  E  ++ G+ A    +
Sbjct  300   SDIAVTNNRGSAVESLDDIEEGTHWNHLPVSEYSNSCPEGALTASEIADSSGSAAENLNA  359

Query  952   PLEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQ  1131
                  ++ D+DQ E  +  +LP    LSCVICWT+FSS+RG+LPCGHRFC+SCIQ WA+ 
Sbjct  360   -----KVKDIDQFE--SVARLPVPAELSCVICWTEFSSTRGVLPCGHRFCYSCIQEWANH  412

Query  1132  MVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPA  1311
             M SR + STCPLCK GF+ ITKV DA  SDQKIYSQTIP      D++     E + F +
Sbjct  413   MASRRRISTCPLCKAGFSIITKVEDAATSDQKIYSQTIPHASSTVDVFFGMLQEQNKFGS  472

Query  1312  NPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
              P+  PVCC+C SREPE+LLI CH+C+TRCIH+YCLDPPL PW C HC+D Q  +   R
Sbjct  473   VPSFGPVCCECRSREPEDLLIRCHLCETRCIHSYCLDPPLSPWICTHCKDLQMLYHHNR  531



>ref|XP_002305970.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE86481.2| zinc finger family protein [Populus trichocarpa]
Length=422

 Score =   368 bits (944),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 207/479 (43%), Positives = 276/479 (58%), Gaps = 65/479 (14%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME VVATVSGY G+ERFNLIKLI+++G +YVGAMS S THLVCW+FEGRK+ELA K  +T
Sbjct  1     MESVVATVSGYHGSERFNLIKLISQSGASYVGAMSNSTTHLVCWKFEGRKYELASKF-DT  59

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQIDTE  435
              +VNHRW+E+C+K+G+RVPE+PY ++ GQEVGPL++++                      
Sbjct  60    LVVNHRWVEECVKQGKRVPEYPYMLESGQEVGPLVLDV----------------------  97

Query  436   VEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPEPAVFL  615
                    P++ K  S  K +             F H  SS + S R E  ++ P    F+
Sbjct  98    -------PNVDKLGSLNKKRKP-----------FVHGGSSYNSS-RHEESDIVPNMH-FV  137

Query  616   KPKKGSMG-----LPETSLKRRRLVKKNIS-DVLE--ISDSEELSPQIRTLPEHESAMQS  771
             + ++ +       L E S K RRL+KKNI+ D LE  +SDS++    +R    + S   +
Sbjct  138   RGRRNTFSNTGSTLAEPSRKGRRLMKKNIARDNLETVLSDSDQEWHPVRLNKNNNSKSTA  197

Query  772   NSANIGRHDHTSNNSQTTRISCPEDHTNGIEVPGDTEEVLNVTIGETLENEGALASPFKS  951
                   R         T+ ++   +  + +E   + EE  +       E   +       
Sbjct  198   KRTGCKRKLDIFEAEVTSDVAVINNRGSAVESLDEIEEGTHWNHLPVSEYSNSFPE----  253

Query  952   PLEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQ  1131
                     D+DQ E  +  +LP    LSCVICWT+FSS+RG+LPCGHRFC+SCIQ WAD 
Sbjct  254   --------DMDQFE--SVARLPAPAELSCVICWTEFSSTRGVLPCGHRFCYSCIQEWADH  303

Query  1132  MVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPA  1311
             M SR + STCPLCK GF+ ITKV DA  SDQKIYSQTIP      D++     E + F A
Sbjct  304   MASRRRISTCPLCKAGFSIITKVEDAATSDQKIYSQTIPHASSTVDVFFSMLQEQNKFGA  363

Query  1312  NPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
              P+   VCC+C SREPE+LLI CH+C+TRCIH+YCLDPPL PW C HC+D Q  +   R
Sbjct  364   EPSFGSVCCECRSREPEDLLIRCHLCETRCIHSYCLDPPLSPWICTHCKDLQMLYHHNR  422



>gb|EYU44279.1| hypothetical protein MIMGU_mgv1a027065mg [Erythranthe guttata]
Length=435

 Score =   366 bits (939),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 217/475 (46%), Positives = 279/475 (59%), Gaps = 52/475 (11%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME V+ATVSGY G ERFNLI+LI++ G +YVG M+ S+THLVCW+FEGRK+ELAKK + +
Sbjct  1     MESVIATVSGYHGAERFNLIRLISQTGASYVGNMNQSVTHLVCWKFEGRKYELAKKFKIS  60

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNI---TQVGEGNQSSGCNHKEPQI  426
              IVNHRWIE+C KKGRRV E PYT Q G+E GPL ++        +    +    K P I
Sbjct  61    -IVNHRWIEECAKKGRRVSEEPYTFQSGEETGPLCLDTPLGIHQAKAQSKALKTSKRPVI  119

Query  427   DTEVEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPEPA  606
             D E E+                 N +   D  L   FD              E  + + A
Sbjct  120   DIECEDV----------------NNAAWSDSIL---FDEIK-----------EASTSQLA  149

Query  607   VFLKPKKGSMGLPETSLKRRRLVKKNISDVLEISDSEELSPQIRTLPEHE-SAMQSNSAN  783
                K KK S+       K RRLVKK+       + + ++SPQ       + S + S+S++
Sbjct  150   DTYKLKKRSLTSSGPHCKSRRLVKKHTG-----TTNTKVSPQNNNNNNIDNSVILSDSSD  204

Query  784   IGRHDHTS--NNSQTTRISCPEDHTNGIEVPGDTEEVLNVTIGETLENEGALASPFKSPL  957
             I  H+  S  N  + +  S  +D+ N  +   D EE+  V   + ++N+    SP     
Sbjct  205   IEIHERASTRNAFEFSSFSSGQDNRNTRD---DVEEIEYV--NDEIQNDRVHGSPSSLLA  259

Query  958   EQRRIVD--VDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQ  1131
                 +++  VD  E +   K P S  LSCVICWTDFSS+RG+LPCGHRFCFSCIQ+WAD 
Sbjct  260   ASEDLLEAFVDFTEVDPSNKQPASSELSCVICWTDFSSTRGVLPCGHRFCFSCIQNWADH  319

Query  1132  MVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPA  1311
             M SR K STCPLCK  F  ITKV DA  SDQKIYSQ+IP D    ++Y+LPD ET    A
Sbjct  320   MASRRKASTCPLCKASFICITKVEDAVSSDQKIYSQSIPHDTSKMNLYILPD-ETCPL-A  377

Query  1312  NPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRF  1476
             NP+   VC +CSSREPE+LLI CH CQ RC+H+YCLDPPL PWTC+HC+D Q  +
Sbjct  378   NPS-AAVCSRCSSREPEDLLIKCHFCQIRCVHSYCLDPPLFPWTCVHCKDLQMLY  431



>ref|XP_008230418.1| PREDICTED: uncharacterized protein LOC103329696 [Prunus mume]
Length=521

 Score =   361 bits (926),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 223/515 (43%), Positives = 296/515 (57%), Gaps = 53/515 (10%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GME V+ATVSGY G++RFNLIKLI+ AG +YVGA+S S THLVCW+FEG+K+ELA K 
Sbjct  5     IQGMESVIATVSGYHGSDRFNLIKLISHAGASYVGALSRSTTHLVCWKFEGKKYELAHKF  64

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMN---ITQVGEG--------NQ  393
              NT ++NHRWIEDCIK+G+RVPE PY +QCGQEVGPLL+    + +VG          ++
Sbjct  65    -NTIVLNHRWIEDCIKQGKRVPERPYILQCGQEVGPLLLEPPPVAKVGVSTKNWNVLSDK  123

Query  394   SSGCNHKEPQIDTEV---------------EEYFPD--PDIAKPKSRKKMKNRSLKCDRN  522
             S+ C+  E  I+                  E+ FP+   + +  KS++K   R+ K +  
Sbjct  124   SNVCDDSEQIIELGCGASRRSVLTDSCLLNEDLFPEFKENNSSLKSKQKHVRRNSKQELR  183

Query  523   LSSRFDHYDSSMSGSWRMETEELSPEPAVFLKPKKGSMG--LPETSLKRRRLVKKNISDV  696
               SR    D  ++ S RME +E S   A   +      G  + ETS K RRL K NI   
Sbjct  184   SCSRPCFQDPPLTTSLRMELQESSTHLARAKRNISSGNGSSMAETSRKGRRLAKWNIGRD  243

Query  697   LE---ISDSEELSPQIR---------TLPEHESAMQSNSANIGRHDHTSNNSQTTRISCP  840
             ++   +SDS++    IR         T+   +S  + N   +G    T N     R    
Sbjct  244   MKESALSDSDQECHPIRFQNMHKDVVTVLSDDSGEERNGNILGTEGKTDNGMHIRRRIRN  303

Query  841   EDHTNGIEVPGDTEEVLNVTIGETLENEGALASPFKSPLEQRRIVDVDQKE------DEN  1002
                   +EV    E  L+ +    +  E A  S   +P +    V+  ++E       E+
Sbjct  304   RGLKGVLEV---DENHLSPSKDPNIYVEDAPTSLEGTPQDGCFEVENSKEEFKNRFGTED  360

Query  1003  CVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGF  1182
               ++P S  LSCVICWT+FSS+RG+LPCGHRFC+SCI+SWA  M S+ K STCPLCK  F
Sbjct  361   ATRIPPSMELSCVICWTEFSSTRGILPCGHRFCYSCIESWAGHMGSKSKNSTCPLCKASF  420

Query  1183  TSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPE  1362
             TSITKV DA+  DQKIYSQTIP   P  DI +       +F A      VC  CS REPE
Sbjct  421   TSITKVDDADMIDQKIYSQTIPS-APKMDIPVPTYRGIPNFGAQSPSGTVCVACSGREPE  479

Query  1363  ELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQ  1467
             ELL+ C++C +RCIH+YCLDPPL PWTCIHC+D +
Sbjct  480   ELLVACNLCHSRCIHSYCLDPPLFPWTCIHCKDLR  514



>ref|XP_010660521.1| PREDICTED: BRCT domain-containing protein At4g02110 isoform X2 
[Vitis vinifera]
Length=490

 Score =   356 bits (913),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 216/496 (44%), Positives = 290/496 (58%), Gaps = 42/496 (8%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GME ++ATVSGY G ER NLIKLI++ G  YVG MS SITHLVCW+FEGRK+ LAKK 
Sbjct  13    IQGMESIIATVSGYHGVERSNLIKLISQTGAKYVGTMSRSITHLVCWKFEGRKYSLAKKF  72

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEG----NQSSGCNHK  414
             + T IVNHRW EDCIK G+R+PE+ Y +Q GQEVGPL + +  V E      + +G  H 
Sbjct  73    K-TLIVNHRWFEDCIKAGKRLPENSYLLQSGQEVGPLSLEVPLVSEKANPLTKKNGRAHS  131

Query  415   EPQIDTEV-EEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEEL  591
                   ++ +E + D           + +  L          +H +SS         ++ 
Sbjct  132   VRGSACDISKELWVDKGWGGADDAVWIDSFLLN---------EHEESSFRSHRHSVRQKR  182

Query  592   SPEPAVFLKPKKGSMGLPETSLKRRRLVKKNIS-DVLE--ISDSEELSPQIRTLPEHESA  762
             S    ++      S    E S K RRLVKKN S D+LE  +SDS++    I T     S 
Sbjct  183   SNCNYIY------SSTSSEPSRKGRRLVKKNASRDMLESLLSDSDKECNLI-TARNRRSN  235

Query  763   MQS--NSANIGRHDHTSNNSQTTRISCPEDHTNGIEVPGDTEEV-----LNVTIGET---  912
             +    N ++  R + TS   + T      DH  G    G  E+V     LN ++      
Sbjct  236   LGPPPNCSDGVRDESTSTIRRLTSDDGFYDH--GSHRDGTLEDVEEIRDLNHSLASKDSK  293

Query  913   LENEGALASPFKSPLEQRRIVDVD---QKEDENCVK--LPTSPALSCVICWTDFSSSRGL  1077
             L  E     P ++  ++   ++ +   + +D + ++  +PTS  LSCVICWT+FSS+RG+
Sbjct  294   LHGEKLSTVPERTSQDEGFDIEDNINSEIKDGDRIRQMIPTSANLSCVICWTEFSSTRGV  353

Query  1078  LPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDR  1257
             LPCGHRFC+SCIQSWAD M SR KT+TCPLCK  F SITKV DA  SDQKIYSQTIP   
Sbjct  354   LPCGHRFCYSCIQSWADHMASRRKTATCPLCKASFVSITKVDDAAYSDQKIYSQTIPYAP  413

Query  1258  PGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHP  1437
               +DI +L D E+  F A  +  PVCC+C  REPE+LL++CH+C+ RC+H+YCLDPPL P
Sbjct  414   STSDILILADQESPSFGAQSSRLPVCCECRCREPEDLLVSCHLCRIRCVHSYCLDPPLLP  473

Query  1438  WTCIHCQDYQRRFETY  1485
             WTCIHC+D +  +  +
Sbjct  474   WTCIHCKDLRMLYHHF  489



>ref|XP_002279145.3| PREDICTED: BRCT domain-containing protein At4g02110 isoform X1 
[Vitis vinifera]
Length=510

 Score =   356 bits (913),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 216/496 (44%), Positives = 290/496 (58%), Gaps = 42/496 (8%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GME ++ATVSGY G ER NLIKLI++ G  YVG MS SITHLVCW+FEGRK+ LAKK 
Sbjct  33    IQGMESIIATVSGYHGVERSNLIKLISQTGAKYVGTMSRSITHLVCWKFEGRKYSLAKKF  92

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEG----NQSSGCNHK  414
             + T IVNHRW EDCIK G+R+PE+ Y +Q GQEVGPL + +  V E      + +G  H 
Sbjct  93    K-TLIVNHRWFEDCIKAGKRLPENSYLLQSGQEVGPLSLEVPLVSEKANPLTKKNGRAHS  151

Query  415   EPQIDTEV-EEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEEL  591
                   ++ +E + D           + +  L          +H +SS         ++ 
Sbjct  152   VRGSACDISKELWVDKGWGGADDAVWIDSFLLN---------EHEESSFRSHRHSVRQKR  202

Query  592   SPEPAVFLKPKKGSMGLPETSLKRRRLVKKNIS-DVLE--ISDSEELSPQIRTLPEHESA  762
             S    ++      S    E S K RRLVKKN S D+LE  +SDS++    I T     S 
Sbjct  203   SNCNYIY------SSTSSEPSRKGRRLVKKNASRDMLESLLSDSDKECNLI-TARNRRSN  255

Query  763   MQS--NSANIGRHDHTSNNSQTTRISCPEDHTNGIEVPGDTEEV-----LNVTIGET---  912
             +    N ++  R + TS   + T      DH  G    G  E+V     LN ++      
Sbjct  256   LGPPPNCSDGVRDESTSTIRRLTSDDGFYDH--GSHRDGTLEDVEEIRDLNHSLASKDSK  313

Query  913   LENEGALASPFKSPLEQRRIVDVD---QKEDENCVK--LPTSPALSCVICWTDFSSSRGL  1077
             L  E     P ++  ++   ++ +   + +D + ++  +PTS  LSCVICWT+FSS+RG+
Sbjct  314   LHGEKLSTVPERTSQDEGFDIEDNINSEIKDGDRIRQMIPTSANLSCVICWTEFSSTRGV  373

Query  1078  LPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDR  1257
             LPCGHRFC+SCIQSWAD M SR KT+TCPLCK  F SITKV DA  SDQKIYSQTIP   
Sbjct  374   LPCGHRFCYSCIQSWADHMASRRKTATCPLCKASFVSITKVDDAAYSDQKIYSQTIPYAP  433

Query  1258  PGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHP  1437
               +DI +L D E+  F A  +  PVCC+C  REPE+LL++CH+C+ RC+H+YCLDPPL P
Sbjct  434   STSDILILADQESPSFGAQSSRLPVCCECRCREPEDLLVSCHLCRIRCVHSYCLDPPLLP  493

Query  1438  WTCIHCQDYQRRFETY  1485
             WTCIHC+D +  +  +
Sbjct  494   WTCIHCKDLRMLYHHF  509



>gb|KDP24355.1| hypothetical protein JCGZ_25651 [Jatropha curcas]
Length=544

 Score =   357 bits (915),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 227/548 (41%), Positives = 298/548 (54%), Gaps = 82/548 (15%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GME VVATVSGY G+ERFNLIKLI++AG NYVGAMS S THL+CW+FEGRK++LAKK 
Sbjct  5     IRGMETVVATVSGYHGSERFNLIKLISQAGANYVGAMSRSTTHLICWKFEGRKYDLAKKL  64

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMN---ITQVGEGNQSS------  399
             +   IVNHRW+EDCIK+G+RVPEHPY +Q G+EVGPLL+    I + G  +Q+       
Sbjct  65    K-IVIVNHRWVEDCIKEGKRVPEHPYMLQSGKEVGPLLLEVPFIDKAGFSHQNREALSDK  123

Query  400   --------------GCNHKEPQIDTEV----EEYFPDPDIAKPKSRKKMKNRSLKCDRNL  525
                           GC        T+     E  FP+ +       K M  R+ K  R  
Sbjct  124   SNTFEDSERLLNGLGCGDSSLAGWTDSFLLNENLFPELNKNNINLSKSMPKRTKKPTRQK  183

Query  526   SSRFDHY---DSSMSGSWRMETEELSP----------------EPAVF------------  612
                +  Y   D  +SG   +E E  S                 E ++F            
Sbjct  184   DRSYGRYCFQDPPLSGLVELEHENSSSKSSMHSVREKGKISGHEESIFDVMDSQLARGKR  243

Query  613   -LKPKKGSMGLPETSLKRRRLVKKNISD---VLEISDSEELSPQIRTLPEHESAMQSNSA  780
              +    GS  L E     RRLVKKN+      +E+SDS++ S  IR   ++  A  + S+
Sbjct  244   KISDDIGSTFLAEPPPNGRRLVKKNVRKNNLQIELSDSDQESNPIRLHNKNSEA--AASS  301

Query  781   NIGRHDHTSNNSQTTRISCPEDHTNGI-----EVPGDTEEVLNVTIGETLEN-----EGA  930
                 +D   N  +T R S  +    G+     E   D E++ +     T ++     E A
Sbjct  302   KYEGYDKNVNIFETGRAS--DAPLTGVGASSNEAFDDIEDIKDSNQSTTAKDSNPYLEEA  359

Query  931   LASPFKSPLEQRRIVDVDQKEDENCVKLPTSPA--LSCVICWTDFSSSRGLLPCGHRFCF  1104
             L     S  E R  ++    +++     P S +  LSC+ICWT+F S+RG+LPC HRFC+
Sbjct  360   LIGMDGS--ESRPAIENFAGKNKEASVEPNSKSEDLSCIICWTEFCSTRGVLPCKHRFCY  417

Query  1105  SCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLP  1284
             SCIQ+WADQ++S  K  TCPLCK  F SITKV  A  SDQK+YSQTIP     TDI+LL 
Sbjct  418   SCIQNWADQLISSRKNPTCPLCKARFVSITKVEHATTSDQKMYSQTIPC-ASTTDIFLLN  476

Query  1285  DGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDY  1464
             D E   F    ++P VC +C  REPE+LLI+CH CQ +CIH YCLDPPL PWTC+HC+D 
Sbjct  477   DQERCRFGGESSLPTVCAECFCREPEDLLISCHYCQIQCIHMYCLDPPLLPWTCMHCKDL  536

Query  1465  QRRFETYR  1488
             QR +   R
Sbjct  537   QRLYHHAR  544



>emb|CBI16878.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   352 bits (903),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 215/493 (44%), Positives = 288/493 (58%), Gaps = 42/493 (9%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME ++ATVSGY G ER NLIKLI++ G  YVG MS SITHLVCW+FEGRK+ LAKK + T
Sbjct  1     MESIIATVSGYHGVERSNLIKLISQTGAKYVGTMSRSITHLVCWKFEGRKYSLAKKFK-T  59

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEG----NQSSGCNHKEPQ  423
              IVNHRW EDCIK G+R+PE+ Y +Q GQEVGPL + +  V E      + +G  H    
Sbjct  60    LIVNHRWFEDCIKAGKRLPENSYLLQSGQEVGPLSLEVPLVSEKANPLTKKNGRAHSVRG  119

Query  424   IDTEV-EEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPE  600
                ++ +E + D           + +  L          +H +SS         ++ S  
Sbjct  120   SACDISKELWVDKGWGGADDAVWIDSFLLN---------EHEESSFRSHRHSVRQKRSNC  170

Query  601   PAVFLKPKKGSMGLPETSLKRRRLVKKNIS-DVLE--ISDSEELSPQIRTLPEHESAMQS  771
               ++      S    E S K RRLVKKN S D+LE  +SDS++    I T     S +  
Sbjct  171   NYIY------SSTSSEPSRKGRRLVKKNASRDMLESLLSDSDKECNLI-TARNRRSNLGP  223

Query  772   --NSANIGRHDHTSNNSQTTRISCPEDHTNGIEVPGDTEEV-----LNVTIGET---LEN  921
               N ++  R + TS   + T      DH  G    G  E+V     LN ++      L  
Sbjct  224   PPNCSDGVRDESTSTIRRLTSDDGFYDH--GSHRDGTLEDVEEIRDLNHSLASKDSKLHG  281

Query  922   EGALASPFKSPLEQRRIVDVD---QKEDENCVK--LPTSPALSCVICWTDFSSSRGLLPC  1086
             E     P ++  ++   ++ +   + +D + ++  +PTS  LSCVICWT+FSS+RG+LPC
Sbjct  282   EKLSTVPERTSQDEGFDIEDNINSEIKDGDRIRQMIPTSANLSCVICWTEFSSTRGVLPC  341

Query  1087  GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGT  1266
             GHRFC+SCIQSWAD M SR KT+TCPLCK  F SITKV DA  SDQKIYSQTIP     +
Sbjct  342   GHRFCYSCIQSWADHMASRRKTATCPLCKASFVSITKVDDAAYSDQKIYSQTIPYAPSTS  401

Query  1267  DIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTC  1446
             DI +L D E+  F A  +  PVCC+C  REPE+LL++CH+C+ RC+H+YCLDPPL PWTC
Sbjct  402   DILILADQESPSFGAQSSRLPVCCECRCREPEDLLVSCHLCRIRCVHSYCLDPPLLPWTC  461

Query  1447  IHCQDYQRRFETY  1485
             IHC+D +  +  +
Sbjct  462   IHCKDLRMLYHHF  474



>ref|XP_007217229.1| hypothetical protein PRUPE_ppa005340mg [Prunus persica]
 gb|EMJ18428.1| hypothetical protein PRUPE_ppa005340mg [Prunus persica]
Length=466

 Score =   343 bits (881),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 204/489 (42%), Positives = 279/489 (57%), Gaps = 55/489 (11%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME V+ATVSGY G++RFNLIKLI+ AG +YVGA+S S THLVCW+FEG+K+ELA K  NT
Sbjct  1     MESVIATVSGYHGSDRFNLIKLISHAGASYVGALSRSTTHLVCWKFEGKKYELAHKF-NT  59

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMN---ITQVGEGNQSSGCNHKEPQI  426
              +++HRWIEDCIK+G+RVPE PY +QCGQEVGPLL+    + +VG   ++      +  +
Sbjct  60    IVLSHRWIEDCIKQGKRVPERPYILQCGQEVGPLLLEPPPVAKVGVSTKNWNVLSDKSNV  119

Query  427   DTEVEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPEPA  606
               + E+     ++    SR     RS+  D  L +      + ++ + R           
Sbjct  120   CDDSEQII---ELGCGASR-----RSVLTDSCLLNELQESSTYLARAKRD----------  161

Query  607   VFLKPKKGSMGLPETSLKRRRLVKKNIS-DVLE--ISDSEE---------LSPQIRTLPE  750
               +    GS  + ETS K RRL K+NI  D  E  +SDS++         +   + T+  
Sbjct  162   --ISSGNGS-SMAETSRKGRRLAKRNIGRDTKESALSDSDQECHPIRFQNMDKDVVTVLS  218

Query  751   HESAMQSNSANIGRHDHTSNNSQTTR----------ISCPEDHTNGIEVPGDTEEVLNVT  900
              +S  + N   +G    T N     R          +   E+H +  + P       N+ 
Sbjct  219   DDSGEERNGNILGTEGKTDNGLHIRRRIRNRGLKGVLEVDENHLSPSKDP-------NIY  271

Query  901   IGETLENEGALASPFKSPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLL  1080
             +G+   +           +E  +    ++   E+  ++P S  LSCVICWT+FSS+RG+L
Sbjct  272   VGDAPTSLEGTPQDGCFEVENSKEEFKNRFGTEDATRIPPSMELSCVICWTEFSSTRGIL  331

Query  1081  PCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRP  1260
             PCGHRFC+SCI+SWA  M S+ K STCPLCK  FTSITKV DA+  DQKIYSQTIP   P
Sbjct  332   PCGHRFCYSCIESWAGHMGSKSKNSTCPLCKASFTSITKVDDADMIDQKIYSQTIPS-AP  390

Query  1261  GTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPW  1440
               DI +       +F A      VC  CS REPEELL+ C++C +RCIH+YCLDPPL PW
Sbjct  391   KMDIPVPTYRGIPNFGAQSPSGTVCVACSGREPEELLVACNLCHSRCIHSYCLDPPLFPW  450

Query  1441  TCIHCQDYQ  1467
             TCIHC+D +
Sbjct  451   TCIHCKDLR  459



>gb|KGN57738.1| hypothetical protein Csa_3G271310 [Cucumis sativus]
Length=542

 Score =   341 bits (875),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 215/534 (40%), Positives = 279/534 (52%), Gaps = 87/534 (16%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GME VV TVSGY GTERFNLIK+I+  G +YVGAMS SITHL+CW  +GRKF+LA+K 
Sbjct  28    IEGMESVVVTVSGYHGTERFNLIKMISYTGASYVGAMSRSITHLICWELQGRKFDLAEKF  87

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSG--------  402
             R T IVNHRW+EDCIK G+RVPE PY +Q GQ +GPL M +    +G  S+         
Sbjct  88    R-TIIVNHRWLEDCIKHGKRVPEGPYILQSGQSIGPLSMKLPLADKGYVSAKKYNLLSEK  146

Query  403   ---------------CNH------KEPQIDTEVEEYFPDPDIAKPKSRKKMKNRSLKCD-  516
                            C+       +   +D ++   F   D    K + K++ R  K + 
Sbjct  147   LHNYGNVEDQSIKDICSFGDSILPRSSLLDKDLSSDFRKSDDTAHKRKHKVRKRISKLED  206

Query  517   -RNLSSRFDHYDSSMSGSWRMETEELSPEPAVFLKPKKGSMGLPETSLK----RRRLVKK  681
               + SSR    + + +G + +E    S   ++    +KG     ++++K    RR LV  
Sbjct  207   PSSSSSRNRFEEPTSAGLFAIECGSPS---SLARDERKGESSNQDSTVKSSRRRRLLVSN  263

Query  682   NISDVLEISDSEELSPQIRTLPEHESAM----------QSNSANIGRHDHTSNNSQTTRI  831
             N  +     D     P++  L    S                 NIG    TS+  Q    
Sbjct  264   NSREDHNKPDISNFDPELYRLGTRNSLTVPSVLWDAETDIEVVNIG---GTSDREQL---  317

Query  832   SCPEDHTNGIEVPG-----------DTE-------EVLNVTIGETLENEGALASPFKSPL  957
              C E     +   G           DT         VL++T  + L N   L    + P 
Sbjct  318   -CDERGLASVRFEGVEACENQSTSKDTNLLVDNAPRVLSITSEDELHNMNDLQKNIEDP-  375

Query  958   EQRRIVDVDQKEDENCVKLP-TSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQM  1134
                 ++++D         LP TS  LSCVICWTDFSS+RG+LPCGHRFC+SCIQ+WAD M
Sbjct  376   ----VIELD-------ASLPSTSTELSCVICWTDFSSTRGVLPCGHRFCYSCIQNWADHM  424

Query  1135  VSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPAN  1314
                 K STCPLCK  F SITKV  A  SDQKIYSQTIP      DIYLL D  T +    
Sbjct  425   ALSRKISTCPLCKASFLSITKVEYAATSDQKIYSQTIPCGSSLLDIYLLSDERTLNNVVQ  484

Query  1315  PAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRF  1476
             P++  VC  C  REPE+LL++CH+CQ R IH+YCLDPPL PWTCIHC+D Q  +
Sbjct  485   PSVAAVCSACRCREPEDLLMSCHLCQIRQIHSYCLDPPLLPWTCIHCKDLQTLY  538



>ref|XP_010552264.1| PREDICTED: uncharacterized protein LOC104822671 [Tarenaya hassleriana]
 ref|XP_010552274.1| PREDICTED: uncharacterized protein LOC104822671 [Tarenaya hassleriana]
 ref|XP_010552281.1| PREDICTED: uncharacterized protein LOC104822671 [Tarenaya hassleriana]
 ref|XP_010552289.1| PREDICTED: uncharacterized protein LOC104822671 [Tarenaya hassleriana]
Length=476

 Score =   339 bits (870),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 211/509 (41%), Positives = 281/509 (55%), Gaps = 80/509 (16%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GME VVATVSGY G+ERF LIKLI+ +G +YVGAMS SITHLVCW FEG+K+ LAKK 
Sbjct  5     IEGMENVVATVSGYHGSERFKLIKLISHSGASYVGAMSRSITHLVCWEFEGKKYNLAKKF  64

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQV-GEGNQSSGCNHKEPQ  423
              +T IVNH+W+E+CIK+G+RVPE PY  + G EVG L + +  V GEG  +     K+ +
Sbjct  65    -DTIIVNHQWVEECIKQGKRVPETPYMSKSGAEVGLLTIEVPAVSGEGEVT-----KKLK  118

Query  424   IDTEVEEYF----------PDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWR  573
                E+ + F             D +       +K +++  + NL SR          S R
Sbjct  119   KPVEISDKFFGNCEETWGGGASDFSAWTDSILLKEKNI--ESNLQSR---------RSTR  167

Query  574   METEELSPEPAVFLKPKKGSMGLPETSLKRRRLVKKNISDVLEISDSEELSPQIRTLPEH  753
              +   LS +        K + GL E S K +RL KK+                 RT+ + 
Sbjct  168   KKRNNLSED--------KENTGLGECSRKGQRLTKKH---------------SFRTIVDI  204

Query  754   ESAMQSNSANIGRHDHTSNNSQTTRISCPEDHTNGIEVPGDTE------EVLNVTIGETL  915
             ES  +S+       D+  NN +  R    ED  + + V   T       E  N  + E  
Sbjct  205   ESDQESDINRNEILDNQRNNGRAPRQPHSEDENDCVAVETSTRQCAGHSETTNWDLDEIE  264

Query  916   ENEG-ALASPFKSPL--------EQRRIVDVD---------QKEDENCVKLPTSPA----  1029
             E E  + +S FK P         E  R  D +         +KED    ++  +P     
Sbjct  265   ETENWSHSSLFKRPRSSHANASNELHRTHDHNGENFNKLESRKEDREATEMTNTPLASSD  324

Query  1030  LSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADA  1209
             +SCVICWT+FSS+RG+LPCGHRFC+ CIQ+WAD++VSRGK S CPLCK  F+SITKV DA
Sbjct  325   VSCVICWTEFSSTRGILPCGHRFCYPCIQNWADRLVSRGKDSACPLCKASFSSITKVEDA  384

Query  1210  EPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVC  1389
               SDQKIYSQT+P      ++ +LP+ E  +F A P +   C +C SREP++LLI CH+C
Sbjct  385   GSSDQKIYSQTVPSPSSTDNLIILPEQERPNFRALP-LASACTRCYSREPQDLLIRCHIC  443

Query  1390  QTRCIHAYCLDPPLHPWTCIHCQDYQRRF  1476
               RCIH+YCLDP L PW C HC D Q  +
Sbjct  444   NFRCIHSYCLDPYLLPWACTHCSDMQMLY  472



>ref|XP_010029463.1| PREDICTED: uncharacterized protein LOC104419480 isoform X2 [Eucalyptus 
grandis]
Length=500

 Score =   338 bits (868),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 203/504 (40%), Positives = 277/504 (55%), Gaps = 36/504 (7%)
 Frame = +1

Query  46    AIQISARVAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRK  225
             A +++  V GME VVA+VSGY G ERF+LIKLI+  G +YVGAMS S THLVC RFEG+K
Sbjct  2     AHEVAGPVRGMESVVASVSGYHGAERFDLIKLISSMGASYVGAMSSSTTHLVCRRFEGQK  61

Query  226   FELAKKSRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLM--------NITQVG  381
             ++LA+K + T +VNHRW+E+CIK+G+RVPEHPYT + G+EVG LL+         IT+  
Sbjct  62    YDLARKFK-THVVNHRWVEECIKQGKRVPEHPYTWESGEEVGSLLLPVPVNSKPYITRKK  120

Query  382   EGNQSSGCNHKEPQIDTEVEEYFPD------PDIAKPKSRKKMKNRSLKCDRNLSSRFDH  543
                 S   N          +  F D       D    K   ++   S +  R       H
Sbjct  121   HKVLSDRSNFASASTRQVADSAFEDNRSDIWTDSHLLKECPELNRSSRRLLRGKRIITPH  180

Query  544   YDSSMSGSWRMETEELSPEPAVFLKPKKGSMGLPETSLKRRRLVKKNISD---VLEISDS  714
              +S +S S      E+            G     E+S + R LVK+N       L  SDS
Sbjct  181   EESHLSPSMCFGRREMKSFSG------NGDSSYAESSKRGRNLVKRNAKREALKLNASDS  234

Query  715   EELSPQIRTLPEHESAMQSNSANIGRHDHTSNNSQTTRISCPEDHTNGIEVPGDTEEVLN  894
             ++    +    ++      +    G+   T   +        E   NGI    D +E+ +
Sbjct  235   DQECYVVGGDDKYGDITSPSEQLNGKFVSTRKGATQNGPYGHEGAINGI--IEDVDEIED  292

Query  895   VTIGETLENEGALASPFKSPLE---------QRRIVDVDQKEDENCVK-LPTSPALSCVI  1044
                      E ++       LE         ++  ++VD     + VK LP+S  LSCVI
Sbjct  293   RNYDHQPSPEDSIRKDLPDSLERVSKDEPNAEKLSLEVDDVGQTDYVKCLPSSVELSCVI  352

Query  1045  CWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQ  1224
             CWT++SS+RG+LPCGHRFC+SCI++W+D M SR  TSTCPLCK  F SITKV D+  S+Q
Sbjct  353   CWTEYSSTRGILPCGHRFCYSCIRNWSDHMSSRKTTSTCPLCKTSFVSITKVEDSSGSEQ  412

Query  1225  KIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCI  1404
             KIYSQTIP D+  +++Y++ D   +   A      VC +C SREP +LLI+CH+C TRCI
Sbjct  413   KIYSQTIPHDQSTSEVYVVTDQGRTSSRAESFGAQVCSECRSREPVDLLISCHLCHTRCI  472

Query  1405  HAYCLDPPLHPWTCIHCQDYQRRF  1476
             H+YCLDPPL PWTC+HC+D Q  F
Sbjct  473   HSYCLDPPLLPWTCVHCKDLQMLF  496



>gb|KDO58898.1| hypothetical protein CISIN_1g011171mg [Citrus sinensis]
Length=492

 Score =   338 bits (866),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 204/498 (41%), Positives = 269/498 (54%), Gaps = 42/498 (8%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME VVATVSGY GTERFNLIKLI+ +G +YVG MS S THLVCW+FEG K  LAKK R T
Sbjct  1     MESVVATVSGYHGTERFNLIKLISYSGASYVGTMSKSTTHLVCWKFEGEKHSLAKKFR-T  59

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQIDTE  435
              IVNH+W+EDCIK+ RR+PE PY +Q GQE+GPLL+ +      +  S  N  +   + E
Sbjct  60    IIVNHQWVEDCIKQHRRLPERPYMLQSGQEIGPLLLEVPLFNMNSDRS--NLDDNSKNEE  117

Query  436   VEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPEPAVFL  615
              +  F   ++A  K    + N +L      S    H   S S     + E+ S     F 
Sbjct  118   TDMRFEVSELAGWKG-SFLLNENLLPKFGKSENTSHKCKSKSFKRASKQEQRSSARNCFQ  176

Query  616   KPKKGSMGLPETSLKRRRLVKKNISDVLEISDSEELSPQ--IRTLPEHESAMQSNSANIG  789
              P    +   E           ++    +IS  EE S    +R+L E     +   ++  
Sbjct  177   DPPLSGLIRMEYEESSSDSSIHSVRGKRKISKHEESSTHSSLRSLREKTKISKGIGSSSS  236

Query  790   RHDHTSNNSQTTRISCPEDHTNGIE---VPGDTEEVLNVTIGET----LENEGAL--ASP  942
                 T        I       NG+E   +  D +    + I ET       +G +   S 
Sbjct  237   AKPSTKGRRLAKCIG-----RNGLESMLLDSDQDRAPVIRIAETSDDGFHKDGGINEGSE  291

Query  943   FKSPLEQRRIVDVDQKED--------------------ENCVKLPTSPALSCVICWTDFS  1062
                 +E+R    + Q+E                     E+  +  TS  LSCVICWT+FS
Sbjct  292   VIKEIEERDFPALLQRESQDGCSGIENSNGMVKNTDRIEHVNRSSTSGELSCVICWTEFS  351

Query  1063  SSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQT  1242
             S+RG+L CGHRFC+SCIQ+WAD M S  K STCPLCK  F SITKV DA  SDQKIYSQT
Sbjct  352   STRGVLACGHRFCYSCIQNWADHMASVRKISTCPLCKASFMSITKVEDAATSDQKIYSQT  411

Query  1243  IPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLD  1422
             IP      D+++LPDG+++     P++   C +C S+EP++LLI CH+CQ+RCIH YC+D
Sbjct  412   IPCAWSTRDVFILPDGDSA--SVQPSLLEACIECRSQEPQDLLIRCHLCQSRCIHCYCMD  469

Query  1423  PPLHPWTCIHCQDYQRRF  1476
             PPL PWTCIHC+D Q  +
Sbjct  470   PPLDPWTCIHCKDLQMLY  487



>ref|XP_010029462.1| PREDICTED: uncharacterized protein LOC104419480 isoform X1 [Eucalyptus 
grandis]
Length=501

 Score =   337 bits (865),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 202/504 (40%), Positives = 277/504 (55%), Gaps = 36/504 (7%)
 Frame = +1

Query  46    AIQISARVAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRK  225
             +  ++  V GME VVA+VSGY G ERF+LIKLI+  G +YVGAMS S THLVC RFEG+K
Sbjct  3     SFLVAGPVRGMESVVASVSGYHGAERFDLIKLISSMGASYVGAMSSSTTHLVCRRFEGQK  62

Query  226   FELAKKSRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLM--------NITQVG  381
             ++LA+K + T +VNHRW+E+CIK+G+RVPEHPYT + G+EVG LL+         IT+  
Sbjct  63    YDLARKFK-THVVNHRWVEECIKQGKRVPEHPYTWESGEEVGSLLLPVPVNSKPYITRKK  121

Query  382   EGNQSSGCNHKEPQIDTEVEEYFPD------PDIAKPKSRKKMKNRSLKCDRNLSSRFDH  543
                 S   N          +  F D       D    K   ++   S +  R       H
Sbjct  122   HKVLSDRSNFASASTRQVADSAFEDNRSDIWTDSHLLKECPELNRSSRRLLRGKRIITPH  181

Query  544   YDSSMSGSWRMETEELSPEPAVFLKPKKGSMGLPETSLKRRRLVKKNI---SDVLEISDS  714
              +S +S S      E+            G     E+S + R LVK+N    +  L  SDS
Sbjct  182   EESHLSPSMCFGRREMKSFSG------NGDSSYAESSKRGRNLVKRNAKREALKLNASDS  235

Query  715   EELSPQIRTLPEHESAMQSNSANIGRHDHTSNNSQTTRISCPEDHTNGIEVPGDTEEVLN  894
             ++    +    ++      +    G+   T   +        E   NGI    D +E+ +
Sbjct  236   DQECYVVGGDDKYGDITSPSEQLNGKFVSTRKGATQNGPYGHEGAINGI--IEDVDEIED  293

Query  895   VTIGETLENEGALASPFKSPLE---------QRRIVDVDQKEDENCVK-LPTSPALSCVI  1044
                      E ++       LE         ++  ++VD     + VK LP+S  LSCVI
Sbjct  294   RNYDHQPSPEDSIRKDLPDSLERVSKDEPNAEKLSLEVDDVGQTDYVKCLPSSVELSCVI  353

Query  1045  CWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQ  1224
             CWT++SS+RG+LPCGHRFC+SCI++W+D M SR  TSTCPLCK  F SITKV D+  S+Q
Sbjct  354   CWTEYSSTRGILPCGHRFCYSCIRNWSDHMSSRKTTSTCPLCKTSFVSITKVEDSSGSEQ  413

Query  1225  KIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCI  1404
             KIYSQTIP D+  +++Y++ D   +   A      VC +C SREP +LLI+CH+C TRCI
Sbjct  414   KIYSQTIPHDQSTSEVYVVTDQGRTSSRAESFGAQVCSECRSREPVDLLISCHLCHTRCI  473

Query  1405  HAYCLDPPLHPWTCIHCQDYQRRF  1476
             H+YCLDPPL PWTC+HC+D Q  F
Sbjct  474   HSYCLDPPLLPWTCVHCKDLQMLF  497



>ref|XP_008341848.1| PREDICTED: uncharacterized protein LOC103404692 isoform X1 [Malus 
domestica]
Length=537

 Score =   336 bits (862),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 218/537 (41%), Positives = 295/537 (55%), Gaps = 67/537 (12%)
 Frame = +1

Query  31    RL*KTAIQISARVAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWR  210
             RL ++   + + + GME V+ATVSGY G+ERF LIKLI++AG +YVGAMS S THLVCW+
Sbjct  9     RLPQSPEAMGSPIQGMESVIATVSGYHGSERFXLIKLISRAGASYVGAMSRSTTHLVCWK  68

Query  211   FEGRKFELAKKSRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMN---ITQVG  381
             FEGRK+ELA K  +  +VNHRWIE+CIK+G+RVPE PYT++CGQEVGPLL+    +  VG
Sbjct  69    FEGRKYELANKF-DAKVVNHRWIEECIKQGKRVPERPYTLRCGQEVGPLLLQPPPVVTVG  127

Query  382   EG--------NQSSGCNHKEPQIDTEV---------------EEYFP--DPDIAKPKSRK  486
             E         ++S+G +     ID++                E  FP    + +  K+++
Sbjct  128   ESSKKWNALSDKSNGYBDSVKIIDSZSGASRRHLLAESRLLDENLFPAFKENSSSHKAKQ  187

Query  487   KMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPEPAVFLKPKKGSM------GLPE  648
             K   R+ K +   SSR    D  ++ S  +  EE   E +  L   K ++       + E
Sbjct  188   KHVGRNSKQELRSSSRHCLEDPPLTRS--LXREEKVQESSTHLVRAKRNIFSGKESSMAE  245

Query  649   TSLKRRRLVKKNISDVL---EISDSEELSPQIRTLPEHESAMQ--SNSANIGRHDHTSNN  813
             TS K R+L+K NI   +   E+S+S++    IR        +   S+ ++  R+D+    
Sbjct  246   TSRKGRKLIKXNIGRRMVESELSESDQECHPIRFQSTRNDVITVLSDXSDEERNDNILET  305

Query  814   SQTT--------RI--------SCPEDHTNGIEVPGDTEEVLNVTIGETLENEGALASPF  945
              + T        RI            +H +  + P  + E     + ET  +E       
Sbjct  306   ERDTDNGLYIGRRIRNGLKGVEEADRNHPSSSKHPNISVEDEPTALEETPXDEWFEVENS  365

Query  946   KSPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWA  1125
             K   E R        E E   K+P S  LSCVICWT++SS RG+LPCGHRFC+SCI++WA
Sbjct  366   KEECEGRF-------ETEAATKIP-SMELSCVICWTEYSSIRGILPCGHRFCYSCIENWA  417

Query  1126  DQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHF  1305
               M SR K STCPLCK  FT ITKV DA+  DQKIYSQTIP   P  DI +       +F
Sbjct  418   GHMSSRRKNSTCPLCKASFTCITKVDDADMIDQKIYSQTIPSA-PKMDIPVPTYRGPPNF  476

Query  1306  PANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRF  1476
              A       C  C  REP +LL +C VC  RCIH +CLDPPL PWTCIHC+D +R +
Sbjct  477   SAPSISATACSVCRQREPVDLLFSCDVCCIRCIHNFCLDPPLFPWTCIHCKDLRRLY  533



>ref|XP_008341849.1| PREDICTED: uncharacterized protein LOC103404692 isoform X2 [Malus 
domestica]
Length=521

 Score =   335 bits (859),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 216/525 (41%), Positives = 289/525 (55%), Gaps = 67/525 (13%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GME V+ATVSGY G+ERF LIKLI++AG +YVGAMS S THLVCW+FEGRK+ELA K 
Sbjct  5     IQGMESVIATVSGYHGSERFXLIKLISRAGASYVGAMSRSTTHLVCWKFEGRKYELANKF  64

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMN---ITQVGEG--------NQ  393
              +  +VNHRWIE+CIK+G+RVPE PYT++CGQEVGPLL+    +  VGE         ++
Sbjct  65    -DAKVVNHRWIEECIKQGKRVPERPYTLRCGQEVGPLLLQPPPVVTVGESSKKWNALSDK  123

Query  394   SSGCNHKEPQIDTEV---------------EEYFP--DPDIAKPKSRKKMKNRSLKCDRN  522
             S+G +     ID++                E  FP    + +  K+++K   R+ K +  
Sbjct  124   SNGYBDSVKIIDSZSGASRRHLLAESRLLDENLFPAFKENSSSHKAKQKHVGRNSKQELR  183

Query  523   LSSRFDHYDSSMSGSWRMETEELSPEPAVFLKPKKGSM------GLPETSLKRRRLVKKN  684
              SSR    D  ++ S  +  EE   E +  L   K ++       + ETS K R+L+K N
Sbjct  184   SSSRHCLEDPPLTRS--LXREEKVQESSTHLVRAKRNIFSGKESSMAETSRKGRKLIKXN  241

Query  685   ISDVL---EISDSEELSPQIRTLPEHESAMQ--SNSANIGRHDHTSNNSQTT--------  825
             I   +   E+S+S++    IR        +   S+ ++  R+D+     + T        
Sbjct  242   IGRRMVESELSESDQECHPIRFQSTRNDVITVLSDXSDEERNDNILETERDTDNGLYIGR  301

Query  826   RI--------SCPEDHTNGIEVPGDTEEVLNVTIGETLENEGALASPFKSPLEQRRIVDV  981
             RI            +H +  + P  + E     + ET  +E       K   E R     
Sbjct  302   RIRNGLKGVEEADRNHPSSSKHPNISVEDEPTALEETPXDEWFEVENSKEECEGRF----  357

Query  982   DQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTC  1161
                E E   K+P S  LSCVICWT++SS RG+LPCGHRFC+SCI++WA  M SR K STC
Sbjct  358   ---ETEAATKIP-SMELSCVICWTEYSSIRGILPCGHRFCYSCIENWAGHMSSRRKNSTC  413

Query  1162  PLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQ  1341
             PLCK  FT ITKV DA+  DQKIYSQTIP   P  DI +       +F A       C  
Sbjct  414   PLCKASFTCITKVDDADMIDQKIYSQTIPSA-PKMDIPVPTYRGPPNFSAPSISATACSV  472

Query  1342  CSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRF  1476
             C  REP +LL +C VC  RCIH +CLDPPL PWTCIHC+D +R +
Sbjct  473   CRQREPVDLLFSCDVCCIRCIHNFCLDPPLFPWTCIHCKDLRRLY  517



>ref|XP_010415273.1| PREDICTED: E3 ubiquitin-protein ligase RNF8-B-like [Camelina 
sativa]
 ref|XP_010415274.1| PREDICTED: E3 ubiquitin-protein ligase RNF8-B-like [Camelina 
sativa]
 ref|XP_010415275.1| PREDICTED: E3 ubiquitin-protein ligase RNF8-B-like [Camelina 
sativa]
Length=465

 Score =   333 bits (853),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 201/500 (40%), Positives = 285/500 (57%), Gaps = 71/500 (14%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME VVATVSGY G+ERF LIKLI+ +G +YVGAMS SITHLVCWRFEG+K++LAKK  NT
Sbjct  1     MENVVATVSGYHGSERFKLIKLISHSGASYVGAMSRSITHLVCWRFEGKKYDLAKKF-NT  59

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQV-GEGNQSSGCNHKEPQIDT  432
              +VNH+W+E+C+++GRRV E PY  + G+EVGPL+M +  + GE   +   N      D 
Sbjct  60    VVVNHQWVEECVREGRRVSETPYMFESGEEVGPLMMELPAISGEAKATKKVNKATETFD-  118

Query  433   EVEEYFPDPDIAKPKSRKKMK---NRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPEP  603
                +YF + + ++  S  ++    +  L  ++N  +             R      +  P
Sbjct  119   ---KYFNNGEESRRGSTSELATWMDSVLLKEKNTEAN------------RQSVRLRTKRP  163

Query  604   AVFLKPKKGSMGLPETSLK-RRRLVKKNISDVLEISDSEELSPQIRTLPEHESAMQSNSA  780
             +   + K+ + G+ E+S K +RRLV+K +                R L + ES  +S+++
Sbjct  164   SNIFEDKENT-GVAESSGKGKRRLVQKRL---------------CRNLIDLESDEESDNS  207

Query  781   NIGRHDHTSNNSQTTRISCPEDH-----------TNGIEVPGDTEEVLNVTIGETLENEG  927
              +   D   N +Q TR   P+D            T+ +  PGD+    N  + E  E+E 
Sbjct  208   WLDNSDENRNKTQDTRE--PDDENVRECVFEPGETSALRHPGDSA-TQNWDVDEIEESEN  264

Query  928   -ALASPFKSPLE---QRRIVD--------VDQKEDENCVKLPTSPALSCVICWTDFSSSR  1071
              + ++ FK P     +R++ +          ++E+    +      +SC+ICWT+FSSSR
Sbjct  265   WSHSAVFKRPRSNSTERKLQEDGSNYNKTYSRREETEATEKVLPAQVSCIICWTEFSSSR  324

Query  1072  GLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQ  1251
             G+LPCGHRFCFSCIQ WAD++VS  K +TCPLCK  F +ITK+ DA  SDQ IYSQT+P 
Sbjct  325   GILPCGHRFCFSCIQKWADRLVSERKKTTCPLCKSNFITITKIEDAGSSDQNIYSQTVP-  383

Query  1252  DRPGTD--IYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDP  1425
             D   T+  + +LP+ E     ++ A    C +C   EPEELLI CH+C  R IH+YCLDP
Sbjct  384   DLSSTNNTLVVLPEEEERRGFSSLARASGCSKCFLTEPEELLIRCHLCNFRRIHSYCLDP  443

Query  1426  PLHPWTCIHCQD----YQRR  1473
              L PWTC HC D    YQRR
Sbjct  444   YLLPWTCKHCNDLQMMYQRR  463



>ref|XP_010511631.1| PREDICTED: E3 ubiquitin-protein ligase RNF8-A-like [Camelina 
sativa]
 ref|XP_010511632.1| PREDICTED: E3 ubiquitin-protein ligase RNF8-A-like [Camelina 
sativa]
Length=466

 Score =   330 bits (845),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 204/502 (41%), Positives = 284/502 (57%), Gaps = 74/502 (15%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME VVATVSGY G+ERF LIKLI+ +G +YVGAMS SITHLVCW+FEG+K++LAKK    
Sbjct  1     MENVVATVSGYHGSERFKLIKLISHSGASYVGAMSRSITHLVCWKFEGKKYDLAKKFNTV  60

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQV-GEGNQSSGCNHKEPQIDT  432
              +VNH+W+E+C+K+GRRV E PY  + G+EVGPL+M +  V GE   +   N      D 
Sbjct  61    VVVNHQWVEECVKEGRRVSETPYMFESGEEVGPLIMELPAVSGEAKVTKKVNKTTETFD-  119

Query  433   EVEEYFPDPDIAKPKSRKKMK---NRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPEP  603
                +YF + + ++  S  ++    +  L  ++N  +             R      +  P
Sbjct  120   ---KYFNNGEESRRGSTSELATWMDSVLLKEKNTEAN------------RQSVRLRTKRP  164

Query  604   AVFLKPKKGSMGLPETSLK-RRRLVKKNISDVLEISDSEELSPQIRTLPEHESAMQSNSA  780
             +   + K+ + G+ E+S K +RRLV+K +                R L + ES  +S+ +
Sbjct  165   SNIFEDKENT-GVAESSGKGKRRLVQKRL---------------CRNLVDLESDEESDHS  208

Query  781   NIGRHDHTSNNSQTTRISCPED-----------HTNGIEVPGDTEEVLNVTIGETLENEG  927
              +   D   N +Q TR   P+D            T+ +  PGD+    N  + E  E+E 
Sbjct  209   WLYNSDENRNKTQDTRE--PDDENVRECVFEPGETSALRHPGDS-ATQNWDVDEIEESEN  265

Query  928   -ALASPFKSPLE---QRRI---------VDVDQKEDENCVKLPTSPA-LSCVICWTDFSS  1065
              + ++ FK P     +R++          D  ++E E   K+P  PA +SC+ICWT+FSS
Sbjct  266   WSHSAVFKRPRSNSTERKLQEDGSNYNKTDSRREETEATEKVP--PAQVSCIICWTEFSS  323

Query  1066  SRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTI  1245
             SRG+LPCGHRFC+SCIQ WAD++V+  K +TCPLCK  F +ITK+ DA  SDQ IYSQT+
Sbjct  324   SRGILPCGHRFCYSCIQKWADRLVAERKKTTCPLCKSNFITITKIEDAGSSDQNIYSQTV  383

Query  1246  PQDRPGTD--IYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCL  1419
             P D   T+  + +LP+ E        A    C +C   EPEELLI CH+C  R IH+YCL
Sbjct  384   P-DLSSTNNTLVVLPEEEERRGFNALARVSGCSKCYLTEPEELLIRCHLCNFRRIHSYCL  442

Query  1420  DPPLHPWTCIHCQD----YQRR  1473
             DP L PWTC HC D    YQRR
Sbjct  443   DPYLLPWTCKHCNDLQMMYQRR  464



>ref|XP_010470615.1| PREDICTED: E3 ubiquitin-protein ligase RNF8-A-like [Camelina 
sativa]
 ref|XP_010470616.1| PREDICTED: E3 ubiquitin-protein ligase RNF8-A-like [Camelina 
sativa]
Length=462

 Score =   328 bits (841),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 205/502 (41%), Positives = 275/502 (55%), Gaps = 78/502 (16%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME VVATVSGY G+ERF LIKLI+ +G +YVGAMS SITHLVCWRFEG+K++LAKK    
Sbjct  1     MENVVATVSGYHGSERFKLIKLISHSGASYVGAMSRSITHLVCWRFEGKKYDLAKKFNTV  60

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQIDTE  435
              +VNH+W+E+C+K+GRRV E PY  + G+EVGPL+M +  V                   
Sbjct  61    VVVNHQWVEECVKEGRRVSETPYIFESGEEVGPLMMELPAVS------------------  102

Query  436   VEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSP-EPAVF  612
                        + K  KK+K          +  FD Y ++   S R  T EL+    +V 
Sbjct  103   ----------GEAKVTKKVK--------RATETFDKYFNNGEESRRGSTSELATWMDSVL  144

Query  613   LKPKKGSMGLPETSLKRRR----LVKKNISDVLEISDSEELSPQIRTLPEHESAMQSNSA  780
             LK K          L+ +R       K  + V E S   +     + L  +   ++S+++
Sbjct  145   LKEKTTEANRQSVRLRTKRPSNIFEDKENTGVAESSGKGKRRLVQKRLCSNLIDLESDNS  204

Query  781   NIGRHDHTSNNSQTTRISCPED-----------HTNGIEVPGDTEEVLNVTIGETLENEG  927
              +   D   N +Q TR   P+D            T+ +  PGD+    N  + E  E+E 
Sbjct  205   WLDNSDENRNKTQDTRE--PDDENVRECVFEPGETSALRHPGDS-ATQNWDVDEIEESEN  261

Query  928   -ALASPFKSPLE---QRRI---------VDVDQKEDENCVKLPTSPA-LSCVICWTDFSS  1065
              + ++ FK P     +R++          D  ++E E   K+P  PA +SC+ICWT+FSS
Sbjct  262   WSHSAVFKRPRSNSTERKLQEDGSNYNKTDSRREETEGTEKVP--PAQVSCIICWTEFSS  319

Query  1066  SRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTI  1245
             SRG+LPCGHRFC+SCIQ WAD++VS  K +TCPLCK  F +ITK+ DA  SDQKIYSQT+
Sbjct  320   SRGILPCGHRFCYSCIQKWADRLVSERKKTTCPLCKSNFITITKIEDAGSSDQKIYSQTV  379

Query  1246  PQDRPGTD--IYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCL  1419
             P D   T+  + +LP+ E        A    C +C   EPEELLI CH+C  R IH+YCL
Sbjct  380   P-DLSSTNNTLVVLPEEEERRGFNALARASGCSKCFLTEPEELLIRCHLCNFRRIHSYCL  438

Query  1420  DPPLHPWTCIHCQD----YQRR  1473
             DP L PWTC HC D    YQRR
Sbjct  439   DPYLLPWTCKHCNDLQMMYQRR  460



>ref|XP_006302233.1| hypothetical protein CARUB_v10020256mg [Capsella rubella]
 gb|EOA35131.1| hypothetical protein CARUB_v10020256mg [Capsella rubella]
Length=462

 Score =   328 bits (840),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 204/501 (41%), Positives = 284/501 (57%), Gaps = 76/501 (15%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME VVATVSGY G+ERF LIKLI+ +G +YVGAMS SITHLVCWRFEG+K++LAKK  NT
Sbjct  1     MENVVATVSGYHGSERFKLIKLISHSGASYVGAMSRSITHLVCWRFEGKKYDLAKKF-NT  59

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQIDTE  435
              +VNH+W+E+C++KGRRV E PY  + G+EVGPL++ +  V +  +      K  +    
Sbjct  60    VVVNHQWLEECVRKGRRVSETPYMFESGEEVGPLMIELPSVAKVAK------KVNKAAET  113

Query  436   VEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEELS-----PE  600
              ++YF + + ++  S  ++                  DS +     ME    S       
Sbjct  114   FDKYFSNGEESRRGSTSELAT--------------WMDSVLLKEKNMEVNRQSVRLRTKR  159

Query  601   PAVFLKPKKGSMGLPETSLK-RRRLVKKNISDVLEISDSEELSPQIRTLPEHESAMQSNS  777
             P+  L+ K+ + G+ E+S K +RRLV++ +                R L + ES  +S++
Sbjct  160   PSSILEDKENT-GVAESSGKGKRRLVQQRL---------------CRNLIDLESDEESDN  203

Query  778   ANIGRHDHTSNNSQTTRISCPED-----------HTNGIEVPGDTEEVLNVTIGETLENE  924
               +   D   N ++T  I  P+D            T+ +  PGD+    N  + E  E+E
Sbjct  204   NCLDNSDE--NQNKTHDIREPDDEFVRDCVFEPGETSALRHPGDS-TTQNWDVNEIEESE  260

Query  925   G-ALASPFKSPLE---QRRIVD-------VDQKEDENCVKLPTSPA-LSCVICWTDFSSS  1068
               + ++ FK P     +R+  D        D + DE        PA +SC+ICWT+FSSS
Sbjct  261   NWSHSAVFKRPRSNCAERKPQDDESNYNKTDSRTDETDATEKVPPAQVSCIICWTEFSSS  320

Query  1069  RGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIP  1248
             RG+LPCGHRFC+SCIQ WAD++V+  K +TCPLCK  F +ITK+ DA+ SDQKIYSQT+P
Sbjct  321   RGILPCGHRFCYSCIQKWADRLVAERKKTTCPLCKSNFITITKIEDADSSDQKIYSQTVP  380

Query  1249  QDRPGTD--IYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLD  1422
              D   T+  + +LP+ E     +  A    C +C   EPEELLI CH+C  R IH+YCLD
Sbjct  381   -DLSSTNNTLVVLPEEEERRGFSALARASGCSKCYLTEPEELLIRCHLCNFRRIHSYCLD  439

Query  1423  PPLHPWTCIHCQD----YQRR  1473
             P L PWTC HC D    YQRR
Sbjct  440   PYLLPWTCKHCSDLQTMYQRR  460



>ref|NP_176889.1| RING-finger and BRCT domain-containing protein [Arabidopsis thaliana]
 gb|AAD10663.1| Hypothetical protein [Arabidopsis thaliana]
 gb|AEE34609.1| RING-finger and BRCT domain-containing protein [Arabidopsis thaliana]
Length=453

 Score =   326 bits (835),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 199/483 (41%), Positives = 273/483 (57%), Gaps = 51/483 (11%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME VVATVSGY G++RF LIKLI+ +G +YVGAMS SITHLVCW+FEG+K++LAKK   T
Sbjct  1     MENVVATVSGYHGSDRFKLIKLISHSGASYVGAMSRSITHLVCWKFEGKKYDLAKKF-GT  59

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQIDTE  435
              +VNHRW+E+C+K+GRRV E PY    G+EVGPL++ +  V E    +    K  +    
Sbjct  60    VVVNHRWVEECVKEGRRVSETPYMFDSGEEVGPLMIELPAVSE---EAKVTKKVNKASET  116

Query  436   VEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPEPAVFL  615
              ++YF +            +NRS      L++  +    +   S R+ T+     P+  L
Sbjct  117   FDKYFSNGG----------ENRSGSTSE-LATWMEKNVEANRHSVRLRTKR----PSSIL  161

Query  616   KPKKGSMGLPETSLKRRRLVKKNISDVLEISDSEELSPQIRTLPEHESAMQSNSANIGRH  795
             + K+ S G+ E+S K ++ V K  S               R L + ES  +S++ +    
Sbjct  162   ENKENS-GVAESSRKGKKRVVKQRS--------------YRNLIDLESDEESDNNHHDNS  206

Query  796   DHTSNNSQTTRISCPED---------HTNGIEVPGDTEEVLNVTIGETLENEG-ALASPF  945
             D   N +Q  R    E+          T+ +  PGD     N  + E  E+E  + ++ F
Sbjct  207   DENQNETQDHREPADENVRGFVFEQGETSALRHPGDLA-TPNWDVDEIEESENWSHSAVF  265

Query  946   KSPLE---QRRIVDVDQKEDENCVKLPTSPA-LSCVICWTDFSSSRGLLPCGHRFCFSCI  1113
             K P     + +  D D+   E       +PA +SC+ICWT+FSSSRG+LPCGHRFC+SCI
Sbjct  266   KRPRSFSPEIKPQDDDESTREETEATEKAPAQVSCIICWTEFSSSRGILPCGHRFCYSCI  325

Query  1114  QSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIY-LLPDG  1290
             Q WAD++VS  K +TCPLCK  F +ITK+ DA+ SDQKIYSQT+P      +I  +LP+ 
Sbjct  326   QKWADRLVSERKKTTCPLCKSNFITITKIEDADSSDQKIYSQTVPDLSSTNNILVVLPEE  385

Query  1291  ETSHFPANP-AMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQ  1467
             E      NP      C +C   EPEELLI CH+C  R IH+YCLDP L PWTC HC D Q
Sbjct  386   EEQRQTLNPLTRASGCSRCYLTEPEELLIRCHLCNFRRIHSYCLDPYLLPWTCNHCNDLQ  445

Query  1468  RRF  1476
               +
Sbjct  446   MMY  448



>emb|CDY12624.1| BnaA02g12920D [Brassica napus]
Length=465

 Score =   321 bits (823),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 183/474 (39%), Positives = 256/474 (54%), Gaps = 27/474 (6%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME VVATVSGY G+ERF LIKLI+ +G +YVGAMS SITHLVCW+FEG+K+ LA K  NT
Sbjct  1     MENVVATVSGYHGSERFKLIKLISLSGASYVGAMSRSITHLVCWKFEGKKYHLANKF-NT  59

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNI-TQVGEGNQSSGCNHKEPQIDT  432
              +VNH+W+E CI++GRRV E PYT + G+EVGPL++ +    GE   +   N      D 
Sbjct  60    IVVNHQWVEACIREGRRVSEAPYTFESGEEVGPLMVELPADSGEAKVTKKANKPADTFD-  118

Query  433   EVEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHY--DSSMSGSWRMETEELSPEPA  606
                +YF + + ++   R             LS+  D +      + + R      +  P+
Sbjct  119   ---KYFANGEESRRNGRTS----------ELSTWMDSFLLKEKNTEATRQSVRLRTKRPS  165

Query  607   VFLKPKKGSMGLPETSLKRRRLVKKNIS-DVLEISDSEELSPQIRTLPEHESAM-----Q  768
                + K+ +     +   +RRLVK   S +++++   EE       +P+ +        +
Sbjct  166   NIFEDKENTCVAESSRKGKRRLVKPGSSRNLIDLDSDEESDSNCHDIPDEQQRTSQDPRE  225

Query  769   SNSANIGRHDHTSNNSQTTRISCPEDHTNGIEVPGDTEEVLNVTIGETLENEGALASPFK  948
              N  N+   D      +T+    P D T       + EE  N       +   ++ +  +
Sbjct  226   LNDENV--EDCVLEQGETSARGHPRDSTTQDWAADEIEESENWNHSAVFKRPRSINAEKE  283

Query  949   SPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWAD  1128
                ++      D +E+E       S  +SCVICWT FSS+RG+LPCGHRFC+SCIQ W D
Sbjct  284   PQDDESNFNKPDSREEEKEATKMVSAQVSCVICWTGFSSTRGILPCGHRFCYSCIQQWVD  343

Query  1129  QMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQ-DRPGTDIYLLPDGETSHF  1305
             ++VS  K +TCPLCK  F +ITK+ DA  SDQKIYSQT+P        + +LP+ E    
Sbjct  344   RLVSERKKTTCPLCKFNFVTITKIEDAGSSDQKIYSQTVPDPSSTNNSLVILPEEEERQG  403

Query  1306  PANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQ  1467
                 +    C +CS  EPE+LLI CH+C  R IH YCLDP L PWTC HC D Q
Sbjct  404   FNPLSRASACGRCSLSEPEDLLIRCHICNFRRIHTYCLDPYLVPWTCNHCNDLQ  457



>ref|XP_009127529.1| PREDICTED: uncharacterized protein LOC103852378 [Brassica rapa]
 ref|XP_009127530.1| PREDICTED: uncharacterized protein LOC103852378 [Brassica rapa]
Length=461

 Score =   316 bits (810),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 191/475 (40%), Positives = 266/475 (56%), Gaps = 33/475 (7%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME VVATVSGY G+ER  LIKLI+ +G +YVGAMS SITHLVCW+FEG+K+ LA K  NT
Sbjct  1     MENVVATVSGYHGSERVKLIKLISLSGASYVGAMSRSITHLVCWKFEGKKYHLANKF-NT  59

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNI-TQVGEGNQSSGCNHKEPQIDT  432
              +VNH+W+E CI++GRRV E PY+ + G+EVGPL++ +    GE   ++  N      D 
Sbjct  60    IVVNHQWVEACIREGRRVSEAPYSFESGEEVGPLMVELPADSGEAKVTNKANKHADTFD-  118

Query  433   EVEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHY--DSSMSGSWRMETEELSPEPA  606
                +YF + + ++ +SR+  +         LS+  D +      + S R      +  P+
Sbjct  119   ---KYFANGEESR-RSRRTSE---------LSTWMDSFLLKEKNTESTRQSVRLRTKRPS  165

Query  607   VFLKPKKGSMGLPETSLK-RRRLVK----KNISDVLEISDSEELSPQIRTLPEHESAMQS  771
                + K+ + G  E+S K +RRLVK    +N+ D+   SD E  S       E       
Sbjct  166   NIFEDKENT-GAAESSRKGKRRLVKPRSSRNLIDL--DSDGESDSHCHEYSDEQRRKSPV  222

Query  772   NSANIGRHDHTSNNSQTTRISCPEDHTNGIEVPGDTEEVLNVTIGETLENEGALASPFKS  951
             N  N+   D      +T+    P D+        + EE  N       +   ++    K+
Sbjct  223   NDENV--EDCVLEQGETSARGHPRDYATQDWAADEIEESENWNHSAVFKRPRSVNPEKKT  280

Query  952   PLEQRRIVDVDQKEDE-NCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWAD  1128
               ++     +D +E+E +  K+ +   +SCVICWT FSS+RG+LPCGHRFC+SCIQ W D
Sbjct  281   QDDESNFSKLDSREEEKDATKMVSQ--VSCVICWTGFSSTRGILPCGHRFCYSCIQQWVD  338

Query  1129  QMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQ-DRPGTDIYLLPDGETSHF  1305
             ++VS  K +TCPLCK  F +ITK+ DA  SDQKIYSQT+P        + +LP+      
Sbjct  339   RLVSERKKTTCPLCKFNFVTITKIEDAGSSDQKIYSQTVPDPSSTNNSLVVLPEEGEERQ  398

Query  1306  PANP-AMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQ  1467
               NP +    C +CS  EPE+LLI CH+C  R IH YCLDP L PWTC HC D Q
Sbjct  399   GFNPLSRASACGRCSLSEPEDLLIRCHICNFRRIHTYCLDPYLVPWTCNHCNDLQ  453



>gb|KHN28366.1| BRCT domain-containing protein [Glycine soja]
Length=468

 Score =   314 bits (805),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 197/509 (39%), Positives = 266/509 (52%), Gaps = 69/509 (14%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME+VVATVSGY G+ERFNLIKLI++AGGNYVGAMS SITHLVCW+FEG+K+++A K R  
Sbjct  1     MERVVATVSGYHGSERFNLIKLISQAGGNYVGAMSKSITHLVCWKFEGKKYDIALKFR-I  59

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQIDTE  435
              +VNHRW+EDCIK+GRRVPE  YT+Q G EVGPLL+ +  V                   
Sbjct  60    HVVNHRWVEDCIKEGRRVPEDSYTLQSGHEVGPLLLEVPLVR------------------  101

Query  436   VEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMET-------EELS  594
                       A   ++KK+    L    +     D + S  SG++ +E        EE S
Sbjct  102   ----------ASSLTKKKLVGDKLHATGSERKNSD-FSSGASGTYVLEDSCLMKKHEESS  150

Query  595   PEPAVFLKPKKGSM--GLPETSLKR-----RRLVKKNISDVL---EISDSEELSPQIRTL  744
                +   +  K  +  G   T++ R     RRL    +  V+    I D        R  
Sbjct  151   SYSSRLSRRGKRHICNGKENTTVARPSRKGRRLASDLVDKVVLGPSILDLTTDDHLFRMD  210

Query  745   PEHESAMQSNSANIGRHDHTS-NNSQTTRISCPEDHTNGIEVPGDTEEVLNVT-IGETLE  918
              +   A  ++S ++G +++    NS+             I    D E++ + + I +   
Sbjct  211   SQQTDAEATSSLSVGVNNNIILQNSEGPNAGLSNQSRTIIGGSNDIEQIKDSSHISKPRN  270

Query  919   NEGALASPFKSPLEQRRIVDVDQKEDE---------NCVKLPTSPALSCVICWTDFSSSR  1071
             +   +  P   P   +  +D+   +DE         N   LPTS  +SCVIC T+FSS+R
Sbjct  271   STSFIEDPLPVP---QTSIDLCSSDDEKFTDGDQADNVAGLPTSTEMSCVICLTEFSSTR  327

Query  1072  GLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQ  1251
             G+LPCGHRFCF CIQ+WAD   S  KTSTCPLCK  F  I KV  A  +DQKIYSQTIP 
Sbjct  328   GILPCGHRFCFPCIQNWADHTTSMRKTSTCPLCKASFMMIKKVEHAATADQKIYSQTIPC  387

Query  1252  DRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPL  1431
             D   + I++  D          A    C  C  REPE+LL +C VC  R IH+YC+DPPL
Sbjct  388   DNSASVIFIPVDQNLPDNIFESAQSNACVVCRGREPEDLLESCDVCHIRKIHSYCMDPPL  447

Query  1432  HPWTCIHCQDYQRRFETYRRIW*YINHLF  1518
              PW C HC++ +  + +        NHL+
Sbjct  448   RPWICTHCKELRMHYRS--------NHLY  468



>ref|XP_002887108.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63367.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=464

 Score =   313 bits (802),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 197/497 (40%), Positives = 278/497 (56%), Gaps = 66/497 (13%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME VVATVSGY G++RF LIKLI+ +G +YVGAMS SITHLVCW+FEG+K++LAKK   T
Sbjct  1     MENVVATVSGYHGSDRFKLIKLISHSGASYVGAMSRSITHLVCWKFEGKKYDLAKKF-GT  59

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQV-GEGNQSSGCNHKEPQIDT  432
              +VNH+W+E+C+++GRRV E PY  + G+EVGPL++ +  V GE   +   N        
Sbjct  60    VVVNHQWVEECVREGRRVSETPYMFESGEEVGPLMVELPAVSGEAKVTKKVNKAAETF--  117

Query  433   EVEEYFPDPDIAKPKSRKKMK---NRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPEP  603
               E+YF   +  +  S  ++    +  L  ++N+ +           S R+ T+     P
Sbjct  118   --EKYFSKGEENRSGSTSELATWMDSVLLKEKNVEAN--------RHSVRLRTKR----P  163

Query  604   AVFLKPKKGSMGLPETSLK-RRRLVKKNISDVLEISDSEELSPQIRTLPEHESAMQSNSA  780
             +   + K+ + G+ ++S K +R+LVK+                  R L + ES  +S++ 
Sbjct  164   SNIFEDKENT-GVAKSSRKGKRQLVKQR---------------SCRNLIDLESDEESDNN  207

Query  781   NIGRHDHTSNNSQTTRISCPEDH---------TNGIEVPGDTEEVLNVTIGETLENEG-A  930
                  D   N +Q  R    E+          T+ +  PGD+    N  + E  E+E  +
Sbjct  208   RHENSDENRNETQDPREPADENERGCVFEQGETSALRHPGDSA-TQNWDVDEIEESENWS  266

Query  931   LASPFKSPLE-------QRRIVDVDQKE---DENCVKLPTSPALSCVICWTDFSSSRGLL  1080
              ++ FK P         Q    + ++ E   DE       +  +SC+ICWT+FSSSRG+L
Sbjct  267   HSAVFKRPRSISPEIKPQDDGSNYNKPESTRDETEATQKATAQVSCIICWTEFSSSRGIL  326

Query  1081  PCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRP  1260
             PCGHRFC+SCIQ WAD++VS  K +TCPLCK  F +ITK+ DA+ SDQKIYSQT+P D  
Sbjct  327   PCGHRFCYSCIQKWADRLVSERKKTTCPLCKSNFITITKIEDADSSDQKIYSQTVP-DLS  385

Query  1261  GTD--IYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLH  1434
              T+  + +LP+ E             C +C   EPEELLI CH+C  R IH+YCLDP L 
Sbjct  386   STNNTLVVLPEEEQRQTFNPLTRASGCSRCYLTEPEELLIRCHLCNFRRIHSYCLDPYLL  445

Query  1435  PWTCIHCQD----YQRR  1473
             PWTC HC D    YQRR
Sbjct  446   PWTCNHCNDLQMMYQRR  462



>ref|XP_009371063.1| PREDICTED: uncharacterized protein LOC103960332 [Pyrus x bretschneideri]
Length=512

 Score =   315 bits (806),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 206/524 (39%), Positives = 278/524 (53%), Gaps = 74/524 (14%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GME V+AT         FNLIKLI++AG +YVGAMS S THLVCW+FEGRK+ELA K 
Sbjct  5     IQGMESVIAT---------FNLIKLISRAGASYVGAMSRSTTHLVCWKFEGRKYELANKF  55

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMN---ITQVGEG--------NQ  393
              +  +VNHRWIE+CIK+G+RVPE PYT++CGQEVGPLL+    +  V E         ++
Sbjct  56    -DMKVVNHRWIEECIKQGKRVPERPYTLRCGQEVGPLLLEPPPVVTVDESSKKWNALSDK  114

Query  394   SSGCNHKEPQIDTEV---------------EEYFP--DPDIAKPKSRKKMKNRSLKCDRN  522
             S+GC+     ID++                E  FP    + +  K+++K   R+ K +  
Sbjct  115   SNGCDDLVKIIDSDCGASRRHLLAESRLLDENLFPAFKENSSSHKAKQKHDGRNSKQELR  174

Query  523   LSSRFDHYDSSMSGSWRMETEELSPEPAVFLKPKKGSMGLPETSL-----KRRRLVKKNI  687
              SSR    D  ++ S R E E++       ++ K+      E+S+     K R+L+KKNI
Sbjct  175   SSSRHCLEDPPLTRSLRRE-EKVQESSTHLVRAKRNIFSGKESSMAGTSRKGRKLIKKNI  233

Query  688   SDVLEISDSEELSPQ------------IRTLPEHESAMQSNSANIGRHDHTSN-------  810
                +  S+  E   +            + T+   +S  + N   +     T N       
Sbjct  234   DRHMVESELSEYDQECHPTRFQSTCNDVITVLSDDSDEERNDNILETERDTDNGLCIGRR  293

Query  811   --NSQTTRISCPEDHTNGIEVPGDTEEVLNVTIGETLENEGALASPFKSPLEQRRIVDVD  984
               N          +H +  + P  + E     + ET  +E       K   E R      
Sbjct  294   IRNGLKGVEEADRNHPSSSKHPNISVEDEPTALEETPRDEWFEVENSKEESESRF-----  348

Query  985   QKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCP  1164
               E E   K+P S  LSCVICWT++SS RG+LPCGHRFC+SCI++WA  M S+ K STCP
Sbjct  349   --ETEAATKIP-SMELSCVICWTEYSSIRGILPCGHRFCYSCIENWAGHMSSKRKNSTCP  405

Query  1165  LCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQC  1344
             LCK  FTSITKV DA+  DQKIYSQTIP   P  DI +       +F A       C  C
Sbjct  406   LCKASFTSITKVDDADMIDQKIYSQTIPS-APKMDIPVPTYRGPPNFSAPSISATACSVC  464

Query  1345  SSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRF  1476
               REP +LL +C VC+ RCIH +CLDPPL PWTCIHC+D +R +
Sbjct  465   RQREPVDLLFSCDVCRIRCIHNFCLDPPLFPWTCIHCKDLRRLY  508



>ref|XP_006391481.1| hypothetical protein EUTSA_v10018524mg [Eutrema salsugineum]
 gb|ESQ28767.1| hypothetical protein EUTSA_v10018524mg [Eutrema salsugineum]
Length=456

 Score =   313 bits (801),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 194/495 (39%), Positives = 268/495 (54%), Gaps = 70/495 (14%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME VVATVSGY G ERF LIKLI+ +G +YVGAMS SITHLVCW+FEG+K++LAKK  + 
Sbjct  1     MENVVATVSGYHGAERFKLIKLISHSGASYVGAMSRSITHLVCWKFEGKKYDLAKKF-DI  59

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQIDTE  435
              +VNH+W+E+CI++GRRVPE PY  + G+EVGPL++ + +  E   +   N      D  
Sbjct  60    KVVNHQWVEECIREGRRVPEAPYMSESGEEVGPLMIELPE--ETKVTKKVNKAADTFD--  115

Query  436   VEEYFPDPDIAKPKSRKK----MKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPEP  603
               +YF +   ++  S  +    M +  LK    +S+R          S R+ T+     P
Sbjct  116   --KYFGNGQESRTGSTSELATWMDSVLLKEKNTVSNRH---------SVRLRTKR----P  160

Query  604   AVFLKPKKGSMGLPETSLKRRRLVKKNISDVLEISDSEELSPQIRTLPEHESAMQSNSAN  783
             +   + K+ +     +   +RRLVKK                  R L +    ++S+   
Sbjct  161   SNIFEDKENTSVAESSGKGKRRLVKKR---------------SYRNLID----LESDDDC  201

Query  784   IGRHDHTSNNSQTTRISCPEDHTNGIEVPGDTE--------EVLNVTIGETLENE-----  924
             +   D   N +Q  R    E+    +  PG+T         E+ N  + E  E+E     
Sbjct  202   LDNSDENRNKTQDPREPNDENVREWVLEPGETSALPHTGGSEIQNWDVDEIEESEHWNHT  261

Query  925   GALASPFKSPLEQRRIVDV------DQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPC  1086
                  P  S  E++   D       D +E+E       S  +SC+ICWT+FSS+RG+LPC
Sbjct  262   AVFKRPKTSSAERKPQDDELNFDKPDSREEETEASKMVSAQVSCIICWTEFSSTRGILPC  321

Query  1087  GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQ-DRPG  1263
             GHRFC+SCIQ+W D++VS  K +TCPLCK  F +ITK+ DA  SDQ IYSQT+P      
Sbjct  322   GHRFCYSCIQTWVDRLVSERKKTTCPLCKSSFITITKIEDAGSSDQNIYSQTVPDPSSTN  381

Query  1264  TDIYLLPDGETSHFPANP-AMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPW  1440
               + +LP+ +   F  NP +    C +C   EPE+LLI CH+C  R IH YCLDP L PW
Sbjct  382   NTLVVLPEEDRQGF--NPLSRASACSRCYLSEPEDLLIRCHLCNLRRIHTYCLDPYLVPW  439

Query  1441  TCIHCQD----YQRR  1473
             TC HC D    YQRR
Sbjct  440   TCNHCNDLQMLYQRR  454



>emb|CDY54118.1| BnaC02g45430D [Brassica napus]
Length=431

 Score =   308 bits (790),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 184/467 (39%), Positives = 248/467 (53%), Gaps = 47/467 (10%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME VVATVSGY G+ERF LIKLI+ +G +YVGAMS SITHLVCW+FEG+K+ LA K  NT
Sbjct  1     MENVVATVSGYHGSERFKLIKLISLSGASYVGAMSRSITHLVCWKFEGKKYHLANKF-NT  59

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNI-TQVGEGNQSSGCNHKEPQIDT  432
              +VNH+W+E CI++GRRV E PYT + G+EVGPL++ +    GE   +   N+     D 
Sbjct  60    IVVNHQWVEACIREGRRVSEAPYTFESGEEVGPLMVELPADSGEAKVTKKANNPADTFD-  118

Query  433   EVEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPEPAVF  612
                +YF + +    +SR+  +   L    +     +    S   S R+ T+     P+  
Sbjct  119   ---KYFSNGE----ESRRSRRTSELSTWMDSVLLKEKNTESTRHSVRLRTK----RPSNI  167

Query  613   LKPKKGSMGLPETSLKRRRLVKKNISDVLEISDSEELSPQIRTLPEHESAMQSNSANIGR  792
              + K+ +  + E+S K +R  ++   D  E++D                       N+  
Sbjct  168   FEDKEYTC-VAESSRKGKRRQQRKSQDPRELNDE----------------------NV--  202

Query  793   HDHTSNNSQTTRISCPEDHTNGIEVPGDTEEVLNVTIGETLENEGALASPFKSPLEQRRI  972
              D      +T+    P D T       + EE       E   +      P     E+   
Sbjct  203   EDCVLEQGETSAREHPRDSTTQDWAADEIEE------SENWNHSAVFKRPRSINAEKSNF  256

Query  973   VDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKT  1152
                D +E+E       S  +SCVICWT FSS+RG+LPCGHRFC+SCIQ W D++VS  K 
Sbjct  257   NKPDSREEETEATKMVSAQVSCVICWTGFSSTRGILPCGHRFCYSCIQQWVDRLVSERKK  316

Query  1153  STCPLCKVGFTSITKVADAEPSDQKIYSQTIPQ-DRPGTDIYLLPDGETSHFPANP-AMP  1326
             +TCPLCK  F +ITK+ DA  SDQKIYSQT+P        + +LP+        NP    
Sbjct  317   TTCPLCKFSFVTITKIEDAGSSDQKIYSQTVPDPSSTNNSLVVLPEEGEERQGFNPLTRA  376

Query  1327  PVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQ  1467
               C +CS  EP +LLI CH+C  R IH YCLDP L PWTC HC D Q
Sbjct  377   SACGRCSLSEPVDLLIRCHICNFRRIHTYCLDPYLVPWTCNHCNDLQ  423



>ref|XP_010100918.1| BRCT domain-containing protein [Morus notabilis]
 gb|EXB85842.1| BRCT domain-containing protein [Morus notabilis]
Length=565

 Score =   312 bits (800),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 214/569 (38%), Positives = 284/569 (50%), Gaps = 109/569 (19%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GM+ V+ATVSGY G ER NL+KLI+ AG +YVGAMS SITHLVCW+FEGRK+ +A  S
Sbjct  11    IEGMKSVIATVSGYHGIERLNLVKLISHAGASYVGAMSSSITHLVCWKFEGRKYGIAMNS  70

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQV--------------GE  384
               T +VNHRWIEDCIK+G+RVPE PYT +CGQEVGPLL  + QV               +
Sbjct  71    E-TIVVNHRWIEDCIKQGKRVPERPYTFKCGQEVGPLLSEVPQVPKVGASVKKQKVLYDK  129

Query  385   GNQSSGCNHKEPQIDTEVEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDS----  552
              N   G   K   +  E        D+   +S   + N++L CD N      H       
Sbjct  130   SNTCYGSEKKRGYMGVEAS-----GDVVCNRS---LLNQTLFCDVNKVGNSSHKSKDELV  181

Query  553   -SMSGS-------WRMETEELSPEPAVFLKPKKGSM------GLPETSLKRRRLVKK---  681
              S SG         +   E  S   ++ L  +KG +        PETS +RRRLVKK   
Sbjct  182   KSTSGQEHPISRPLKNPHEGTSSHASLELVRRKGKIINNNGSNEPETSRRRRRLVKKSTH  241

Query  682   -NISDVLEISDSEELSP-QIRTLPEHES---AMQSNSANIGRHDHTSNNSQTT---RISC  837
              +I D+     +++  P ++  L ++      + SN  +     + S+N + +     + 
Sbjct  242   SDILDLFPSGSNQDCYPIEVDNLNQNNEDVVVLLSNPLDAAMCANVSDNGRPSIDGFFNP  301

Query  838   PEDHTNGIE-VPGDTEEVLNVTIGET------------LEN--EGALASPFKSPLEQRRI  972
              E    G++ V  D       ++               LEN  E   +    S  E  + 
Sbjct  302   KESRNKGLDSVEADVPSRFCASMDPNEPDVHAENGLMDLENTSEDGCSDAENSKEETTKG  361

Query  973   VDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKT  1152
             +++  K D     +P+S  LSCVIC TDFSS+RG+LPCGHRFC+SCI+SWAD M  + K 
Sbjct  362   LEI--KHDST---IPSSTELSCVICLTDFSSTRGVLPCGHRFCYSCIESWADHMALKRKI  416

Query  1153  STCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPA----NPA  1320
             STCPLCK  F SI K  D     QKIYSQTIP      D+++L D ET++  A    + A
Sbjct  417   STCPLCKESFASIIKFEDTATDGQKIYSQTIPCGLSMMDMFILHDQETANMTAQSHVSEA  476

Query  1321  M---------------------------------PPVCCQCSSREPEELLINCHVCQTRC  1401
             M                                   VC  C   EP +LLI C+VCQ R 
Sbjct  477   MFNYILIHMEDLNFLFRCLILFLSQSDEVEQHDSATVCSVCRRLEPVDLLIICNVCQIRR  536

Query  1402  IHAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
             IH+YCLDPP+ PWTCI C+D QR     R
Sbjct  537   IHSYCLDPPVDPWTCIDCKDLQRLLPLSR  565



>ref|XP_006659394.1| PREDICTED: uncharacterized protein LOC102704439 [Oryza brachyantha]
Length=532

 Score =   308 bits (790),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 189/533 (35%), Positives = 288/533 (54%), Gaps = 63/533 (12%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             V GM  VVATVSGY G ER  L+KLIA+ G +YVGAMS SITHLVCWR EG+K+++A++ 
Sbjct  4     VEGMRDVVATVSGYHGDERHRLVKLIAETGASYVGAMSRSITHLVCWRLEGKKYDIARRL  63

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPL-----------------------  357
             R T +V+HRW EDC+++G+R+PE PY ++ G+E GP+                       
Sbjct  64    R-TRVVSHRWFEDCLREGKRLPEKPYIMESGEEAGPVPEVPTFPCGRSKRDASMKNRCLK  122

Query  358   -----LMNITQVGE----GNQSSGCNHKEPQIDTEVEE-YFPDPDIAK------PKSRKK  489
                    N +   +     +  S C H      + ++E  F   + +K       + RK+
Sbjct  123   ELPDDFCNTSYATDVLRVADSGSDCEHHGWSDSSLLKENVFVGGENSKIGATHAKERRKR  182

Query  490   MKNRSLKCDRNLSSRFDHYDSSMSGSWRMETE--------ELSPEPAVFLKPKKGSMGLP  645
             +K+     + ++    D+  + M+   R E+         E   + + FL     +M   
Sbjct  183   LKHAQKSTNEDVLEPEDNISNLMARKGRHESSFTSSRSRSEQKGDLSRFLHNDDANMMAK  242

Query  646   ETSLKRRRLVKKNISDVLEISDSEELSPQIRTLPEHESAMQSNSANIGRHDHTSNNSQTT  825
               SL ++  + K+   ++E  ++E L+    + PE   +  +      R    S++ + +
Sbjct  243   RNSLMKKESITKHAGYLVESCENEILADSF-SEPEMLDSPSTEDRRKIRKTRLSSSFRQS  301

Query  826   RISCPEDHTNGIE-VPGDTEEVLNVTIGETLENEGALASPFKSPL----EQRRIVDVDQK  990
              +    D+   IE  P  + +  +  +GE+  +    +S  + P     E+     +D +
Sbjct  302   TLDSIYDYGEAIEHDPEKSADQESFELGESPRSFQPSSSSRQEPAFCTEEKANQSGIDDE  361

Query  991   EDENCVKLPTSPA-------LSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGK  1149
             + ++       PA       LSCVICWTDFSS+RG+LPCGHRFC+SCI  WAD + SRGK
Sbjct  362   KGDDGKPPLEKPASCQGQAELSCVICWTDFSSTRGILPCGHRFCYSCIHGWADCLSSRGK  421

Query  1150  TSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPP  1329
              +TCPLCK  FT I+K+ +A  SDQKIYSQTIP     +D ++  D  T   P +P+   
Sbjct  422   VATCPLCKTSFTWISKIDEAGTSDQKIYSQTIPF-LTSSDTFMF-DDRTYGNPESPSGQG  479

Query  1330  VCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
              C QC  REPEELL++CHVC+++ +H+YCLDPPL PWTCIHC+D++  ++ YR
Sbjct  480   ACYQCHCREPEELLLSCHVCRSQWVHSYCLDPPLTPWTCIHCRDHRMLYQRYR  532



>ref|NP_001061801.1| Os08g0414200 [Oryza sativa Japonica Group]
 dbj|BAC99707.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23715.1| Os08g0414200 [Oryza sativa Japonica Group]
 gb|EEE68680.1| hypothetical protein OsJ_27307 [Oryza sativa Japonica Group]
Length=531

 Score =   306 bits (784),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 199/540 (37%), Positives = 280/540 (52%), Gaps = 78/540 (14%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             V GM  VVATVSGY G ER  L++LIA+ G +YVGAMS SITHLVCWR EG+K+++A++ 
Sbjct  4     VEGMRDVVATVSGYHGDERHRLVRLIAETGASYVGAMSRSITHLVCWRLEGKKYDIARRL  63

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQ----------------------------CGQ  342
             R T +V+HRW EDC+K+GRR+PE PY ++                            C +
Sbjct  64    R-TRVVSHRWFEDCLKEGRRLPEKPYMLESGEEAGPVPELPTFPRSRSKRNASMEDRCLK  122

Query  343   EVGPLLMNITQVGE----GNQSSGCNHKEPQIDTEVEEYF-PDPDIAK------PKSRKK  489
             E+     N +   +     +  S CNH+     + ++E F  D D +K       + RK+
Sbjct  123   ELPDDFCNTSYATDVLVVADSGSDCNHQRWSDSSLLKENFVGDRDNSKIGATHVKERRKR  182

Query  490   MKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPEPAV--------FLKPKKGSMGLP  645
             +K+     + +     D+    M+   R E+   S   A          L     SM   
Sbjct  183   LKHAQNSTNEDALDAEDNISRLMARQGRYESSYTSSRSASNQKGDLLKLLHNDDASMMRK  242

Query  646   ETSLKRRRLVKKNISDVLEISDSEELS-----PQIRTLPEHESAMQSNSANIGRHDHTSN  810
               SL ++    K    ++E  ++  L+     PQ+   P  E   +     +        
Sbjct  243   RNSLMKKETRTKLAGYLIESCENGSLTDSFDEPQMSDTPPTEDRRKIRKTRL--------  294

Query  811   NSQTTRISCPEDHTNGIEVPGDTEEVLNVTIGETLENEGALASPFKSPL------EQRRI  972
               Q+T  S  +        P  +E+  N  +GE+  +  +  S  + P        Q  I
Sbjct  295   -RQSTLDSIYDYGEASEHDPEKSEDQENFELGESSRSFQSSDSSRQEPAFCTEKTNQGSI  353

Query  973   ---VDVDQKEDENC-VKLPTS----PALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWAD  1128
                 D D+ +DE   ++ PTS      LSCVICWTDFSS+RG+LPCGHRFC+SCIQ WAD
Sbjct  354   DIAADDDKGDDEKATLEEPTSCQGQAELSCVICWTDFSSTRGILPCGHRFCYSCIQEWAD  413

Query  1129  QMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFP  1308
              + SRGK STCPLCK  F  I+K+ +A  SDQKIYSQTIP     TD ++  D      P
Sbjct  414   SLSSRGKVSTCPLCKTSFAWISKIDEAGTSDQKIYSQTIPCS-TSTDTFIF-DDRVYGLP  471

Query  1309  ANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
              +P+    C QC  REPEELL++CHVC+++ +H+YCLDPPL PWTCIHC+D +  ++ YR
Sbjct  472   ESPSGQGACYQCHCREPEELLLSCHVCRSQWVHSYCLDPPLTPWTCIHCRDLRMLYQRYR  531



>ref|XP_011099302.1| PREDICTED: uncharacterized protein LOC105177754 isoform X3 [Sesamum 
indicum]
Length=462

 Score =   304 bits (778),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 201/452 (44%), Positives = 265/452 (59%), Gaps = 40/452 (9%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GME ++ATVSGY G ERFNLI+LI++ G +YVG+M+ S+THLVCW+FEGRK+ELAKK 
Sbjct  9     LKGMESILATVSGYHGAERFNLIRLISRTGASYVGSMNQSVTHLVCWKFEGRKYELAKKL  68

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQ------CGQEVGPLLMNITQVGEGNQSSGC-  405
             +   IVNHRWIE+C+KKG+RV E PYT Q       G+E GPL +++ ++G    S+   
Sbjct  69    K-IKIVNHRWIEECVKKGKRVSEEPYTSQRYSELWNGEETGPLCLDV-RLGINPTSARSR  126

Query  406   ---NHKEPQIDTEVEEYF-------------PDPDIAKP-----KSRKKMKNRSLKCDRN  522
                N KEP ID E E  +             P P   +      +S +K   RSL+ D  
Sbjct  127   ALKNTKEPVIDIECEGIYDRAWTELLLFDEDPFPQQRQNGRRSNRSARKAIERSLRKDCP  186

Query  523   LSSRFDHYDSSMSGSWRMETEELSPE-PAVFLKPKKGSMGLPETSLKRRRLVKKNIS--D  693
              SSR+     + SG   ME EE S   PA   + +K +   PE+  K RRLVKK IS  D
Sbjct  187   SSSRY--CLETPSGPTVMELEEASTSLPAYSCRQRKRNSISPESQGKGRRLVKKRISMDD  244

Query  694   VLEISDSEELSPQIRTLPEHE-SAMQSNSANIGRHDHTSNNSQTTRISCPEDHTNGIEVP  870
              L  S+ EE   +   LPE+  S + S+S+++ R D    N + +   C     +  +  
Sbjct  245   WLLTSNVEEYK-EDNVLPENNFSRILSDSSDVER-DQGLPNGRISDARCFLSGQDDGDGC  302

Query  871   GDTEEVLNVTIGETLEN-EGALASPFKSPLEQRRIVDVDQKEDENCVKLPTSPALSCVIC  1047
                EE  +V  G    +   A +S  ++  E +   + D  + +   +LP S   SCVIC
Sbjct  303   DGLEENEDVNAGNLNPHIHVAQSSLLETSDELKVAANEDFIDVDPGSRLPASSEFSCVIC  362

Query  1048  WTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQK  1227
             WTDFSS+RG+LPCGHRFCFSCIQ+WAD M SR KTSTCPLCK  F  ITKV DA  SDQK
Sbjct  363   WTDFSSTRGVLPCGHRFCFSCIQNWADHMASRKKTSTCPLCKASFICITKVEDAVSSDQK  422

Query  1228  IYSQTIPQDRPGTDIYLLPDGETSHFPANPAM  1323
             IYSQ+IP D   TD+Y+LPD ET   P+N  +
Sbjct  423   IYSQSIPHDHSKTDLYILPD-ETCGPPSNATI  453



>ref|XP_010666051.1| PREDICTED: uncharacterized protein LOC104883257 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=511

 Score =   301 bits (771),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 196/545 (36%), Positives = 263/545 (48%), Gaps = 108/545 (20%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             V GM   V TV+GY G+ER  LIKLI+ AG NYVG ++ S THL+CW+F+G K+ELAKK 
Sbjct  2     VEGMNATVVTVTGYHGSERMKLIKLISLAGANYVGKITKSTTHLICWKFKGEKYELAKKF  61

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVG------PLLMNITQVGEGNQSSGCN  408
               T IVNH+W+EDCI +G+R+PE PYT+  GQEVG      P++     +   N+     
Sbjct  62    -GTKIVNHQWLEDCINEGKRIPEAPYTLLSGQEVGFNIPDHPVVRETVSILSENKRL---  117

Query  409   HKEPQIDTEVEEYFP-DPD-----------------IAKPKSRKKMKNRSLKCDRNLSSR  534
                P I   + +    D D                 + KP+SRK  + RS    R L+  
Sbjct  118   MNRPSIHDYLNDVIALDSDEIENDDWDDDPLLDENLVLKPRSRKSSQQRS---KRKLAKE  174

Query  535   FDHYDSSMSGSWRMETEELSPEPAVFL-------------KPKKGS------MGLPETSL  657
                 D  +    R+   E        L             K ++        + +PE+S 
Sbjct  175   TLE-DRRVKAGTRLVIHETQKTTVDGLQCGVSNYSHKCSTKQRRSDNVTGVWLDVPESSR  233

Query  658   KRRRLVKK----NISDVLEI----------------------SDSEELSPQIRTLPEHES  759
             K RRLV+K    NI+D+  I                      +DS++LS +I  +     
Sbjct  234   KSRRLVEKDAEPNITDIATIDAERQNRTHADDSELHVALSLSNDSDDLSTEIEAIISARL  293

Query  760   AMQSNSANIGRHDHTSNNSQTTRISCPEDHTNGIEVPG-DTEEV---LNVTIGETLENEG  927
                S      RH+    N     ++    H N +   G + EE+   ++ + G+ L  + 
Sbjct  294   DTISTVHGQSRHEVNPMNDLDPLLN-KSSHDNALNAKGRNVEEISPDVSNSNGDKLGRDQ  352

Query  928   ALASPFKSPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFS  1107
             + A                            S  LSCVICWT++SS RG+LPCGHRFCF 
Sbjct  353   STAD--------------------------ASIELSCVICWTEYSSVRGVLPCGHRFCFP  386

Query  1108  CIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPD  1287
             CIQ+WAD M S  K  TCPLCK  F S T+V  A   DQKIYSQTIP      DIY +P+
Sbjct  387   CIQNWADHMRSNRKEPTCPLCKAAFVSFTRVEAAATLDQKIYSQTIPFASSSQDIYFVPE  446

Query  1288  GETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQ  1467
             G T  F       PVCC C SR+P ++LI C VC +  IH+YCLDPPL PWTCI C+  +
Sbjct  447   GRTGFFDVEITPLPVCCYCQSRDPADMLIECRVCHSSRIHSYCLDPPLFPWTCIGCRHRR  506

Query  1468  RRFET  1482
               F +
Sbjct  507   VLFRS  511



>ref|XP_004145658.1| PREDICTED: uncharacterized protein LOC101213123 [Cucumis sativus]
Length=490

 Score =   300 bits (767),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 204/531 (38%), Positives = 261/531 (49%), Gaps = 109/531 (21%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME VV TVSGY GTERFNLIK+I+  G +YVGAMS SITHL+CW  +GRKF+LA+K R T
Sbjct  1     MESVVVTVSGYHGTERFNLIKMISYTGASYVGAMSRSITHLICWELQGRKFDLAEKFR-T  59

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPL-----------------------LMN  366
              IVNHRW+EDCIK G+RVPE PY +Q GQ +GPL                       L N
Sbjct  60    IIVNHRWLEDCIKHGKRVPEGPYILQSGQSIGPLSMKLPLADKGYVSAKKYNLLSEKLHN  119

Query  367   ITQVGEGNQSSGCNH------KEPQIDTEVEEYFPDPDIAKPKSRKKMKNRSLKCD--RN  522
                V + +    C+       +   +D ++   F   D    K + K++ R  K +   +
Sbjct  120   YGNVEDQSIKDICSFGDSILPRSSLLDKDLSSDFRKSDDTAHKRKHKVRKRISKLEDPSS  179

Query  523   LSSRFDHYDSSMSGSWRMETEELSPEPAVFLKPKKGSMGLPETSLK----RRRLVKKNIS  690
              SSR    + + +G + +E    SP  ++    +KG     ++++K    RR LV  N  
Sbjct  180   SSSRNRFEEPTSAGLFAIECG--SPS-SLARDERKGESSNQDSTVKSSRRRRLLVSNNSR  236

Query  691   DVLEISDSEELSPQIRTLPEHESAM----------QSNSANIGRHDHTSNNSQTTRISCP  840
             +     D     P++  L    S                 NIG    TS+  Q     C 
Sbjct  237   EDHNKPDISNFDPELYRLGTRNSLTVPSVLWDAETDIEVVNIG---GTSDREQL----CD  289

Query  841   EDHTNGIEVPG-----------DTE-------EVLNVTIGETLENEGALASPFKSPLEQR  966
             E     +   G           DT         VL++T  + L N   L    + P    
Sbjct  290   ERGLASVRFEGVEACENQSTSKDTNLLVDNAPRVLSITSEDELHNMNDLQKNIEDP----  345

Query  967   RIVDVDQKEDENCVKLP-TSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSR  1143
              ++++D         LP TS  LSCVICWTDFSS+RG+LPCGHRFC+SCIQ+WAD M   
Sbjct  346   -VIELD-------ASLPSTSTELSCVICWTDFSSTRGVLPCGHRFCYSCIQNWADHMALS  397

Query  1144  GKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAM  1323
              K STCPLCK  F SITKV  A  SDQKIYSQTIP      DIYLL D  T +       
Sbjct  398   RKISTCPLCKASFLSITKVEYAATSDQKIYSQTIPCGSSLLDIYLLSDERTLNNVVQ---  454

Query  1324  PPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRF  1476
                                H+CQ R IH+YCLDPPL PWTCIHC+D Q  +
Sbjct  455   -------------------HLCQIRQIHSYCLDPPLLPWTCIHCKDLQTLY  486



>gb|EPS69307.1| zinc finger family protein, partial [Genlisea aurea]
Length=405

 Score =   297 bits (760),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 177/468 (38%), Positives = 252/468 (54%), Gaps = 67/468 (14%)
 Frame = +1

Query  85    VVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNTFIV  264
             ++ TVSGY+G ERF LI+LIA  G  YVG M+ S+TH++CW+ +G+K+ LAK+ +   IV
Sbjct  1     MIVTVSGYRGFERFKLIRLIATTGAVYVGRMNRSVTHVICWKHQGKKYRLAKRLK-VAIV  59

Query  265   NHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQIDTEVEE  444
             NH WIE+C+K+G  VP  PYT + G+E+GPL  ++           C  +E         
Sbjct  60    NHHWIEECVKRGTIVPVEPYTFRSGEEIGPLSADVPL---------CMKQE---------  101

Query  445   YFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPEPAVFLKPK  624
                     KP+ +   K + L C R+                           + F + +
Sbjct  102   --------KPQPKPVKKAKKLSCSRH---------------------------SNFRRLR  126

Query  625   KGSMGLPETSLKRRRLVKKNISDVLEISDSEELSPQIRTLPEHESAMQSNSANIGRHDHT  804
             KG    PE   KRRRLVK N S++      +E   +   +    ++ + +S ++   D  
Sbjct  127   KGYSTPPEPQGKRRRLVK-NCSNLDNWLSRKEEHSEGVAISSKRNSHRVDSIDL---DMK  182

Query  805   SNNSQTTRISCPEDHTNGIEVPGDTEEVLNVTIGETLENEGALASPFKSPLEQRRIVDVD  984
                  + ++   E+ T+  +   D   V  + +G   EN    A    +P+     V   
Sbjct  183   GRVGTSKKLWLNENSTDENDSGHD---VKGIDVGYH-ENRATQAGDASTPVLTSEKVTQA  238

Query  985   QKEDENCVK----LPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKT  1152
               ED +       LP S   SCVIC TDFSS+RG+LPCGHRFCFSCIQSWAD   SR K 
Sbjct  239   ACEDLSTPGHDNFLPRSNQPSCVICLTDFSSTRGVLPCGHRFCFSCIQSWADHTASRNKL  298

Query  1153  STCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPV  1332
             STCPLCK  F  I+++     SDQKIYSQ++P+D    D ++LP+ +T   P + + PPV
Sbjct  299   STCPLCKASFICISRMEATVTSDQKIYSQSVPEDSARIDFFVLPE-QTCGPPISASAPPV  357

Query  1333  CCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRF  1476
             C +CSS+EPE+LLI C  CQ RC+H++CLDPPL PWTC HC+D +  +
Sbjct  358   CFRCSSKEPEDLLIRCQFCQIRCVHSFCLDPPLFPWTCNHCKDLRMLY  405



>ref|XP_009401325.1| PREDICTED: uncharacterized protein LOC103985377 [Musa acuminata 
subsp. malaccensis]
Length=493

 Score =   299 bits (765),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 187/501 (37%), Positives = 270/501 (54%), Gaps = 57/501 (11%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GME VVATVSGY GTERF LIKLIA+ G +Y GAM+ S THLVCW+FEG+K+++A+++
Sbjct  23    IQGMESVVATVSGYHGTERFKLIKLIAQTGASYTGAMTKSTTHLVCWQFEGKKYDMARRT  82

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQI  426
                 I++HRW EDC+K+ +R+PE PY  Q GQE G +   +                  +
Sbjct  83    -GAHIISHRWFEDCLKERKRLPEDPYAAQSGQETGTITWEMPAA---------------L  126

Query  427   DTEVEEYFPDPDIAKPKSRKKMKNRSLKCDRNL----SSRFDHYDSSMSGSWRMETEELS  594
             DT  +       I+  +        +L C RN+    +S  D  DS +    R    E S
Sbjct  127   DTSGK---GKTIISAERCMLSDNFSALNC-RNIVEIDASYLDWSDSQLLHKCR----ESS  178

Query  595   PEPAVFLKPKKGSM--GLPETSLK--RR--RLVKKNISDVLEI--------SDSEELSPQ  732
               P V    KK ++     + + K  RR  RL KK   ++L          +  ++ S Q
Sbjct  179   TFPKVCSSSKKRNLFDATQDVTCKPTRRSNRLKKKAYCNLLNYVSLGQKQGTSVKKFSSQ  238

Query  733   IRTLPEHESAMQSNSANIGRHDHTSNNSQTTRISCPEDHTNGIEV--PGDTEEVLNVTI-  903
             +  +    +   ++   +G    +S+  +TT     +   +GIE       EE+ N  I 
Sbjct  239   VEIIDLDSTCENTSRRRLG----SSSQGKTTDFMLSDHEGSGIEGLEQDGVEELRNDNIL  294

Query  904   ---GETLENEG-ALASPFKSPLEQRRIVDVDQKEDENCVKLPT--SPALSCVICWTDFSS  1065
                G   +NE            E  R  +   KE EN  +        LSCVICWT+FS+
Sbjct  295   SDNGIFSDNENFECIGKMLGSSENARNDNEHHKEGENLYEAGAYKQAELSCVICWTEFST  354

Query  1066  SRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTI  1245
             +R +LPCGHRFC+SCIQ W D + SRGK S+CPLCK  FTS+ K+  +  +DQKIYSQTI
Sbjct  355   TRAVLPCGHRFCYSCIQGWVDCLASRGKISSCPLCKSSFTSMRKMDTS--TDQKIYSQTI  412

Query  1246  PQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDP  1425
             P +    DI ++ +       A+  M PVC +C +REPE+LL+ C +CQ++ +H+YCLDP
Sbjct  413   PSESSNIDIIMVSNNGNDSARASMPMDPVCSECHNREPEDLLLCCCICQSQWVHSYCLDP  472

Query  1426  PLHPWTCIHCQDYQRRFETYR  1488
             P+ PWTCIHC+D +  ++ +R
Sbjct  473   PVSPWTCIHCRDLRTLYQRFR  493



>ref|XP_010913594.1| PREDICTED: uncharacterized protein LOC105039215 [Elaeis guineensis]
Length=529

 Score =   300 bits (768),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 203/534 (38%), Positives = 274/534 (51%), Gaps = 87/534 (16%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GME V+ TVSGY GTERF LIKLIA+ G ++VGAM  S THLVCWRFEG+K+ELA+  
Sbjct  23    IPGMESVIVTVSGYHGTERFKLIKLIAQTGASFVGAMGRSTTHLVCWRFEGKKYELARNI  82

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQV----------------  378
               +  +NH W E C+K+G+R+PE PYT+Q G E GP+   +  +                
Sbjct  83    -GSHSINHCWFEACLKEGKRLPEGPYTMQSGWEAGPISWEVPAILDTHGKEKCVVTRERN  141

Query  379   --GEGNQSSGCNHKEPQIDTEVEE----YFPDPDIAKPK-----SRKKMKNRSLKCDRNL  525
                + + +S C+ +  +ID    +    ++ D  + K         + M +++++  R  
Sbjct  142   VLSDQSHASNCS-RAAEIDARCFDVECLHWSDSHLLKENFFLTWDTEMMGSKNVRKIRKA  200

Query  526   SSRFDHYDSSMSGSWRMETEELSPEP----------------AVFLKPKKGSMGLPETSL  657
             S +     SS  G        L P+P                ++F   +    G P  + 
Sbjct  201   SKQ--GAKSSNKGHLGPPNIRLYPQPEESSSFSSLCSSRNKRSLFHSTQNDVTGEP--AH  256

Query  658   KRRRLVKKNIS-----DVLEISDSEELSPQIRTLPEHESAMQSNSANIGRHDHTSNNSQT  822
             + RRLVKKN S     DV  ISDS +           E  +  +S ++   D+  N +Q 
Sbjct  257   RSRRLVKKNASFNHLNDV--ISDSRQ-----------EHYLTESSGHLDLLDYEGNRTQG  303

Query  823   TR----ISCPEDHTNGIEVPGDTEEVLNVTIGET--------LENEGALASPFKSPLEQR  966
                   I  P DH    EVP  +     +   E            E   +S F    +Q+
Sbjct  304   LEQVEDIEGPRDHPLS-EVPESSRSCHALLEHEINSKDKHCQYTRENIDSSDFGMNHDQQ  362

Query  967   RIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRG  1146
                D +Q E  +  K      LSCVICWTDFSS RG+LPCGHRFC+ CI  WAD M SRG
Sbjct  363   SKED-NQSESGSVCK---QAELSCVICWTDFSSIRGVLPCGHRFCYLCILGWADCMASRG  418

Query  1147  KTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMP  1326
             K STCPLCK  FTSI K+    P DQKIYSQTIP     TD+ L   G  +     P   
Sbjct  419   KISTCPLCKASFTSIRKMEAGSP-DQKIYSQTIPCGSSNTDLTLFDKGNYNLETWTPDF-  476

Query  1327  PVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
              VC QC +REPE+LLI+CH+CQT  +H+ CLDPPL PWTCIHC+D +  ++ +R
Sbjct  477   -VCYQCHNREPEDLLISCHICQTHWVHSCCLDPPLVPWTCIHCRDLRMLYQRFR  529



>ref|NP_001148993.1| ubiquitin-protein ligase/ zinc ion binding protein [Zea mays]
 gb|ACG33745.1| ubiquitin-protein ligase/ zinc ion binding protein [Zea mays]
 gb|ACN35591.1| unknown [Zea mays]
 gb|AFW62167.1| Ubiquitin-protein ligase/ zinc ion binding protein [Zea mays]
Length=500

 Score =   298 bits (764),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 197/520 (38%), Positives = 278/520 (53%), Gaps = 68/520 (13%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GM  VVATVSGY G ER  L+ LIA+ G +YVG+MS SITHLVCWR EG+K+++A++ 
Sbjct  3     IDGMRSVVATVSGYHGDERHRLVNLIAETGASYVGSMSRSITHLVCWRLEGKKYDIARR-  61

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPL---------------LM------  363
               T +V+H W  +C+++GRR+PE PY +  G+E GP+               +M      
Sbjct  62    LGTRVVSHWWFTECLREGRRLPEDPYFMVSGEEAGPVPELPSRSRKQVKKNAIMEDRVFQ  121

Query  364   ----NITQVGEGNQSSGCNHKEPQIDTE---VEEYFPDPDIAKPKSRKKMKNRSLKCDRN  522
                 +         S      +   D E   +E+    PD+ K   RK+MK+ +   DR+
Sbjct  122   ELPDDFWDTPRARASYKVKLDDSDSDFESALLEQKNHSPDVKK--RRKRMKHVNTSTDRD  179

Query  523   LSSRFDHYDSSMSGSWRMETEELSPEPAVFLKPKKGSMG------LPETSLKRRRLVKKN  684
             + +  D+  S M+   R      S   +      KG++       +P    +R  L + +
Sbjct  180   VLNLQDNVSSVMA---RQCLHISSHRTSQSTSKHKGNLSHLLHNEVPIRMGERNNLTENS  236

Query  685   ISDVLEISDSEELSPQIRTLPEHESAMQSNSANIGRHDHTSNNSQTTRISCPEDHTNGIE  864
              +D L  S SE   PQ       E+  +S++        +S+  Q+T  S  E       
Sbjct  237   ENDSLSDSFSE---PQTSDTLCIEAQRKSSAP-------SSSLRQSTLDSLYEFGETSRH  286

Query  865   VPGDTEEVLNVTIGET----LENEGALASPFKSPLEQRRIVD-------VDQKEDENCVK  1011
              P   +++ NV + ET    L  + +   P     EQ   VD        D+K  E    
Sbjct  287   EPAGRKKLDNVELRETSRSLLPFDLSGQEPAFCTQEQ---VDKCSLGTLADKKPMEKSSN  343

Query  1012  LPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSI  1191
             +   P LSCVICWTDFSS+RG+LPCGHRFC+SCIQ W D + SRGK STCPLCK  FT I
Sbjct  344   MERQPELSCVICWTDFSSTRGILPCGHRFCYSCIQGWVDCLASRGKVSTCPLCKASFTCI  403

Query  1192  TKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANP-AMPPVCCQCSSREPEEL  1368
             +KV +A  SDQKIYSQTIP +   TD+++   G   +  + P +    C QC  REPEEL
Sbjct  404   SKVDEAGTSDQKIYSQTIPCE-ASTDVFV--SGNVGYDFSRPTSGQGACYQCHFREPEEL  460

Query  1369  LINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
             L++CHVC+++ +H+YCLDPPL PWTC+HC+D +  F  YR
Sbjct  461   LLSCHVCRSQWVHSYCLDPPLTPWTCMHCRDLRMLFHRYR  500



>ref|XP_008667743.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=500

 Score =   296 bits (757),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 194/523 (37%), Positives = 271/523 (52%), Gaps = 74/523 (14%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GM  VVATVSGY G ER  L+ LIA+ G +YVG+MS SITHLVCWR EG+K+++A++ 
Sbjct  3     IDGMVSVVATVSGYHGDERHRLVNLIAETGASYVGSMSRSITHLVCWRLEGKKYDIARR-  61

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQI  426
               T +V+H W  +C+++GRR+P   Y +  G+E GP+    T+     + S     E ++
Sbjct  62    LGTLVVSHWWFTECLREGRRLPVDSYLMVSGEEAGPVPELPTRSRTQGKKSAI--MEDRV  119

Query  427   DTEVEEYFPDPDIAKP-------------------KSRKKMKNRSLKCDRNLSSRFDHYD  549
               E+ + F D  +A+                    K RK+MK+ +   DRN+ +  D+  
Sbjct  120   FQELPDDFWDTPLARTSYKNSVGDGDSKKNRSSDVKKRKRMKHVNTSTDRNVLNSQDNVS  179

Query  550   SSMSGSWRMETEELSPEPAVFLKPKKGSMGLPETSLK---RRRLVKKNISDVLEISDSEE  720
             S M   +   +   + +     K     +   E  ++   R  L +   +D L  S SE 
Sbjct  180   SVMERHFLHLSSHTTSKSTSKQKENLSHLLHNEVPIRMGERNDLTENFENDSLSDSFSE-  238

Query  721   LSPQI-------------RTLPEHESAMQSNSANI------GRHDHTSNNSQ-------T  822
               PQI             +T     S  QS   ++       RH+      Q       T
Sbjct  239   --PQISDTLCVEAQRKFTKTSAPSSSLRQSTMDSLYEFGETSRHEPAGKKEQDNVELRKT  296

Query  823   TRISCPEDHTNGIEVPGDTEE-VLNVTIGETLENEGALASPFKSPLEQRRIVDVDQKEDE  999
             +R   P D  +G E P  T+E V   + G   ++E                +  D K  E
Sbjct  297   SRSFLPFD-MSGQEPPFCTQEQVDKCSFGTLADDE----------------MGYDNKPME  339

Query  1000  NCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVG  1179
                 L     LSCVICWTDFSS+RG+LPCGHRFC+SCIQ W+D + SRGK STCPLCK  
Sbjct  340   KSSNLERQTELSCVICWTDFSSTRGILPCGHRFCYSCIQGWSDCLASRGKVSTCPLCKAS  399

Query  1180  FTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREP  1359
             FT I+KV +A   DQK+YSQTIP +   TD+++L   E   F    +    C QC  REP
Sbjct  400   FTWISKVDEAGTLDQKVYSQTIPCE-ASTDVFVL-GSEGYDFSGPTSGQGACYQCHFREP  457

Query  1360  EELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
             EELL++CHVC++  +H+YCLDPPL PWTC+HC+D +  F  YR
Sbjct  458   EELLLSCHVCRSLWVHSYCLDPPLTPWTCMHCRDLRVLFHRYR  500



>gb|ACG44968.1| ubiquitin-protein ligase/ zinc ion binding protein [Zea mays]
 tpg|DAA49112.1| TPA: ubiquitin-protein ligase/ zinc ion binding protein [Zea 
mays]
Length=473

 Score =   291 bits (744),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 184/494 (37%), Positives = 262/494 (53%), Gaps = 43/494 (9%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GM  VVATVSGY G ER  L+ LIA+ G +YVG+MS SITHLVCWR EG+K+++A++ 
Sbjct  3     IDGMVSVVATVSGYHGDERHRLVNLIAETGASYVGSMSRSITHLVCWRLEGKKYDIARR-  61

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQI  426
               T +V+H W  +C+++GRR+P   Y +  G+E GP+    T+     + S     E ++
Sbjct  62    LGTLVVSHWWFTECLREGRRLPVDSYLMVSGEEAGPVPELPTRSRTQGKKSAI--MEDRV  119

Query  427   DTEVEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPEPA  606
               E+ + F D  +A+   + K  +     +  L     H+   +S     ++     E  
Sbjct  120   FQELPDDFWDTPLARTSYKVKFDDSDSDFESALLKEERHF-LHLSSHTTSKSTSKQKENL  178

Query  607   VFLKPKKGSMGLPETSLKRRRLVKKNISDVL---EISDSEELSPQ---IRTLPEHESAMQ  768
               L   +  + + E +         ++SD     +ISD+  +  Q    +T     S  Q
Sbjct  179   SHLLHNEVPIRMGERNDLTENFENDSLSDSFSEPQISDTLCVEAQRKFTKTSAPSSSLRQ  238

Query  769   SNSANI------GRHDHTSNNSQ-------TTRISCPEDHTNGIEVPGDTEE-VLNVTIG  906
             S   ++       RH+      Q       T+R   P D  +G E P  T+E V   + G
Sbjct  239   STMDSLYEFGETSRHEPAGKKEQDNVELRKTSRSFLPFD-MSGQEPPFCTQEQVDKCSFG  297

Query  907   ETLENEGALASPFKSPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPC  1086
                ++E                +  D K  E    L     LSCVICWTDFSS+RG+LPC
Sbjct  298   TLADDE----------------MGYDNKPMEKSSNLERQTELSCVICWTDFSSTRGILPC  341

Query  1087  GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGT  1266
             GHRFC+SCIQ W+D + SRGK STCPLCK  FT I+KV +A   DQK+YSQTIP +   T
Sbjct  342   GHRFCYSCIQGWSDCLASRGKVSTCPLCKASFTWISKVDEAGTLDQKVYSQTIPCE-AST  400

Query  1267  DIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTC  1446
             D+++L   E   F    +    C QC  REPEELL++CHVC++  +H+YCLDPPL PWTC
Sbjct  401   DVFVL-GSEGYDFSGPTSGQGACYQCHFREPEELLLSCHVCRSLWVHSYCLDPPLTPWTC  459

Query  1447  IHCQDYQRRFETYR  1488
             +HC+D +  F  YR
Sbjct  460   MHCRDLRVLFHRYR  473



>gb|KFK41119.1| hypothetical protein AALP_AA2G088200 [Arabis alpina]
Length=456

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 183/481 (38%), Positives = 258/481 (54%), Gaps = 44/481 (9%)
 Frame = +1

Query  76    MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
             ME VVATVSGY   ERF LIKLI+ +G +YVGAMS SITHLVCW+FEG+K+ +A K   T
Sbjct  1     MENVVATVSGYHDPERFKLIKLISHSGASYVGAMSKSITHLVCWKFEGKKYSIANK-LGT  59

Query  256   FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQIDTE  435
              +VNH+W+E+CI++GRRV E PY  + G++VGPL++ +  V E          E ++  +
Sbjct  60    KVVNHQWVEECIREGRRVSEAPYMFESGEKVGPLMIELPAVSE----------EARVTKK  109

Query  436   VEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEE-----LSPE  600
             V            K+ +   N       + S  F   DS +     +E         S  
Sbjct  110   VN-----------KAAETFDNGEGNIRGSTSELFTWMDSVLLKEKNIEPNRHSVRLRSKR  158

Query  601   PAVFLKPKKGSMGLPETSLK-RRRLVK----KNISDVLEISDSEELSPQIRTLPEHESAM  765
             P+   + K+ ++   E+S K +RRLVK    +N+ D LE  D  ++S + R   + +   
Sbjct  159   PSNIFEDKENTVA--ESSGKGKRRLVKQRSCRNLVD-LESDDYHDISDEQRR--KAQDTR  213

Query  766   QSNSANIGRHDHTSNNSQTTRISCPEDHTNGIEVPGDTEEVLNVTIGETLENEGALASPF  945
               + AN G+ D      +T+ +    D+        + EE  N +     +     ++  
Sbjct  214   GPDDAN-GK-DCVLERGETSALRHHRDYATQNWDVDEIEEPENWSPPAFFKPPRPDSTVR  271

Query  946   KSPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWA  1125
             K   ++  I + D + +        S  +SC+ICWTDF+S+RG L CGH FC+SCIQ W 
Sbjct  272   KLQDDRLNISNPDSRREATEAIEEVSAQVSCIICWTDFNSTRGRLSCGHMFCYSCIQKWV  331

Query  1126  DQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHF  1305
             D +VS  K +TCPLCK  F +ITK+ DA  SDQKIYSQ +P      +I ++   E    
Sbjct  332   DHLVSERKKTTCPLCKSSFIAITKIEDAGSSDQKIYSQRVPDPSSTNNILVVLPEEEERQ  391

Query  1306  PANP-AMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQD----YQR  1470
               NP +    C +C   EPE+LLI CH+C  R IH+YCLDP L PWTC HC D    YQR
Sbjct  392   AFNPQSRASACSRCYVSEPEDLLIRCHLCNFRRIHSYCLDPYLVPWTCKHCNDLQMLYQR  451

Query  1471  R  1473
             R
Sbjct  452   R  452



>ref|XP_008667741.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACR38368.1| unknown [Zea mays]
 tpg|DAA49111.1| TPA: hypothetical protein ZEAMMB73_965281 [Zea mays]
Length=517

 Score =   280 bits (716),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 190/540 (35%), Positives = 276/540 (51%), Gaps = 91/540 (17%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GM  VVATVSGY G ER  L+ LIA+ G +YVG+MS SITHLVCWR EG+K+++A++ 
Sbjct  3     IDGMVSVVATVSGYHGDERHRLVNLIAETGASYVGSMSRSITHLVCWRLEGKKYDIARR-  61

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQI  426
               T +V+H W  +C+++GRR+P   Y +  G+E GP+    T+     + S     E ++
Sbjct  62    LGTLVVSHWWFTECLREGRRLPVDSYLMVSGEEAGPVPELPTRSRTQGKKSAI--MEDRV  119

Query  427   DTEVEEYFPDPDIAKP------------------------------------KSRKKMKN  498
               E+ + F D  +A+                                     K RK+MK+
Sbjct  120   FQELPDDFWDTPLARTSYKVKFDDSDSDFESALLKENSVGDGDSKKNRSSDVKKRKRMKH  179

Query  499   RSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPEPAVFLKPKKGSMGLPETSLK---RRR  669
              +   DRN+ +  D+  S M   +   +   + +     K     +   E  ++   R  
Sbjct  180   VNTSTDRNVLNSQDNVSSVMERHFLHLSSHTTSKSTSKQKENLSHLLHNEVPIRMGERND  239

Query  670   LVKKNISDVLEISDSEELSPQI-------------RTLPEHESAMQSNSANI------GR  792
             L +   +D L  S SE   PQI             +T     S  QS   ++       R
Sbjct  240   LTENFENDSLSDSFSE---PQISDTLCVEAQRKFTKTSAPSSSLRQSTMDSLYEFGETSR  296

Query  793   HDHTSNNSQ-------TTRISCPEDHTNGIEVPGDT-EEVLNVTIGETLENEGALASPFK  948
             H+      Q       T+R   P D  +G E P  T E+V   + G   ++E    +   
Sbjct  297   HEPAGKKEQDNVELRKTSRSFLPFD-MSGQEPPFCTQEQVDKCSFGTLADDEMGYDN---  352

Query  949   SPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWAD  1128
              P+E+    +++++ + +CV           ICWTDFSS+RG+LPCGHRFC+SCIQ W+D
Sbjct  353   KPMEKSS--NLERQTELSCV-----------ICWTDFSSTRGILPCGHRFCYSCIQGWSD  399

Query  1129  QMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFP  1308
              + SRGK STCPLCK  FT I+KV +A   DQK+YSQTIP +   TD+++L   E   F 
Sbjct  400   CLASRGKVSTCPLCKASFTWISKVDEAGTLDQKVYSQTIPCE-ASTDVFVL-GSEGYDFS  457

Query  1309  ANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
                +    C QC  REPEELL++CHVC++  +H+YCLDPPL PWTC+HC+D +  F  YR
Sbjct  458   GPTSGQGACYQCHFREPEELLLSCHVCRSLWVHSYCLDPPLTPWTCMHCRDLRVLFHRYR  517



>gb|KFK41118.1| hypothetical protein AALP_AA2G088200 [Arabis alpina]
Length=511

 Score =   274 bits (700),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 177/477 (37%), Positives = 253/477 (53%), Gaps = 44/477 (9%)
 Frame = +1

Query  88    VATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNTFIVN  267
             +  VSGY   ERF LIKLI+ +G +YVGAMS SITHLVCW+FEG+K+ +A K   T +VN
Sbjct  60    IRPVSGYHDPERFKLIKLISHSGASYVGAMSKSITHLVCWKFEGKKYSIANK-LGTKVVN  118

Query  268   HRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQIDTEVEEY  447
             H+W+E+CI++GRRV E PY  + G++VGPL++ +  V E          E ++  +V   
Sbjct  119   HQWVEECIREGRRVSEAPYMFESGEKVGPLMIELPAVSE----------EARVTKKVN--  166

Query  448   FPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEE-----LSPEPAVF  612
                      K+ +   N       + S  F   DS +     +E         S  P+  
Sbjct  167   ---------KAAETFDNGEGNIRGSTSELFTWMDSVLLKEKNIEPNRHSVRLRSKRPSNI  217

Query  613   LKPKKGSMGLPETSLK-RRRLVK----KNISDVLEISDSEELSPQIRTLPEHESAMQSNS  777
              + K+ ++   E+S K +RRLVK    +N+ D LE  D  ++S + R   + +     + 
Sbjct  218   FEDKENTVA--ESSGKGKRRLVKQRSCRNLVD-LESDDYHDISDEQRR--KAQDTRGPDD  272

Query  778   ANIGRHDHTSNNSQTTRISCPEDHTNGIEVPGDTEEVLNVTIGETLENEGALASPFKSPL  957
             AN G+ D      +T+ +    D+        + EE  N +     +     ++  K   
Sbjct  273   AN-GK-DCVLERGETSALRHHRDYATQNWDVDEIEEPENWSPPAFFKPPRPDSTVRKLQD  330

Query  958   EQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMV  1137
             ++  I + D + +        S  +SC+ICWTDF+S+RG L CGH FC+SCIQ W D +V
Sbjct  331   DRLNISNPDSRREATEAIEEVSAQVSCIICWTDFNSTRGRLSCGHMFCYSCIQKWVDHLV  390

Query  1138  SRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANP  1317
             S  K +TCPLCK  F +ITK+ DA  SDQKIYSQ +P      +I ++   E      NP
Sbjct  391   SERKKTTCPLCKSSFIAITKIEDAGSSDQKIYSQRVPDPSSTNNILVVLPEEEERQAFNP  450

Query  1318  -AMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQD----YQRR  1473
              +    C +C   EPE+LLI CH+C  R IH+YCLDP L PWTC HC D    YQRR
Sbjct  451   QSRASACSRCYVSEPEDLLIRCHLCNFRRIHSYCLDPYLVPWTCKHCNDLQMLYQRR  507



>ref|XP_011099303.1| PREDICTED: uncharacterized protein LOC105177754 isoform X4 [Sesamum 
indicum]
Length=448

 Score =   266 bits (680),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 191/503 (38%), Positives = 258/503 (51%), Gaps = 100/503 (20%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GME ++ATVSGY G ERFNLI+LI++ G +YVG+M+ S+THLVCW+FEGRK+ELAKK 
Sbjct  9     LKGMESILATVSGYHGAERFNLIRLISRTGASYVGSMNQSVTHLVCWKFEGRKYELAKKL  68

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQ------CGQEVGPLLMNITQVGEGNQSSGC-  405
             +   IVNHRWIE+C+KKG+RV E PYT Q       G+E GPL +++ ++G    S+   
Sbjct  69    K-IKIVNHRWIEECVKKGKRVSEEPYTSQRYSELWNGEETGPLCLDV-RLGINPTSARSR  126

Query  406   ---NHKEPQIDTEVEEYF-------------PDPDIAKP-----KSRKKMKNRSLKCDRN  522
                N KEP ID E E  +             P P   +      +S +K   RSL+ D  
Sbjct  127   ALKNTKEPVIDIECEGIYDRAWTELLLFDEDPFPQQRQNGRRSNRSARKAIERSLRKDCP  186

Query  523   LSSRFDHYDSSMSGSWRMETEELSPE-PAVFLKPKKGSMGLPETSLKRRRLVKKNIS--D  693
              SSR+     + SG   ME EE S   PA   + +K +   PE+  K RRLVKK IS  D
Sbjct  187   SSSRY--CLETPSGPTVMELEEASTSLPAYSCRQRKRNSISPESQGKGRRLVKKRISMDD  244

Query  694   VLEISDSEELSPQIRTLPEHE-SAMQSNSANIGRHDHTSNNSQTTRISCPEDHTNGIEVP  870
              L  S+ EE   +   LPE+  S + S+S+++ R D    N + +   C     +  +  
Sbjct  245   WLLTSNVEEYK-EDNVLPENNFSRILSDSSDVER-DQGLPNGRISDARCFLSGQDDGDGC  302

Query  871   GDTEEVLNVTIGETLEN-EGALASPFKSPLEQRRIVDVDQKEDENCVKLPTSPALSCVIC  1047
                EE  +V  G    +   A +S  ++  E +   + D  + +   +LP S   SCVIC
Sbjct  303   DGLEENEDVNAGNLNPHIHVAQSSLLETSDELKVAANEDFIDVDPGSRLPASSEFSCVIC  362

Query  1048  WTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQK  1227
             WTDFSS+RG+LPCGHRFC                          F+ I   AD  PS   
Sbjct  363   WTDFSSTRGVLPCGHRFC--------------------------FSCIQNWADHMPS---  393

Query  1228  IYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIH  1407
                                               VCC+C SREPE+LLI C+ CQTRC+H
Sbjct  394   --------------------------------AIVCCRCFSREPEDLLIRCNFCQTRCVH  421

Query  1408  AYCLDPPLHPWTCIHCQDYQRRF  1476
             +YCLDP L PW C+HC+D Q  +
Sbjct  422   SYCLDPLLLPWICVHCKDLQMLY  444



>ref|XP_004507249.1| PREDICTED: uncharacterized protein LOC101495587 [Cicer arietinum]
Length=466

 Score =   251 bits (641),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 176/483 (36%), Positives = 242/483 (50%), Gaps = 65/483 (13%)
 Frame = +1

Query  175   MSVSITHLVCWRFEGRKFELAKKSRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVG-  351
             MS SITHLVCW+FEG+K+++A+K R   IVNHRWIEDCIK+GRRVPE  Y +Q G EVG 
Sbjct  1     MSKSITHLVCWKFEGKKYDIARKLR-IHIVNHRWIEDCIKEGRRVPEDSYILQSGYEVGP  59

Query  352   -----PLLMNITQVGEGNQSSG--CNHKEPQIDTEV-------------------EEYFP  453
                  P  +  + + +    SG  C+    + +T+                    EE   
Sbjct  60    LLIEVPFTVQASSLSKNKVVSGRFCDIGPERQNTDFSAGVCEISVLEDSCLLKKHEESSS  119

Query  454   DPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPEPAVFLKPKKGS  633
                    K ++   N   +   + S R        +G+  +  E  S    +  K K+ S
Sbjct  120   YSSRLSRKGKRNSGNEVKEESSSYSPRLSRKGKRNTGN-EVNEESSSYSSRLSRKGKRNS  178

Query  634   MGLPETSLKR----RRLVKKNISDVLE-----ISDSEELSPQIRTLPEHESAMQSNSANI  786
                  T+ +R    RR+VK +   VL+     +S  +ELS   R     E+A  S     
Sbjct  179   GNEISTAARRSRKERRVVKYDDEGVLDPIILDLSTDDELSRMDRL--HTEAAATSTLPGR  236

Query  787   GRHDHTSNNSQTTRIS-CPEDHTNGIEVPGDTEEVLNVTIGETLENEGALASPFKSPLEQ  963
                D+   NS+      C +  T  I+   D        I +T  +  ++  PF  P+ Q
Sbjct  237   VNVDNIQENSEGLDAGLCRQSRT--IDRSSDG-------IEQTRSSTLSIEDPF--PVTQ  285

Query  964   RRIVDV---------DQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQ  1116
                VD+         D    +N   LPTS  LSCVIC+TDFSS+RG+L CGHRFCF CIQ
Sbjct  286   TS-VDLCSSAAEKFNDGDPVDNSDDLPTSNELSCVICFTDFSSTRGILACGHRFCFKCIQ  344

Query  1117  SWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGET  1296
              W D+ ++ GK S CPLCK   T I KV  A  +DQK+YSQ+IP D   +DI++  + E 
Sbjct  345   DWVDRRIAMGKISNCPLCKASITMIKKVEHAATTDQKVYSQSIPCDYTSSDIFIPMEQE-  403

Query  1297  SHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRF  1476
               FP N      C  C  REPE+LL NC VC+TR IH+YC+DPPL PWTC  C++ +  +
Sbjct  404   --FPHNNLEAGACVICRGREPEDLLENCDVCRTRRIHSYCMDPPLRPWTCSSCKELRMLY  461

Query  1477  ETY  1485
               +
Sbjct  462   RNH  464



>ref|XP_007151461.1| hypothetical protein PHAVU_004G048500g [Phaseolus vulgaris]
 gb|ESW23455.1| hypothetical protein PHAVU_004G048500g [Phaseolus vulgaris]
Length=472

 Score =   248 bits (634),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 173/480 (36%), Positives = 236/480 (49%), Gaps = 54/480 (11%)
 Frame = +1

Query  112   GTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNTFIVNHRWIEDCI  291
             G ER    KL   +  NY   +   +   VCW+FEG+K+++A K R   +VNH+WIEDCI
Sbjct  20    GNERTGYYKL---SLTNYF-MIDYFVIDQVCWKFEGKKYDIALKFR-IPVVNHQWIEDCI  74

Query  292   KKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQIDTEVEEYFPDPDIAK  471
             K+GRRVPE  YT+Q G EVG LL+                       EV     D  + K
Sbjct  75    KEGRRVPEDSYTLQSGHEVGRLLL-----------------------EVPHTVRDSRLTK  111

Query  472   PK--SRKKMKNRSLKCDRNLSSRFDH-YDSSMSGSWRMETEELSPEPAVFLKPK------  624
              K  S K     S + + N  S     Y    S   +   E  S    +  K K      
Sbjct  112   KKIVSDKLHDTGSERQETNFGSGISRTYVLEDSCLMKRHDESSSYSSRLSRKGKRNICNG  171

Query  625   KGSMGLPETSLKRRRLVKKNISDVLEISDSEELSP--------QIRTLPEHESAMQS--N  774
             KG   +   S K RRL +  + +V+      +LSP        +++T  E  S++    N
Sbjct  172   KGDRTVAGPSRKGRRLTRNLVDEVVLAPSILDLSPDNPLFRMDRLQTEAEATSSLSGCVN  231

Query  775   SANIGRHDHTSNNSQTTRISCPEDHTNGIEVPGDTEEVLNVTIGETLENEGALASPFKS-  951
             S  I ++    N   +         ++ I+   D+  + +     T   E AL  P  S 
Sbjct  232   SNIILQNSEGPNAGLSNESRIINGGSDVIDQIKDSSHI-SAPRNSTFFVEDALPVPQTSI  290

Query  952   ---PLEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSW  1122
                  +  + +D DQ E  N   LPTS  +SCVIC+TDFS++RG+LPCGHRFCF CIQSW
Sbjct  291   DLCSSDDEKFMDGDQVE--NGAGLPTSSEMSCVICFTDFSTTRGILPCGHRFCFPCIQSW  348

Query  1123  ADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSH  1302
              D   S  K STCPLCK  F  I KV  A  +DQK+YSQTIP +   +DI++  D E  H
Sbjct  349   VDHRTSMRKMSTCPLCKASFVMIKKVEHAATADQKVYSQTIPCNHSSSDIFIPMDQELRH  408

Query  1303  FPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFET  1482
                  +    C  C  REPE+LL +C +CQ R IH+YC+DPPL PWTC HC++ +  + +
Sbjct  409   TIFESSQSGACVICRGREPEDLLESCDICQIRKIHSYCMDPPLRPWTCNHCKELRMLYRS  468



>gb|ABR16284.1| unknown [Picea sitchensis]
Length=489

 Score =   221 bits (564),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 160/491 (33%), Positives = 236/491 (48%), Gaps = 61/491 (12%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             + GM  VV ++SGY   E+  L KLI + G  Y G++    THLVCW F G K+ LAK+ 
Sbjct  35    IPGMGSVVVSISGYSVLEKIKLTKLIDQTGALYTGSLGNGNTHLVCWNFLGAKYSLAKRL  94

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGE--GNQSSGCNHKEP  420
             R T +VNHRW EDC++ GRR+PE PY ++ G+EVGPLL     V +  GN+    +H + 
Sbjct  95    RLT-VVNHRWFEDCLRAGRRLPEGPYIMKSGREVGPLLWEPPVVAKITGNKKIPSSHDQA  153

Query  421   QIDTEVEEYFPDPDIAKPKSRKKMKNRSLK-CD--RNLSSRFDHYDSSMSGSWRMETEEL  591
              +          P+ ++P    +  +R  K CD  R L+    + ++      + +   +
Sbjct  154   AML---------PNCSRPILIGESPSRMHKTCDETRILAESLTYRNN------QEDDANI  198

Query  592   SPEPAVFLKPKKGSMGLPETSLKRRRLVKKNISD--VLEISDSEELSPQIRTLPEHESAM  765
              P    ++   KG   +PE S  ++ + K+ I    +++ISD                  
Sbjct  199   VPTGKAYIDKAKGE--VPEISTSKQNMDKRGIKKRRLVKISDC---------------GN  241

Query  766   QSNSANIGRH-DHTSNNSQTTRISCPEDHTNGIEVPGDTEEVLNVTIGETLENEGALASP  942
             + N A IG   +    N+Q   +                 E+++ T  E ++N     S 
Sbjct  242   KENPARIGNSGEDKEGNNQLKNLEIEGKQGQAASSSNPCNEIIDCTPAENIKN-----SN  296

Query  943   FKSPLEQRRIVDVDQKEDENCVKLPTSPA------LSCVICWTDFSSSRGLLPCGHRFCF  1104
                P E    +D++   D     +P  P       +SC ICWT+ SSSRG+L CGHRFCF
Sbjct  297   EAQPHESTSGMDMEMGIDIEIPLVPRLPGSNPASEISCAICWTESSSSRGVLSCGHRFCF  356

Query  1105  SCIQSWADQMVSRGKTS-TCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLL  1281
              CI+ WA + VS+ K   TCPLC   F  IT    A  +DQKI+SQT+P+        +L
Sbjct  357   KCIRRWAVEKVSKKKKEPTCPLCLKSFDFITVTNHASSNDQKIFSQTLPELSDDNIFMVL  416

Query  1282  -PDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHP-----WT  1443
               +G  +       +   C  C SR+ EELL+ C+ C  R  H +CLDPPL P     W+
Sbjct  417   GENGIAADLQLTTNLQ--CNICGSRDTEELLLRCYRCGKRATHTFCLDPPLPPFPGLQWS  474

Query  1444  CIHCQDYQRRF  1476
             C  C   +R F
Sbjct  475   CTLCTSGRRPF  485



>ref|XP_008461601.1| PREDICTED: uncharacterized protein LOC103500164 [Cucumis melo]
Length=366

 Score =   216 bits (550),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 115/157 (73%), Gaps = 0/157 (0%)
 Frame = +1

Query  1015  PTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSIT  1194
             PTS  LSCVICWTDFSS+RG+LPCGHRFC+SCIQ+WAD M    K STCPLCK  F SIT
Sbjct  210   PTSTELSCVICWTDFSSTRGVLPCGHRFCYSCIQNWADHMALSRKISTCPLCKASFLSIT  269

Query  1195  KVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLI  1374
             KV DA  SDQKIYSQTIP      DIYLL D  T +    P++  VC  C  REPE+LL+
Sbjct  270   KVEDAATSDQKIYSQTIPCGPSLVDIYLLSDERTLNNVVQPSVAAVCSACRCREPEDLLM  329

Query  1375  NCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFETY  1485
             +CH+CQ R IH+YCLDPPL PWTCIHC+D    + ++
Sbjct  330   SCHLCQIRQIHSYCLDPPLLPWTCIHCKDLLTLYRSH  366



>ref|XP_003574477.1| PREDICTED: uncharacterized protein LOC100840339 [Brachypodium 
distachyon]
Length=546

 Score =   221 bits (562),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 130/317 (41%), Positives = 180/317 (57%), Gaps = 30/317 (9%)
 Frame = +1

Query  604   AVFLKPKKGSMGLPETSLKRRRLVKKNISDVLEISDSEELSP-----QIRTLPEHESAMQ  768
             A+      G MG     L R+    K+   + EISD +  +      QI  +P  E+  +
Sbjct  238   ALLHNEISGRMG-ERNDLMRKESQSKHARYLTEISDDDGSTDSFEEVQILDIPTTEARTK  296

Query  769   SNSANIGRHDHTSNNSQTT--RISCPEDHTNGIEVPGDTEEVLNVTIGET---------L  915
                  IGR + +++  Q+T   I    ++++ +    ++EE +NV IG++          
Sbjct  297   -----IGRRNASASFRQSTLDSIYSFGENSSHVYESEESEEQVNVEIGQSSRSLQPGDLF  351

Query  916   ENEGALASPFKSPLEQRRIVDVDQKEDEN------CVKLPTSPALSCVICWTDFSSSRGL  1077
              +E    +  K       IV   +K DE          L     LSCVICWTDFSS+RG+
Sbjct  352   GDEPPFCTQEKIDQSNLDIVADHEKTDEEKPTMEESSNLQRQAELSCVICWTDFSSTRGI  411

Query  1078  LPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDR  1257
             LPCGHRFC+SCIQ WAD + SRGK STCPLCK  F+ I+KV +A  SDQKIYSQTIP   
Sbjct  412   LPCGHRFCYSCIQGWADCLSSRGKVSTCPLCKASFSWISKVDEAGTSDQKIYSQTIPCG-  470

Query  1258  PGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHP  1437
               TD+++  D +    P + +    C QC SREPEELL++CHVC++R +H+YCLDPPL P
Sbjct  471   ASTDVFVFAD-DGYDLPGSSSAQGACYQCHSREPEELLLSCHVCRSRWVHSYCLDPPLTP  529

Query  1438  WTCIHCQDYQRRFETYR  1488
             WTCIHC+D +R ++ YR
Sbjct  530   WTCIHCRDLRRTYQRYR  546


 Score =   135 bits (341),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 78/97 (80%), Gaps = 1/97 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
            V GM+KVVATVSGY   ER  L+KLI++ G +YVGAMS SITHLVCWR EG+K+++AKK 
Sbjct  3    VEGMDKVVATVSGYHADERHRLVKLISETGASYVGAMSRSITHLVCWRLEGKKYDIAKK-  61

Query  247  RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPL  357
              T +V+HRW +DC+K+GRR+PE PY ++ G+E GP+
Sbjct  62   LGTRVVSHRWFQDCLKEGRRLPEGPYMMESGEEAGPV  98



>ref|XP_006430843.1| hypothetical protein CICLE_v10011421mg [Citrus clementina]
 gb|ESR44083.1| hypothetical protein CICLE_v10011421mg [Citrus clementina]
Length=544

 Score =   218 bits (554),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 120/160 (75%), Gaps = 2/160 (1%)
 Frame = +1

Query  997   ENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKV  1176
             E+  +  TS  LSCVICWT+FSS+RG+L CGHRFC+SCIQ+WAD M S  K STCPLCK 
Sbjct  382   EHVNRSSTSGELSCVICWTEFSSTRGVLACGHRFCYSCIQNWADHMASVRKISTCPLCKA  441

Query  1177  GFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSRE  1356
              F SITKV DA  SDQKIYSQTIP      D+++LPDG+++     P++   C +C S+E
Sbjct  442   SFMSITKVEDAATSDQKIYSQTIPCAWSTRDVFILPDGDSA--SVQPSLLEACIECRSQE  499

Query  1357  PEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRF  1476
             P++LLI CH+CQ+RCIH YC+DPPL PWTCIHC+D Q  +
Sbjct  500   PQDLLIRCHLCQSRCIHCYCMDPPLDPWTCIHCKDLQMLY  539



>ref|XP_007021832.1| Zinc finger family protein / BRCT domain-containing protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOY13357.1| Zinc finger family protein / BRCT domain-containing protein, 
putative isoform 1 [Theobroma cacao]
Length=539

 Score =   217 bits (552),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 118/163 (72%), Gaps = 0/163 (0%)
 Frame = +1

Query  982   DQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTC  1161
             D  + E   +LP S  LSCVICWT+FS++RG+LPCGHRFC+SCIQ WAD M+S  KTSTC
Sbjct  371   DVGQIELASRLPNSTELSCVICWTEFSATRGVLPCGHRFCYSCIQDWADHMISSRKTSTC  430

Query  1162  PLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQ  1341
             PLCK  F SITKV DA   DQKI+SQTIP+     D+ +LPD E   F    +   VC +
Sbjct  431   PLCKASFMSITKVEDAAICDQKIFSQTIPRATSTMDVSILPDQERPSFGVQSSSAFVCVK  490

Query  1342  CSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQR  1470
             C  REPE+LL++CH+CQ R +H YCLDPPL PWTCIHC+D +R
Sbjct  491   CRCREPEDLLVSCHLCQIRNVHTYCLDPPLLPWTCIHCKDLER  533


 Score =   158 bits (400),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 87/105 (83%), Gaps = 1/105 (1%)
 Frame = +1

Query  76   MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
            ME VVATVSGY G+ERFNLIKLI+ AG NYVG++S S THLVCWRFEGRK+ELAKK + T
Sbjct  1    MESVVATVSGYHGSERFNLIKLISHAGANYVGSLSQSTTHLVCWRFEGRKYELAKKLK-T  59

Query  256  FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGN  390
             IVNHRW EDCIK+G+R+PE PY +Q G+E GPLL+ I  + +G+
Sbjct  60   IIVNHRWFEDCIKEGKRLPEAPYMLQSGKEKGPLLLEIHDLAKGD  104



>ref|XP_006482402.1| PREDICTED: BRCT domain-containing protein At4g02110-like [Citrus 
sinensis]
Length=512

 Score =   213 bits (542),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 115/153 (75%), Gaps = 2/153 (1%)
 Frame = +1

Query  1018  TSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITK  1197
              S  LSCVICWT+FSS+RG+L CGHRFC+SCIQ+WAD M S  K STCPLCK  F SITK
Sbjct  357   ASGELSCVICWTEFSSTRGVLACGHRFCYSCIQNWADHMASVRKISTCPLCKASFMSITK  416

Query  1198  VADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLIN  1377
             V DA  SDQKIYSQTIP      D+++LPDG+++      ++   C +C S+EP++LLI 
Sbjct  417   VEDAATSDQKIYSQTIPCAWSTRDVFILPDGDSA--SVQLSLLEACIECRSQEPQDLLIR  474

Query  1378  CHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRF  1476
             CH+CQ+RCIH YC+DPPL PWTCIHC+D Q  +
Sbjct  475   CHLCQSRCIHCYCMDPPLDPWTCIHCKDLQMLY  507



>dbj|BAJ93149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=678

 Score =   211 bits (537),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = +1

Query  1030  LSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADA  1209
             LSCVICWTDFSSSRG+LPCGHRFCFSCIQ WAD + SRGK STCPLCK  F+ I+KV +A
Sbjct  527   LSCVICWTDFSSSRGILPCGHRFCFSCIQGWADCLFSRGKVSTCPLCKASFSWISKVDEA  586

Query  1210  EPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVC  1389
               SDQKIYSQT       TDI++  D E    P   +    C  C SREPEEL+++CHVC
Sbjct  587   GTSDQKIYSQTPVPCGASTDIFMFTD-EGHDLPGPSSAQGACYMCHSREPEELILSCHVC  645

Query  1390  QTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
             Q++ +H+YCLDPPL PWTCIHC+D +R ++ YR
Sbjct  646   QSQWVHSYCLDPPLTPWTCIHCRDLRRMYQRYR  678


 Score =   130 bits (328),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             AGM+KVVATVSGY G ER  L+KLI++AG +YVGAMS SITHLVCWR EG+K+++A++ 
Sbjct  56   AAGMDKVVATVSGYHGDERHRLVKLISEAGASYVGAMSRSITHLVCWRLEGKKYDIARRL  115

Query  247  RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPL  357
            R   IV+HRW   C+++G R+PE PY ++ G+E GP+
Sbjct  116  R-VRIVSHRWFLHCLQQGTRLPEAPYAMESGEEAGPV  151



>ref|NP_001141455.1| hypothetical protein [Zea mays]
 gb|ACF86405.1| unknown [Zea mays]
 tpg|DAA49113.1| TPA: hypothetical protein ZEAMMB73_965281 [Zea mays]
Length=284

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 118/172 (69%), Gaps = 2/172 (1%)
 Frame = +1

Query  973   VDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKT  1152
             +  D K  E    L     LSCVICWTDFSS+RG+LPCGHRFC+SCIQ W+D + SRGK 
Sbjct  115   MGYDNKPMEKSSNLERQTELSCVICWTDFSSTRGILPCGHRFCYSCIQGWSDCLASRGKV  174

Query  1153  STCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPV  1332
             STCPLCK  FT I+KV +A   DQK+YSQTIP +   TD+++L   E   F    +    
Sbjct  175   STCPLCKASFTWISKVDEAGTLDQKVYSQTIPCE-ASTDVFVL-GSEGYDFSGPTSGQGA  232

Query  1333  CCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
             C QC  REPEELL++CHVC++  +H+YCLDPPL PWTC+HC+D +  F  YR
Sbjct  233   CYQCHFREPEELLLSCHVCRSLWVHSYCLDPPLTPWTCMHCRDLRVLFHRYR  284



>ref|XP_004973423.1| PREDICTED: uncharacterized protein LOC101764105 [Setaria italica]
Length=504

 Score =   203 bits (516),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 119/169 (70%), Gaps = 2/169 (1%)
 Frame = +1

Query  982   DQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTC  1161
             D+K  E    L     LSC ICWTDFSS+RG+L CGHRFC+SCIQ WAD + SRGK STC
Sbjct  338   DKKPSEKTSNLEKQEELSCAICWTDFSSTRGILRCGHRFCYSCIQEWADCLASRGKVSTC  397

Query  1162  PLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQ  1341
             PLCK  FT I+KV +A  SDQKIYSQTIP +   TD+++  + E   F  +      C Q
Sbjct  398   PLCKASFTWISKVDEAGTSDQKIYSQTIPCE-ASTDVFVFRN-EGYGFSRSWVGLGACYQ  455

Query  1342  CSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
             C SREPEELL++CHVC+++ +H+YCLDPPL PWTC+HC+D +  +  YR
Sbjct  456   CHSREPEELLLSCHVCRSQWVHSYCLDPPLTPWTCVHCRDMRMMYHRYR  504


 Score =   125 bits (315),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
            V GM  VVATVSGY G ER  L+KLI++ G +YVG MS SITHLVCWR EG+K+++A+K 
Sbjct  3    VEGMGSVVATVSGYHGDERHRLVKLISETGASYVGTMSKSITHLVCWRLEGKKYDIARKL  62

Query  247  RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPL  357
            R T +V+HRW  +C+++GRR+PE PY ++ G+E G +
Sbjct  63   R-TRVVSHRWFLECLREGRRLPEGPYLMESGEEAGSV  98



>gb|EMT11059.1| hypothetical protein F775_08253 [Aegilops tauschii]
Length=656

 Score =   204 bits (520),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 123/292 (42%), Positives = 162/292 (55%), Gaps = 28/292 (10%)
 Frame = +1

Query  679   KNISDVLEISDSEELSPQIRTLPEHESAMQSNSANIGRHDHTSNNSQTTRISCPEDHTNG  858
             K+   +LE+SD + LS     L      M   S+   R    S N+ + R S  E   + 
Sbjct  371   KHARSLLELSD-DSLSDSFEEL-----QMFDTSSTEARRKIRSTNAPSFRQSTLESIYDH  424

Query  859   IEV------PGDTEEVLNVTIGETLEN--EGALASPFKSPLEQRRI--------VDVDQK  990
              E       P  +EE   + +GE   +   G L+    S   Q +I         D D+ 
Sbjct  425   CETSMHDYEPEKSEEQETIDLGERSRSLQPGDLSGHEPSFCTQEKIDQSDLGITADHDKG  484

Query  991   EDEN-----CVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTS  1155
             +DE         L     LSCVICWTDFSSSRG+LPCGHRFC+SCIQ WAD + SRGK S
Sbjct  485   DDEKPTMEESSNLKRQAELSCVICWTDFSSSRGILPCGHRFCYSCIQGWADCLSSRGKVS  544

Query  1156  TCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFP-ANPAMPPV  1332
             TCPLCK  F+ I+KV +A  SDQKIYSQT       T I++      S  P ++ +    
Sbjct  545   TCPLCKASFSWISKVDEAGTSDQKIYSQTPVPCGASTSIFMFTGEGHSDLPGSSSSAQGA  604

Query  1333  CCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
             C  C SREPEEL+++CHVC+++ +H+YCLDPPL PWTCIHC+D +R ++ YR
Sbjct  605   CYMCHSREPEELILSCHVCRSQWVHSYCLDPPLTPWTCIHCRDLRRMYQRYR  656


 Score = 75.9 bits (185),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = +1

Query  196  LVCWRFEGRKFELAKKSRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPL  357
            +VCWR EG+K+++A++ R   IV+HRW  DC+K+GRR+PE PYT++ G+E GP+
Sbjct  75   VVCWRLEGKKYDIARRLR-VRIVSHRWFHDCLKEGRRLPEGPYTMESGEEAGPV  127



>gb|EEC83574.1| hypothetical protein OsI_29232 [Oryza sativa Indica Group]
Length=818

 Score =   205 bits (521),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 114/153 (75%), Gaps = 2/153 (1%)
 Frame = +1

Query  1030  LSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADA  1209
             LSCVICWTDFSS+RG+LPCGHRFC+SCIQ WAD + SRGK STCPLCK  F  I+K+ +A
Sbjct  668   LSCVICWTDFSSTRGILPCGHRFCYSCIQEWADSLSSRGKVSTCPLCKTSFAWISKIDEA  727

Query  1210  EPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVC  1389
               SDQKIYSQTIP     TD ++  D      P +P+    C QC  REPEELL++CHVC
Sbjct  728   GTSDQKIYSQTIPC-LTSTDTFIFDD-SLYGLPESPSGQGACYQCHCREPEELLLSCHVC  785

Query  1390  QTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
             +++ +H+YCLDPPL PWTCIHC+D +  ++ YR
Sbjct  786   RSQWVHSYCLDPPLTPWTCIHCRDLRMLYQRYR  818



>ref|XP_002459851.1| hypothetical protein SORBIDRAFT_02g012355 [Sorghum bicolor]
 gb|EER96372.1| hypothetical protein SORBIDRAFT_02g012355 [Sorghum bicolor]
Length=216

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 117/172 (68%), Gaps = 2/172 (1%)
 Frame = +1

Query  973   VDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKT  1152
             + VD K  E    +     LSCVICWTDFSS+RG+LPCGHRFC+SCIQ W D + S  K 
Sbjct  47    MGVDNKPMEKSSNIEMQAELSCVICWTDFSSTRGILPCGHRFCYSCIQGWVDCLASNSKV  106

Query  1153  STCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPV  1332
             STCPLCK  FT I+KV +A  SDQKIYSQTIP  +  TD+++  + E      + +    
Sbjct  107   STCPLCKANFTRISKVEEAGTSDQKIYSQTIPC-KSSTDVFVFGN-EGYDLSRSTSEQGA  164

Query  1333  CCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
             C QC  REPEELL++CHVC+++ +H+YCL PPL PWTC+HC+D +  +  YR
Sbjct  165   CYQCHCREPEELLLSCHVCRSQWVHSYCLGPPLTPWTCMHCRDLRTLYHRYR  216



>ref|XP_010666057.1| PREDICTED: uncharacterized protein LOC104883257 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=433

 Score =   197 bits (501),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 118/313 (38%), Positives = 156/313 (50%), Gaps = 57/313 (18%)
 Frame = +1

Query  634   MGLPETSLKRRRLVKK----NISDVLEI----------------------SDSEELSPQI  735
             + +PE+S K RRLV+K    NI+D+  I                      +DS++LS +I
Sbjct  148   LDVPESSRKSRRLVEKDAEPNITDIATIDAERQNRTHADDSELHVALSLSNDSDDLSTEI  207

Query  736   RTLPEHESAMQSNSANIGRHDHTSNNSQTTRISCPEDHTNGIEVPG-DTEEV---LNVTI  903
               +        S      RH+    N     ++    H N +   G + EE+   ++ + 
Sbjct  208   EAIISARLDTISTVHGQSRHEVNPMNDLDPLLN-KSSHDNALNAKGRNVEEISPDVSNSN  266

Query  904   GETLENEGALASPFKSPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLP  1083
             G+ L  + + A                            S  LSCVICWT++SS RG+LP
Sbjct  267   GDKLGRDQSTAD--------------------------ASIELSCVICWTEYSSVRGVLP  300

Query  1084  CGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPG  1263
             CGHRFCF CIQ+WAD M S  K  TCPLCK  F S T+V  A   DQKIYSQTIP     
Sbjct  301   CGHRFCFPCIQNWADHMRSNRKEPTCPLCKAAFVSFTRVEAAATLDQKIYSQTIPFASSS  360

Query  1264  TDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWT  1443
              DIY +P+G T  F       PVCC C SR+P ++LI C VC +  IH+YCLDPPL PWT
Sbjct  361   QDIYFVPEGRTGFFDVEITPLPVCCYCQSRDPADMLIECRVCHSSRIHSYCLDPPLFPWT  420

Query  1444  CIHCQDYQRRFET  1482
             CI C+  +  F +
Sbjct  421   CIGCRHRRVLFRS  433



>ref|XP_002444326.1| hypothetical protein SORBIDRAFT_07g020200 [Sorghum bicolor]
 gb|EES13821.1| hypothetical protein SORBIDRAFT_07g020200 [Sorghum bicolor]
Length=518

 Score =   197 bits (501),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 116/169 (69%), Gaps = 2/169 (1%)
 Frame = +1

Query  982   DQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTC  1161
             D+K  E    L   P LSCVICWTDFSS+RG+LPCGHRFC+SCIQ WAD + S GK STC
Sbjct  352   DKKPMEKSSNLERQPELSCVICWTDFSSTRGILPCGHRFCYSCIQGWADCLASSGKVSTC  411

Query  1162  PLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQ  1341
             PLCK  F  I+KV +A  SDQKIYSQTIP +   TD+++L + E   F  + A    C Q
Sbjct  412   PLCKASFIYISKVDEAGTSDQKIYSQTIPCE-ASTDVFVLGN-EGYDFSRSTAGQGACYQ  469

Query  1342  CSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
             C  REPEELL +C VC+ + +HAYCLDPP   WTC+HC+D +  F  YR
Sbjct  470   CHFREPEELLQSCDVCRLQWVHAYCLDPPQTRWTCMHCRDPRMLFHRYR  518


 Score =   125 bits (313),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
            + GM  VVATVSGY G ER  L+ LIA+ G +YVG+MS SITHLVCWR EG+K+++A+K 
Sbjct  3    IDGMRSVVATVSGYHGEERHRLVNLIAETGASYVGSMSRSITHLVCWRLEGKKYDIARK-  61

Query  247  RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPL  357
              T +V+HRW  +C+ +GRR+PE PY +  G+E GP+
Sbjct  62   LGTRVVSHRWFMECLSEGRRLPEDPYLMVSGEEAGPV  98



>gb|KCW56381.1| hypothetical protein EUGRSUZ_I02107, partial [Eucalyptus grandis]
Length=330

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 112/152 (74%), Gaps = 2/152 (1%)
 Frame = +1

Query  970   IVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGK  1149
             + DV Q +   C  LP+S  LSCVICWT++SS+RG+LPCGHRFC+SCI++W+D M SR  
Sbjct  181   VDDVGQTDYVKC--LPSSVELSCVICWTEYSSTRGILPCGHRFCYSCIRNWSDHMSSRKT  238

Query  1150  TSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPP  1329
             TSTCPLCK  F SITKV D+  S+QKIYSQTIP D+  +++Y++ D   +   A      
Sbjct  239   TSTCPLCKTSFVSITKVEDSSGSEQKIYSQTIPHDQSTSEVYVVTDQGRTSSRAESFGAQ  298

Query  1330  VCCQCSSREPEELLINCHVCQTRCIHAYCLDP  1425
             VC +C SREP +LLI+CH+C TRCIH+YCLDP
Sbjct  299   VCSECRSREPVDLLISCHLCHTRCIHSYCLDP  330



>ref|XP_006603959.1| PREDICTED: uncharacterized protein LOC100815034 [Glycine max]
Length=488

 Score =   187 bits (474),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 113/187 (60%), Gaps = 10/187 (5%)
 Frame = +1

Query  958   EQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMV  1137
             +  +  D DQ +  N   LPTS  +SCVIC T+FSS+RG+LPCGHRFCF CIQ+WAD   
Sbjct  312   DDEKFTDGDQAD--NVAGLPTSTEMSCVICLTEFSSTRGILPCGHRFCFPCIQNWADHTT  369

Query  1138  SRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANP  1317
             S  KTSTCPLCK  F  I KV  A  +DQKIYSQTIP D   + I++  D          
Sbjct  370   SMRKTSTCPLCKASFMMIKKVEHAATADQKIYSQTIPCDNSASVIFIPVDQNLPDNIFES  429

Query  1318  AMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYRRIW  1497
             A    C  C  REPE+LL +C VC  R IH+YC+DPPL PW C HC++ +  + +     
Sbjct  430   AQSNACVVCRGREPEDLLESCDVCHIRKIHSYCMDPPLRPWICTHCKELRMHYRS-----  484

Query  1498  *YINHLF  1518
                NHL+
Sbjct  485   ---NHLY  488


 Score =   162 bits (411),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
            V GME+VVATVSGY G+ERFNLIKLI++AGGNYVGAMS SITHLVCW+FEG+K+++A K 
Sbjct  18   VQGMERVVATVSGYHGSERFNLIKLISQAGGNYVGAMSKSITHLVCWKFEGKKYDIALKF  77

Query  247  RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQV  378
            R   +VNHRW+EDCIK+GRRVPE  YT+Q G EVGPLL+ +  V
Sbjct  78   R-IHVVNHRWVEDCIKEGRRVPEDSYTLQSGHEVGPLLLEVPLV  120



>gb|KEH25278.1| zinc finger, C3HC4 type (RING finger) protein, putative [Medicago 
truncatula]
Length=462

 Score =   185 bits (469),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 102/154 (66%), Gaps = 3/154 (2%)
 Frame = +1

Query  1015  PTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSIT  1194
             PTS  LSCVICWTDFSS+RG+L CGHRFCFSCIQ W D   + GK S CPLCK     I 
Sbjct  307   PTSNELSCVICWTDFSSTRGILECGHRFCFSCIQGWVDCRKAMGKVSNCPLCKASIMKIM  366

Query  1195  KVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLI  1374
             KV  A+ +DQK YSQTIP D   +D+++  D E   FP N      C  C  REPE+LL 
Sbjct  367   KVEHADTTDQKAYSQTIPCDYTSSDVFIPIDQE---FPDNSLEAGACVICGGREPEDLLE  423

Query  1375  NCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRF  1476
             NC VC+ R IH+YC+DPPL PWTC  C++ +  +
Sbjct  424   NCDVCRCRRIHSYCMDPPLRPWTCTSCKELRMLY  457


 Score =   151 bits (381),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 86/98 (88%), Gaps = 1/98 (1%)
 Frame = +1

Query  76   MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
            M++VVATVSGY+  ERFNLIKLI+++G +YVG MS SITHLVCW+FEG+K+++A+K +  
Sbjct  1    MDRVVATVSGYRELERFNLIKLISRSGASYVGDMSKSITHLVCWKFEGKKYDIARKLK-I  59

Query  256  FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNI  369
            ++VNHRW+EDCIK+GRRVPE  YT+Q GQEVGPL+M +
Sbjct  60   YVVNHRWVEDCIKEGRRVPEDSYTLQSGQEVGPLVMEV  97



>ref|XP_006844201.1| hypothetical protein AMTR_s00006p00265240 [Amborella trichopoda]
 gb|ERN05876.1| hypothetical protein AMTR_s00006p00265240 [Amborella trichopoda]
Length=497

 Score =   185 bits (469),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 166/522 (32%), Positives = 222/522 (43%), Gaps = 97/522 (19%)
 Frame = +1

Query  67    VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
             V GM+ VVATVSGY G  R  LIKLI + G +YVG MS S +HLVCW+F GRK++LAKK 
Sbjct  18    VPGMDSVVATVSGYHGVGRLKLIKLINQTGAHYVGNMSKSTSHLVCWQFNGRKYDLAKK-  76

Query  247   RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLL----MNITQVG-----------  381
               T +VNHRW EDC+K G+ +PE  Y + CGQEV PL      N  + G           
Sbjct  77    LGTKVVNHRWFEDCMKAGKLLPESGYNMLCGQEVDPLSWEVPANAVETGHKKKRLPDQSR  136

Query  382   ---------------------------EGNQSSGCNHKEPQIDTEVEEYFPDPDIAKPKS  480
                                          N +SG + +  +++    E     ++ + K 
Sbjct  137   AFQSLDVDRSYSSVESLAQFRSSLRSENANSNSGSSDRTAKMNKLSREKHKLRELLQVKE  196

Query  481   R--KKMKNRSLKCDRNLSSRFDHYDSSM--SGSWRMETEELSPEPAVFLKPKKGSMGLPE  648
             R   ++ +RS    R +S+      SS     S  M T   SP PA    P + S     
Sbjct  197   RPPLQLVDRS---GRVMSAESKACISSTCHKSSLHMTTRNNSP-PASTSVPTRKS-----  247

Query  649   TSLKRRRLVKKNISDVLEISDSEELSPQIRTLPEHESAMQSNSANIGRHDHTSNNSQTTR  828
                  RRLVKK+      +SD  EL       P   + + S+S+     D  S NS++ R
Sbjct  248   -----RRLVKKSSCYDTILSDGVELDQIKENQPNQFNIVISSSS----ADCDSLNSESIR  298

Query  829   ISCPEDHTNGIEVPGDTEEVLNVTIG-ETLENEGA-LASPFKSPLEQRRIVDVDQKEDEN  1002
                  D         D E     +IG E +E  G+ L  P         I   D      
Sbjct  299   NEDQLDTGLLTSRNADKEIGRCESIGVEAVEEAGSVLGLPISLADVSCAICWTDFSSTRG  358

Query  1003  CVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGF  1182
              +        SC+  W D  +S+G                        K STCPLCK  F
Sbjct  359   VLSCGHRFCFSCIQDWADQMASKG------------------------KESTCPLCKACF  394

Query  1183  TSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPE  1362
               IT++ DA   DQK++SQT+PQ    T + LL   E   F A   +   C +C S +  
Sbjct  395   VCITRLEDATSPDQKMFSQTLPQ-AANTSVVLLHGAEDQSFAAMD-LAFKCHECRSGDTG  452

Query  1363  ELLINCHVCQTRCIHAYCLDPPLH----PWTCIHCQDYQRRF  1476
             E L+ C  C  R +H +CLDPPL      WTC  C   +R F
Sbjct  453   ECLLRCRACGNRWVHTFCLDPPLSRHSASWTCNPCNLRRRPF  494



>ref|XP_008782114.1| PREDICTED: uncharacterized protein LOC103701730 [Phoenix dactylifera]
Length=505

 Score =   185 bits (469),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 106/159 (67%), Gaps = 14/159 (9%)
 Frame = +1

Query  1030  LSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADA  1209
             LSCVICWTDFSS+RG+LPCGHRFC+ CI  WAD M S+GK STCPLCK  F SI K+ +A
Sbjct  355   LSCVICWTDFSSTRGVLPCGHRFCYLCILGWADCMASKGKVSTCPLCKASFASIRKMEEA  414

Query  1210  EPSDQKIYSQTIPQDRPGTDIYLLPDGE------TSHFPANPAMPPVCCQCSSREPEELL  1371
                DQKIYSQTIP      D  L   G       TS F        VC QC + EP +LL
Sbjct  415   GSPDQKIYSQTIPCGSSNMDFMLFDRGNYNLETLTSDF--------VCYQCHNHEPADLL  466

Query  1372  INCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
             ++CH+CQT  +H+ CLDPPL PWTC+HC+D +  ++ +R
Sbjct  467   VSCHICQTHWVHSCCLDPPLVPWTCMHCRDLRMLYQRFR  505


 Score =   134 bits (338),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = +1

Query  76   MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
            ME V+ TVSGY GTERF LIKLIA+ G +YVGAM  S THLVCW+FEG+K+ELA ++   
Sbjct  1    MESVIVTVSGYHGTERFKLIKLIAQTGASYVGAMGRSTTHLVCWQFEGKKYELA-RNIGA  59

Query  256  FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGC  405
             I++HRW E C+KKG+R+PE PYT+Q G E GP+   +  V + +    C
Sbjct  60   HIISHRWFEACLKKGKRLPEGPYTMQSGWEAGPISWEVPAVLDTHDKKKC  109



>gb|KEH25277.1| zinc finger, C3HC4 type (RING finger) protein, putative [Medicago 
truncatula]
Length=465

 Score =   181 bits (459),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 103/157 (66%), Gaps = 6/157 (4%)
 Frame = +1

Query  1015  PTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSIT  1194
             PTS  LSCVICWTDFSS+RG+L CGHRFCFSCIQ W D   + GK S CPLCK     I 
Sbjct  307   PTSNELSCVICWTDFSSTRGILECGHRFCFSCIQGWVDCRKAMGKVSNCPLCKASIMKIM  366

Query  1195  KVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPAN---PAMPPVCCQCSSREPEE  1365
             KV  A+ +DQK YSQTIP D   +D+++  D E   FP N    +    C  C  REPE+
Sbjct  367   KVEHADTTDQKAYSQTIPCDYTSSDVFIPIDQE---FPDNSLESSQAGACVICGGREPED  423

Query  1366  LLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRF  1476
             LL NC VC+ R IH+YC+DPPL PWTC  C++ +  +
Sbjct  424   LLENCDVCRCRRIHSYCMDPPLRPWTCTSCKELRMLY  460


 Score =   151 bits (381),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 86/98 (88%), Gaps = 1/98 (1%)
 Frame = +1

Query  76   MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
            M++VVATVSGY+  ERFNLIKLI+++G +YVG MS SITHLVCW+FEG+K+++A+K +  
Sbjct  1    MDRVVATVSGYRELERFNLIKLISRSGASYVGDMSKSITHLVCWKFEGKKYDIARKLK-I  59

Query  256  FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNI  369
            ++VNHRW+EDCIK+GRRVPE  YT+Q GQEVGPL+M +
Sbjct  60   YVVNHRWVEDCIKEGRRVPEDSYTLQSGQEVGPLVMEV  97



>ref|XP_007021833.1| Zinc finger family protein / BRCT domain-containing protein, 
putative isoform 2 [Theobroma cacao]
 gb|EOY13358.1| Zinc finger family protein / BRCT domain-containing protein, 
putative isoform 2 [Theobroma cacao]
Length=490

 Score =   159 bits (403),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 87/105 (83%), Gaps = 1/105 (1%)
 Frame = +1

Query  76   MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
            ME VVATVSGY G+ERFNLIKLI+ AG NYVG++S S THLVCWRFEGRK+ELAKK + T
Sbjct  1    MESVVATVSGYHGSERFNLIKLISHAGANYVGSLSQSTTHLVCWRFEGRKYELAKKLK-T  59

Query  256  FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGN  390
             IVNHRW EDCIK+G+R+PE PY +Q G+E GPLL+ I  + +G+
Sbjct  60   IIVNHRWFEDCIKEGKRLPEAPYMLQSGKEKGPLLLEIHDLAKGD  104


 Score =   145 bits (365),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = +1

Query  982   DQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTC  1161
             D  + E   +LP S  LSCVICWT+FS++RG+LPCGHRFC+SCIQ WAD M+S  KTSTC
Sbjct  371   DVGQIELASRLPNSTELSCVICWTEFSATRGVLPCGHRFCYSCIQDWADHMISSRKTSTC  430

Query  1162  PLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAM  1323
             PLCK  F SITKV DA   DQKI+SQTIP+     D+ +LPD E   F    A+
Sbjct  431   PLCKASFMSITKVEDAAICDQKIFSQTIPRATSTMDVSILPDQERPSFGVQVAL  484



>ref|XP_004173036.1| PREDICTED: uncharacterized LOC101213123, partial [Cucumis sativus]
Length=248

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 85/131 (65%), Gaps = 21/131 (16%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHL----------------  198
            + GME VV TVSGY GTERFNLIK+I+  G +YVGAMS SITHL                
Sbjct  28   IEGMESVVVTVSGYHGTERFNLIKMISYTGASYVGAMSRSITHLNKFGVLDGDLMKHFME  87

Query  199  ----VCWRFEGRKFELAKKSRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMN  366
                +CW  +GRKF+LA+K R T IVNHRW+EDCIK G+RVPE PY +Q GQ +GPL M 
Sbjct  88   YTIAICWELQGRKFDLAEKFR-TIIVNHRWLEDCIKHGKRVPEGPYILQSGQSIGPLSMK  146

Query  367  ITQVGEGNQSS  399
            +    +G  S+
Sbjct  147  LPLADKGYVSA  157



>gb|KCW56380.1| hypothetical protein EUGRSUZ_I02105 [Eucalyptus grandis]
Length=247

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 84/114 (74%), Gaps = 5/114 (4%)
 Frame = +1

Query  946   KSPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWA  1125
             KS +E   I DV Q +  N   L +S  LSCVICWT++SS+RG+LPCGHRFC+SCI++W 
Sbjct  109   KSSIE---IDDVGQTDYVN--SLSSSVELSCVICWTEYSSTRGILPCGHRFCYSCIRNWY  163

Query  1126  DQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPD  1287
             D M SR KTSTCPLCK  F SITKV D+  S QKIYSQTIP D+  +++Y++ D
Sbjct  164   DHMSSRKKTSTCPLCKTSFVSITKVEDSSGSQQKIYSQTIPHDQSTSEVYVVTD  217



>ref|XP_010030803.1| PREDICTED: DNA repair protein RAD5-like [Eucalyptus grandis]
Length=247

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 84/114 (74%), Gaps = 5/114 (4%)
 Frame = +1

Query  946   KSPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWA  1125
             KS +E   I DV Q +  N   L +S  LSCVICWT++SS+RG+LPCGHRFC+SCI++W 
Sbjct  109   KSSIE---IDDVGQTDYVN--SLSSSVELSCVICWTEYSSTRGILPCGHRFCYSCIRNWY  163

Query  1126  DQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPD  1287
             D M SR KTSTCPLCK  F SITKV D+  S QKIYSQTIP D+  +++Y++ D
Sbjct  164   DHMSSRKKTSTCPLCKTSFVSITKVEDSSGSQQKIYSQTIPHDQSTSEVYVVTD  217



>ref|XP_010029458.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW56379.1| hypothetical protein EUGRSUZ_I02104 [Eucalyptus grandis]
Length=132

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 81/111 (73%), Gaps = 1/111 (1%)
 Frame = +1

Query  76   MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
            ME VVA+VSGY G ERF+LIKLI   G +YVGAMS S THLVC RFEG+K++LA+K + T
Sbjct  1    MESVVASVSGYHGAERFDLIKLIPSLGASYVGAMSSSTTHLVCRRFEGQKYDLARKFK-T  59

Query  256  FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCN  408
             +VNHRW+E+C+K+G+RVPEHPYT +    V  L     +  + N+SS  +
Sbjct  60   HVVNHRWVEECVKQGKRVPEHPYTWEWCVSVVNLADVYVKKSKKNRSSATD  110



>ref|XP_010029459.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X2 [Eucalyptus grandis]
Length=102

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 71/84 (85%), Gaps = 1/84 (1%)
 Frame = +1

Query  76   MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
            ME VVA+VSGY G ERF+LIKLI   G +YVGAMS S THLVC RFEG+K++LA+K + T
Sbjct  1    MESVVASVSGYHGAERFDLIKLIPSLGASYVGAMSSSTTHLVCRRFEGQKYDLARKFK-T  59

Query  256  FIVNHRWIEDCIKKGRRVPEHPYT  327
             +VNHRW+E+C+K+G+RVPEHPYT
Sbjct  60   HVVNHRWVEECVKQGKRVPEHPYT  83



>emb|CAN65241.1| hypothetical protein VITISV_025050 [Vitis vinifera]
Length=562

 Score =   134 bits (337),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 71/89 (80%), Gaps = 1/89 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
            + GME ++ATVSGY G ER NLIKLI++ G  YVG MS SITHLVCW+FEGRK+ LAKK 
Sbjct  452  IQGMESIIATVSGYHGVERSNLIKLISQTGAKYVGTMSRSITHLVCWKFEGRKYSLAKKF  511

Query  247  RNTFIVNHRWIEDCIKKGRRVPEHPYTVQ  333
            + T IVNHRW EDCIK G+R+PE+ Y +Q
Sbjct  512  K-TLIVNHRWFEDCIKAGKRLPENSYLLQ  539



>gb|EMS48159.1| hypothetical protein TRIUR3_05608 [Triticum urartu]
Length=607

 Score =   130 bits (326),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = +1

Query  997   ENCVKLPTSPALSCVICWTDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKV  1176
             E    L     LSCVICWTDFSSSRG+LPCGHRFC+SCIQ WAD + SRGK STCPLCK 
Sbjct  485   EESSSLQRQAELSCVICWTDFSSSRGILPCGHRFCYSCIQGWADCLSSRGKVSTCPLCKA  544

Query  1177  GFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAM  1323
              F+ I+KV +A  SDQKIYSQT       T+I++  D      P + ++
Sbjct  545   SFSWISKVDEAGTSDQKIYSQTPVPCGASTNIFMFTDEGHGDLPGSSSI  593


 Score = 76.6 bits (187),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (74%), Gaps = 2/73 (3%)
 Frame = +1

Query  139  LIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNTFIVNHRWIEDCIKKGRRVPEH  318
            L A+  G   GA++ + +  VCWR EG+K+++A++ R   IV+HRW +DC+++GRR+PE 
Sbjct  50   LPARDEGLRHGAVARA-SQEVCWRLEGKKYDIARRLR-VRIVSHRWFQDCLREGRRLPEG  107

Query  319  PYTVQCGQEVGPL  357
            PYT++ G+E GP+
Sbjct  108  PYTMESGEEAGPV  120



>gb|AFK42608.1| unknown [Lotus japonicus]
Length=327

 Score =   121 bits (304),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
            +  M KV+ TV+GY G ERFNLIKLIA AG +Y G M+  I HLVC++FEGRK+E+A++ 
Sbjct  18   IQDMGKVLVTVTGYHGLERFNLIKLIAYAGSSYSGRMAEFINHLVCFKFEGRKYEIARRL  77

Query  247  RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNI  369
            +   IVNHRWIEDC+++  R+P   Y +Q G EVGPL + +
Sbjct  78   K-IPIVNHRWIEDCLRERTRLPVDSYMLQSGHEVGPLSLRV  117



>gb|AGW47710.1| putative BRCT protein [Hordeum vulgare subsp. vulgare]
Length=150

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 86/140 (61%), Gaps = 10/140 (7%)
 Frame = +1

Query  76   MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
            M+KV+  VSGY G +R  L+KLI++AG +YVGAMS SITHLVCW  EG+K+++A++    
Sbjct  1    MDKVIEMVSGYHGDDRHRLVKLISEAGASYVGAMSRSITHLVCWGLEGKKYDIARRLW-V  59

Query  256  FIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVG--------PLLMNITQVGEGNQSSGCNH  411
             IV+HRW  DC+++GRR+PE PY ++ G   G         +L+   +  E     G   
Sbjct  60   RIVSHRWFLDCLRQGRRLPEGPYAMERGNSSGVFAVVSIEEILLERPRASEHKLFIGMLP  119

Query  412  KEPQIDTEVEEYFPDPDIAK  471
            K    DTE+ + FP  +I +
Sbjct  120  KNVA-DTELTDLFPSMEIYQ  138



>ref|XP_002975153.1| hypothetical protein SELMODRAFT_415214 [Selaginella moellendorffii]
 gb|EFJ23938.1| hypothetical protein SELMODRAFT_415214 [Selaginella moellendorffii]
Length=497

 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
            V GM+ ++ T+SGY GT+R  ++ LI + G  ++G +S S THLVCW F G+K+ L+K+ 
Sbjct  45   VPGMDSLIVTISGYTGTQRSRVVALINRTGALFLGDLSTSHTHLVCWSFTGKKYHLSKEL  104

Query  247  RNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPL  357
                IVNH+W EDC++ GRR+PE PYT + G+EVGP+
Sbjct  105  -GIKIVNHQWFEDCLRAGRRLPEEPYTHKSGKEVGPV  140


 Score = 99.8 bits (247),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 87/158 (55%), Gaps = 19/158 (12%)
 Frame = +1

Query  1030  LSCVICWTDFSSS-RGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITK---  1197
             ++CVIC  +  ++  G+L CGH+FCF CI+ W+ Q      T  CPLCK  F  ITK   
Sbjct  348   VACVICHDENQTNVEGVLACGHQFCFDCIKKWS-QHSGSANTPKCPLCKAPFDFITKREP  406

Query  1198  -VADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLI  1374
              ++ A+  + K Y +TI        + +    + +   A P +   C  CS ++ EELL+
Sbjct  407   FISLADDDENKRYFETI--------VAIEKKIQRTRANAFP-VARSCVVCSGQDAEELLL  457

Query  1375  NCHVCQTRCIHAYCLDPP----LHPWTCIHCQDYQRRF  1476
              C+VC++R +H +CLDPP    L+PW C  C +  RR+
Sbjct  458   VCNVCRSRAVHTFCLDPPRVDALYPWECRVCLEQGRRY  495



>ref|XP_002977557.1| hypothetical protein SELMODRAFT_417401 [Selaginella moellendorffii]
 gb|EFJ21561.1| hypothetical protein SELMODRAFT_417401 [Selaginella moellendorffii]
Length=439

 Score =   100 bits (250),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 87/158 (55%), Gaps = 19/158 (12%)
 Frame = +1

Query  1030  LSCVICWTDFSSS-RGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITK---  1197
             ++CVIC  +  ++  G+L CGH+FCF CI+ W+ Q      T  CPLCK  F  ITK   
Sbjct  290   VACVICHDENQTNVEGVLACGHQFCFDCIKKWS-QHSGSANTPKCPLCKAPFDFITKREP  348

Query  1198  -VADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLI  1374
              ++ A+  + K Y +TI        + +    + +   A P +   C  CS ++ EELL+
Sbjct  349   FISLADDDENKRYFETI--------VAIEKKIQRTRANAFP-VARSCVICSGQDAEELLL  399

Query  1375  NCHVCQTRCIHAYCLDPP----LHPWTCIHCQDYQRRF  1476
              C+VC++R +H +CLDPP    L+PW C  C +  RRF
Sbjct  400   VCNVCRSRAVHTFCLDPPRVDALYPWECRVCLEQGRRF  437



>ref|XP_010429211.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X2 [Camelina sativa]
Length=1097

 Score = 89.4 bits (220),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            V G + +V  ++GYQG +R +++ ++   GGN+   +  + +THL+C++FEG K+ELAK+
Sbjct  105  VPGSKTLVVCLTGYQGQDREDIMAMVDLMGGNFSKPLVANRVTHLICYKFEGEKYELAKR  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
             +   +VNHRW+EDC+K  + +PE  Y
Sbjct  165  MKKIKVVNHRWLEDCLKNWKLLPEVEY  191



>ref|XP_006286902.1| hypothetical protein CARUB_v10000047mg [Capsella rubella]
 gb|EOA19800.1| hypothetical protein CARUB_v10000047mg [Capsella rubella]
Length=1327

 Score = 89.4 bits (220),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            V G   +V  ++GYQG +R +++ ++   GGN+   +  + ITHL+C++FEG K+ELAK+
Sbjct  105  VPGSSTLVVCLTGYQGQDREDIMTMVDLMGGNFSKPLVANRITHLICYKFEGEKYELAKR  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTV  330
             +   +VNHRW+EDC+K  + +PE  Y +
Sbjct  165  MKRIKLVNHRWLEDCLKNWKLLPEVDYEI  193



>ref|XP_009616220.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X1 [Nicotiana tomentosiformis]
Length=1410

 Score = 89.0 bits (219),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 113/228 (50%), Gaps = 11/228 (5%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            ++G + +V  ++GYQG +R +++K++   G N+   +  + +THL+C++FEG K+ELAKK
Sbjct  111  ISGAKSLVVCLTGYQGQDRDDIMKMVGLMGANFSKPLVANKVTHLICYKFEGDKYELAKK  170

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQ  423
             +    VNH W+EDC++    +PE  Y  + G E+  +        E N+    N +  +
Sbjct  171  MKTIKFVNHHWLEDCLRSWEILPEDDYD-KSGYELMMMEAEAKDSEEENEGIAANRRGEK  229

Query  424  IDTEVEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPEP  603
            I     ++   P+    K         L   R LS   +  + S+S S + ++ ++   P
Sbjct  230  IAIMRPDHSKSPNQFLVKQEASTNILDLSTFRGLSGLGNTKELSLSASKQSKSHQV---P  286

Query  604  AVFLKPKKGSMGLPETSLKRRR-----LVKKNISDVLEISDSEELSPQ  732
            A    P + +  L  T+L R +      +++N SD + +S S   SP 
Sbjct  287  AFEESPNRHAKML-NTNLCRTKEELPSRIEQNGSDFVFVSSSARKSPH  333



>ref|XP_010456981.1| PREDICTED: BRCT domain-containing protein At4g02110-like [Camelina 
sativa]
 ref|XP_010456982.1| PREDICTED: BRCT domain-containing protein At4g02110-like [Camelina 
sativa]
Length=220

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 62/90 (69%), Gaps = 1/90 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            V G + +V  ++GYQG +R +++ ++   GGN+   +  + +THL+C++FEG K+ELAK+
Sbjct  105  VPGSKTLVVCLTGYQGQDREDIMAMVDLMGGNFSKPLVANRVTHLICYKFEGEKYELAKR  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTVQ  333
             +   +VNHRW+EDC+K  + +PE  Y ++
Sbjct  165  MKKIKVVNHRWLEDCLKNWKLLPEVEYEIR  194



>ref|XP_010429204.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X1 [Camelina sativa]
Length=1341

 Score = 88.6 bits (218),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            V G + +V  ++GYQG +R +++ ++   GGN+   +  + +THL+C++FEG K+ELAK+
Sbjct  105  VPGSKTLVVCLTGYQGQDREDIMAMVDLMGGNFSKPLVANRVTHLICYKFEGEKYELAKR  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
             +   +VNHRW+EDC+K  + +PE  Y
Sbjct  165  MKKIKVVNHRWLEDCLKNWKLLPEVEY  191



>ref|XP_010652234.1| PREDICTED: BRCT domain-containing protein At4g02110 isoform X2 
[Vitis vinifera]
Length=1153

 Score = 88.6 bits (218),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G E +VA ++GY G +R +++ ++   G  +   +  S +THLVC++FEG K+ELAKK
Sbjct  11   IPGAESLVACLTGYHGQDRDDVMTMVGLMGAQFSKPLVASKVTHLVCYKFEGEKYELAKK  70

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTV  330
             +   +VNHRW+EDC+K  + +PE  Y +
Sbjct  71   LKTIKLVNHRWLEDCLKAWKILPEDNYAM  99



>ref|XP_010652233.1| PREDICTED: BRCT domain-containing protein At4g02110 isoform X1 
[Vitis vinifera]
Length=1247

 Score = 88.2 bits (217),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G E +VA ++GY G +R +++ ++   G  +   +  S +THLVC++FEG K+ELAKK
Sbjct  105  IPGAESLVACLTGYHGQDRDDVMTMVGLMGAQFSKPLVASKVTHLVCYKFEGEKYELAKK  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTV  330
             +   +VNHRW+EDC+K  + +PE  Y +
Sbjct  165  LKTIKLVNHRWLEDCLKAWKILPEDNYAM  193



>ref|XP_009790562.1| PREDICTED: BRCT domain-containing protein At4g02110-like [Nicotiana 
sylvestris]
Length=1410

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/228 (27%), Positives = 113/228 (50%), Gaps = 11/228 (5%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + +V  ++GY G +R +++K++   G N+   +  + +THL+C++FEG K+ELAKK
Sbjct  111  IPGAKSLVVCLTGYTGPDRDDIMKMVGLMGANFSKPLVANKVTHLICYKFEGDKYELAKK  170

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQ  423
            ++   +VNH W+EDC++    +PE  Y  + G E+  +        E N+    N    +
Sbjct  171  TKTIKLVNHHWLEDCLRSWEILPEDDYD-KSGYELMMMEAEAKDSEEENEGIAANRHGEK  229

Query  424  IDTEVEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPEP  603
            I     ++   P+    K         L+  R LS   +  + S+S S + ++ ++   P
Sbjct  230  IAIMGPDHSKSPNQFLVKQEASTNTSDLRTFRGLSGLGNTKELSLSASKQSKSHQV---P  286

Query  604  AVFLKPKKGSMGLPETSLKRRR-----LVKKNISDVLEISDSEELSPQ  732
            A    P + +  L  T+L R +      +++N SD + +S S   SP 
Sbjct  287  AFEESPNRDTKML-NTNLCRTKEELPSSIEQNGSDFVFVSSSARKSPH  333



>emb|CAN62071.1| hypothetical protein VITISV_036193 [Vitis vinifera]
Length=1391

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G E +VA ++GY G +R +++ ++   G  +   +  S +THLVC++FEG K+ELAKK
Sbjct  104  IPGAESLVACLTGYHGQDRDDVMTMVGLMGAQFSKPLVASKVTHLVCYKFEGEKYELAKK  163

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTV  330
             +   +VNHRW+EDC+K  + +PE  Y +
Sbjct  164  LKTIKLVNHRWLEDCLKAWKILPEDNYAM  192



>ref|XP_010424668.1| PREDICTED: BRCT domain-containing protein At4g02110-like [Camelina 
sativa]
Length=1174

 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 67/101 (66%), Gaps = 3/101 (3%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            V G + +V  ++GYQG +R +++ ++   GG++   +  + +THL+C++FEG K+ELAK+
Sbjct  105  VPGSKTLVVCLTGYQGQDREDIMAMVDLMGGHFSKPLVANRVTHLICYKFEGEKYELAKR  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMN  366
             +   +VNHRW+EDC+K  + +PE  Y +  GQ  G L M+
Sbjct  165  MKRIKVVNHRWLEDCLKNWKLLPEVEYEI-SGQN-GSLQMD  203



>ref|XP_010556700.1| PREDICTED: BRCT domain-containing protein At4g02110 [Tarenaya 
hassleriana]
Length=1277

 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G E ++  ++GYQ  +R +++ ++A  GG +   +  + ITHL+C++FEG K+ELAK+
Sbjct  104  IPGAESLIVCLTGYQRHDRDDIMSMVALMGGQFSKPLVANKITHLICYKFEGDKYELAKR  163

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTV  330
             +   IVNHRW+EDC+K  + +PE  Y +
Sbjct  164  IKRIKIVNHRWLEDCLKAWQLLPEADYGI  192



>ref|NP_192120.4| transcription coactivator protein [Arabidopsis thaliana]
 sp|O04251.3|Y4211_ARATH RecName: Full=BRCT domain-containing protein At4g02110 [Arabidopsis 
thaliana]
 gb|AEE82125.1| transcription coactivator protein [Arabidopsis thaliana]
Length=1329

 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 61/89 (69%), Gaps = 1/89 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + +V  ++GYQG +R ++++++   GG +   +  + +THL+C++FEG K+ELAK+
Sbjct  106  IPGSKALVVCLTGYQGHDREDIMRMVELMGGQFSKPLVANRVTHLICYKFEGEKYELAKR  165

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTV  330
             +   +VNHRW+EDC+K  + +PE  Y +
Sbjct  166  IKRIKLVNHRWLEDCLKNWKLLPEVDYEI  194



>ref|XP_011079572.1| PREDICTED: BRCT domain-containing protein At4g02110 [Sesamum 
indicum]
 ref|XP_011079573.1| PREDICTED: BRCT domain-containing protein At4g02110 [Sesamum 
indicum]
Length=1195

 Score = 85.5 bits (210),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 63/95 (66%), Gaps = 2/95 (2%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + +V  ++GYQ  +R +++ ++A  G N+   +  + +THL+C++FEG KFELA+K
Sbjct  111  IPGAKSLVVCLTGYQRQDRDDIMTMVALMGANFSKPLVANKVTHLICYKFEGEKFELARK  170

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEV  348
             +   +VNHRW+EDC++    +PE  Y ++ G E+
Sbjct  171  MKKIKLVNHRWLEDCLRAWELLPEAGY-IKSGYEL  204



>gb|AFW62168.1| hypothetical protein ZEAMMB73_939706 [Zea mays]
Length=80

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +1

Query  1330  VCCQCSSREPEELLINCHVCQTRCIHAYCLDPPLHPWTCIHCQDYQRRFETYR  1488
              C QC  REPEELL++CHVC+++ +H+YCLDPPL PWTC+HC+D +  F  YR
Sbjct  28    ACYQCHFREPEELLLSCHVCRSQWVHSYCLDPPLTPWTCMHCRDLRMLFHRYR  80



>ref|XP_010542843.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X1 [Tarenaya hassleriana]
Length=1108

 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GYQ  +R +++ ++A  GG +   +  + +THLVC++FEG K+ELAK+
Sbjct  105  IPGAKSLIVCLTGYQRQDRDDIMAMVALMGGQFSKPLVANKVTHLVCYKFEGEKYELAKR  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
             +   +VNH+W+EDC+K+ + +PE  Y
Sbjct  165  MKKIKLVNHQWLEDCLKEWKLLPEADY  191



>ref|XP_010542844.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X2 [Tarenaya hassleriana]
Length=1067

 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GYQ  +R +++ ++A  GG +   +  + +THLVC++FEG K+ELAK+
Sbjct  105  IPGAKSLIVCLTGYQRQDRDDIMAMVALMGGQFSKPLVANKVTHLVCYKFEGEKYELAKR  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
             +   +VNH+W+EDC+K+ + +PE  Y
Sbjct  165  MKKIKLVNHQWLEDCLKEWKLLPEADY  191



>emb|CDX90952.1| BnaA03g26320D [Brassica napus]
Length=1216

 Score = 83.2 bits (204),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GYQ  +R +++ ++   GG +   +  + +THL+C++FEG K+ELAK+
Sbjct  104  IPGAKSLIVCLTGYQRQDREDIMTMVDLMGGQFSKPLVANRVTHLICYKFEGEKYELAKR  163

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTV  330
             +   +VNHRW+EDC+K  + +PE  Y +
Sbjct  164  MKRIKLVNHRWLEDCLKNWKLLPEVDYQI  192



>ref|XP_009102821.1| PREDICTED: BRCT domain-containing protein At4g02110 [Brassica 
rapa]
Length=1218

 Score = 83.2 bits (204),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GYQ  +R +++ ++   GG +   +  + +THL+C++FEG K+ELAK+
Sbjct  104  IPGAKSLIVCLTGYQRQDREDIMTMVDLMGGQFSKPLVANRVTHLICYKFEGEKYELAKR  163

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTV  330
             +   +VNHRW+EDC+K  + +PE  Y +
Sbjct  164  MKRIKLVNHRWLEDCLKNWKLLPEVDYEI  192



>gb|EYU46798.1| hypothetical protein MIMGU_mgv1a000275mg [Erythranthe guttata]
Length=1316

 Score = 82.8 bits (203),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + +V  ++GYQ  +R +++ ++A  G N+   +  + +THL+C++FEG K+ELAKK
Sbjct  111  IPGAKSLVVCLTGYQRQDRDDIMTMVALMGANFSKPLVANKVTHLICYKFEGEKYELAKK  170

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
             +   +VNH W+EDC+K    +PE  Y
Sbjct  171  MKRIQLVNHHWLEDCLKAWELLPEANY  197



>ref|XP_006355860.1| PREDICTED: BRCT domain-containing protein At4g02110-like [Solanum 
tuberosum]
Length=1428

 Score = 82.8 bits (203),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 108/227 (48%), Gaps = 9/227 (4%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GYQ  +R +++ ++   G N+   +  + +THL+C++FEG K+ELAKK
Sbjct  108  IPGAKSLIVCLTGYQRQDRDDIMTMVGLMGANFSKPLVANKVTHLICYKFEGEKYELAKK  167

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQ  423
             +   +VNH+W+EDC+K    + E  Y  + G E+  +        + N+    N     
Sbjct  168  MKTIKLVNHQWLEDCLKSWEILSEAEY-AKSGYELDMMEAEAKDSEDENEGIAANRSAET  226

Query  424  IDTEVEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPEP  603
            I     EY   P+    K         L   R LS   +  + S+S S + +++++   P
Sbjct  227  IAIMGPEYPKSPNQFLVKQEASTNISDLNIFRGLSGLGNTKELSLSASKQSKSDQV---P  283

Query  604  AVFLKPKKGSMGLPETSLKRRR----LVKKNISDVLEISDSEELSPQ  732
            A    P +    L     + +      +++N SD++ +S+S   SP 
Sbjct  284  AFEESPNRHDEMLNSNFCRTKEEPPSSMQQNGSDLVSVSNSARKSPH  330



>emb|CDX91805.1| BnaC03g31070D [Brassica napus]
Length=1210

 Score = 82.0 bits (201),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G +  +  ++GYQ  +R +++ ++   GG +   +  + +THL+C++FEG K+ELAK+
Sbjct  105  IPGAKSFIVCLTGYQRQDREDIMTMVELMGGQFSKPLVANRVTHLICYKFEGEKYELAKR  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTV  330
             +   +VNHRW+EDC+K  + +PE  Y +
Sbjct  165  MKRIKLVNHRWLEDCLKNWKLLPEVDYEI  193



>gb|KFK30769.1| hypothetical protein AALP_AA6G023800 [Arabis alpina]
Length=1437

 Score = 82.4 bits (202),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G +++V  ++GYQ  +R +++ ++   G  +   +  + +THL+C++FEG K+ELAK+
Sbjct  104  IPGAKRLVVCLTGYQRQDREDIMTMVDLMGAEFSKPLVANEVTHLICYKFEGEKYELAKR  163

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTV  330
             +   +VNHRW+EDC+K  + +PE  Y +
Sbjct  164  MKTIKLVNHRWLEDCLKNWKLLPEIEYAI  192



>ref|XP_009778218.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X1 [Nicotiana sylvestris]
Length=1109

 Score = 81.6 bits (200),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAM-SVSITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GYQ  +R +++ ++ + G N+   + S  +THL+C++FEG K+ELAKK
Sbjct  111  IPGAKSLILCLTGYQRQDRDDIMTMVGRMGANFSKPLVSHKVTHLICYKFEGEKYELAKK  170

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
             +   +VNH+W+EDC++    +PE  Y
Sbjct  171  LKRIKLVNHQWLEDCLRDWEILPEAAY  197



>ref|XP_009616157.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X1 [Nicotiana tomentosiformis]
Length=1108

 Score = 81.6 bits (200),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAM-SVSITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GYQ  +R +++ ++   G N+   + S  +THL+C++FEG K+ELAKK
Sbjct  111  IPGAKSLILCLTGYQRQDRDDIMTMVGLMGANFSKPLVSHKVTHLICYKFEGEKYELAKK  170

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
             +   +VNHRW+EDC++    +PE  Y
Sbjct  171  LKRIKLVNHRWLEDCLRAWEILPEAAY  197



>emb|CDP07711.1| unnamed protein product [Coffea canephora]
Length=1184

 Score = 81.6 bits (200),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + +V  ++GYQG ER +++ ++   G N+   +  + +THL+C++FEG K++LA++
Sbjct  101  IPGAKSLVVCLTGYQGHERDDIMVMVDLMGANFSKPLVANKVTHLICYKFEGMKYDLARQ  160

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
             +   +VNHRW+EDC++  + +PE  Y
Sbjct  161  IKRIKLVNHRWLEDCLRTWQILPEDDY  187



>ref|XP_010921524.1| PREDICTED: BRCT domain-containing protein At4g02110 [Elaeis guineensis]
Length=1181

 Score = 81.3 bits (199),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 58/88 (66%), Gaps = 2/88 (2%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G E +   ++GYQ  ER +++K+++  GG +   +  + +THL+C++FEG K+ELAKK
Sbjct  111  IPGSESLFICLTGYQRPERDDIMKMVSLMGGRFSKPLIANQVTHLICYKFEGEKYELAKK  170

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYT  327
              N  +VNHRW+EDC+K    +P   YT
Sbjct  171  V-NIKLVNHRWLEDCLKAWEILPTDDYT  197



>ref|XP_006396410.1| hypothetical protein EUTSA_v10028365mg [Eutrema salsugineum]
 gb|ESQ37863.1| hypothetical protein EUTSA_v10028365mg [Eutrema salsugineum]
Length=1324

 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + +V  ++GYQ  +R +++ ++   GG +   +  + +THL+C++FEG K+ELAK+
Sbjct  105  IPGSKSLVVCLTGYQRQDREDIMTMVDLMGGQFSKPLVANRVTHLICYKFEGEKYELAKR  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTV  330
             +   +VNHRW+E C+K  + +PE  Y +
Sbjct  165  MKRIKLVNHRWLEHCLKNWKLLPEADYEI  193



>ref|XP_010679354.1| PREDICTED: BRCT domain-containing protein At4g02110 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=1481

 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G  +++  ++GYQG +R +++ ++   G ++   +  + +THL+C++FEG K+ELAKK
Sbjct  102  IPGANELLICLTGYQGADREDIMMMVRLMGAHFSKPLLANKVTHLICYKFEGEKYELAKK  161

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTV  330
                 +VNH W+EDC+K  + +PE  Y +
Sbjct  162  MNYAKLVNHLWLEDCLKAWKILPEESYNI  190



>ref|XP_010679355.1| PREDICTED: BRCT domain-containing protein At4g02110 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=1470

 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G  +++  ++GYQG +R +++ ++   G ++   +  + +THL+C++FEG K+ELAKK
Sbjct  102  IPGANELLICLTGYQGADREDIMMMVRLMGAHFSKPLLANKVTHLICYKFEGEKYELAKK  161

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTV  330
                 +VNH W+EDC+K  + +PE  Y +
Sbjct  162  MNYAKLVNHLWLEDCLKAWKILPEESYNI  190



>ref|XP_008451492.1| PREDICTED: BRCT domain-containing protein At4g02110 isoform X1 
[Cucumis melo]
Length=1376

 Score = 79.7 bits (195),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GYQ  +R +++ ++   G  +   +  + +THL+C++FEG K+ELAK+
Sbjct  106  IPGAKSLIMCLTGYQRQDRDDVMTMVGLIGAQFSKPLVANKVTHLICYKFEGDKYELAKR  165

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTV  330
             R   +VNHRW+EDC+++   +PE  Y +
Sbjct  166  LRTIKLVNHRWLEDCLREWMLLPESNYNM  194



>ref|XP_003057818.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57769.1| predicted protein [Micromonas pusilla CCMP1545]
Length=1201

 Score = 79.3 bits (194),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 37/91 (41%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = +1

Query  73   GMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRN  252
             M+ +   V+GY G  R  LIK+  + G  Y+  +    THLVC+ FEG K+  A ++  
Sbjct  124  AMKDLKVCVTGYTGDRRTQLIKITERLGAEYMRVLDRKSTHLVCYEFEGAKWAKANQTGI  183

Query  253  TFIVNHRWIEDCIKKGRRVPEHPYTVQCGQE  345
              +V+H W+EDC+KK  R+PE PYT + G+E
Sbjct  184  QRVVSHAWLEDCLKKWTRLPEEPYTHRSGKE  214



>ref|XP_010259356.1| PREDICTED: BRCT domain-containing protein At4g02110 [Nelumbo 
nucifera]
Length=1264

 Score = 79.3 bits (194),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + +   ++GYQ  +R +++K++   G ++   +  + +THL+C++FEG K+ELAKK
Sbjct  111  IPGAKALSICLTGYQRQDREDIMKMVGLMGAHFSKPLVANKVTHLICYKFEGEKYELAKK  170

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
             +   +VNHRW+EDC++    +PE  Y
Sbjct  171  MKKIKLVNHRWLEDCLRAWEILPEGSY  197



>ref|XP_008650963.1| PREDICTED: uncharacterized protein LOC100216554 isoform X1 [Zea 
mays]
 tpg|DAA64229.1| TPA: hypothetical protein ZEAMMB73_629903 [Zea mays]
Length=1342

 Score = 79.3 bits (194),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 64/95 (67%), Gaps = 3/95 (3%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSI-THLVCWRFEGRKFELAKK  243
            + G +K+   ++GYQ   R +++K+++  G N+  +++ +I THL+C++FEG K+ELAK+
Sbjct  110  IPGCDKLHICLTGYQKNWRDDIMKMVSLMGANFSKSLAANIITHLICYKFEGEKYELAKR  169

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEV  348
              N  +VNHRW+E+C+K    +P   YT + G EV
Sbjct  170  V-NIKLVNHRWLEECLKAWEILPVDHYT-KSGWEV  202



>ref|XP_006444467.1| hypothetical protein CICLE_v100245902mg, partial [Citrus clementina]
 gb|ESR57707.1| hypothetical protein CICLE_v100245902mg, partial [Citrus clementina]
Length=192

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G   +V  ++GYQ  +R +++ L+   G  +   +  + +THL+C++FEG K+ELAKK
Sbjct  104  IHGANSLVMCLTGYQRQDREDIMTLVRLMGSQFSKPLVANKVTHLICYKFEGEKYELAKK  163

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
             ++  +VNHRW+EDC++    +PE  Y
Sbjct  164  IKSIKLVNHRWLEDCLRVWELLPEVNY  190



>ref|XP_010038278.1| PREDICTED: BRCT domain-containing protein At4g02110 [Eucalyptus 
grandis]
Length=1226

 Score = 79.0 bits (193),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 56/88 (64%), Gaps = 1/88 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G E ++  ++GYQ  +R +++ ++   G  +   +  + +THL+C++FEG K+ELAKK
Sbjct  105  IPGAEGLIMCLTGYQRQDRDDIMTMVGLMGAQFSKPLVANKVTHLICYKFEGEKYELAKK  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYT  327
                 +VNHRW+EDC++    +PE  Y+
Sbjct  165  IMTIKLVNHRWLEDCLRDWEILPEDNYS  192



>ref|XP_006349254.1| PREDICTED: BRCT domain-containing protein At4g02110-like [Solanum 
tuberosum]
Length=1214

 Score = 78.6 bits (192),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GYQ  +R +++ ++   G N+   +  + +THL+C++FEG K+ELAKK
Sbjct  110  IPGAKSLILCLTGYQRQDRDDIMIMVGLMGANFSKPLVANKVTHLICYKFEGEKYELAKK  169

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
             +   +VNH W+EDC++    +PE  Y
Sbjct  170  MKKIKLVNHLWLEDCLRAWEILPEASY  196



>ref|XP_008781324.1| PREDICTED: LOW QUALITY PROTEIN: BRCT domain-containing protein 
At4g02110 [Phoenix dactylifera]
Length=1180

 Score = 78.6 bits (192),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 57/88 (65%), Gaps = 2/88 (2%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G E +   ++GYQ  ER +++K+++  G  +   +  + +THL+C++FEG K+ELAKK
Sbjct  111  IPGSESLFICLTGYQRPERDDIMKMVSLMGARFSKPLIANQVTHLICYKFEGEKYELAKK  170

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYT  327
              N  +VNHRW+EDC+K    +P   YT
Sbjct  171  V-NIKLVNHRWLEDCLKAWEILPIDDYT  197



>ref|XP_008369115.1| PREDICTED: BRCT domain-containing protein At4g02110-like [Malus 
domestica]
Length=1241

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            +   ++++  ++GYQ  +R +++ ++   G  +   +  + +THLVC++FEG K+ELAKK
Sbjct  105  IPDAKRLIVCLTGYQRQDRDDIMTMVGLMGAQFSKPLVANKVTHLVCYKFEGEKYELAKK  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTV  330
                 +VNHRW+EDC++  + +PE  Y +
Sbjct  165  IPKMKLVNHRWLEDCLRDWQLLPEXNYNI  193



>ref|XP_010321873.1| PREDICTED: BRCT domain-containing protein At4g02110 [Solanum 
lycopersicum]
Length=1237

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 106/227 (47%), Gaps = 9/227 (4%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GYQ  +R +++ ++   G N+   +  + +THL+C++FEG K+ELAKK
Sbjct  104  IPGAKSLIVCLTGYQRQDRDDIMTMVGLMGANFSKPLVANKVTHLICYKFEGEKYELAKK  163

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNHKEPQ  423
             +   +VNH+W+EDC+K    + E  Y  + G E+  +        + N+    N     
Sbjct  164  MKTIKLVNHQWLEDCLKSWEILSEAEYD-KSGYELEMMEAEAKDSEDENEGIAANRSAET  222

Query  424  IDTEVEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMSGSWRMETEELSPEP  603
            I     E    P+    K         L   R  S   +  + S+S S + +++++   P
Sbjct  223  IAIMGPENPKSPNQFFVKQEASTNISGLNTSRGSSGLGNRKELSLSASKQSKSDQV---P  279

Query  604  AVFLKPKKGSMGLPETSLKRRR----LVKKNISDVLEISDSEELSPQ  732
            A    P +    L     + +      +++N SD++ +S+S   SP 
Sbjct  280  AFEESPNRHDEMLNSNFYRTKEEPPSSMQQNGSDLVSVSNSARKSPH  326



>ref|XP_009378696.1| PREDICTED: BRCT domain-containing protein At4g02110 isoform X1 
[Pyrus x bretschneideri]
Length=1238

 Score = 77.8 bits (190),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            +   ++++  ++GYQ  +R +++ ++   G  +   +  + +THLVC++FEG K+ELAKK
Sbjct  105  IPDAKRLIVCLTGYQRQDRDDIMTMVGLMGARFSKPLVANKVTHLVCYKFEGEKYELAKK  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTV  330
                 +VNHRW+EDC++  + +PE  Y +
Sbjct  165  IPKMKLVNHRWLEDCLRDWQLLPEDNYNI  193



>ref|XP_009378697.1| PREDICTED: BRCT domain-containing protein At4g02110 isoform X2 
[Pyrus x bretschneideri]
Length=1201

 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            +   ++++  ++GYQ  +R +++ ++   G  +   +  + +THLVC++FEG K+ELAKK
Sbjct  105  IPDAKRLIVCLTGYQRQDRDDIMTMVGLMGARFSKPLVANKVTHLVCYKFEGEKYELAKK  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTV  330
                 +VNHRW+EDC++  + +PE  Y +
Sbjct  165  IPKMKLVNHRWLEDCLRDWQLLPEDNYNI  193



>ref|XP_002515302.1| DNA replication regulator dpb11, putative [Ricinus communis]
 gb|EEF47286.1| DNA replication regulator dpb11, putative [Ricinus communis]
Length=1069

 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 57/88 (65%), Gaps = 1/88 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GYQ  +R +++ +++  G  +   +  + +THL+C++FEG K+ELA K
Sbjct  104  IPGAKSLIMCLTGYQRQDRDDIMTMVSLMGAQFSKPLVANKVTHLICYKFEGEKYELANK  163

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYT  327
             +   +VNHRW+EDC++    +PE  Y+
Sbjct  164  LKKIKLVNHRWLEDCLRDWELLPEDNYS  191



>gb|KDO87037.1| hypothetical protein CISIN_1g000734mg [Citrus sinensis]
Length=1239

 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G   +V  ++GYQ  +R +++ L+   G  +   +  + +THL+C++FEG K+ELAKK
Sbjct  19   IHGANSLVMCLTGYQRQDREDIMTLVRLMGSQFSKPLVANKVTHLICYKFEGEKYELAKK  78

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
             ++  +VNHRW+EDC++    +PE  Y
Sbjct  79   IKSIKLVNHRWLEDCLRVWELLPEVNY  105



>gb|KGN45004.1| hypothetical protein Csa_7G407570 [Cucumis sativus]
Length=1175

 Score = 77.0 bits (188),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + +V  ++GYQ  +R +++ ++   G  +   +  + +THL+C++FEG K+ELAK+
Sbjct  106  IPGAKSLVMCLTGYQRQDRDDVMTMVGLIGAQFSKPLVANKVTHLICYKFEGDKYELAKR  165

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTV  330
             R   +VNHRW+ED +++   +PE  Y +
Sbjct  166  LRTIKLVNHRWLEDSLREWMLLPESNYNI  194



>gb|KDO87036.1| hypothetical protein CISIN_1g000734mg [Citrus sinensis]
Length=1324

 Score = 77.0 bits (188),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G   +V  ++GYQ  +R +++ L+   G  +   +  + +THL+C++FEG K+ELAKK
Sbjct  104  IHGANSLVMCLTGYQRQDREDIMTLVRLMGSQFSKPLVANKVTHLICYKFEGEKYELAKK  163

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
             ++  +VNHRW+EDC++    +PE  Y
Sbjct  164  IKSIKLVNHRWLEDCLRVWELLPEVNY  190



>ref|XP_006492314.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X1 [Citrus sinensis]
Length=1317

 Score = 77.0 bits (188),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G   +V  ++GYQ  +R +++ L+   G  +   +  + +THL+C++FEG K+ELAKK
Sbjct  104  IHGANSLVMCLTGYQRQDREDIMTLVRLMGSQFSKPLVANKVTHLICYKFEGEKYELAKK  163

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
             ++  +VNHRW+EDC++    +PE  Y
Sbjct  164  IKSIKLVNHRWLEDCLRVWELLPEVNY  190



>ref|XP_006492315.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X2 [Citrus sinensis]
Length=1277

 Score = 77.0 bits (188),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G   +V  ++GYQ  +R +++ L+   G  +   +  + +THL+C++FEG K+ELAKK
Sbjct  104  IHGANSLVMCLTGYQRQDREDIMTLVRLMGSQFSKPLVANKVTHLICYKFEGEKYELAKK  163

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
             ++  +VNHRW+EDC++    +PE  Y
Sbjct  164  IKSIKLVNHRWLEDCLRVWELLPEVNY  190



>ref|XP_004136156.1| PREDICTED: uncharacterized protein LOC101219784 [Cucumis sativus]
Length=1372

 Score = 76.6 bits (187),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + +V  ++GYQ  +R +++ ++   G  +   +  + +THL+C++FEG K+ELAK+
Sbjct  106  IPGAKSLVMCLTGYQRQDRDDVMTMVGLIGAQFSKPLVANKVTHLICYKFEGDKYELAKR  165

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTV  330
             R   +VNHRW+ED +++   +PE  Y +
Sbjct  166  LRTIKLVNHRWLEDSLREWMLLPESNYNI  194



>gb|EAY89682.1| hypothetical protein OsI_11217 [Oryza sativa Indica Group]
Length=1412

 Score = 76.6 bits (187),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 61/93 (66%), Gaps = 6/93 (6%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSI-THLVCWRFEGRKFELAKK  243
            +AG E +   ++GYQ ++R +++ +++  G  +  +++  + THL+C++FEG K+E AKK
Sbjct  110  IAGSESLRICLTGYQRSDREDIMSMVSLMGAQFSKSLNPDVVTHLICYKFEGEKYEAAKK  169

Query  244  SRNTF-----IVNHRWIEDCIKKGRRVPEHPYT  327
            ++  F     +VNHRW+EDC+K  + +P   Y+
Sbjct  170  AKLKFNFNIKLVNHRWLEDCLKCWKILPVDDYS  202



>ref|NP_001049876.1| Os03g0304400 [Oryza sativa Japonica Group]
 gb|ABF95512.1| BRCA1 C Terminus domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11790.1| Os03g0304400 [Oryza sativa Japonica Group]
 gb|EAZ26639.1| hypothetical protein OsJ_10544 [Oryza sativa Japonica Group]
Length=1462

 Score = 76.3 bits (186),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 61/93 (66%), Gaps = 6/93 (6%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSI-THLVCWRFEGRKFELAKK  243
            +AG E +   ++GYQ ++R +++ +++  G  +  +++  + THL+C++FEG K+E AKK
Sbjct  110  IAGSESLRICLTGYQRSDREDIMSMVSLMGAQFSKSLNPDVVTHLICYKFEGEKYEAAKK  169

Query  244  SRNTF-----IVNHRWIEDCIKKGRRVPEHPYT  327
            ++  F     +VNHRW+EDC+K  + +P   Y+
Sbjct  170  AKLKFNFNIKLVNHRWLEDCLKCWKILPVDDYS  202



>ref|XP_003535960.2| PREDICTED: BRCT domain-containing protein At4g02110-like [Glycine 
max]
Length=1318

 Score = 75.9 bits (185),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GY   +R +++ ++   G  +   +  + +THL+C++FEG K+ELAKK
Sbjct  105  IPGAKDLIMCLTGYLRQDRDDIMTMVGLMGAQFSKPLVANKVTHLICYKFEGEKYELAKK  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
                 +VNHRW+EDC+K+   +PE  Y
Sbjct  165  LGTIKLVNHRWLEDCLKEWVLLPEDKY  191



>ref|XP_008451493.1| PREDICTED: BRCT domain-containing protein At4g02110 isoform X2 
[Cucumis melo]
Length=1263

 Score = 75.9 bits (185),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +1

Query  97   VSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKKSRNTFIVNHR  273
            ++GYQ  +R +++ ++   G  +   +  + +THL+C++FEG K+ELAK+ R   +VNHR
Sbjct  3    LTGYQRQDRDDVMTMVGLIGAQFSKPLVANKVTHLICYKFEGDKYELAKRLRTIKLVNHR  62

Query  274  WIEDCIKKGRRVPEHPYTV  330
            W+EDC+++   +PE  Y +
Sbjct  63   WLEDCLREWMLLPESNYNM  81



>ref|XP_003591424.1| BRCT domain-containing protein [Medicago truncatula]
 gb|AES61675.1| DNA replication regulator dpb11, putative [Medicago truncatula]
Length=1346

 Score = 75.5 bits (184),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + +V  ++GY   +R +++ ++   G  +   +  + +THL+C++FEG K+ELAK+
Sbjct  105  IPGAKDLVVCLTGYLRQDRDDIMTMVGLMGAQFSKPLVANKVTHLICYKFEGEKYELAKR  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
                 +VNHRW+EDC+K    +PE  Y
Sbjct  165  LATIKLVNHRWLEDCLKDWVLLPEDKY  191



>ref|XP_009616158.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X2 [Nicotiana tomentosiformis]
Length=1093

 Score = 75.5 bits (184),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAM-SVSITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GYQ  +R +++ ++   G N+   + S  +THL+C++FEG K+ELAKK
Sbjct  111  IPGAKSLILCLTGYQRQDRDDIMTMVGLMGANFSKPLVSHKVTHLICYKFEGEKYELAKK  170

Query  244  SRNTFIVNHRWIEDC  288
             +   +VNHRW+EDC
Sbjct  171  LKRIKLVNHRWLEDC  185



>gb|KEH43208.1| DNA replication regulator dpb11, putative [Medicago truncatula]
Length=1243

 Score = 75.5 bits (184),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + +V  ++GY   +R +++ ++   G  +   +  + +THL+C++FEG K+ELAK+
Sbjct  105  IPGAKDLVVCLTGYLRQDRDDIMTMVGLMGAQFSKPLVANKVTHLICYKFEGEKYELAKR  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
                 +VNHRW+EDC+K    +PE  Y
Sbjct  165  LATIKLVNHRWLEDCLKDWVLLPEDKY  191



>gb|KHN30648.1| BRCT domain-containing protein [Glycine soja]
Length=1319

 Score = 75.5 bits (184),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GY   +R +++ ++   G  +   +  + +THL+C++FEG K+ELAKK
Sbjct  105  IPGAKDLIMCLTGYLRQDRDDIMTMVGLMGAQFSKPLVANKVTHLICYKFEGEKYELAKK  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
                 +VNHRW+EDC+K+   +PE  Y
Sbjct  165  LGTIKLVNHRWLEDCLKEWVLLPEDNY  191



>ref|XP_004301808.1| PREDICTED: uncharacterized protein LOC101306440 [Fragaria vesca 
subsp. vesca]
Length=1367

 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G   ++  ++GY G +R +++ ++A  G  +   +  S +THL+C++FEG K+ LAK+
Sbjct  105  IPGARNLLMCLTGYHGQDRDDIMTMVALMGAQFSKPLVASKVTHLICYKFEGEKYRLAKQ  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEV  348
                 IVNHRW+EDC++    + E  Y  Q G E+
Sbjct  165  LPQIKIVNHRWLEDCLRDWVLLREDNYN-QSGYEL  198



>ref|XP_009414151.1| PREDICTED: BRCT domain-containing protein At4g02110 [Musa acuminata 
subsp. malaccensis]
Length=1159

 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 57/88 (65%), Gaps = 2/88 (2%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + +   ++GYQ  ER +++K+++  G  +   +  + +THL+C++FEG K+ELAKK
Sbjct  111  IPGSKSLHICLTGYQRQERDDIMKMVSLMGAKFSKPLIANQVTHLICYKFEGEKYELAKK  170

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYT  327
              N  +VNHRW+EDC+K    +P   YT
Sbjct  171  V-NIKLVNHRWLEDCLKAWAILPIDNYT  197



>ref|XP_006855301.1| hypothetical protein AMTR_s00057p00057240 [Amborella trichopoda]
 gb|ERN16768.1| hypothetical protein AMTR_s00057p00057240 [Amborella trichopoda]
Length=1226

 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + +   ++GYQ  ER +++K++   G  +   +  S +THLVC++FEG K+ LAKK
Sbjct  109  IRGCQSMHICLTGYQKQERSDIMKMVDLMGAQFTKPLIASKVTHLVCYKFEGEKYNLAKK  168

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTV  330
                 ++NHRW+EDC+K    +PE  Y +
Sbjct  169  -LGIKLINHRWLEDCLKAWDILPEDRYRI  196



>ref|XP_008235221.1| PREDICTED: BRCT domain-containing protein At4g02110 [Prunus mume]
Length=1232

 Score = 74.7 bits (182),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            +   + ++  ++GYQ  +R +++ ++   G  +   +  + +THL+C++FEG K+ELAKK
Sbjct  105  IPDAKSLIVCLTGYQRQDRDDIMTMVGLMGAQFSKPLVANKVTHLICYKFEGEKYELAKK  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
                 +VNHRW+EDC++    +PE  Y
Sbjct  165  IPKIKLVNHRWLEDCLRDWALLPEDDY  191



>ref|XP_011042232.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X1 [Populus euphratica]
Length=1147

 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +1

Query  85   VVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKKSRNTFI  261
            +   ++GYQ  +R +++ ++   G ++   +  + +THL+C++FEG K+ELA K +   +
Sbjct  111  LTVCLTGYQRQDRDDIMTMVGLMGAHFSKPLVANRVTHLICYKFEGEKYELANKMKKIKL  170

Query  262  VNHRWIEDCIKKGRRVPEHPYT  327
            VNHRW+EDC++    +PE  Y+
Sbjct  171  VNHRWLEDCLRNWELLPEDNYS  192



>ref|XP_002301504.2| BRCT domain-containing family protein [Populus trichocarpa]
 gb|EEE80777.2| BRCT domain-containing family protein [Populus trichocarpa]
Length=1221

 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +1

Query  85   VVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKKSRNTFI  261
            +   ++GYQ  +R +++ ++   G ++   +  + +THL+C++FEG K+ELA K +   +
Sbjct  111  ITMCLTGYQRQDRDDIMTMVGLMGAHFSKPLVANRVTHLICYKFEGEKYELANKMKKMKL  170

Query  262  VNHRWIEDCIKKGRRVPEHPYT  327
            VNHRW+EDC++    +PE  Y+
Sbjct  171  VNHRWLEDCLRNWELLPEDNYS  192



>ref|XP_008654787.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X3 [Zea mays]
Length=1498

 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 59/88 (67%), Gaps = 2/88 (2%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAM-SVSITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GYQ   R +++K+++  G  +   + + ++THLVC++FEG K+E+AKK
Sbjct  110  IPGAQSLLICLTGYQKRYREDMMKMVSLMGARFSKPLIANAVTHLVCYKFEGEKYEVAKK  169

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYT  327
              N  +VNH+W+EDC+K  + +P   Y+
Sbjct  170  V-NIKLVNHQWLEDCLKAWKILPVSDYS  196



>ref|XP_008654782.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X2 [Zea mays]
Length=1500

 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 59/88 (67%), Gaps = 2/88 (2%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAM-SVSITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GYQ   R +++K+++  G  +   + + ++THLVC++FEG K+E+AKK
Sbjct  110  IPGAQSLLICLTGYQKRYREDMMKMVSLMGARFSKPLIANAVTHLVCYKFEGEKYEVAKK  169

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYT  327
              N  +VNH+W+EDC+K  + +P   Y+
Sbjct  170  V-NIKLVNHQWLEDCLKAWKILPVSDYS  196



>ref|XP_008654775.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X1 [Zea mays]
Length=1501

 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 59/88 (67%), Gaps = 2/88 (2%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAM-SVSITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GYQ   R +++K+++  G  +   + + ++THLVC++FEG K+E+AKK
Sbjct  110  IPGAQSLLICLTGYQKRYREDMMKMVSLMGARFSKPLIANAVTHLVCYKFEGEKYEVAKK  169

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYT  327
              N  +VNH+W+EDC+K  + +P   Y+
Sbjct  170  V-NIKLVNHQWLEDCLKAWKILPVSDYS  196



>ref|XP_008654789.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X4 [Zea mays]
Length=1476

 Score = 73.9 bits (180),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 59/88 (67%), Gaps = 2/88 (2%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAM-SVSITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GYQ   R +++K+++  G  +   + + ++THLVC++FEG K+E+AKK
Sbjct  85   IPGAQSLLICLTGYQKRYREDMMKMVSLMGARFSKPLIANAVTHLVCYKFEGEKYEVAKK  144

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYT  327
              N  +VNH+W+EDC+K  + +P   Y+
Sbjct  145  V-NIKLVNHQWLEDCLKAWKILPVSDYS  171



>ref|XP_003518848.2| PREDICTED: BRCT domain-containing protein At4g02110-like [Glycine 
max]
Length=1319

 Score = 73.9 bits (180),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GY   +R +++ ++   G  +   +  + +THL+C++FEG K+ELA K
Sbjct  105  IPGAKDLIMCLTGYLRQDRDDIMTMVGLMGAQFSKPLVANKVTHLICYKFEGEKYELANK  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
                 +VNHRW+EDC+K+   +PE  Y
Sbjct  165  LGTIKLVNHRWLEDCLKEWVLLPEDKY  191



>gb|KHN08647.1| BRCT domain-containing protein [Glycine soja]
Length=1319

 Score = 73.9 bits (180),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GY   +R +++ ++   G  +   +  + +THL+C++FEG K+ELA K
Sbjct  105  IPGAKDLIMCLTGYLRQDRDDIMTMVGLMGAQFSKPLVANKVTHLICYKFEGEKYELANK  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
                 +VNHRW+EDC+K+   +PE  Y
Sbjct  165  LGTIKLVNHRWLEDCLKEWVLLPEDKY  191



>ref|XP_004495912.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X2 [Cicer arietinum]
Length=1094

 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAM-SVSITHLVCWRFEGRKFELAKK  243
            + G + +   ++GY   +R +++ ++   G  +   + +  +THLVC++FEG K+ELAK+
Sbjct  105  IPGAKNLTVCLTGYLRQDRDDIMTMVELMGAQFSKPLVATKVTHLVCYKFEGEKYELAKR  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
                 +VNH W+EDC+K  + +PE  Y
Sbjct  165  LATIKLVNHHWLEDCLKNWKILPEEKY  191



>ref|XP_004495911.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X1 [Cicer arietinum]
Length=1242

 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAM-SVSITHLVCWRFEGRKFELAKK  243
            + G + +   ++GY   +R +++ ++   G  +   + +  +THLVC++FEG K+ELAK+
Sbjct  105  IPGAKNLTVCLTGYLRQDRDDIMTMVELMGAQFSKPLVATKVTHLVCYKFEGEKYELAKR  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
                 +VNH W+EDC+K  + +PE  Y
Sbjct  165  LATIKLVNHHWLEDCLKNWKILPEEKY  191



>ref|XP_002960239.1| hypothetical protein SELMODRAFT_437359 [Selaginella moellendorffii]
 gb|EFJ37778.1| hypothetical protein SELMODRAFT_437359 [Selaginella moellendorffii]
Length=812

 Score = 72.8 bits (177),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 68/135 (50%), Gaps = 12/135 (9%)
 Frame = +1

Query  61   ARVAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSV-SITHLVCWRFEGRKFELA  237
            A + G +KV   ++GYQ   R  +  ++A  G ++   +    +THLVC++FEG K+ELA
Sbjct  78   AGIPGAKKVCVCLTGYQSASRREIEAMVAMMGASFTKPLDARKVTHLVCYKFEGDKYELA  137

Query  238  KKSRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQ-EVGPLLMNITQVGEGNQSSGCNHK  414
            +  +   +VNHRW+EDC++    V E  Y +     E+        QV E  Q +  N  
Sbjct  138  EHMK-LKLVNHRWLEDCLRTWSLVDEANYRISAHDLEIAEAQAKDAQVSE--QPNETNAA  194

Query  415  EPQIDTEVEEYFPDP  459
             P+I        PDP
Sbjct  195  PPEI-------APDP  202



>ref|XP_002500112.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61370.1| predicted protein [Micromonas sp. RCC299]
Length=1256

 Score = 72.8 bits (177),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 35/90 (39%), Positives = 52/90 (58%), Gaps = 0/90 (0%)
 Frame = +1

Query  76   MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
            M  V   V+GY G  R  LI +    G  Y+  +    THLVC+ FEG K+  A ++   
Sbjct  127  MANVRVCVTGYTGERRQQLIDMCKSLGCEYMRVLDRKSTHLVCYEFEGAKWAKANQTGLQ  186

Query  256  FIVNHRWIEDCIKKGRRVPEHPYTVQCGQE  345
             IV+HRW+E+C+++ +R+ E PYT   G+E
Sbjct  187  RIVSHRWLEECLRQWKRLDETPYTTHSGRE  216



>ref|XP_006649951.1| PREDICTED: uncharacterized protein LOC102719748 [Oryza brachyantha]
Length=1460

 Score = 72.8 bits (177),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 58/93 (62%), Gaps = 6/93 (6%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSI-THLVCWRFEGRKFELAKK  243
            +AG E +   ++GYQ   R +++ +++  G  +  +++  + THL+C++FEG K+E AKK
Sbjct  110  IAGSETLHICLTGYQRNGREDIMNMVSLMGAQFSKSLTPGVATHLICYKFEGEKYEAAKK  169

Query  244  SRNTF-----IVNHRWIEDCIKKGRRVPEHPYT  327
             +  +     +VNHRW+EDC+K  + +P   Y+
Sbjct  170  VKLKYNLDIKLVNHRWLEDCLKSWKILPVDDYS  202



>ref|XP_002452280.1| hypothetical protein SORBIDRAFT_04g022946 [Sorghum bicolor]
 gb|EES05256.1| hypothetical protein SORBIDRAFT_04g022946 [Sorghum bicolor]
Length=98

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +1

Query  166  VGAMSVSITHLVCWRFEGRKFELAKKSRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQE  345
            +G+MS SI HLVCWR +G+K+   ++     +V+H W  +C+++GRR+ E PY +  G E
Sbjct  26   LGSMSRSIIHLVCWRLKGKKYVRHREEAGDLLVSHCWFTECLREGRRLAEDPYLMVSGGE  85

Query  346  VGPL  357
             GP+
Sbjct  86   AGPI  89



>ref|XP_007199477.1| hypothetical protein PRUPE_ppa027200mg [Prunus persica]
 gb|EMJ00676.1| hypothetical protein PRUPE_ppa027200mg [Prunus persica]
Length=1235

 Score = 72.4 bits (176),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            +   + ++  ++GYQ  +R +++ ++   G  +   +  + +THL+C++FEG K+ELAKK
Sbjct  105  IPDAKSLIVCLTGYQRQDRDDIMTMVGLMGAQFSKPLVANKVTHLICYKFEGEKYELAKK  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
                 +VNH W+EDC++    +PE  Y
Sbjct  165  IPKIKLVNHHWLEDCLRDWALLPEDDY  191



>ref|XP_004958775.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X1 [Setaria italica]
Length=1419

 Score = 72.4 bits (176),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 63/95 (66%), Gaps = 3/95 (3%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G +++   ++GYQ + R +++++++  G ++  ++  S  THL+C++FEG K+ELA++
Sbjct  108  IPGSDELHICLTGYQKSWREDIMRMVSLMGAHFSKSLRASEDTHLICYKFEGEKYELARQ  167

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEV  348
              N  IVNHRW+E+C+K    +P   YT + G EV
Sbjct  168  V-NIKIVNHRWLEECLKAWEILPVDDYT-KSGWEV  200



>ref|XP_004958776.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X2 [Setaria italica]
Length=1408

 Score = 72.4 bits (176),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 63/95 (66%), Gaps = 3/95 (3%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G +++   ++GYQ + R +++++++  G ++  ++  S  THL+C++FEG K+ELA++
Sbjct  108  IPGSDELHICLTGYQKSWREDIMRMVSLMGAHFSKSLRASEDTHLICYKFEGEKYELARQ  167

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEV  348
              N  IVNHRW+E+C+K    +P   YT + G EV
Sbjct  168  V-NIKIVNHRWLEECLKAWEILPVDDYT-KSGWEV  200



>ref|XP_002967474.1| hypothetical protein SELMODRAFT_408510 [Selaginella moellendorffii]
 gb|EFJ32073.1| hypothetical protein SELMODRAFT_408510 [Selaginella moellendorffii]
Length=811

 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 68/135 (50%), Gaps = 12/135 (9%)
 Frame = +1

Query  61   ARVAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSV-SITHLVCWRFEGRKFELA  237
            A + G +KV   ++GYQ   R  +  ++A  G ++   +    +THLVC++FEG K+ELA
Sbjct  78   AGIPGAKKVCVCLTGYQSASRREIEAMVAMMGASFTKPLDARKVTHLVCYKFEGDKYELA  137

Query  238  KKSRNTFIVNHRWIEDCIKKGRRVPEHPYTVQCGQ-EVGPLLMNITQVGEGNQSSGCNHK  414
            +  +   +VNHRW+EDC++    V E  Y +     E+        QV E  Q +  N  
Sbjct  138  EHMK-LKLVNHRWLEDCLRTWSLVDEANYRISGHDLEIAEAQAKDAQVSE--QPNETNAA  194

Query  415  EPQIDTEVEEYFPDP  459
             P+I        PDP
Sbjct  195  PPEI-------APDP  202



>ref|XP_003559756.1| PREDICTED: BRCT domain-containing protein At4g02110 [Brachypodium 
distachyon]
Length=1377

 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 55/88 (63%), Gaps = 2/88 (2%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSI-THLVCWRFEGRKFELAKK  243
            + G + +   ++GYQ   R +++K++   G N+  ++     THL+C++FEG K+ELAK+
Sbjct  112  IPGSQSLNICLTGYQKNRREDIMKMVTLMGANFSKSLVAGTSTHLICYKFEGEKYELAKR  171

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYT  327
              +  +VNHRW+EDC++    +P   YT
Sbjct  172  V-DIKLVNHRWLEDCLEAWEILPIDNYT  198



>ref|XP_004987034.1| PREDICTED: BRCT domain-containing protein At4g02110-like [Setaria 
italica]
Length=1511

 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 57/88 (65%), Gaps = 2/88 (2%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSI-THLVCWRFEGRKFELAKK  243
            + G + ++  ++GYQ   R  ++K+++  G  +  ++  ++ THL+C++FEG K+E+AKK
Sbjct  110  IPGAQSLLICLTGYQRNYREYIMKMVSLMGARFSKSLIANVVTHLICYKFEGEKYEVAKK  169

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYT  327
              N  +VNH+W+EDC+K    +P   Y+
Sbjct  170  V-NIKLVNHQWLEDCLKAWEILPVDDYS  196



>ref|XP_007145159.1| hypothetical protein PHAVU_007G215300g [Phaseolus vulgaris]
 gb|ESW17153.1| hypothetical protein PHAVU_007G215300g [Phaseolus vulgaris]
Length=1408

 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GY   +R +++ ++   G ++   +  + +THL+C++FEG K+ LAK+
Sbjct  105  IPGAKGLIMCLTGYLRQDRDDIMTMVGLMGAHFSKPLVANKVTHLICYKFEGEKYVLAKR  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
                 +VNHRW+EDC+K+   +PE  Y
Sbjct  165  LGTIKLVNHRWLEDCLKEWVLLPEDKY  191



>emb|CEF98729.1| BRCT domain [Ostreococcus tauri]
Length=1032

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = +1

Query  76   MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
            M+  V +++GY G  R ++  +    G  +  A   S+THLVC+   G KFE AK+  + 
Sbjct  143  MKSCVVSLTGYAGGRRRDVETMTRVLGAKFQKAFDRSVTHLVCYEHSGAKFEKAKEFGSA  202

Query  256  FIVNHRWIEDCIKKGRRVPEHPYT  327
             IVNH W+EDCI + +R+ E  Y+
Sbjct  203  HIVNHVWLEDCISRWQRLGESAYS  226



>ref|XP_003080343.1| dna topoisomerase ii binding protein 1 (IC) [Ostreococcus tauri]
Length=1269

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = +1

Query  76   MEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT  255
            M+  V +++GY G  R ++  +    G  +  A   S+THLVC+   G KFE AK+  + 
Sbjct  114  MKSCVVSLTGYAGGRRRDVETMTRVLGAKFQKAFDRSVTHLVCYEHSGAKFEKAKEFGSA  173

Query  256  FIVNHRWIEDCIKKGRRVPEHPYT  327
             IVNH W+EDCI + +R+ E  Y+
Sbjct  174  HIVNHVWLEDCISRWQRLGESAYS  197



>ref|XP_010095304.1| BRCT domain-containing protein [Morus notabilis]
 gb|EXB59333.1| BRCT domain-containing protein [Morus notabilis]
Length=1286

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAM-SVSITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GYQ  +R +++ ++   G  +   + +  +THL+C++FEG K++LAKK
Sbjct  105  IPGAKGLIMCLTGYQRQDRDDIMTMVGLMGAQFSKPLVATKVTHLICYKFEGEKYDLAKK  164

Query  244  SRNTFIVNHRWIEDC  288
                 +VNHRW+EDC
Sbjct  165  LPKVKLVNHRWLEDC  179



>ref|XP_002500078.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61336.1| predicted protein [Micromonas sp. RCC299]
Length=703

 Score = 68.6 bits (166),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 51/87 (59%), Gaps = 4/87 (5%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELA---  237
            V GME+ V +++GY+G  R ++ +LI  AG  +    +   THL+C+R E   +  A   
Sbjct  220  VPGMEQAVVSIAGYKGPIRNDIRELIEAAGATFNQNFTKKTTHLICYRAESEVYAKALLF  279

Query  238  -KKSRNTFIVNHRWIEDCIKKGRRVPE  315
              + +   IVNHRWIED ++  RR+PE
Sbjct  280  KLEGQMLEIVNHRWIEDSVRNWRRMPE  306



>ref|XP_002491567.1| Protein implicated in Mms22-dependent DNA repair during S phase 
[Komagataella pastoris GS115]
 emb|CAY69287.1| Protein implicated in Mms22-dependent DNA repair during S phase 
[Komagataella pastoris GS115]
 emb|CCA38324.1| BRCT-containing protein 1 [Komagataella pastoris CBS 7435]
Length=951

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 84/170 (49%), Gaps = 16/170 (9%)
 Frame = +1

Query  55   ISARVAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFEL  234
            +  ++ G EK V +V+ + G  R  + +L+   GG +   +S   THL+  + +G K+E+
Sbjct  344  VFGKLPGFEKFVISVTNFTGDARLYVHQLVTLMGGEFTRTLSQKNTHLIVSKPQGLKYEV  403

Query  235  AKKSRNTFIVNHRWIEDCIKKGRRVPEH-PYTVQCGQEVGPLLMNITQVGEGNQSSGCNH  411
            A+  ++  +VNH W+E+C +  + + +  P  V   +E      N+TQ+  G+ S     
Sbjct  404  ARTWKDIKLVNHLWLEECYRNWKVLNDKDPVYVHFPKET-----NLTQIL-GSTS-----  452

Query  412  KEPQIDTEVEEYFPDPDIAKPKSRKKMKNRSLKCDRNLSSRFDHYDSSMS  561
                +D +V + F +    KPK   + K +  K  +  SS     DS++S
Sbjct  453  ----LDKKVLKQFYEKKTNKPKKTSERKTKKEKLSQTQSSEIRQVDSALS  498



>ref|XP_002467987.1| hypothetical protein SORBIDRAFT_01g037650 [Sorghum bicolor]
 gb|EER94985.1| hypothetical protein SORBIDRAFT_01g037650 [Sorghum bicolor]
Length=254

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 58/94 (62%), Gaps = 8/94 (9%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSV-SITHLVCWRFEG------RK  225
            + G   ++  ++GYQ + R +++K+++  G  +   +   ++THL+C++FEG       K
Sbjct  112  IPGAPSLLICLTGYQKSYREDMMKMVSLMGARFSKPLIANAVTHLICYKFEGVLFLLGDK  171

Query  226  FELAKKSRNTFIVNHRWIEDCIKKGRRVPEHPYT  327
            +E+AKK  N  +VNHRW+EDC+K  + +P   Y+
Sbjct  172  YEVAKKV-NIKLVNHRWLEDCLKAWKILPVSDYS  204



>gb|EMT01350.1| BRCT domain-containing protein [Aegilops tauschii]
Length=1466

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAM-SVSITHLVCWRFEGRKFELAKK  243
            + G + +   ++GYQ   R +++K++   G  +   + S  +THL+C++FEG K+ELAK 
Sbjct  85   IPGSQSLNICLTGYQKNGREDIMKMVTLMGAQFSKPLISHKVTHLICYKFEGEKYELAKM  144

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
              N  +VNH+W+EDC+K    +P   Y
Sbjct  145  V-NINLVNHQWLEDCLKAWEILPVDNY  170



>ref|XP_011041441.1| PREDICTED: BRCT domain-containing protein At4g02110-like [Populus 
euphratica]
Length=1227

 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GYQ  +R +++ ++   G  +   +  + +THL+C++FEG K+ LA K
Sbjct  105  IPGAKNLIMCLTGYQRQDRDDIMTMVGLMGAQFSKPLVANKVTHLICYKFEGEKYLLASK  164

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYT  327
             +   +VNHRW+E+ ++    +PE  Y+
Sbjct  165  MKKIKLVNHRWLEESLRNWELLPEDNYS  192



>ref|XP_011042233.1| PREDICTED: BRCT domain-containing protein At4g02110-like isoform 
X2 [Populus euphratica]
Length=1132

 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = +1

Query  85   VVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKKSRNTFI  261
            +   ++GYQ  +R +++ ++   G ++   +  + +THL+C++FEG K+ELA K +   +
Sbjct  111  LTVCLTGYQRQDRDDIMTMVGLMGAHFSKPLVANRVTHLICYKFEGEKYELANKMKKIKL  170

Query  262  VNHRWIEDC  288
            VNHRW+EDC
Sbjct  171  VNHRWLEDC  179



>ref|XP_002141698.1| PHD / zinc finger (C3HC4 type) family protein [Cryptosporidium 
muris RN66]
 gb|EEA07349.1| PHD / zinc finger (C3HC4 type) family protein [Cryptosporidium 
muris RN66]
Length=855

 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 64/134 (48%), Gaps = 22/134 (16%)
 Frame = +1

Query  1072  GLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQ  1251
             GLL C H FC SCI+ WA Q+ ++     CPLCK  F +I    D  P++  I   TIP 
Sbjct  188   GLLICKHIFCLSCIKQWA-QIATQ-----CPLCKREFETIIGY-DHIPTENSIAIITIPV  240

Query  1252  DRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRC-IHAYCLDPP  1428
             +R   +   L DG+      +P     C  C   + EE+L+ C  C   C  H YCLDPP
Sbjct  241   ERRTLNNDEL-DGD------DPFADFACEVCHLNDHEEVLLLCDGCD--CGYHTYCLDPP  291

Query  1429  LHP-----WTCIHC  1455
             L       W C  C
Sbjct  292   LDSVPSGEWFCPRC  305



>ref|XP_003057852.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57803.1| predicted protein [Micromonas pusilla CCMP1545]
Length=699

 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 48/87 (55%), Gaps = 4/87 (5%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELA---  237
            V GM   V +V+GY+G  R ++ +LI  AG  +    +   THL+C+R E   +  A   
Sbjct  179  VPGMAHAVVSVAGYKGPIRNDIRELIEAAGATFNQNFTKKTTHLICYRAESEVYAKALLF  238

Query  238  -KKSRNTFIVNHRWIEDCIKKGRRVPE  315
              + +   IVNHRWIED +K  RR PE
Sbjct  239  KLEGQMLEIVNHRWIEDSVKTWRRAPE  265



>gb|EAZ41167.1| hypothetical protein OsJ_25663 [Oryza sativa Japonica Group]
Length=1335

 Score = 66.2 bits (160),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 55/93 (59%), Gaps = 6/93 (6%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAM-SVSITHLVCWRFEGRKFELAK-  240
            + G + +   ++GYQ   R +++K+ +  G  +  +  ++  THL+C++FEG K+++AK 
Sbjct  109  IPGSQSLRICLTGYQKNWRDDIMKMASLMGAEFSKSFDALKDTHLICYKFEGEKYKVAKR  168

Query  241  ----KSRNTFIVNHRWIEDCIKKGRRVPEHPYT  327
                K  N  +VNH+W+EDC+   + +P   YT
Sbjct  169  ENTAKRANVSLVNHQWLEDCLMAWKILPADDYT  201



>ref|NP_001060709.2| Os07g0689900 [Oryza sativa Japonica Group]
 dbj|BAC16036.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22623.2| Os07g0689900 [Oryza sativa Japonica Group]
Length=1335

 Score = 66.2 bits (160),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 55/93 (59%), Gaps = 6/93 (6%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAM-SVSITHLVCWRFEGRKFELAK-  240
            + G + +   ++GYQ   R +++K+ +  G  +  +  ++  THL+C++FEG K+++AK 
Sbjct  109  IPGSQSLRICLTGYQKNWRDDIMKMASLMGAEFSKSFDALKDTHLICYKFEGEKYKVAKR  168

Query  241  ----KSRNTFIVNHRWIEDCIKKGRRVPEHPYT  327
                K  N  +VNH+W+EDC+   + +P   YT
Sbjct  169  ENTAKRANVSLVNHQWLEDCLMAWKILPADDYT  201



>gb|EAR92090.2| C3HC4 type (RING finger) zinc finger protein [Tetrahymena thermophila 
SB210]
Length=560

 Score = 65.5 bits (158),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/155 (28%), Positives = 63/155 (41%), Gaps = 14/155 (9%)
 Frame = +1

Query  1012  LPTSPALSCVICW-TDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTS  1188
             L +    +C IC      S  G++ C H FC  CI  W++       T+ CP+C+  F+ 
Sbjct  405   LMSQQLKNCAICLGIPEDSIYGVVQCQHEFCIDCILQWSE------VTNLCPMCRAEFSK  458

Query  1189  ITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEEL  1368
             I K    +   Q++ +    + R   D     + E   F  +  +  VC  C + + E  
Sbjct  459   IQKKNYNDLDYQEVITVEPKKQRINDDDEFYWE-EVDSFLDDDGLDEVCYICETNQDENK  517

Query  1369  LINCHVCQTRCIHAYCLDP------PLHPWTCIHC  1455
             LI C  C  R  H YC D       PL  W C  C
Sbjct  518   LIICDHCGFRICHTYCDDELLDDQVPLEDWFCHEC  552



>ref|XP_001012335.1| hypothetical protein TTHERM_00106910 [Tetrahymena thermophila]
Length=597

 Score = 65.5 bits (158),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 43/155 (28%), Positives = 63/155 (41%), Gaps = 14/155 (9%)
 Frame = +1

Query  1012  LPTSPALSCVICW-TDFSSSRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTS  1188
             L +    +C IC      S  G++ C H FC  CI  W++       T+ CP+C+  F+ 
Sbjct  442   LMSQQLKNCAICLGIPEDSIYGVVQCQHEFCIDCILQWSE------VTNLCPMCRAEFSK  495

Query  1189  ITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEEL  1368
             I K    +   Q++ +    + R   D     + E   F  +  +  VC  C + + E  
Sbjct  496   IQKKNYNDLDYQEVITVEPKKQRINDDDEFYWE-EVDSFLDDDGLDEVCYICETNQDENK  554

Query  1369  LINCHVCQTRCIHAYCLDP------PLHPWTCIHC  1455
             LI C  C  R  H YC D       PL  W C  C
Sbjct  555   LIICDHCGFRICHTYCDDELLDDQVPLEDWFCHEC  589



>gb|EPS63240.1| hypothetical protein M569_11549 [Genlisea aurea]
Length=1055

 Score = 65.9 bits (159),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G   +V  ++GY   +R +++ +++  G  +   +  + +THL+C++FEG K+ELAKK
Sbjct  120  IPGARSLVICLTGYLRADRDDIMTMVSIMGATFSKPLVANKVTHLICYKFEGEKYELAKK  179

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPY  324
             +   +VNH W+EDC+K  + +PE  Y
Sbjct  180  LKKIKLVNHLWLEDCLKAWKLLPEVDY  206



>gb|EAZ05222.1| hypothetical protein OsI_27420 [Oryza sativa Indica Group]
Length=1335

 Score = 65.9 bits (159),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 55/93 (59%), Gaps = 6/93 (6%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAM-SVSITHLVCWRFEGRKFELAK-  240
            + G + +   ++GYQ   R +++K+ +  G  +  +  ++  THL+C++FEG K+++AK 
Sbjct  109  IPGSQSLRICLTGYQKNWRDDIMKMASLMGAEFSKSFDALKDTHLICYKFEGEKYKVAKR  168

Query  241  ----KSRNTFIVNHRWIEDCIKKGRRVPEHPYT  327
                K  N  +VNH+W+EDC+   + +P   YT
Sbjct  169  ENTAKRANVNLVNHQWLEDCLMAWKILPADDYT  201



>gb|EMT12543.1| BRCT domain-containing protein [Aegilops tauschii]
Length=1453

 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAM-SVSITHLVCWRFEGRKFELAKK  243
            + G + +   ++GYQ  +R +++K+++  G  +   +    +THLVC++FEG K+ELAK+
Sbjct  73   IPGSDSLQICLTGYQRNDREDIMKMVSLMGAQFSKPLLGHVVTHLVCYKFEGEKYELAKR  132

Query  244  SRNTFIVNHRWIEDC  288
                 + NHRW+EDC
Sbjct  133  -LGIKLANHRWLEDC  146



>ref|XP_001759692.1| predicted protein [Physcomitrella patens]
 gb|EDQ75604.1| predicted protein [Physcomitrella patens]
Length=776

 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 73/186 (39%), Gaps = 27/186 (15%)
 Frame = +1

Query  946   KSPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSRGLLPC-GHRFCFSCIQSW  1122
             + P E  + VD+   ++E  V++       C IC T+  + RG L C  H FCF CI  W
Sbjct  125   QKPKEDGKEVDLSLLDEEKVVQV-------CGICLTEEEAERGKLDCCDHYFCFGCIMEW  177

Query  1123  ADQMVSRGKTSTCPLCKVGFTSITK--VADAEPSDQKIYSQTIPQDRPGTDIYLLPDGET  1296
             +         S CP CK  F +I K  V     S  +I+        P  D    P  E 
Sbjct  178   SK------VESRCPSCKQRFLTIVKPSVPGISRSRPRIFHI------PHKDQVYQPSEEE  225

Query  1297  SHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYC----LDPPLHPWTCIHCQDY  1464
                  +P +  VC  C     E +L+ C  C +   H YC    L  P   W C  C   
Sbjct  226   IRLFTDPYLDVVCSVCQEAGDEGVLLLCDGCDS-AAHTYCVGLGLSVPRGDWFCNACSIE  284

Query  1465  QRRFET  1482
              R F T
Sbjct  285   HRGFST  290



>ref|XP_001751236.1| predicted protein [Physcomitrella patens]
 gb|EDQ83553.1| predicted protein [Physcomitrella patens]
Length=708

 Score = 62.8 bits (151),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 66/167 (40%), Gaps = 20/167 (12%)
 Frame = +1

Query  982   DQKEDENCVKLPT----SPALSCVICWTDFSSSRGLLPC-GHRFCFSCIQSWADQMVSRG  1146
             DQK+ E  V+           +C IC T+    RG L C  H FCF CI  W+       
Sbjct  51    DQKDVERKVEYSLVNEEKAVQACGICLTEEEVGRGKLDCCDHYFCFGCIMEWSK------  104

Query  1147  KTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMP  1326
               S CP+CK  F +I K+     S  +  +  IP       +Y  P  E      +P + 
Sbjct  105   VESRCPICKQRFVTIVKLPVPGMSRSRPRTFHIPHK---NQVY-EPSEEEIRLFTDPYLH  160

Query  1327  PVCCQCSSREPEELLINCHVCQTRCIHAYCLD----PPLHPWTCIHC  1455
              VC +C     E LL+ C  C     H YC+      P   W C  C
Sbjct  161   VVCTECQQAGDERLLLLCDGCDA-AAHTYCVGLGRKVPRGDWFCNTC  206



>ref|XP_008807766.1| PREDICTED: uncharacterized protein LOC103720028 [Phoenix dactylifera]
Length=787

 Score = 62.8 bits (151),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 79/185 (43%), Gaps = 21/185 (11%)
 Frame = +1

Query  925   GALASPFKSPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSS--RGLLPC-GHR  1095
             G L+ P    +  RR V+V  KE E       S    C IC ++      +G+L C  H 
Sbjct  333   GILSQPQPERICARRKVEVKGKEKE----ADESGKHVCGICLSEEQKGTIQGVLNCCAHY  388

Query  1096  FCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIY  1275
             FCF+CI  W+         S CP+CK  F +ITK + ++P      +    Q R   D  
Sbjct  389   FCFACIMEWSKV------ESRCPVCKRRFMTITKSSRSDPGFGLRRAVIRVQKR---DQV  439

Query  1276  LLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCL----DPPLHPWT  1443
               P  E      +P    VC +C     +EL++ C +C +   H YC+    + P   W 
Sbjct  440   YQPSEEEMRGFLDPYENVVCIECQQGGDDELMLLCDICDSPA-HTYCVGLGREVPEGNWY  498

Query  1444  CIHCQ  1458
             C  C+
Sbjct  499   CELCR  503



>ref|XP_007051075.1| Transcription coactivators, putative [Theobroma cacao]
 gb|EOX95232.1| Transcription coactivators, putative [Theobroma cacao]
Length=1241

 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 59/106 (56%), Gaps = 19/106 (18%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEG--------  219
            + G + ++  ++GYQ  +R +++ +++  G  +   +  + +THL+C++FEG        
Sbjct  105  IPGAKSLIICLTGYQRQDRDDIMTMVSLMGAQFSKPLVANKVTHLICYKFEGAVFYFPIN  164

Query  220  ----------RKFELAKKSRNTFIVNHRWIEDCIKKGRRVPEHPYT  327
                       K+ELAKK +   ++NHRW+EDC+++ + + E  Y+
Sbjct  165  FLINLANYAGEKYELAKKIKKIKLINHRWLEDCLREWKLLSEANYS  210



>ref|XP_008467824.1| PREDICTED: PHD and RING finger domain-containing protein 1 [Diaphorina 
citri]
Length=1919

 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 66/148 (45%), Gaps = 25/148 (17%)
 Frame = +1

Query  1033  SCVICWTDFSS--SRGLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVAD  1206
             SC IC +  ++  +  +  C H F  +CI  W++      +T+TCP+ ++ F  IT V +
Sbjct  37    SCAICLSSLANRIAAQISGCSHEFHNTCILKWSE------RTNTCPIDRLKFNKIT-VKN  89

Query  1207  AEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHV  1386
              E    KI   T   D+         D E   FP        C  C S + E++L+ C  
Sbjct  90    KE---GKIVKVTEIDDKNAA----TADDEEQAFPDEAIN---CVICGSPDNEDVLLLCDG  139

Query  1387  CQTRCIHAYCLDPPLH-----PWTCIHC  1455
             C  R  H YCL+PPL       W C HC
Sbjct  140   C-NRGFHIYCLNPPLARVPEGNWICQHC  166



>gb|KFM80629.1| PHD and RING finger domain-containing protein 1, partial [Stegodyphus 
mimosarum]
Length=2361

 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 63/169 (37%), Gaps = 51/169 (30%)
 Frame = +1

Query  1027  ALSCVICWTDFSSSRGLLP--CGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKV  1200
             A  C IC   F       P  C H FC  C+Q WA  +      +TCP+ ++ F  I   
Sbjct  99    AEKCAICLNKFHGQDIATPETCDHMFCLDCLQEWAKNV------NTCPIDRLKFNLILIR  152

Query  1201  ADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMP--------------PVCC  1338
                E   +KI  +          IY+           NP +P                C 
Sbjct  153   HHKE---EKIIRR----------IYI----------NNPELPWFTEFESESPQTLITYCE  189

Query  1339  QCSSREPEELLINCHVCQTRCIHAYCLDPPLHP-----WTCIHCQDYQR  1470
              C   + EE L+ CH CQ +C H  C+ PPLH      W C  C +Y R
Sbjct  190   ICGEYDSEETLLLCHECQ-KCYHTECIFPPLHSSSMDCWLCPTCANYVR  237



>emb|CDP17228.1| unnamed protein product [Coffea canephora]
Length=715

 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 77/173 (45%), Gaps = 18/173 (10%)
 Frame = +1

Query  961   QRRIVDVDQKEDENCVKLPTSPALSCVICWTDFS--SSRGLLPC-GHRFCFSCIQSWADQ  1131
             QR+ +    KE E  +K+ T   + C IC ++    + RG L C  H FCF+CI  W+  
Sbjct  206   QRKRLVRKGKEKEEDLKIETGKQV-CGICLSEEGKRTVRGTLNCCSHYFCFACIIEWSK-  263

Query  1132  MVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPA  1311
                    S CPLCK  F +I+K A    SD     +T+    P  D    P  E      
Sbjct  264   -----VESRCPLCKQRFATISKPAR---SDTGFELRTMIIQIPERDQVYQPSEEELRGYL  315

Query  1312  NPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCL----DPPLHPWTCIHCQ  1458
             +P    +C +C+    + L++ C +C +   H YC+    + P   W C  C+
Sbjct  316   DPYENVICTECNHGGDDALMLLCDLCDSPA-HTYCVGLGREVPEGNWYCEGCR  367



>ref|XP_011087472.1| PREDICTED: chromodomain-helicase-DNA-binding protein 5-like [Sesamum 
indicum]
 ref|XP_011087473.1| PREDICTED: chromodomain-helicase-DNA-binding protein 5-like [Sesamum 
indicum]
 ref|XP_011087474.1| PREDICTED: chromodomain-helicase-DNA-binding protein 5-like [Sesamum 
indicum]
 ref|XP_011087475.1| PREDICTED: chromodomain-helicase-DNA-binding protein 5-like [Sesamum 
indicum]
 ref|XP_011087476.1| PREDICTED: chromodomain-helicase-DNA-binding protein 5-like [Sesamum 
indicum]
 ref|XP_011087477.1| PREDICTED: chromodomain-helicase-DNA-binding protein 5-like [Sesamum 
indicum]
 ref|XP_011087478.1| PREDICTED: chromodomain-helicase-DNA-binding protein 5-like [Sesamum 
indicum]
 ref|XP_011087479.1| PREDICTED: chromodomain-helicase-DNA-binding protein 5-like [Sesamum 
indicum]
 ref|XP_011087480.1| PREDICTED: chromodomain-helicase-DNA-binding protein 5-like [Sesamum 
indicum]
Length=730

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 72/299 (24%), Positives = 123/299 (41%), Gaps = 37/299 (12%)
 Frame = +1

Query  601   PAVFLKPKKGSMGLPETSLKRRRLVKKNISDVLEISDSEELSPQIRTLPEHESAMQSNSA  780
             P   LK  +  +G      KRR L KKN S++ +    E  +P+ + +       +    
Sbjct  207   PGEVLKRTRRKLG------KRRVLKKKNRSNLFKEFRDENHNPRKKKMTTGWGWGRRRKP  260

Query  781   NIGRH-DHTSNNSQTTRISCPEDHTNGIEVPGDTEEVLNVTIGET-----LENEGALASP  942
             N+    D  S+ S     +  E+    I    +    LN ++  +     ++ E  L S 
Sbjct  261   NVNSDSDFVSSGSSDYEYTISEEEREQIREATEFCSRLNPSLRSSSSLKMIKEEETLPSK  320

Query  943   FKSPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWTDFS--SSRGLLPC-GHRFCFSCI  1113
              K P ++ +   +D       +K+     + C IC ++    + RG+L C  H FCF+CI
Sbjct  321   TKRPGKKGKQKMID-------MKIEVGKQV-CGICLSEEGKRTVRGVLNCCSHYFCFACI  372

Query  1114  QSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGE  1293
               W+ ++ SR     CPLCK  F +I++ A A+   Q +     P   P  D    P  E
Sbjct  373   MEWS-KVESR-----CPLCKQRFATISRTARADDG-QDLKDAVFPV--PERDQVYQPSEE  423

Query  1294  TSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCL----DPPLHPWTCIHCQ  1458
                   +P    +C +C     +  ++ C +C +   H YC+    + P   W C  C+
Sbjct  424   ELRGYLDPYENVLCTECQQGGDDAFMLLCDLCDSPA-HTYCVGLGREVPEGNWYCDGCR  481



>gb|KDO81739.1| hypothetical protein CISIN_1g003346mg [Citrus sinensis]
 gb|KDO81740.1| hypothetical protein CISIN_1g003346mg [Citrus sinensis]
Length=777

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 81/196 (41%), Gaps = 25/196 (13%)
 Frame = +1

Query  892   NVTIGETLENEGALASPFKSPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWT--DFSS  1065
             N +  +T++ +G L  P       R+ +    KE    VK   +  + C IC +  D   
Sbjct  306   NSSSSKTIQEDGNLGQP-------RKTLGRKGKEKIEEVKSEVAKQV-CGICLSEEDKRR  357

Query  1066  SRGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQT  1242
              RG L C  H FCF+CI  W+         S CPLCK  F +ITK    E S   +  ++
Sbjct  358   LRGTLNCCSHYFCFTCIMEWSKV------ESRCPLCKQRFKTITK---PERSTAGVDLRS  408

Query  1243  IPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLD  1422
             +    P  D    P  E      +P    +C +C     + L++ C +C +   H YC+ 
Sbjct  409   VVIQVPERDQVYQPSEEDLRSFLDPYENVICSECHQGGDDGLMLLCDICDS-SAHTYCVG  467

Query  1423  ----PPLHPWTCIHCQ  1458
                  P   W C  C+
Sbjct  468   LGRVVPEGNWYCDGCR  483



>emb|CEF98880.1| Phox/Bem1p [Ostreococcus tauri]
Length=628

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 45/87 (52%), Gaps = 0/87 (0%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
            V G       V GY G ++ +L++LI  AGG +   M+   THLVC+R     +  A   
Sbjct  110  VEGFASARIVVDGYVGQDKLDLVELIEAAGGTHEEEMTSKTTHLVCYRAGSSAYVQAVTR  169

Query  247  RNTFIVNHRWIEDCIKKGRRVPEHPYT  327
                +VNH W+++C+++   +P   Y+
Sbjct  170  GRVAVVNHLWVDECVREWTLLPVEGYS  196



>ref|XP_003080553.1| Myosin class II heavy chain (ISS) [Ostreococcus tauri]
Length=610

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 45/87 (52%), Gaps = 0/87 (0%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
            V G       V GY G ++ +L++LI  AGG +   M+   THLVC+R     +  A   
Sbjct  110  VEGFASARIVVDGYVGQDKLDLVELIEAAGGTHEEEMTSKTTHLVCYRAGSSAYVQAVTR  169

Query  247  RNTFIVNHRWIEDCIKKGRRVPEHPYT  327
                +VNH W+++C+++   +P   Y+
Sbjct  170  GRVAVVNHLWVDECVREWTLLPVEGYS  196



>ref|XP_004230275.1| PREDICTED: uncharacterized protein LOC101264764 [Solanum lycopersicum]
Length=925

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 83/187 (44%), Gaps = 23/187 (12%)
 Frame = +1

Query  934   ASPFKSPLE-----QRRIVDVDQKEDENCVKLPTSPALSCVICWTDFS--SSRGLLPC-G  1089
             AS  KSP+E     QR+      KE    +K+     + C IC ++    + RG L C  
Sbjct  504   ASLKKSPIEEAPRLQRKHPARKAKEKMEELKIEAGKQI-CGICLSEEGKRTVRGTLNCCS  562

Query  1090  HRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTD  1269
             H FCF+CI  W+ ++ SR     CPLCK  F +I+K A    SD     +T+    P  D
Sbjct  563   HYFCFACIMEWS-KVESR-----CPLCKQRFVTISKPAR---SDTGFDLRTVAIQVPERD  613

Query  1270  IYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCL----DPPLHP  1437
                 P  E      +P    +C +C     + L++ C +C +   H YC+    + P   
Sbjct  614   QVYQPSEEELRGYLDPYENVLCTECQQGGDDALMLLCDLCDS-PAHTYCVGLGHEVPEGN  672

Query  1438  WTCIHCQ  1458
             W C  C+
Sbjct  673   WYCESCR  679



>dbj|GAA94968.1| hypothetical protein E5Q_01623 [Mixia osmundae IAM 14324]
 gb|KEI37369.1| hypothetical protein L969DRAFT_19421 [Mixia osmundae IAM 14324]
Length=955

 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 53/110 (48%), Gaps = 8/110 (7%)
 Frame = +1

Query  73   GMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRN  252
            GM+  + T+S Y G  R  L  LI   GG Y G MS   TH++    EGRK E A+++  
Sbjct  397  GMDAFLFTISAYVGGPRDALRSLIEAMGGQYAGGMSPQTTHVIAANHEGRKVEAARRTHR  456

Query  253  TFIVNHRWIEDCIKKG--RRVPEHPYTVQCGQEVGPLLMNITQVGEGNQS  396
              I+NH W+ D   +   +   E  YT     EV P + +   +G+   S
Sbjct  457  P-ILNHLWLHDSFARWQLQSTSEPRYT-----EVTPDIQHAHAIGKATLS  500



>ref|XP_005104626.1| PREDICTED: DNA topoisomerase 2-binding protein 1-A-like [Aplysia 
californica]
Length=1671

 Score = 61.2 bits (147),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 63/135 (47%), Gaps = 20/135 (15%)
 Frame = +1

Query  85   VVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKKSRNTFI  261
            +   VSG+  +ER  L   + + GG Y G + ++  THLV    +G K+E AK  +   I
Sbjct  202  LTVVVSGFSSSERNQLKSFVTRGGGKYSGELKMNECTHLVVKEAKGAKYEAAKNWK-IRI  260

Query  262  VNHRWIEDCIKKGRRVPEHPYTVQCGQEV----------------GPLLMNITQVGEGNQ  393
            ++ +W+ DC+ K R +   PY  QCG+ V                GP + +++ +  G  
Sbjct  261  LHDKWVYDCMDKKRYLDPEPY--QCGKNVPGRNVKTSTPERRSVIGPHISDVSAITSGGN  318

Query  394  SSGCNHKEPQIDTEV  438
            SS  +  +   D  V
Sbjct  319  SSTFHQADETSDMTV  333



>gb|KDO81736.1| hypothetical protein CISIN_1g003346mg [Citrus sinensis]
 gb|KDO81737.1| hypothetical protein CISIN_1g003346mg [Citrus sinensis]
 gb|KDO81738.1| hypothetical protein CISIN_1g003346mg [Citrus sinensis]
Length=828

 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 81/196 (41%), Gaps = 25/196 (13%)
 Frame = +1

Query  892   NVTIGETLENEGALASPFKSPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWT--DFSS  1065
             N +  +T++ +G L  P       R+ +    KE    VK   +  + C IC +  D   
Sbjct  306   NSSSSKTIQEDGNLGQP-------RKTLGRKGKEKIEEVKSEVAKQV-CGICLSEEDKRR  357

Query  1066  SRGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQT  1242
              RG L C  H FCF+CI  W+         S CPLCK  F +ITK    E S   +  ++
Sbjct  358   LRGTLNCCSHYFCFTCIMEWSKV------ESRCPLCKQRFKTITK---PERSTAGVDLRS  408

Query  1243  IPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLD  1422
             +    P  D    P  E      +P    +C +C     + L++ C +C +   H YC+ 
Sbjct  409   VVIQVPERDQVYQPSEEDLRSFLDPYENVICSECHQGGDDGLMLLCDICDS-SAHTYCVG  467

Query  1423  ----PPLHPWTCIHCQ  1458
                  P   W C  C+
Sbjct  468   LGRVVPEGNWYCDGCR  483



>ref|XP_006472161.1| PREDICTED: uncharacterized protein LOC102611360 isoform X1 [Citrus 
sinensis]
 ref|XP_006472162.1| PREDICTED: uncharacterized protein LOC102611360 isoform X2 [Citrus 
sinensis]
 ref|XP_006472163.1| PREDICTED: uncharacterized protein LOC102611360 isoform X3 [Citrus 
sinensis]
Length=827

 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 81/196 (41%), Gaps = 25/196 (13%)
 Frame = +1

Query  892   NVTIGETLENEGALASPFKSPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWT--DFSS  1065
             N +  +T++ +G L  P       R+ +    KE    VK   +  + C IC +  D   
Sbjct  305   NSSSSKTIQEDGNLGQP-------RKTLGRKGKEKIEEVKSEVAKQV-CGICLSEEDKRR  356

Query  1066  SRGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQT  1242
              RG L C  H FCF+CI  W+         S CPLCK  F +ITK    E S   +  ++
Sbjct  357   LRGTLNCCSHYFCFTCIMEWSKV------ESRCPLCKQRFKTITK---PERSTAGVDLRS  407

Query  1243  IPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLD  1422
             +    P  D    P  E      +P    +C +C     + L++ C +C +   H YC+ 
Sbjct  408   VVIQVPERDQVYQPSEEDLRSFLDPYENVICSECHQGGDDGLMLLCDICDS-SAHTYCVG  466

Query  1423  ----PPLHPWTCIHCQ  1458
                  P   W C  C+
Sbjct  467   LGRVVPEGNWYCDGCR  482



>ref|XP_009759809.1| PREDICTED: nucleolin-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009759810.1| PREDICTED: nucleolin-like isoform X1 [Nicotiana sylvestris]
Length=854

 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 71/165 (43%), Gaps = 18/165 (11%)
 Frame = +1

Query  988   KEDENCVKLPTSPALS-CVICWTDFS--SSRGLLPC-GHRFCFSCIQSWADQMVSRGKTS  1155
             ++D+  V L T      C IC ++    + RG L C  H FCF+CI  W+         S
Sbjct  458   RKDKEKVDLKTEAGKQICGICLSEEGKRTVRGTLNCCSHYFCFACIMEWSKV------ES  511

Query  1156  TCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVC  1335
              CPLCK  F +I+K A    SD     +T+    P  D    P  E      +P    +C
Sbjct  512   RCPLCKQRFVTISKPAR---SDTGFELRTVAIQVPERDQVYQPSEEELRGYIDPYENVLC  568

Query  1336  CQCSSREPEELLINCHVCQTRCIHAYCL----DPPLHPWTCIHCQ  1458
              +C     + L++ C +C +   H YC+    + P   W C  C+
Sbjct  569   TECQQGGDDALMLLCDLCDS-PAHTYCVGLGHEVPEGNWYCESCR  612



>ref|XP_002882430.1| hypothetical protein ARALYDRAFT_477858 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58689.1| hypothetical protein ARALYDRAFT_477858 [Arabidopsis lyrata subsp. 
lyrata]
Length=869

 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 73/167 (44%), Gaps = 21/167 (13%)
 Frame = +1

Query  988   KEDENCVKLPTSPALS--CVICWT--DFSSSRGLLPC-GHRFCFSCIQSWADQMVSRGKT  1152
             K+ E  VKL     +   C IC +  D    +G L C  H FCF+CI  W+         
Sbjct  382   KKGEKKVKLVKREVIKNVCGICLSEEDMRRLKGTLDCCSHYFCFTCIMEWSKV------E  435

Query  1153  STCPLCKVGFTSITKVADAEPS-DQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPP  1329
             S CPLCK  F +I+K A + P  D +    T+P+     D    P  E      +P    
Sbjct  436   SRCPLCKQRFRTISKPARSTPGVDLREVVITVPE----RDQVYQPTEEELRSYLDPYENI  491

Query  1330  VCCQCSSREPEELLINCHVCQTRCIHAYCL----DPPLHPWTCIHCQ  1458
             +C +C   + + L++ C +C +   H YC+    + P   W C  C+
Sbjct  492   ICTECHQGDDDGLMLLCDLCDSSA-HTYCVGLGREVPEGNWYCEGCR  537



>ref|XP_009759811.1| PREDICTED: chromodomain-helicase-DNA-binding protein 4-like isoform 
X2 [Nicotiana sylvestris]
Length=812

 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 71/165 (43%), Gaps = 18/165 (11%)
 Frame = +1

Query  988   KEDENCVKLPTSPALS-CVICWTDFS--SSRGLLPC-GHRFCFSCIQSWADQMVSRGKTS  1155
             ++D+  V L T      C IC ++    + RG L C  H FCF+CI  W+         S
Sbjct  416   RKDKEKVDLKTEAGKQICGICLSEEGKRTVRGTLNCCSHYFCFACIMEWSKV------ES  469

Query  1156  TCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVC  1335
              CPLCK  F +I+K A    SD     +T+    P  D    P  E      +P    +C
Sbjct  470   RCPLCKQRFVTISKPAR---SDTGFELRTVAIQVPERDQVYQPSEEELRGYIDPYENVLC  526

Query  1336  CQCSSREPEELLINCHVCQTRCIHAYCL----DPPLHPWTCIHCQ  1458
              +C     + L++ C +C +   H YC+    + P   W C  C+
Sbjct  527   TECQQGGDDALMLLCDLCDS-PAHTYCVGLGHEVPEGNWYCESCR  570



>ref|XP_009759812.1| PREDICTED: uncharacterized protein LOC104212288 isoform X3 [Nicotiana 
sylvestris]
Length=712

 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 71/165 (43%), Gaps = 18/165 (11%)
 Frame = +1

Query  988   KEDENCVKLPTSPALS-CVICWTDFS--SSRGLLPC-GHRFCFSCIQSWADQMVSRGKTS  1155
             ++D+  V L T      C IC ++    + RG L C  H FCF+CI  W+         S
Sbjct  316   RKDKEKVDLKTEAGKQICGICLSEEGKRTVRGTLNCCSHYFCFACIMEWSKV------ES  369

Query  1156  TCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVC  1335
              CPLCK  F +I+K A    SD     +T+    P  D    P  E      +P    +C
Sbjct  370   RCPLCKQRFVTISKPAR---SDTGFELRTVAIQVPERDQVYQPSEEELRGYIDPYENVLC  426

Query  1336  CQCSSREPEELLINCHVCQTRCIHAYCL----DPPLHPWTCIHCQ  1458
              +C     + L++ C +C +   H YC+    + P   W C  C+
Sbjct  427   TECQQGGDDALMLLCDLCDS-PAHTYCVGLGHEVPEGNWYCESCR  470



>ref|XP_010228722.1| PREDICTED: ABC transporter F family member 4-like isoform X1 
[Brachypodium distachyon]
Length=841

 Score = 60.5 bits (145),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 86/186 (46%), Gaps = 22/186 (12%)
 Frame = +1

Query  928   ALASPFKSPLEQRRIVDVDQKEDENCVK--LPTSPALSCVICWTDFS--SSRGLLPC-GH  1092
             A A+P   P+  RRI      ED+   K  L  +    C IC ++    + +G+L C  H
Sbjct  463   AQATP---PVSPRRISFTRNGEDKGKEKRELVDAGKPRCGICLSEDQKMTLQGVLDCCSH  519

Query  1093  RFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDI  1272
              FCF+CI  W+ ++ SR     CPLCK  FT+ITK +  +   +   S  + ++R   D 
Sbjct  520   FFCFACIMEWS-RVESR-----CPLCKRRFTTITKSSKVDLRLELKNSVIMVEER---DQ  570

Query  1273  YLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCL----DPPLHPW  1440
                P  E      +P    VC +C+    + L++ C +C +   H YC+    + P   W
Sbjct  571   VYQPTQEEIRRWLDPYENLVCIECNQGGDDSLMLLCDICDS-SAHTYCVGLGREVPEGNW  629

Query  1441  TCIHCQ  1458
              C  C+
Sbjct  630   YCGGCR  635



>ref|XP_010228723.1| PREDICTED: ABC transporter F family member 4-like isoform X2 
[Brachypodium distachyon]
Length=836

 Score = 60.1 bits (144),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 86/186 (46%), Gaps = 22/186 (12%)
 Frame = +1

Query  928   ALASPFKSPLEQRRIVDVDQKEDENCVK--LPTSPALSCVICWTDFS--SSRGLLPC-GH  1092
             A A+P   P+  RRI      ED+   K  L  +    C IC ++    + +G+L C  H
Sbjct  458   AQATP---PVSPRRISFTRNGEDKGKEKRELVDAGKPRCGICLSEDQKMTLQGVLDCCSH  514

Query  1093  RFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDI  1272
              FCF+CI  W+ ++ SR     CPLCK  FT+ITK +  +   +   S  + ++R   D 
Sbjct  515   FFCFACIMEWS-RVESR-----CPLCKRRFTTITKSSKVDLRLELKNSVIMVEER---DQ  565

Query  1273  YLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCL----DPPLHPW  1440
                P  E      +P    VC +C+    + L++ C +C +   H YC+    + P   W
Sbjct  566   VYQPTQEEIRRWLDPYENLVCIECNQGGDDSLMLLCDICDS-SAHTYCVGLGREVPEGNW  624

Query  1441  TCIHCQ  1458
              C  C+
Sbjct  625   YCGGCR  630



>gb|KFY62720.1| hypothetical protein V496_04435 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=810

 Score = 60.1 bits (144),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = +1

Query  46   AIQISARVAGMEKVVATVSGYQ-GTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGR  222
            A++    +  +  ++  ++G++  TER N+I LI   GG Y G ++ SITHL+  R EG+
Sbjct  123  ALEFEHTLPTLASLIVCMTGFEDSTERTNIINLICSNGGEYHGDLTRSITHLIASRPEGK  182

Query  223  KFELAKKSRNTFIVNHRWIEDCIKKGRRVPEHPY  324
            K++ AK  +   +V+  W+ D I++G  + E+ Y
Sbjct  183  KYKFAKDWK-IRLVSAEWLYDSIQRGMILDENLY  215



>ref|XP_006344715.1| PREDICTED: uncharacterized protein LOC102592881 isoform X1 [Solanum 
tuberosum]
 ref|XP_006344716.1| PREDICTED: uncharacterized protein LOC102592881 isoform X2 [Solanum 
tuberosum]
 ref|XP_006344717.1| PREDICTED: uncharacterized protein LOC102592881 isoform X3 [Solanum 
tuberosum]
Length=949

 Score = 60.1 bits (144),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 83/187 (44%), Gaps = 23/187 (12%)
 Frame = +1

Query  934   ASPFKSPLE-----QRRIVDVDQKEDENCVKLPTSPALSCVICWTDFS--SSRGLLPC-G  1089
             AS  KSP+E     QR+      KE    +K+     + C IC ++    + RG L C  
Sbjct  528   ASLKKSPIEEAPRLQRKHPARKAKEKMEELKIEAGKQI-CGICLSEEGKRTVRGTLNCCS  586

Query  1090  HRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTD  1269
             H FCF+CI  W+ ++ SR     CPLCK  F +I+K A    SD     +T+    P  D
Sbjct  587   HYFCFACIMEWS-KVESR-----CPLCKQRFVTISKPA---RSDTGFDLRTVVIHVPERD  637

Query  1270  IYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCL----DPPLHP  1437
                 P  E      +P    +C +C     + L++ C +C +   H YC+    + P   
Sbjct  638   QVYQPSEEELRGYLDPYENVLCTECQQGGDDALMLLCDLCDS-PAHTYCVGLGHEVPEGN  696

Query  1438  WTCIHCQ  1458
             W C  C+
Sbjct  697   WYCESCR  703



>gb|KFY90315.1| hypothetical protein V498_06048 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=792

 Score = 60.1 bits (144),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = +1

Query  46   AIQISARVAGMEKVVATVSGYQ-GTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGR  222
            A++    +  +  ++  ++G++  TER N+I LI   GG Y G ++ SITHL+  R EG+
Sbjct  105  ALEFEHTLPTLASLIVCMTGFEDSTERTNIINLICSNGGEYHGDLTRSITHLIASRPEGK  164

Query  223  KFELAKKSRNTFIVNHRWIEDCIKKGRRVPEHPY  324
            K++ AK  +   +V+  W+ D I++G  + E+ Y
Sbjct  165  KYKFAKDWK-IRLVSAEWLYDSIQRGMILDENLY  197



>ref|XP_625456.1| 2x PHD domain containing protein [Cryptosporidium parvum Iowa 
II]
 gb|EAK87407.1| 2x PHD domain containing protein [Cryptosporidium parvum Iowa 
II]
Length=933

 Score = 60.1 bits (144),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 53/130 (41%), Gaps = 21/130 (16%)
 Frame = +1

Query  1072  GLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQ  1251
             GL  C H FCF CI+ W+D        + CPLCK  F  I    +  P +  I    IP 
Sbjct  200   GLSVCKHIFCFVCIKQWSDV------ATQCPLCKREFDHINAF-NVIPGELSIPVMVIPV  252

Query  1252  DRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPL  1431
             +        +     +    +P     C  C   + EE+L+ C  C  R  H YCLDPPL
Sbjct  253   E--------MKKLNCNEMDEDPFADFACEVCRLNDHEEVLLLCDRCD-RGYHTYCLDPPL  303

Query  1432  HP-----WTC  1446
                    W C
Sbjct  304   DSVPSGEWFC  313



>ref|XP_665508.1| KIAA1453 protein [Cryptosporidium hominis TU502]
Length=933

 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 53/130 (41%), Gaps = 21/130 (16%)
 Frame = +1

Query  1072  GLLPCGHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQ  1251
             GL  C H FCF CI+ W+D        + CPLCK  F  I    +  P +  I    IP 
Sbjct  200   GLSVCKHIFCFVCIKQWSDV------ATQCPLCKREFDHINAF-NVIPGELSIPVMVIPV  252

Query  1252  DRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLDPPL  1431
             +        +     +    +P     C  C   + EE+L+ C  C  R  H YCLDPPL
Sbjct  253   E--------MKKLNCNEMDEDPFADFACEVCRLNDHEEVLLLCDRCD-RGYHTYCLDPPL  303

Query  1432  HP-----WTC  1446
                    W C
Sbjct  304   DSVPSGEWFC  313



>ref|XP_006433493.1| hypothetical protein CICLE_v10000286mg [Citrus clementina]
 gb|ESR46733.1| hypothetical protein CICLE_v10000286mg [Citrus clementina]
Length=828

 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 53/191 (28%), Positives = 79/191 (41%), Gaps = 25/191 (13%)
 Frame = +1

Query  907   ETLENEGALASPFKSPLEQRRIVDVDQKEDENCVKLPTSPALSCVICWT--DFSSSRGLL  1080
             +T++ +G L  P       R+ +    KE    VK   +  + C IC +  D    RG L
Sbjct  311   KTIQEDGNLGQP-------RKTLGRKGKEKIEEVKSEVAKQV-CGICLSEEDKRRLRGTL  362

Query  1081  PC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDR  1257
              C  H FCF+CI  W+         S CPLCK  F +ITK    E S   +  +++    
Sbjct  363   NCCSHYFCFTCIMEWSKV------ESRCPLCKQRFKTITK---PERSTAGVDLRSVVIQV  413

Query  1258  PGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHVCQTRCIHAYCLD----P  1425
             P  D    P  E      +P    +C +C     + L++ C +C +   H YC+      
Sbjct  414   PERDQVYQPSEEDLRSFLDPYENVICSECHQGGDDGLMLLCDICDS-SAHTYCVGLGRVV  472

Query  1426  PLHPWTCIHCQ  1458
             P   W C  C+
Sbjct  473   PEGNWYCDGCR  483



>gb|KHG02838.1| PHD and RING finger domain-containing 1 [Gossypium arboreum]
Length=877

 Score = 59.7 bits (143),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 66/148 (45%), Gaps = 17/148 (11%)
 Frame = +1

Query  1036  CVICWT--DFSSSRGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVAD  1206
             C IC +  D    RG L C  H FCF+CI  W+ ++ SR     CPLCK  F +I+K A 
Sbjct  385   CGICLSEEDKRRLRGTLNCCSHYFCFTCIMEWS-KVESR-----CPLCKQRFETISKPAR  438

Query  1207  AEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHV  1386
             +        S+ +    P  D    P  E      +P    +C +C     +EL++ C +
Sbjct  439   SAAG---FDSREVLIQVPKRDQVYQPSEEELRSYLDPYENVICSECHQGGDDELMLLCDI  495

Query  1387  CQTRCIHAYCL----DPPLHPWTCIHCQ  1458
             C +   H YC+    + P   W C  C+
Sbjct  496   CDSSA-HTYCVGLGREVPEDNWYCDGCR  522



>ref|XP_447336.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG60273.1| unnamed protein product [Candida glabrata]
Length=1099

 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 57/109 (52%), Gaps = 15/109 (14%)
 Frame = +1

Query  79   EKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRNT-  255
            + +  T + Y G +R  L +LI   GG+    +S   THL+C    G+K+E+A K + + 
Sbjct  374  QDLAVTYTNYFGEQRTYLQQLIELLGGSATMELSKQNTHLICNLPFGKKYEVAMKWKESG  433

Query  256  ---FIVNHRWIEDCIKKGRRVP-----------EHPYTVQCGQEVGPLL  360
                I +HRW+E+C   G++VP           ++ Y++  GQ++ P L
Sbjct  434  SKIVICSHRWLEECYISGKKVPVDEAYTRLERDDNTYSLTLGQQLSPKL  482



>ref|XP_006855347.1| hypothetical protein AMTR_s00057p00103590 [Amborella trichopoda]
 gb|ERN16814.1| hypothetical protein AMTR_s00057p00103590 [Amborella trichopoda]
Length=731

 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 61/148 (41%), Gaps = 19/148 (13%)
 Frame = +1

Query  1036  CVICWTD--FSSSRGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVAD  1206
             C IC ++    S RG L C  H FCF CI  W+         S CP+CK  F SI K   
Sbjct  329   CGICLSEERKGSIRGSLNCCDHYFCFGCIMEWSKV------ESRCPICKQRFVSINKFGG  382

Query  1207  AEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHV  1386
                 D  + S +I    P  D    P  E      +P    VC +C     + L++ C +
Sbjct  383   V---DTGVRSMSIRI--PKRDQVYEPSEEELRGYLDPYANIVCMECQQGGDDNLMLLCDI  437

Query  1387  CQTRCIHAYCL----DPPLHPWTCIHCQ  1458
             C +   H YC+    + P   W C  C+
Sbjct  438   CDS-SAHTYCVGLGREVPDGNWYCDVCR  464



>gb|EEE65531.1| hypothetical protein OsJ_20986 [Oryza sativa Japonica Group]
Length=1288

 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 70/152 (46%), Gaps = 23/152 (15%)
 Frame = +1

Query  1027  ALSCVICWTDFSSS-RGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITK-  1197
              +SC IC TD   + RG L C  H FCF CI +WA ++ SR     CP CK  F +IT+ 
Sbjct  24    GVSCGICLTDARRAVRGELDCCAHHFCFVCIMAWA-RVESR-----CPFCKARFRTITRP  77

Query  1198  -VADAEPSDQKIYSQTIPQDRPGTDIYLLPDGE-TSHFPANPAMPPVCCQCSSREPEELL  1371
              V    PS + +    +P+     +    P G  +S   A+      C  C+    +ELL
Sbjct  78    PVPGRFPSQRVV---AVPERNQACN----PSGNGSSTVDADLYANTSCSVCNLSNDDELL  130

Query  1372  INCHVCQTRCIHAYCL----DPPLHPWTCIHC  1455
             + C +C +  +H YC     + P   W C  C
Sbjct  131   MLCELCDS-AVHTYCAGLGTEIPEGDWFCTDC  161



>gb|EEC80403.1| hypothetical protein OsI_22555 [Oryza sativa Indica Group]
Length=1223

 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 70/152 (46%), Gaps = 23/152 (15%)
 Frame = +1

Query  1027  ALSCVICWTDFSSS-RGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITK-  1197
              +SC IC TD   + RG L C  H FCF CI +WA ++ SR     CP CK  F +IT+ 
Sbjct  23    GVSCGICLTDARRAVRGELDCCAHHFCFVCIMAWA-RVESR-----CPFCKARFRTITRP  76

Query  1198  -VADAEPSDQKIYSQTIPQDRPGTDIYLLPDGE-TSHFPANPAMPPVCCQCSSREPEELL  1371
              V    PS + +    +P+     +    P G  +S   A+      C  C+    +ELL
Sbjct  77    PVPGRFPSQRVV---AVPERNQACN----PSGNGSSTVDADLYANTSCSVCNLSNDDELL  129

Query  1372  INCHVCQTRCIHAYCL----DPPLHPWTCIHC  1455
             + C +C +  +H YC     + P   W C  C
Sbjct  130   MLCELCDS-AVHTYCAGLGTEIPEGDWFCTDC  160



>ref|NP_001057395.1| Os06g0283200 [Oryza sativa Japonica Group]
 dbj|BAD69258.1| 2x PHD domain containing protein-like [Oryza sativa Japonica 
Group]
 dbj|BAF19309.1| Os06g0283200 [Oryza sativa Japonica Group]
 dbj|BAG93663.1| unnamed protein product [Oryza sativa Japonica Group]
Length=763

 Score = 59.3 bits (142),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 70/152 (46%), Gaps = 23/152 (15%)
 Frame = +1

Query  1027  ALSCVICWTDFSSS-RGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITK-  1197
              +SC IC TD   + RG L C  H FCF CI +WA ++ SR     CP CK  F +IT+ 
Sbjct  24    GVSCGICLTDARRAVRGELDCCAHHFCFVCIMAWA-RVESR-----CPFCKARFRTITRP  77

Query  1198  -VADAEPSDQKIYSQTIPQDRPGTDIYLLPDGE-TSHFPANPAMPPVCCQCSSREPEELL  1371
              V    PS + +    +P+     +    P G  +S   A+      C  C+    +ELL
Sbjct  78    PVPGRFPSQRVV---AVPERNQACN----PSGNGSSTVDADLYANTSCSVCNLSNDDELL  130

Query  1372  INCHVCQTRCIHAYCL----DPPLHPWTCIHC  1455
             + C +C +  +H YC     + P   W C  C
Sbjct  131   MLCELCDS-AVHTYCAGLGTEIPEGDWFCTDC  161



>ref|XP_010245441.1| PREDICTED: uncharacterized protein LOC104588985 isoform X2 [Nelumbo 
nucifera]
Length=726

 Score = 59.3 bits (142),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 64/148 (43%), Gaps = 17/148 (11%)
 Frame = +1

Query  1036  CVICWTDF--SSSRGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVAD  1206
             C IC T+    + RG+L C  H FCFSCI  W+         S CPLCK  F +I+K A 
Sbjct  409   CGICLTEEREETVRGILNCCSHYFCFSCIIEWSK------VESRCPLCKQRFVTISKPA-  461

Query  1207  AEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHV  1386
                S   I  + +    P  D    P  E      +P    VC +C     + L++ C +
Sbjct  462   --RSTIGIDLRNVVIRVPKRDQVYRPSEEEVRGYYDPYANVVCMECQQGGDDNLMLLCDI  519

Query  1387  CQTRCIHAYCL----DPPLHPWTCIHCQ  1458
             C +   H YC+    + P   W C  C+
Sbjct  520   CDSPA-HTYCVGLGREVPEGNWYCEGCR  546



>gb|KFX88186.1| hypothetical protein V490_07779 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=783

 Score = 59.3 bits (142),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = +1

Query  46   AIQISARVAGMEKVVATVSGYQ-GTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGR  222
            A++    +  +  ++  ++G++  TER N+I LI   GG Y G ++ SITHL+  R EG+
Sbjct  88   ALEAEHTLPTLASLIVCMTGFEDSTERTNIINLICSNGGEYHGDLTRSITHLIANRPEGK  147

Query  223  KFELAKKSRNTFIVNHRWIEDCIKKGRRVPEHPY  324
            K++ AK  +   +V+  W+ D I++G  + E+ Y
Sbjct  148  KYKFAKDWK-IRLVSAEWLYDSIQRGMILDENLY  180



>ref|XP_006606546.1| PREDICTED: uncharacterized protein LOC100797448 isoform X1 [Glycine 
max]
 ref|XP_006606547.1| PREDICTED: uncharacterized protein LOC100797448 isoform X2 [Glycine 
max]
Length=858

 Score = 59.3 bits (142),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 48/167 (29%), Positives = 70/167 (42%), Gaps = 17/167 (10%)
 Frame = +1

Query  979   VDQKEDENCVKLPTSPALSCVICWT--DFSSSRGLLPC-GHRFCFSCIQSWADQMVSRGK  1149
             + +K  E    L +    +C IC +  D    RG+L C  H FCF+CI  WA        
Sbjct  388   LGRKGKEKVEDLKSKGKQTCGICLSEEDKRRVRGVLNCCTHFFCFACIMEWAKV------  441

Query  1150  TSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPP  1329
              S CPLCK  F +I+K A    S   I  + +    P  D    P  E      +P    
Sbjct  442   ESRCPLCKQRFKAISKPAR---STTGIDLREVVIQVPERDQVYQPSEEELRSYIDPYEYV  498

Query  1330  VCCQCSSREPEELLINCHVCQTRCIHAYCL----DPPLHPWTCIHCQ  1458
             +C +C     + L++ C +C +   H YC+    + P   W C  C+
Sbjct  499   ICSECHQGGDDGLMLLCDICDSPA-HTYCVGLGREVPEGNWYCDGCR  544



>gb|KFY00480.1| hypothetical protein O988_03282 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=783

 Score = 59.3 bits (142),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = +1

Query  46   AIQISARVAGMEKVVATVSGYQ-GTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGR  222
            A++    +  +  ++  ++G++  TER N+I LI   GG Y G ++ SITHL+  R EG+
Sbjct  88   ALEAEHTLPTLASLIVCMTGFEDSTERTNIINLICSNGGEYHGDLTRSITHLIANRPEGK  147

Query  223  KFELAKKSRNTFIVNHRWIEDCIKKGRRVPEHPY  324
            K++ AK  +   +V+  W+ D I++G  + E+ Y
Sbjct  148  KYKFAKDWK-IRLVSAEWLYDSIQRGMILDENLY  180



>gb|KHN20268.1| PHD and RING finger domain-containing protein 1 [Glycine soja]
Length=858

 Score = 59.3 bits (142),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 48/167 (29%), Positives = 70/167 (42%), Gaps = 17/167 (10%)
 Frame = +1

Query  979   VDQKEDENCVKLPTSPALSCVICWT--DFSSSRGLLPC-GHRFCFSCIQSWADQMVSRGK  1149
             + +K  E    L +    +C IC +  D    RG+L C  H FCF+CI  WA        
Sbjct  388   LGRKGKEKVEDLKSKGKQTCGICLSEEDKRRVRGVLNCCTHFFCFACIMEWAKV------  441

Query  1150  TSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPP  1329
              S CPLCK  F +I+K A    S   I  + +    P  D    P  E      +P    
Sbjct  442   ESRCPLCKQRFKTISKPAR---STTGIDLREVVIQVPERDQVYQPSEEELRSYIDPYEYV  498

Query  1330  VCCQCSSREPEELLINCHVCQTRCIHAYCL----DPPLHPWTCIHCQ  1458
             +C +C     + L++ C +C +   H YC+    + P   W C  C+
Sbjct  499   ICSECHQGGDDGLMLLCDICDSPA-HTYCVGLGREVPEGNWYCDGCR  544



>gb|KFY46003.1| hypothetical protein V495_02714 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY56919.1| hypothetical protein V497_05881 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=783

 Score = 59.3 bits (142),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = +1

Query  46   AIQISARVAGMEKVVATVSGYQ-GTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGR  222
            A++    +  +  ++  ++G++  TER N+I LI   GG Y G ++ SITHL+  R EG+
Sbjct  88   ALEAEHTLPTLASLIVCMTGFEDSTERTNIINLICSNGGEYHGDLTRSITHLIANRPEGK  147

Query  223  KFELAKKSRNTFIVNHRWIEDCIKKGRRVPEHPY  324
            K++ AK  +   +V+  W+ D I++G  + E+ Y
Sbjct  148  KYKFAKDWK-IRLVSAEWLYDSIQRGMILDENLY  180



>gb|EPB82463.1| hypothetical protein HMPREF1544_10802 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=350

 Score = 58.2 bits (139),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (52%), Gaps = 0/81 (0%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
            +AGMEK V  ++G++G  R  L +LI   G  +   ++   T+L+C    G K+      
Sbjct  179  IAGMEKCVIALTGFKGENRTFLNRLIFACGAYFATKLAKDTTYLICGGGYGDKYAELPNY  238

Query  247  RNTFIVNHRWIEDCIKKGRRV  309
             N   VNH W+EDC  + R +
Sbjct  239  PNVIRVNHLWLEDCYAQFRMI  259



>gb|EYU37248.1| hypothetical protein MIMGU_mgv1a001925mg [Erythranthe guttata]
Length=739

 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 68/148 (46%), Gaps = 21/148 (14%)
 Frame = +1

Query  1036  CVICWTDFS--SSRGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVAD  1206
             C IC ++    + RG+L C  H FCF+CI  W+ ++ SR     CPLCK  F +I++ A 
Sbjct  380   CGICLSEEGKRTVRGVLNCCSHHFCFTCIMEWS-KVESR-----CPLCKQRFATISRTAG  433

Query  1207  AEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHV  1386
              E +D       +PQ     D    P  E      +P    +C +C     + L++ C +
Sbjct  434   NELTDAVF---PVPQ----RDQVYQPSEEELRGYLDPYENVLCSECQQGGDDALMLLCDL  486

Query  1387  CQTRCIHAYCL----DPPLHPWTCIHCQ  1458
             C +   H YC+    + P   W C  C+
Sbjct  487   CDSPA-HTYCVGLGHEVPDGNWYCDGCR  513



>gb|KFY23511.1| hypothetical protein V493_05815, partial [Pseudogymnoascus pannorum 
VKM F-4281 (FW-2241)]
Length=873

 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = +1

Query  46   AIQISARVAGMEKVVATVSGYQGT-ERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGR  222
            A++    +  +  ++  ++G++ T ER N+I LI   GG Y G ++ SITHL+  R EG+
Sbjct  119  ALEAEHTLPTLATLIVCMTGFEDTAERTNIINLICSNGGEYHGDLTRSITHLIASRPEGK  178

Query  223  KFELAKKSRNTFIVNHRWIEDCIKKGRRVPEHPY  324
            K++ AK  +   +V+  W+ D I++G  + E+ Y
Sbjct  179  KYKFAKDWK-IRLVSAEWLYDSIQRGMILDENLY  211



>gb|EZG55363.1| RING finger protein [Gregarina niphandrodes]
Length=288

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 69/163 (42%), Gaps = 23/163 (14%)
 Frame = +1

Query  964   RRIVDVDQKEDENCVKLPTSPALSCVICWTDFSSSR-GLLP--CGHRFCFSCIQSWADQM  1134
             RR    + +    C   PT+  + C +C  D S      +P  C HRFC  C+ SWA+  
Sbjct  100   RRRNGAEGEAGSECAAEPTT-GVECPVCMCDMSGHEVSAMPASCSHRFCVECLTSWAE--  156

Query  1135  VSRGKTSTCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPAN  1314
                 K ++CPLC+V F+ I  +    P  Q++  + + +D   +D+ +         PA 
Sbjct  157   ----KCTSCPLCRVSFSGIKILTPEGPLLQRVRKRRLQEDDYESDVAV-------ERPAT  205

Query  1315  PAMPPV----CCQCSSREPEELLINCHVCQTRCIHAYCLDPPL  1431
                PP     CC C SR      I C  C  +  H  C+   L
Sbjct  206   RRRPPSRNGQCCVC-SRALRRHFIECMRCGEK-FHEECMSVRL  246



>ref|XP_010245438.1| PREDICTED: uncharacterized protein LOC104588985 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010245439.1| PREDICTED: uncharacterized protein LOC104588985 isoform X1 [Nelumbo 
nucifera]
Length=891

 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 64/148 (43%), Gaps = 17/148 (11%)
 Frame = +1

Query  1036  CVICWTDF--SSSRGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVAD  1206
             C IC T+    + RG+L C  H FCFSCI  W+         S CPLCK  F +I+K A 
Sbjct  409   CGICLTEEREETVRGILNCCSHYFCFSCIIEWSK------VESRCPLCKQRFVTISKPA-  461

Query  1207  AEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHV  1386
                S   I  + +    P  D    P  E      +P    VC +C     + L++ C +
Sbjct  462   --RSTIGIDLRNVVIRVPKRDQVYRPSEEEVRGYYDPYANVVCMECQQGGDDNLMLLCDI  519

Query  1387  CQTRCIHAYCL----DPPLHPWTCIHCQ  1458
             C +   H YC+    + P   W C  C+
Sbjct  520   CDSPA-HTYCVGLGREVPEGNWYCEGCR  546



>ref|XP_010464100.1| PREDICTED: uncharacterized protein LOC104744710 [Camelina sativa]
 ref|XP_010464101.1| PREDICTED: uncharacterized protein LOC104744710 [Camelina sativa]
Length=904

 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 64/148 (43%), Gaps = 17/148 (11%)
 Frame = +1

Query  1036  CVICWT--DFSSSRGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVAD  1206
             C IC +  D    +G L C  H FCF+CI  W+         S CPLCK  F +I+K A 
Sbjct  429   CGICLSEEDMRRLKGTLDCCSHYFCFTCIMEWSKV------ESRCPLCKQRFRTISKPAR  482

Query  1207  AEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHV  1386
             + P    +    IP   P  D    P  E      +P    +C +C   + + L++ C +
Sbjct  483   STPG-VDLREVVIPV--PERDQVYQPTEEELRSYLDPYENIICTECHQGDDDGLMLLCDL  539

Query  1387  CQTRCIHAYCL----DPPLHPWTCIHCQ  1458
             C +   H YC+    + P   W C  C+
Sbjct  540   CDS-SAHTYCVGLGREVPEGNWYCEGCR  566



>ref|XP_009618260.1| PREDICTED: uncharacterized protein LOC104110464 [Nicotiana tomentosiformis]
 ref|XP_009618261.1| PREDICTED: uncharacterized protein LOC104110464 [Nicotiana tomentosiformis]
 ref|XP_009618262.1| PREDICTED: uncharacterized protein LOC104110464 [Nicotiana tomentosiformis]
Length=690

 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 70/165 (42%), Gaps = 18/165 (11%)
 Frame = +1

Query  988   KEDENCVKLPTSPALS-CVICWTDFS--SSRGLLPC-GHRFCFSCIQSWADQMVSRGKTS  1155
             ++D+  V L T      C IC ++    + RG L C  H FCF+CI  W+         S
Sbjct  295   RKDKEKVDLKTEVGKQICGICLSEEGKRTVRGTLNCCSHYFCFACIMEWSKV------ES  348

Query  1156  TCPLCKVGFTSITKVADAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVC  1335
              CPLCK  F  I+K A    SD     +T+    P  D    P  E      +P    +C
Sbjct  349   RCPLCKQRFVMISKPAR---SDTSFELRTVAFQVPERDQVYQPSEEELRGYIDPYENVLC  405

Query  1336  CQCSSREPEELLINCHVCQTRCIHAYCL----DPPLHPWTCIHCQ  1458
              +C     + L++ C +C +   H YC+    + P   W C  C+
Sbjct  406   TECQQGGDDALMLLCDLCDSPA-HTYCVGLGHEVPEGNWYCESCR  449



>ref|NP_001049869.1| Os03g0302200 [Oryza sativa Japonica Group]
 gb|ABF95494.1| PHD-finger family protein, expressed [Oryza sativa Japonica Group]
 gb|ABF95495.1| PHD-finger family protein, expressed [Oryza sativa Japonica Group]
 gb|ABF95496.1| PHD-finger family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF11783.1| Os03g0302200 [Oryza sativa Japonica Group]
 gb|EAZ26628.1| hypothetical protein OsJ_10531 [Oryza sativa Japonica Group]
Length=799

 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 68/149 (46%), Gaps = 17/149 (11%)
 Frame = +1

Query  1033  SCVICWTDFS--SSRGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVA  1203
             +C IC ++    + +G+L C  H FCF+CI  W+         S CPLCK  FT+ITK +
Sbjct  412   TCGICLSEEQRVTVQGVLDCCSHYFCFACIMQWSKV------ESRCPLCKRRFTTITKSS  465

Query  1204  DAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCH  1383
               +   +   S    ++R   D    P  E      +P    VC +C+    + L++ C 
Sbjct  466   KEDTGLELTNSVIRVEER---DQVYQPTEEEIRRWLDPYENVVCIECNQGGDDSLMLLCD  522

Query  1384  VCQTRCIHAYCL----DPPLHPWTCIHCQ  1458
             +C +   H YC+    + P   W C  C+
Sbjct  523   ICDS-SAHTYCVGLGREVPEGNWYCGGCR  550



>ref|XP_006296950.1| hypothetical protein CARUB_v10012943mg [Capsella rubella]
 ref|XP_006296951.1| hypothetical protein CARUB_v10012943mg [Capsella rubella]
 ref|XP_006296952.1| hypothetical protein CARUB_v10012943mg [Capsella rubella]
 gb|EOA29848.1| hypothetical protein CARUB_v10012943mg [Capsella rubella]
 gb|EOA29849.1| hypothetical protein CARUB_v10012943mg [Capsella rubella]
 gb|EOA29850.1| hypothetical protein CARUB_v10012943mg [Capsella rubella]
Length=888

 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 64/148 (43%), Gaps = 17/148 (11%)
 Frame = +1

Query  1036  CVICWT--DFSSSRGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVAD  1206
             C IC +  D    +G L C  H FCF+CI  W+         S CPLCK  F +I+K A 
Sbjct  414   CGICLSEEDMRRLKGTLDCCSHYFCFTCIMEWSKV------ESRCPLCKQRFRTISKPAR  467

Query  1207  AEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHV  1386
             + P    +    IP   P  D    P  E      +P    +C +C   + + L++ C +
Sbjct  468   STPG-VDLREVVIPV--PERDQVYQPTEEELRSYLDPYENIICTECHQGDDDGLMLLCDL  524

Query  1387  CQTRCIHAYCL----DPPLHPWTCIHCQ  1458
             C +   H YC+    + P   W C  C+
Sbjct  525   CDSSA-HTYCVGLGREVPEGNWYCEGCR  551



>gb|EAY89669.1| hypothetical protein OsI_11202 [Oryza sativa Indica Group]
Length=792

 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 68/149 (46%), Gaps = 17/149 (11%)
 Frame = +1

Query  1033  SCVICWTDFS--SSRGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVA  1203
             +C IC ++    + +G+L C  H FCF+CI  W+         S CPLCK  FT+ITK +
Sbjct  405   TCGICLSEEQRVTVQGVLDCCSHYFCFACIMQWSKV------ESRCPLCKRRFTTITKSS  458

Query  1204  DAEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCH  1383
               +   +   S    ++R   D    P  E      +P    VC +C+    + L++ C 
Sbjct  459   KEDTGLELTNSVIRVEER---DQVYQPTEEEIRRWLDPYENVVCIECNQGGDDSLMLLCD  515

Query  1384  VCQTRCIHAYCL----DPPLHPWTCIHCQ  1458
             +C +   H YC+    + P   W C  C+
Sbjct  516   ICDS-SAHTYCVGLGREVPEGNWYCGGCR  543



>ref|XP_009134838.1| PREDICTED: uncharacterized protein LOC103859105 [Brassica rapa]
Length=857

 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 64/148 (43%), Gaps = 17/148 (11%)
 Frame = +1

Query  1036  CVICWT--DFSSSRGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVAD  1206
             C IC +  D    +G L C  H FCF+CI  W+         S CPLCK  F +I+K A 
Sbjct  384   CGICLSEEDMRRLKGTLDCCSHYFCFTCIMEWSK------VESRCPLCKQRFRTISKPAR  437

Query  1207  AEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHV  1386
             + P    +    IP   P  D    P  E      +P    +C +C   E + L++ C +
Sbjct  438   STPG-VDLREVLIPV--PERDQVYQPTEEELRSYLDPYENTICSECHQGEDDGLMLLCDL  494

Query  1387  CQTRCIHAYCL----DPPLHPWTCIHCQ  1458
             C +   H YC+    + P   W C  C+
Sbjct  495   CDSSA-HTYCVGLGREVPEGNWYCEVCR  521



>emb|CDX74135.1| BnaA03g29120D [Brassica napus]
Length=860

 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 64/148 (43%), Gaps = 17/148 (11%)
 Frame = +1

Query  1036  CVICWT--DFSSSRGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVAD  1206
             C IC +  D    +G L C  H FCF+CI  W+         S CPLCK  F +I+K A 
Sbjct  384   CGICLSEEDMRRLKGTLDCCSHYFCFTCIMEWSK------VESRCPLCKQRFRTISKPAR  437

Query  1207  AEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHV  1386
             + P    +    IP   P  D    P  E      +P    +C +C   E + L++ C +
Sbjct  438   STPG-VDLREVLIPV--PERDQVYQPTEEELRSYLDPYENTICSECHQGEDDGLMLLCDL  494

Query  1387  CQTRCIHAYCL----DPPLHPWTCIHCQ  1458
             C +   H YC+    + P   W C  C+
Sbjct  495   CDSSA-HTYCVGLGREVPEGNWYCEVCR  521



>gb|KHG01528.1| Topors [Gossypium arboreum]
Length=796

 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 64/148 (43%), Gaps = 17/148 (11%)
 Frame = +1

Query  1036  CVICWT--DFSSSRGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVAD  1206
             C IC +  D    RG L C  H FCF+CI  W+         S CPLCK  F +I+K A 
Sbjct  321   CGICLSEEDKRRLRGKLNCCSHYFCFTCIMEWSKV------ESRCPLCKQRFETISKPAR  374

Query  1207  AEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHV  1386
                S   +  + +    P  D    P  E      +P    +C +C+    +EL++ C +
Sbjct  375   ---STAGVDLRDVVIQVPKRDQVYQPSEEELRSYLDPYENVICSECNQGGDDELMLLCDL  431

Query  1387  CQTRCIHAYCL----DPPLHPWTCIHCQ  1458
             C +   H YC+    + P   W C  C+
Sbjct  432   CDSSA-HTYCVGLGREVPEGNWYCYGCR  458



>gb|KHG01529.1| Topors [Gossypium arboreum]
Length=799

 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 64/148 (43%), Gaps = 17/148 (11%)
 Frame = +1

Query  1036  CVICWT--DFSSSRGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVAD  1206
             C IC +  D    RG L C  H FCF+CI  W+         S CPLCK  F +I+K A 
Sbjct  324   CGICLSEEDKRRLRGKLNCCSHYFCFTCIMEWSK------VESRCPLCKQRFETISKPAR  377

Query  1207  AEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHV  1386
                S   +  + +    P  D    P  E      +P    +C +C+    +EL++ C +
Sbjct  378   ---STAGVDLRDVVIQVPKRDQVYQPSEEELRSYLDPYENVICSECNQGGDDELMLLCDL  434

Query  1387  CQTRCIHAYCL----DPPLHPWTCIHCQ  1458
             C +   H YC+    + P   W C  C+
Sbjct  435   CDSSA-HTYCVGLGREVPEGNWYCYGCR  461



>ref|XP_002320980.2| BRCT domain-containing family protein, partial [Populus trichocarpa]
 gb|EEE99295.2| BRCT domain-containing family protein, partial [Populus trichocarpa]
Length=720

 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 50/88 (57%), Gaps = 10/88 (11%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVS-ITHLVCWRFEGRKFELAKK  243
            + G + ++  ++GYQ  +R +++ ++   G  +   +  + +THL+C++FEG K +L   
Sbjct  105  IPGAKNLIMCLTGYQRQDRDDIMTMVGLMGAQFSKPLVANKVTHLICYKFEGVKIKL---  161

Query  244  SRNTFIVNHRWIEDCIKKGRRVPEHPYT  327
                  VNHRW+E+ ++    +PE  Y+
Sbjct  162  ------VNHRWLEESLRNWELLPEDNYS  183



>ref|XP_009538188.1| hypothetical protein PHYSODRAFT_531258 [Phytophthora sojae]
 gb|EGZ06291.1| hypothetical protein PHYSODRAFT_531258 [Phytophthora sojae]
Length=676

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 55/113 (49%), Gaps = 15/113 (13%)
 Frame = +1

Query  73   GMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKSRN  252
            G   VVA+ S Y G E+  +++L+  AG      ++ + THL+C +  G KF+ A K   
Sbjct  561  GFHDVVASTSVYIGIEQLVVVELLRVAGAQVTRKLNTNNTHLICLKPLGMKFDKATK-WG  619

Query  253  TFIVNHRWIEDCIKKGRRVPEHPYTVQCGQEVGPLLMNITQVGEGNQSSGCNH  411
              +V  RWI DC+ +G+R+ E                   QV EG++SS   H
Sbjct  620  LHVVRARWIVDCLLQGKRLSED--------------FPDFQVIEGDESSSFTH  658



>ref|NP_187218.1| RING/U-box protein [Arabidopsis thaliana]
 gb|AAF26130.1|AC011620_6 unknown protein [Arabidopsis thaliana]
 gb|AAM53309.1| unknown protein [Arabidopsis thaliana]
 gb|AAO00928.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74274.1| RING/U-box protein [Arabidopsis thaliana]
Length=883

 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 64/148 (43%), Gaps = 17/148 (11%)
 Frame = +1

Query  1036  CVICWT--DFSSSRGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVAD  1206
             C IC +  D    +G L C  H FCF+CI  W+         S CPLCK  F +I+K A 
Sbjct  413   CGICLSEEDMRRLKGTLDCCSHYFCFTCIMEWSKV------ESRCPLCKQRFRTISKPAR  466

Query  1207  AEPSDQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCHV  1386
             + P    +    IP   P  D    P  E      +P    +C +C   + + L++ C +
Sbjct  467   STPG-VDLREVVIPV--PERDQVYQPTEEELRSYLDPYENIICTECHQGDDDGLMLLCDL  523

Query  1387  CQTRCIHAYCL----DPPLHPWTCIHCQ  1458
             C +   H YC+    + P   W C  C+
Sbjct  524   CDSSA-HTYCVGLGREVPEGNWYCEGCR  550



>ref|XP_004135770.1| PREDICTED: uncharacterized protein LOC101205950 [Cucumis sativus]
Length=830

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 63/149 (42%), Gaps = 19/149 (13%)
 Frame = +1

Query  1036  CVICWT--DFSSSRGLLPC-GHRFCFSCIQSWADQMVSRGKTSTCPLCKVGFTSITKVAD  1206
             C IC +  D    RG L C  H FCFSCI  WA         S CPLCK  F +I+K   
Sbjct  325   CGICLSEEDKRRVRGTLNCCSHFFCFSCIMEWAK------VESRCPLCKQRFQTISKPGR  378

Query  1207  AEPS-DQKIYSQTIPQDRPGTDIYLLPDGETSHFPANPAMPPVCCQCSSREPEELLINCH  1383
             +    D + +   +P+     D    P  E      +P    +C +C     + L++ C 
Sbjct  379   STAGIDLREFVVQVPE----RDQVYQPSEEELRSYLDPYENVICIECHEGGDDNLMLLCD  434

Query  1384  VCQTRCIHAYCL----DPPLHPWTCIHCQ  1458
             +C +   H YC+    + P   W C  C+
Sbjct  435   LCDSPA-HTYCVGLGREVPEGNWYCADCR  462



>gb|KGK40701.1| hypothetical protein JL09_g88 [Pichia kudriavzevii]
Length=832

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 1/86 (1%)
 Frame = +1

Query  67   VAGMEKVVATVSGYQGTERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGRKFELAKKS  246
            + GM+ ++ +++ Y G  R+ + +LI + GG     +  S THL+     G+K+E A K 
Sbjct  299  ILGMKHLLFSITNYTGDARYYIEELITRMGGKCNKNLKASGTHLIAASSVGKKYEYA-KL  357

Query  247  RNTFIVNHRWIEDCIKKGRRVPEHPY  324
             N  +VNH WIEDC      + E  Y
Sbjct  358  WNIKVVNHTWIEDCFMNWELLDEDGY  383



>gb|KFY82197.1| hypothetical protein V500_10740 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=775

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = +1

Query  46   AIQISARVAGMEKVVATVSGYQGT-ERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGR  222
            A++    +  +  ++  ++G++ + ER N+I LI   GG Y G ++ SITHL+  R EG+
Sbjct  88   ALEAEHTLPTLATLIVCMTGFEDSAERTNIINLICSNGGEYHGDLTRSITHLIASRPEGK  147

Query  223  KFELAKKSRNTFIVNHRWIEDCIKKGRRVPEHPY  324
            K++ AK  +   +V+  W+ D I++G  + E+ Y
Sbjct  148  KYKFAKDWK-IRLVSAEWLYDSIQRGMILDENLY  180



>gb|KFZ24097.1| hypothetical protein V502_01431 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=781

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = +1

Query  46   AIQISARVAGMEKVVATVSGYQGT-ERFNLIKLIAKAGGNYVGAMSVSITHLVCWRFEGR  222
            A++    +  +  ++  ++G++ + ER N+I LI   GG Y G ++ SITHL+  R EG+
Sbjct  88   ALEAEHTLPTLATLIVCMTGFEDSAERTNIINLICSNGGEYHGDLTRSITHLIASRPEGK  147

Query  223  KFELAKKSRNTFIVNHRWIEDCIKKGRRVPEHPY  324
            K++ AK  +   +V+  W+ D I++G  + E+ Y
Sbjct  148  KYKFAKDWK-IRLVSAEWLYDSIQRGMILDENLY  180



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4874061219876