BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18440_g1_i2 len=1965 path=[1953:0-849 @2803@!:850-1401
3355:1402-1466 3420:1467-1964]

Length=1965
                                                                      Score     E

ref|XP_009764734.1|  PREDICTED: probable alpha-mannosidase I MNS5...    981   0.0      
ref|XP_011028624.1|  PREDICTED: probable alpha-mannosidase I MNS5       973   0.0      
ref|XP_006439745.1|  hypothetical protein CICLE_v10019471mg             967   0.0      
ref|XP_006476721.1|  PREDICTED: probable alpha-mannosidase I MNS5...    966   0.0      
gb|KDO69780.1|  hypothetical protein CISIN_1g008122mg                   965   0.0      
ref|XP_007036112.1|  Glycosyl hydrolase family 47 protein               962   0.0      
ref|XP_011071786.1|  PREDICTED: probable alpha-mannosidase I MNS5...    961   0.0      
ref|XP_004236144.1|  PREDICTED: probable alpha-mannosidase I MNS5       960   0.0      
ref|XP_002321565.1|  glycoside hydrolase family 47 family protein       956   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002280345.1|  PREDICTED: probable alpha-mannosidase I MNS5...    956   0.0      Vitis vinifera
ref|XP_006345015.1|  PREDICTED: probable alpha-mannosidase I MNS5...    952   0.0      
gb|EYU42528.1|  hypothetical protein MIMGU_mgv1a025048mg                951   0.0      
gb|KHG00400.1|  putative alpha-mannosidase I MNS5 -like protein         949   0.0      
gb|KDP31146.1|  hypothetical protein JCGZ_11522                         948   0.0      
emb|CDP16406.1|  unnamed protein product                                946   0.0      
ref|XP_004299586.1|  PREDICTED: probable alpha-mannosidase I MNS5...    944   0.0      
ref|XP_002511454.1|  Mannosyl-oligosaccharide 1,2-alpha-mannosida...    944   0.0      Ricinus communis
ref|XP_003549640.1|  PREDICTED: probable alpha-mannosidase I MNS5...    941   0.0      
ref|XP_010027922.1|  PREDICTED: probable alpha-mannosidase I MNS5...    938   0.0      
ref|XP_008239715.1|  PREDICTED: probable alpha-mannosidase I MNS5       937   0.0      
ref|XP_003525487.1|  PREDICTED: probable alpha-mannosidase I MNS5...    936   0.0      
ref|XP_010272051.1|  PREDICTED: probable alpha-mannosidase I MNS5...    935   0.0      
ref|XP_007155391.1|  hypothetical protein PHAVU_003G197300g             932   0.0      
ref|XP_009419876.1|  PREDICTED: probable alpha-mannosidase I MNS5...    930   0.0      
ref|XP_010254901.1|  PREDICTED: probable alpha-mannosidase I MNS5       927   0.0      
ref|XP_009419875.1|  PREDICTED: probable alpha-mannosidase I MNS5...    926   0.0      
ref|XP_008798070.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    920   0.0      
ref|XP_004138129.1|  PREDICTED: probable alpha-mannosidase I MNS5...    920   0.0      
ref|XP_010027930.1|  PREDICTED: probable alpha-mannosidase I MNS5...    919   0.0      
ref|XP_003608915.1|  ER degradation-enhancing alpha-mannosidase-l...    916   0.0      
ref|XP_008453129.1|  PREDICTED: probable alpha-mannosidase I MNS5...    911   0.0      
ref|XP_010663211.1|  PREDICTED: probable alpha-mannosidase I MNS5...    907   0.0      
ref|XP_010678691.1|  PREDICTED: probable alpha-mannosidase I MNS5...    905   0.0      
ref|XP_004508837.1|  PREDICTED: probable alpha-mannosidase I MNS5...    905   0.0      
ref|XP_010027939.1|  PREDICTED: probable alpha-mannosidase I MNS5...    903   0.0      
ref|XP_010532268.1|  PREDICTED: probable alpha-mannosidase I MNS5       901   0.0      
ref|XP_010091047.1|  putative alpha-mannosidase I MNS5                  899   0.0      
ref|XP_006836746.1|  hypothetical protein AMTR_s00088p00147420          890   0.0      
ref|XP_002890731.1|  glycoside hydrolase family 47 protein              890   0.0      
ref|XP_006415751.1|  hypothetical protein EUTSA_v10007201mg             890   0.0      
gb|KHN18487.1|  Putative alpha-mannosidase I MNS5                       885   0.0      
emb|CDX84922.1|  BnaC05g21330D                                          884   0.0      
ref|XP_010913486.1|  PREDICTED: probable alpha-mannosidase I MNS5...    884   0.0      
gb|KFK44632.1|  hypothetical protein AALP_AA1G284100                    884   0.0      
ref|NP_564288.1|  putative alpha-mannosidase I MNS5                     880   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307064.1|  hypothetical protein CARUB_v10008651mg             880   0.0      
ref|XP_010499236.1|  PREDICTED: probable alpha-mannosidase I MNS5...    879   0.0      
emb|CDY27620.1|  BnaA09g27870D                                          879   0.0      
ref|XP_010499235.1|  PREDICTED: probable alpha-mannosidase I MNS5...    877   0.0      
ref|XP_007209089.1|  hypothetical protein PRUPE_ppa003534mg             877   0.0      
ref|XP_009113757.1|  PREDICTED: probable alpha-mannosidase I MNS5...    874   0.0      
gb|KHN48621.1|  Putative alpha-mannosidase I MNS5                       873   0.0      
ref|XP_008646239.1|  PREDICTED: probable alpha-mannosidase I MNS5...    867   0.0      
ref|XP_010272052.1|  PREDICTED: probable alpha-mannosidase I MNS5...    860   0.0      
gb|EEC73977.1|  hypothetical protein OsI_08885                          855   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001048080.1|  Os02g0741300                                       855   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004953893.1|  PREDICTED: probable alpha-mannosidase I MNS5...    855   0.0      
emb|CAN68187.1|  hypothetical protein VITISV_013675                     851   0.0      Vitis vinifera
ref|XP_002454305.1|  hypothetical protein SORBIDRAFT_04g028330          850   0.0      Sorghum bicolor [broomcorn]
ref|XP_006649035.1|  PREDICTED: probable alpha-mannosidase I MNS5...    848   0.0      
ref|XP_003573110.1|  PREDICTED: probable alpha-mannosidase I MNS5       845   0.0      
ref|XP_006476722.1|  PREDICTED: probable alpha-mannosidase I MNS5...    844   0.0      
gb|EMT01140.1|  ER degradation-enhancing alpha-mannosidase-like p...    851   0.0      
ref|XP_010913488.1|  PREDICTED: probable alpha-mannosidase I MNS5...    841   0.0      
ref|XP_008646240.1|  PREDICTED: probable alpha-mannosidase I MNS5...    838   0.0      
ref|XP_010913487.1|  PREDICTED: probable alpha-mannosidase I MNS5...    837   0.0      
ref|XP_008453130.1|  PREDICTED: probable alpha-mannosidase I MNS5...    832   0.0      
ref|XP_009419877.1|  PREDICTED: probable alpha-mannosidase I MNS5...    824   0.0      
ref|XP_010913489.1|  PREDICTED: probable alpha-mannosidase I MNS5...    785   0.0      
ref|XP_010913490.1|  PREDICTED: probable alpha-mannosidase I MNS5...    781   0.0      
ref|XP_011071787.1|  PREDICTED: probable alpha-mannosidase I MNS5...    778   0.0      
ref|XP_010678692.1|  PREDICTED: probable alpha-mannosidase I MNS5...    770   0.0      
ref|XP_006476723.1|  PREDICTED: probable alpha-mannosidase I MNS5...    765   0.0      
ref|XP_009419878.1|  PREDICTED: probable alpha-mannosidase I MNS5...    742   0.0      
ref|XP_002994551.1|  hypothetical protein SELMODRAFT_229806             723   0.0      
ref|XP_002975540.1|  hypothetical protein SELMODRAFT_228348             723   0.0      
ref|XP_002973508.1|  hypothetical protein SELMODRAFT_228194             721   0.0      
ref|XP_009113758.1|  PREDICTED: probable alpha-mannosidase I MNS5...    717   0.0      
ref|XP_009764736.1|  PREDICTED: probable alpha-mannosidase I MNS5...    701   0.0      
gb|EMS63302.1|  putative alpha-mannosidase I MNS5                       663   0.0      
ref|XP_002318019.2|  hypothetical protein POPTR_0012s07810g             655   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009764735.1|  PREDICTED: probable alpha-mannosidase I MNS5...    635   0.0      
ref|XP_010462925.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    634   0.0      
ref|XP_009588288.1|  PREDICTED: probable alpha-mannosidase I MNS5       576   0.0      
ref|XP_002504119.1|  glycoside hydrolase family 47 protein              571   0.0      Micromonas commoda
ref|XP_003059643.1|  glycoside hydrolase family 47 protein              525   6e-176   
ref|XP_005643868.1|  seven-hairpin glycosidase                          515   1e-171   
gb|EPS60831.1|  hypothetical protein M569_13969                         501   8e-170   
ref|XP_007146348.1|  hypothetical protein PHAVU_006G033000g             457   2e-153   
dbj|BAJ94418.1|  predicted protein                                      437   3e-146   
ref|XP_007034948.1|  Glycosyl hydrolase family 47 protein isoform 1     437   6e-141   
ref|XP_004134427.1|  PREDICTED: probable alpha-mannosidase I MNS4...    433   2e-139   
ref|XP_006838875.1|  hypothetical protein AMTR_s00002p00267140          433   3e-139   
ref|XP_002985136.1|  hypothetical protein SELMODRAFT_121761             427   7e-139   
ref|XP_002969801.1|  hypothetical protein SELMODRAFT_92622              426   3e-138   
ref|XP_009398566.1|  PREDICTED: probable alpha-mannosidase I MNS4       428   2e-137   
ref|XP_004289466.1|  PREDICTED: probable alpha-mannosidase I MNS4...    427   4e-137   
ref|XP_006403205.1|  hypothetical protein EUTSA_v10003168mg             426   1e-136   
ref|XP_008438590.1|  PREDICTED: probable alpha-mannosidase I MNS4       425   2e-136   
ref|XP_006350659.1|  PREDICTED: probable alpha-mannosidase I MNS4...    423   1e-135   
ref|XP_010936128.1|  PREDICTED: probable alpha-mannosidase I MNS4...    423   2e-135   
ref|XP_006350658.1|  PREDICTED: probable alpha-mannosidase I MNS4...    422   2e-135   
ref|XP_004970143.1|  PREDICTED: probable alpha-mannosidase I MNS4...    424   3e-135   
ref|XP_008224188.1|  PREDICTED: probable alpha-mannosidase I MNS4       421   5e-135   
ref|XP_007222006.1|  hypothetical protein PRUPE_ppa002909mg             421   6e-135   
gb|KHN30561.1|  Putative alpha-mannosidase I MNS4                       421   7e-135   
ref|NP_199184.1|  putative alpha-mannosidase I MNS4                     421   1e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863644.1|  glycoside hydrolase family 47 protein              421   1e-134   
ref|XP_003536208.1|  PREDICTED: probable alpha-mannosidase I MNS4...    421   1e-134   
gb|EYU33010.1|  hypothetical protein MIMGU_mgv1a002884mg                421   2e-134   
ref|XP_002311656.2|  glycoside hydrolase family 47 family protein       420   2e-134   Populus trichocarpa [western balsam poplar]
ref|XP_006282375.1|  hypothetical protein CARUB_v10028673mg             420   2e-134   
ref|XP_008788133.1|  PREDICTED: probable alpha-mannosidase I MNS4       420   3e-134   
dbj|BAD52943.1|  putative aspartyl(D) tRNA Synthetase (89.0 kD)(d...    421   3e-134   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006420090.1|  hypothetical protein CICLE_v10004553mg             420   3e-134   
ref|NP_001044401.1|  Os01g0773600                                       421   4e-134   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006489501.1|  PREDICTED: probable alpha-mannosidase I MNS4...    419   4e-134   
ref|XP_010542914.1|  PREDICTED: probable alpha-mannosidase I MNS4...    421   4e-134   
ref|XP_011027514.1|  PREDICTED: probable alpha-mannosidase I MNS4       419   6e-134   
ref|XP_010441994.1|  PREDICTED: probable alpha-mannosidase I MNS4       419   6e-134   
ref|XP_009123899.1|  PREDICTED: probable alpha-mannosidase I MNS4       419   6e-134   
ref|XP_004241034.1|  PREDICTED: probable alpha-mannosidase I MNS4...    418   8e-134   
gb|KDP40271.1|  hypothetical protein JCGZ_02269                         418   1e-133   
ref|XP_010274205.1|  PREDICTED: probable alpha-mannosidase I MNS4       418   1e-133   
ref|NP_001132501.1|  uncharacterized protein LOC100193961 precursor     419   1e-133   Zea mays [maize]
ref|XP_008341094.1|  PREDICTED: probable alpha-mannosidase I MNS4       417   2e-133   
gb|KFK31701.1|  hypothetical protein AALP_AA6G147900                    418   2e-133   
ref|XP_010322255.1|  PREDICTED: probable alpha-mannosidase I MNS4...    417   2e-133   
ref|XP_007143880.1|  hypothetical protein PHAVU_007G109800g             417   2e-133   
ref|XP_002456427.1|  hypothetical protein SORBIDRAFT_03g036080          416   3e-133   Sorghum bicolor [broomcorn]
ref|XP_010481835.1|  PREDICTED: probable alpha-mannosidase I MNS4       416   1e-132   
ref|XP_011091103.1|  PREDICTED: probable alpha-mannosidase I MNS4       414   4e-132   
ref|XP_004495394.1|  PREDICTED: probable alpha-mannosidase I MNS4...    412   2e-131   
ref|XP_003569932.1|  PREDICTED: probable alpha-mannosidase I MNS4...    414   2e-131   
emb|CDM84177.1|  unnamed protein product                                413   3e-131   
ref|XP_010693817.1|  PREDICTED: probable alpha-mannosidase I MNS4       411   4e-131   
dbj|BAJ85126.1|  predicted protein                                      413   8e-131   
ref|XP_002517026.1|  Mannosyl-oligosaccharide 1,2-alpha-mannosida...    411   1e-130   Ricinus communis
ref|XP_010069175.1|  PREDICTED: probable alpha-mannosidase I MNS4       411   1e-130   
gb|KEH42782.1|  glycosyl hydrolase family 47 protein                    408   2e-130   
emb|CDX96894.1|  BnaC02g30320D                                          409   3e-130   
ref|XP_010542915.1|  PREDICTED: probable alpha-mannosidase I MNS4...    409   4e-130   
ref|XP_007132819.1|  hypothetical protein PHAVU_011G1272001g            395   7e-130   
gb|KEH42783.1|  glycosyl hydrolase family 47 protein                    408   8e-130   
ref|XP_002280131.1|  PREDICTED: probable alpha-mannosidase I MNS4       409   1e-129   Vitis vinifera
ref|XP_004495395.1|  PREDICTED: probable alpha-mannosidase I MNS4...    404   2e-128   
dbj|GAM25915.1|  hypothetical protein SAMD00019534_090900               399   8e-128   
ref|XP_007901596.1|  PREDICTED: ER degradation-enhancing alpha-ma...    403   1e-127   
gb|KFM79018.1|  ER degradation-enhancing alpha-mannosidase-like 1       398   3e-127   
ref|XP_008317896.1|  PREDICTED: ER degradation-enhancing alpha-ma...    402   4e-127   
ref|XP_006646379.1|  PREDICTED: uncharacterized protein LOC102706250    419   5e-127   
ref|XP_003973373.1|  PREDICTED: ER degradation-enhancing alpha-ma...    401   7e-127   
ref|XP_004084433.1|  PREDICTED: ER degradation-enhancing alpha-ma...    400   1e-126   
ref|XP_008155548.1|  PREDICTED: ER degradation-enhancing alpha-ma...    397   2e-126   
ref|XP_005987996.1|  PREDICTED: ER degradation-enhancing alpha-ma...    400   3e-126   
gb|AJA37905.1|  EDEM-like protein 1                                     397   5e-126   
gb|EPB83370.1|  ER degradation enhancer, mannosidase alpha-like 1       404   6e-126   
ref|XP_005796976.1|  PREDICTED: ER degradation-enhancing alpha-ma...    398   8e-126   
ref|XP_005383976.1|  PREDICTED: ER degradation-enhancing alpha-ma...    396   9e-126   
ref|XP_004339384.1|  glycosyl hydrolase family 47 protein               404   2e-125   
ref|XP_010624478.1|  PREDICTED: ER degradation-enhancing alpha-ma...    394   2e-125   
emb|CDH52163.1|  er degradation-enhancing alpha-mannosidase-like1...    401   3e-125   
ref|XP_008406920.1|  PREDICTED: ER degradation-enhancing alpha-ma...    397   4e-125   
ref|XP_010731080.1|  PREDICTED: ER degradation-enhancing alpha-ma...    396   6e-125   
gb|ELR56083.1|  ER degradation-enhancing alpha-mannosidase-like 1       393   7e-125   
emb|CDS05465.1|  hypothetical protein LRAMOSA07993                      394   8e-125   
ref|XP_005881984.1|  PREDICTED: ER degradation-enhancing alpha-ma...    392   9e-125   
ref|XP_008562182.1|  PREDICTED: ER degradation-enhancing alpha-ma...    392   9e-125   
ref|XP_004903313.1|  PREDICTED: ER degradation-enhancing alpha-ma...    393   1e-124   
gb|KFO32430.1|  ER degradation-enhancing alpha-mannosidase-like 1       392   1e-124   
ref|XP_002435164.1|  alpha-mannosidase, putative                        394   1e-124   Ixodes scapularis [blacklegged tick]
gb|ELW70358.1|  ER degradation-enhancing alpha-mannosidase-like 1       393   1e-124   
ref|XP_010936136.1|  PREDICTED: probable alpha-mannosidase I MNS4...    394   1e-124   
ref|XP_005522018.1|  PREDICTED: ER degradation-enhancing alpha-ma...    394   2e-124   
dbj|BAC29890.1|  unnamed protein product                                392   2e-124   Mus musculus [mouse]
ref|XP_005981151.1|  PREDICTED: ER degradation-enhancing alpha-ma...    391   2e-124   
ref|XP_005832283.1|  hypothetical protein GUITHDRAFT_157889             388   2e-124   
ref|XP_008287161.1|  PREDICTED: ER degradation-enhancing alpha-ma...    395   2e-124   
ref|XP_005053435.1|  PREDICTED: ER degradation-enhancing alpha-ma...    391   2e-124   
ref|XP_008287153.1|  PREDICTED: ER degradation-enhancing alpha-ma...    395   2e-124   
ref|XP_006143111.1|  PREDICTED: ER degradation-enhancing alpha-ma...    392   3e-124   
gb|EEE55466.1|  hypothetical protein OsJ_03634                          395   3e-124   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005288571.1|  PREDICTED: LOW QUALITY PROTEIN: ER degradati...    394   3e-124   
ref|XP_004738745.1|  PREDICTED: ER degradation-enhancing alpha-ma...    392   3e-124   
ref|XP_010717069.1|  PREDICTED: ER degradation-enhancing alpha-ma...    392   3e-124   
gb|EEC71566.1|  hypothetical protein OsI_03924                          394   3e-124   Oryza sativa Indica Group [Indian rice]
ref|XP_008573947.1|  PREDICTED: ER degradation-enhancing alpha-ma...    395   3e-124   
ref|XP_003927217.1|  PREDICTED: ER degradation-enhancing alpha-ma...    392   3e-124   
ref|XP_010571461.1|  PREDICTED: ER degradation-enhancing alpha-ma...    392   3e-124   
ref|XP_004629594.1|  PREDICTED: ER degradation-enhancing alpha-ma...    390   4e-124   
ref|XP_006630750.1|  PREDICTED: ER degradation-enhancing alpha-ma...    394   5e-124   
ref|XP_003762443.1|  PREDICTED: ER degradation-enhancing alpha-ma...    392   5e-124   
ref|XP_005896234.1|  PREDICTED: ER degradation-enhancing alpha-ma...    392   5e-124   
gb|EFB13180.1|  hypothetical protein PANDA_008714                       391   5e-124   Ailuropoda melanoleuca
gb|EPQ17462.1|  ER degradation-enhancing alpha-mannosidase-like 1       390   5e-124   
gb|EHB14659.1|  ER degradation-enhancing alpha-mannosidase-like 1       390   6e-124   
ref|XP_010787046.1|  PREDICTED: ER degradation-enhancing alpha-ma...    394   6e-124   
ref|XP_010960689.1|  PREDICTED: ER degradation-enhancing alpha-ma...    392   7e-124   
ref|XP_004442265.1|  PREDICTED: ER degradation-enhancing alpha-ma...    391   7e-124   
ref|XP_006783208.1|  PREDICTED: ER degradation-enhancing alpha-ma...    392   1e-123   
ref|XP_004548751.1|  PREDICTED: ER degradation-enhancing alpha-ma...    392   1e-123   
gb|EHH51168.1|  ER degradation-enhancing alpha-mannosidase-like 1       391   2e-123   
ref|XP_008954887.1|  PREDICTED: ER degradation-enhancing alpha-ma...    391   2e-123   
ref|XP_008654408.1|  PREDICTED: uncharacterized protein LOC100193...    392   2e-123   
ref|XP_001420019.1|  predicted protein                                  385   2e-123   Ostreococcus lucimarinus CCE9901
ref|XP_006220578.1|  PREDICTED: LOW QUALITY PROTEIN: ER degradati...    389   2e-123   
ref|XP_002920037.1|  PREDICTED: ER degradation-enhancing alpha-ma...    390   3e-123   
ref|XP_238366.4|  PREDICTED: ER degradation-enhancing alpha-manno...    392   3e-123   Rattus norvegicus [brown rat]
ref|NP_001006143.1|  ER degradation-enhancing alpha-mannosidase-l...    391   3e-123   Gallus gallus [bantam]
ref|XP_005166083.1|  PREDICTED: ER degradation-enhancing alpha-ma...    391   3e-123   
ref|XP_003448374.1|  PREDICTED: ER degradation enhancer, mannosid...    392   3e-123   
ref|XP_006074665.1|  PREDICTED: ER degradation-enhancing alpha-ma...    392   3e-123   
ref|XP_004854301.1|  PREDICTED: ER degradation-enhancing alpha-ma...    392   4e-123   
ref|XP_004793540.1|  PREDICTED: ER degradation-enhancing alpha-ma...    390   4e-123   
ref|NP_001096562.1|  ER degradation-enhancing alpha-mannosidase-l...    392   4e-123   Bos taurus [bovine]
ref|XP_003383033.1|  PREDICTED: ER degradation-enhancing alpha-ma...    388   4e-123   
ref|XP_003982524.1|  PREDICTED: ER degradation enhancer, mannosid...    387   4e-123   
emb|CEG65919.1|  Putative ER degradation enhancer, mannosidase al...    390   5e-123   
ref|XP_008067717.1|  PREDICTED: ER degradation-enhancing alpha-ma...    387   5e-123   
ref|XP_007952256.1|  PREDICTED: ER degradation-enhancing alpha-ma...    389   6e-123   
ref|XP_010363980.1|  PREDICTED: ER degradation-enhancing alpha-ma...    391   6e-123   
ref|XP_004018659.1|  PREDICTED: ER degradation-enhancing alpha-ma...    390   6e-123   
ref|XP_005331023.1|  PREDICTED: ER degradation-enhancing alpha-ma...    391   7e-123   
ref|XP_008852801.1|  PREDICTED: ER degradation-enhancing alpha-ma...    391   8e-123   
ref|XP_006909253.1|  PREDICTED: ER degradation-enhancing alpha-ma...    387   8e-123   
ref|XP_004368342.1|  PREDICTED: ER degradation-enhancing alpha-ma...    391   9e-123   
ref|XP_533753.2|  PREDICTED: ER degradation enhancer, mannosidase...    391   9e-123   Canis lupus familiaris [dogs]
ref|XP_006846688.1|  PREDICTED: ER degradation-enhancing alpha-ma...    391   9e-123   
gb|EFX90244.1|  hypothetical protein DAPPUDRAFT_190238                  389   1e-122   
ref|XP_005066228.1|  PREDICTED: ER degradation-enhancing alpha-ma...    390   1e-122   
ref|XP_009237052.1|  PREDICTED: ER degradation-enhancing alpha-ma...    390   1e-122   
ref|XP_005149497.1|  PREDICTED: LOW QUALITY PROTEIN: ER degradati...    389   1e-122   
ref|NP_055489.1|  ER degradation-enhancing alpha-mannosidase-like...    390   2e-122   Homo sapiens [man]
ref|XP_007192550.1|  PREDICTED: ER degradation-enhancing alpha-ma...    386   2e-122   
ref|XP_002758636.1|  PREDICTED: ER degradation-enhancing alpha-ma...    390   2e-122   Callithrix jacchus [common marmoset]
dbj|BAA13203.2|  KIAA0212                                               390   2e-122   Homo sapiens [man]
ref|XP_003473504.1|  PREDICTED: ER degradation-enhancing alpha-ma...    390   2e-122   
tpg|DAA17085.1|  TPA: ER degradation enhancer, mannosidase alpha-...    390   2e-122   
ref|XP_004033576.1|  PREDICTED: ER degradation-enhancing alpha-ma...    390   2e-122   
ref|XP_006985094.1|  PREDICTED: ER degradation-enhancing alpha-ma...    390   2e-122   
ref|XP_007530015.1|  PREDICTED: ER degradation-enhancing alpha-ma...    385   2e-122   
ref|NP_001252679.1|  ER degradation-enhancing alpha-mannosidase-l...    390   3e-122   
ref|NP_619618.1|  ER degradation-enhancing alpha-mannosidase-like...    390   3e-122   Mus musculus [mouse]
ref|XP_007983267.1|  PREDICTED: ER degradation-enhancing alpha-ma...    390   3e-122   
ref|XP_003894203.1|  PREDICTED: ER degradation-enhancing alpha-ma...    390   3e-122   
ref|XP_004399487.1|  PREDICTED: ER degradation-enhancing alpha-ma...    390   3e-122   
ref|XP_004274830.1|  PREDICTED: ER degradation-enhancing alpha-ma...    390   3e-122   
gb|ELK15172.1|  ER degradation-enhancing alpha-mannosidase-like 1       385   3e-122   
ref|XP_004329289.1|  PREDICTED: ER degradation-enhancing alpha-ma...    387   4e-122   
dbj|BAC97900.1|  mKIAA0212 protein                                      390   4e-122   Mus musculus [mouse]
ref|XP_003785524.1|  PREDICTED: ER degradation-enhancing alpha-ma...    389   4e-122   
ref|XP_005089315.1|  PREDICTED: ER degradation-enhancing alpha-ma...    387   4e-122   
ref|XP_008499604.1|  PREDICTED: ER degradation-enhancing alpha-ma...    384   4e-122   
gb|KDR17988.1|  ER degradation-enhancing alpha-mannosidase-like 1       386   5e-122   
ref|NP_001233644.1|  ER degradation-enhancing alpha-mannosidase-l...    389   6e-122   
emb|CEG65922.1|  hypothetical protein RMATCC62417_02598                 382   6e-122   
emb|CEG65920.1|  Putative ER degradation enhancer, mannosidase al...    386   7e-122   
ref|XP_004651424.1|  PREDICTED: ER degradation-enhancing alpha-ma...    387   8e-122   
gb|ELU08304.1|  hypothetical protein CAPTEDRAFT_106603                  386   9e-122   
emb|CAG06976.1|  unnamed protein product                                388   9e-122   Tetraodon nigroviridis
ref|XP_006897140.1|  PREDICTED: ER degradation-enhancing alpha-ma...    387   1e-121   
emb|CEF99457.1|  Glycoside hydrolase, family 47                         390   1e-121   
ref|XP_003217858.1|  PREDICTED: ER degradation-enhancing alpha-ma...    387   1e-121   
ref|XP_004581707.1|  PREDICTED: ER degradation-enhancing alpha-ma...    389   2e-121   
emb|CDQ73389.1|  unnamed protein product                                386   2e-121   
ref|XP_007436393.1|  PREDICTED: ER degradation-enhancing alpha-ma...    387   2e-121   
emb|CEG65921.1|  Putative ER degradation enhancer, mannosidase al...    385   2e-121   
dbj|BAE30594.1|  unnamed protein product                                387   3e-121   Mus musculus [mouse]
ref|XP_008271813.1|  PREDICTED: LOW QUALITY PROTEIN: ER degradati...    386   3e-121   
gb|EHH16214.1|  ER degradation-enhancing alpha-mannosidase-like 1       383   3e-121   
ref|XP_001364795.1|  PREDICTED: ER degradation enhancer, mannosid...    387   5e-121   Monodelphis domestica
emb|CEI98373.1|  Putative ER degradation enhancer, mannosidase al...    390   6e-121   
ref|XP_003740891.1|  PREDICTED: ER degradation-enhancing alpha-ma...    384   7e-121   
ref|NP_001091440.1|  ER degradation enhancer, mannosidase alpha-l...    384   7e-121   Xenopus laevis [clawed frog]
ref|XP_005240272.1|  PREDICTED: ER degradation-enhancing alpha-ma...    381   8e-121   
emb|CEI86602.1|  hypothetical protein RMCBS344292_01037                 390   9e-121   
gb|EDK99415.1|  ER degradation enhancer, mannosidase alpha-like 1...    385   1e-120   
ref|XP_009057904.1|  hypothetical protein LOTGIDRAFT_105585             383   1e-120   
ref|NP_989397.1|  ER degradation enhancer, mannosidase alpha-like...    384   1e-120   Xenopus tropicalis [western clawed frog]
ref|XP_010894406.1|  PREDICTED: ER degradation-enhancing alpha-ma...    385   1e-120   
ref|XP_006679328.1|  hypothetical protein BATDEDRAFT_1486               376   2e-120   
ref|XP_004344337.1|  Edem2-PA                                           389   3e-120   
emb|CEG65918.1|  Putative ER degradation enhancer, mannosidase al...    388   5e-120   
ref|XP_002599781.1|  hypothetical protein BRAFLDRAFT_276750             380   8e-120   
ref|XP_006259650.1|  PREDICTED: ER degradation-enhancing alpha-ma...    379   1e-119   
ref|XP_005365033.1|  PREDICTED: ER degradation-enhancing alpha-ma...    383   1e-119   
ref|XP_009019549.1|  hypothetical protein HELRODRAFT_106488             380   1e-119   
gb|ESA09671.1|  hypothetical protein GLOINDRAFT_40562                   375   2e-119   
ref|NP_001167392.1|  ER degradation-enhancing alpha-mannosidase-l...    380   6e-119   
ref|XP_008864351.1|  hypothetical protein H310_02571                    394   6e-119   
ref|XP_003265091.1|  PREDICTED: LOW QUALITY PROTEIN: ER degradati...    381   6e-119   
gb|EKC26076.1|  ER degradation-enhancing alpha-mannosidase-like 1       376   7e-119   
ref|XP_009822371.1|  hypothetical protein H257_01053                    379   8e-118   
ref|XP_008406921.1|  PREDICTED: ER degradation-enhancing alpha-ma...    375   8e-118   
emb|CDQ05069.1|  Protein Bm2817, isoform e                              375   9e-118   
ref|XP_010232412.1|  PREDICTED: probable alpha-mannosidase I MNS4...    377   3e-117   
ref|XP_787584.2|  PREDICTED: ER degradation-enhancing alpha-manno...    374   4e-117   
ref|XP_009097072.1|  PREDICTED: ER degradation-enhancing alpha-ma...    371   4e-117   
ref|XP_005490242.1|  PREDICTED: ER degradation-enhancing alpha-ma...    371   7e-117   
ref|XP_005426710.1|  PREDICTED: ER degradation-enhancing alpha-ma...    370   7e-117   
ref|XP_008861425.1|  hypothetical protein H310_00419                    375   1e-116   
ref|XP_006812583.1|  PREDICTED: ER degradation-enhancing alpha-ma...    370   1e-116   
gb|AAH55547.1|  Edem2 protein                                           372   2e-116   
gb|ERG79762.1|  er degradation-enhancing alpha-mannosidase-like 1       371   3e-116   
gb|KHN76296.1|  ER degradation-enhancing alpha-mannosidase-like p...    371   3e-116   
ref|XP_007419948.1|  PREDICTED: ER degradation-enhancing alpha-ma...    370   6e-116   
ref|XP_007419947.1|  PREDICTED: ER degradation-enhancing alpha-ma...    370   8e-116   
ref|NP_001005031.1|  ER degradation enhancer, mannosidase alpha-l...    370   9e-116   
gb|KFW82951.1|  ER degradation-enhancing alpha-mannosidase-like 1       367   9e-116   
gb|KDO34966.1|  hypothetical protein SPRG_01028                         384   1e-115   
ref|XP_008924574.1|  PREDICTED: ER degradation-enhancing alpha-ma...    367   1e-115   
emb|CDQ68229.1|  unnamed protein product                                369   1e-115   
gb|ADH93655.1|  glycoside hydrolase                                     358   1e-115   
gb|KFO59711.1|  ER degradation-enhancing alpha-mannosidase-like 1       366   2e-115   
ref|XP_009443073.1|  PREDICTED: ER degradation-enhancing alpha-ma...    369   2e-115   
ref|XP_009294929.1|  PREDICTED: ER degradation-enhancing alpha-ma...    370   2e-115   
ref|XP_008632693.1|  PREDICTED: ER degradation-enhancing alpha-ma...    366   2e-115   
ref|XP_009675122.1|  PREDICTED: ER degradation-enhancing alpha-ma...    366   2e-115   
gb|KFV82295.1|  ER degradation-enhancing alpha-mannosidase-like 1       366   3e-115   
ref|XP_003756980.1|  PREDICTED: ER degradation-enhancing alpha-ma...    369   4e-115   
ref|XP_009844310.1|  hypothetical protein H257_17283                    383   5e-115   
ref|XP_971536.1|  PREDICTED: ER degradation-enhancing alpha-manno...    379   9e-115   
ref|XP_006258439.1|  PREDICTED: ER degradation-enhancing alpha-ma...    368   1e-114   
ref|XP_002155446.2|  PREDICTED: ER degradation-enhancing alpha-ma...    366   1e-114   
ref|XP_007578266.1|  PREDICTED: ER degradation-enhancing alpha-ma...    369   2e-114   
ref|XP_007329525.1|  hypothetical protein AGABI1DRAFT_120380            376   2e-114   
ref|XP_006770694.1|  PREDICTED: ER degradation-enhancing alpha-ma...    365   2e-114   
ref|XP_005696125.1|  PREDICTED: ER degradation-enhancing alpha-ma...    365   2e-114   
ref|XP_006106515.1|  PREDICTED: ER degradation-enhancing alpha-ma...    364   2e-114   
ref|XP_010842434.1|  PREDICTED: ER degradation-enhancing alpha-ma...    364   2e-114   
ref|XP_005837465.1|  hypothetical protein GUITHDRAFT_157285             362   2e-114   
gb|EJT97632.1|  hypothetical protein DACRYDRAFT_59015                   373   2e-114   
gb|EKC23948.1|  ER degradation-enhancing alpha-mannosidase-like 2       374   2e-114   
ref|XP_007233052.1|  PREDICTED: ER degradation-enhancing alpha-ma...    366   2e-114   
ref|XP_009071727.1|  PREDICTED: ER degradation-enhancing alpha-ma...    363   2e-114   
ref|XP_006022306.1|  PREDICTED: LOW QUALITY PROTEIN: ER degradati...    367   3e-114   
ref|XP_009908857.1|  PREDICTED: ER degradation-enhancing alpha-ma...    363   3e-114   
gb|ELK25083.1|  ER degradation-enhancing alpha-mannosidase-like 1       365   4e-114   
ref|XP_003446055.1|  PREDICTED: ER degradation enhancer, mannosid...    365   4e-114   
ref|XP_006639581.1|  PREDICTED: ER degradation-enhancing alpha-ma...    365   4e-114   
ref|XP_001381446.3|  PREDICTED: ER degradation enhancer, mannosid...    367   5e-114   
ref|XP_010388578.1|  PREDICTED: ER degradation-enhancing alpha-ma...    363   6e-114   
ref|XP_004970144.1|  PREDICTED: probable alpha-mannosidase I MNS4...    360   6e-114   
emb|CDJ83353.1|  Glycoside hydrolase domain containing protein          366   7e-114   
ref|XP_003467799.1|  PREDICTED: ER degradation-enhancing alpha-ma...    365   8e-114   
ref|XP_005936660.1|  PREDICTED: ER degradation-enhancing alpha-ma...    365   8e-114   
ref|XP_003642546.1|  PREDICTED: ER degradation enhancer, mannosid...    365   9e-114   
ref|XP_007114048.1|  PREDICTED: ER degradation-enhancing alpha-ma...    362   9e-114   
gb|EMD41079.1|  glycoside hydrolase family 47 protein                   374   1e-113   
ref|XP_008605012.1|  hypothetical protein SDRG_01273                    378   1e-113   
gb|KFV62974.1|  ER degradation-enhancing alpha-mannosidase-like 1       362   1e-113   
ref|XP_004612599.1|  PREDICTED: ER degradation-enhancing alpha-ma...    367   1e-113   
ref|XP_005600467.1|  PREDICTED: ER degradation enhancer, mannosid...    362   1e-113   
gb|KFO79799.1|  ER degradation-enhancing alpha-mannosidase-like 1       362   1e-113   
ref|XP_005986732.1|  PREDICTED: ER degradation-enhancing alpha-ma...    365   1e-113   
ref|XP_002187205.1|  PREDICTED: ER degradation-enhancing alpha-ma...    363   1e-113   
gb|EXX60114.1|  Mnl1p                                                   372   2e-113   
ref|XP_001837100.2|  ER degradation-enhancing alpha-mannosidase-l...    370   2e-113   
ref|XP_004272809.1|  PREDICTED: ER degradation-enhancing alpha-ma...    364   2e-113   
ref|XP_004867937.1|  PREDICTED: ER degradation-enhancing alpha-ma...    364   2e-113   
ref|XP_004687312.1|  PREDICTED: ER degradation-enhancing alpha-ma...    364   2e-113   
ref|XP_004698000.1|  PREDICTED: ER degradation-enhancing alpha-ma...    364   2e-113   
ref|XP_010638240.1|  PREDICTED: ER degradation-enhancing alpha-ma...    364   2e-113   
ref|XP_004585810.1|  PREDICTED: ER degradation-enhancing alpha-ma...    364   2e-113   
ref|XP_006460028.1|  hypothetical protein AGABI2DRAFT_184525            373   2e-113   
ref|XP_009644283.1|  PREDICTED: ER degradation-enhancing alpha-ma...    360   2e-113   
ref|XP_008532991.1|  PREDICTED: ER degradation-enhancing alpha-ma...    362   2e-113   
ref|XP_001946268.1|  PREDICTED: ER degradation-enhancing alpha-ma...    372   3e-113   
gb|EFA08227.1|  hypothetical protein TcasGA2_TC005854                   375   3e-113   
ref|XP_010894407.1|  PREDICTED: ER degradation-enhancing alpha-ma...    363   3e-113   
ref|XP_006188624.1|  PREDICTED: ER degradation-enhancing alpha-ma...    363   4e-113   
ref|XP_006881532.1|  PREDICTED: ER degradation-enhancing alpha-ma...    363   4e-113   
ref|XP_003932081.1|  PREDICTED: ER degradation-enhancing alpha-ma...    363   4e-113   
ref|XP_006026760.1|  PREDICTED: ER degradation-enhancing alpha-ma...    361   4e-113   
ref|XP_006876931.1|  PREDICTED: ER degradation-enhancing alpha-ma...    363   4e-113   
ref|XP_007932783.1|  PREDICTED: ER degradation-enhancing alpha-ma...    363   5e-113   
ref|XP_008914784.1|  hypothetical protein PPTG_18414                    374   6e-113   
ref|XP_005748256.1|  PREDICTED: ER degradation-enhancing alpha-ma...    362   7e-113   
ref|XP_002108236.1|  hypothetical protein TRIADDRAFT_52514              361   7e-113   
ref|XP_004573281.1|  PREDICTED: ER degradation-enhancing alpha-ma...    362   8e-113   
ref|XP_004370465.1|  PREDICTED: ER degradation-enhancing alpha-ma...    362   8e-113   
ref|XP_003411721.1|  PREDICTED: ER degradation-enhancing alpha-ma...    362   9e-113   
dbj|GAA96680.1|  hypothetical protein E5Q_03351                         370   1e-112   
ref|XP_008696213.1|  PREDICTED: ER degradation-enhancing alpha-ma...    360   1e-112   
ref|XP_007123804.1|  PREDICTED: ER degradation-enhancing alpha-ma...    362   1e-112   
ref|XP_003220596.1|  PREDICTED: ER degradation-enhancing alpha-ma...    362   1e-112   
ref|XP_004361777.1|  glycoside hydrolase family 47 protein              367   1e-112   
ref|XP_005019967.1|  PREDICTED: ER degradation-enhancing alpha-ma...    362   1e-112   
ref|XP_010890129.1|  PREDICTED: ER degradation-enhancing alpha-ma...    362   1e-112   
ref|XP_003788171.1|  PREDICTED: ER degradation-enhancing alpha-ma...    362   1e-112   
ref|XP_006185687.1|  PREDICTED: ER degradation-enhancing alpha-ma...    362   1e-112   
gb|AJA37857.1|  EDEM-like protein 2                                     367   1e-112   
ref|XP_006202680.1|  PREDICTED: ER degradation-enhancing alpha-ma...    362   1e-112   
ref|XP_002710832.1|  PREDICTED: ER degradation-enhancing alpha-ma...    362   1e-112   
ref|XP_007076679.1|  PREDICTED: ER degradation-enhancing alpha-ma...    360   1e-112   
ref|XP_004630903.1|  PREDICTED: ER degradation-enhancing alpha-ma...    362   1e-112   
ref|XP_008401121.1|  PREDICTED: LOW QUALITY PROTEIN: ER degradati...    363   2e-112   
ref|XP_007522713.1|  PREDICTED: ER degradation-enhancing alpha-ma...    362   2e-112   
ref|NP_501802.2|  Protein C47E12.3                                      361   2e-112   
ref|XP_008147916.1|  PREDICTED: ER degradation-enhancing alpha-ma...    361   2e-112   
gb|ERE66301.1|  ER degradation enhancer, mannosidase alpha-like 1       363   2e-112   
ref|XP_973062.1|  PREDICTED: ER degradation-enhancing alpha-manno...    363   3e-112   
ref|XP_002126322.1|  PREDICTED: ER degradation-enhancing alpha-ma...    361   3e-112   
ref|XP_005879833.1|  PREDICTED: ER degradation-enhancing alpha-ma...    361   3e-112   
ref|XP_007268610.1|  alpha-mannosidase                                  370   4e-112   
ref|XP_006764630.1|  PREDICTED: ER degradation-enhancing alpha-ma...    361   4e-112   
ref|XP_004746621.1|  PREDICTED: ER degradation-enhancing alpha-ma...    361   4e-112   
gb|KFO97954.1|  ER degradation-enhancing alpha-mannosidase-like 2       360   4e-112   
ref|XP_005384861.1|  PREDICTED: ER degradation-enhancing alpha-ma...    361   4e-112   
ref|XP_534400.1|  PREDICTED: ER degradation enhancer, mannosidase...    361   4e-112   
ref|XP_006048152.1|  PREDICTED: ER degradation-enhancing alpha-ma...    361   4e-112   
gb|ETK81031.1|  hypothetical protein L915_13421                         366   4e-112   
ref|XP_004668171.1|  PREDICTED: ER degradation-enhancing alpha-ma...    360   4e-112   
gb|KFP79215.1|  ER degradation-enhancing alpha-mannosidase-like 1       358   4e-112   
ref|XP_004393155.1|  PREDICTED: ER degradation-enhancing alpha-ma...    360   5e-112   
ref|XP_003360006.1|  PREDICTED: ER degradation enhancer, mannosid...    360   5e-112   
ref|XP_006988317.1|  PREDICTED: ER degradation-enhancing alpha-ma...    360   5e-112   
ref|XP_002916447.1|  PREDICTED: ER degradation-enhancing alpha-ma...    360   6e-112   
gb|ETL87727.1|  hypothetical protein L917_13128                         365   6e-112   
ref|XP_003983635.1|  PREDICTED: ER degradation enhancer, mannosid...    360   6e-112   
ref|NP_001094555.1|  ER degradation-enhancing alpha-mannosidase-l...    360   7e-112   
ref|NP_001270985.1|  uncharacterized protein LOC101864833 precursor     360   7e-112   
emb|CAP24335.2|  Protein CBG03437                                       360   7e-112   
ref|XP_002907216.1|  ER degradation-enhancing alpha-mannosidase-l...    372   9e-112   
ref|XP_005329953.1|  PREDICTED: ER degradation-enhancing alpha-ma...    360   9e-112   
gb|ETL78971.1|  hypothetical protein L917_20294                         375   9e-112   
gb|AAH45854.1|  Edem2 protein                                           360   1e-111   
ref|XP_001501479.1|  PREDICTED: ER degradation enhancer, mannosid...    360   1e-111   
ref|XP_009039355.1|  hypothetical protein AURANDRAFT_30199              355   1e-111   
gb|ETK72311.1|  hypothetical protein L915_20555                         375   1e-111   
gb|EMC90568.1|  ER degradation-enhancing alpha-mannosidase-like 2       358   1e-111   
gb|ETI34712.1|  hypothetical protein F443_18881                         375   1e-111   
gb|ETP29943.1|  hypothetical protein F442_20958                         375   1e-111   
gb|ETL25766.1|  hypothetical protein L916_20417                         375   1e-111   
gb|EYB85912.1|  hypothetical protein Y032_0288g1470                     361   1e-111   
ref|XP_004014568.1|  PREDICTED: ER degradation-enhancing alpha-ma...    360   1e-111   
gb|ETP01802.1|  hypothetical protein F441_21001                         375   1e-111   
ref|XP_004430544.1|  PREDICTED: ER degradation-enhancing alpha-ma...    360   1e-111   
ref|XP_006921807.1|  PREDICTED: ER degradation-enhancing alpha-ma...    359   1e-111   
ref|XP_005363129.1|  PREDICTED: ER degradation-enhancing alpha-ma...    359   1e-111   
ref|NP_001247965.1|  ER degradation-enhancing alpha-mannosidase-l...    359   1e-111   
gb|KFU90191.1|  ER degradation-enhancing alpha-mannosidase-like 2       358   1e-111   
gb|ETM32247.1|  hypothetical protein L914_20298                         375   1e-111   
ref|NP_663512.2|  ER degradation enhancer, mannosidase alpha-like...    359   1e-111   
gb|KFW78599.1|  ER degradation-enhancing alpha-mannosidase-like 2       358   1e-111   
dbj|BAC35880.1|  unnamed protein product                                359   1e-111   
gb|ETO60672.1|  hypothetical protein F444_21151                         375   1e-111   
ref|XP_005214739.1|  PREDICTED: ER degradation-enhancing alpha-ma...    359   2e-111   
gb|AAH08268.1|  ER degradation enhancer, mannosidase alpha-like 2       359   2e-111   
ref|XP_001966025.1|  GF19471                                            369   2e-111   
ref|XP_008286309.1|  PREDICTED: ER degradation-enhancing alpha-ma...    358   2e-111   
dbj|BAC37968.1|  unnamed protein product                                359   2e-111   
ref|XP_010890130.1|  PREDICTED: ER degradation-enhancing alpha-ma...    357   2e-111   
ref|XP_005976905.1|  PREDICTED: ER degradation-enhancing alpha-ma...    359   2e-111   
ref|XP_001876643.1|  alpha mannosidase-like protein                     367   2e-111   
ref|XP_004612600.1|  PREDICTED: ER degradation-enhancing alpha-ma...    359   2e-111   
ref|XP_007192549.1|  PREDICTED: ER degradation-enhancing alpha-ma...    358   2e-111   
gb|KGL72386.1|  ER degradation-enhancing alpha-mannosidase-like 2       357   2e-111   
ref|NP_001004230.1|  ER degradation-enhancing alpha-mannosidase-l...    358   3e-111   
ref|XP_009091189.1|  PREDICTED: ER degradation-enhancing alpha-ma...    358   3e-111   
ref|XP_010071522.1|  PREDICTED: ER degradation-enhancing alpha-ma...    355   3e-111   
gb|ETL34457.1|  hypothetical protein L916_13309                         364   3e-111   
gb|ENN80946.1|  hypothetical protein YQE_02651                          362   3e-111   
gb|ETO69632.1|  hypothetical protein F444_13823                         363   3e-111   
gb|ETP38878.1|  hypothetical protein F442_13618                         363   3e-111   
gb|ACI49237.1|  hypothetical protein Csp3_JD06.003                      357   3e-111   
ref|XP_005105902.1|  PREDICTED: uncharacterized protein LOC101849317    369   3e-111   
dbj|BAA91806.1|  unnamed protein product                                358   3e-111   
gb|ETM40955.1|  hypothetical protein L914_13216                         363   3e-111   
ref|XP_008894627.1|  hypothetical protein PPTG_03696                    363   3e-111   
gb|ETI40930.1|  hypothetical protein F443_13768                         363   4e-111   
gb|AAH01371.1|  ER degradation enhancer, mannosidase alpha-like 2       358   4e-111   
ref|XP_003501182.1|  PREDICTED: ER degradation-enhancing alpha-ma...    358   4e-111   
ref|XP_005900486.1|  PREDICTED: ER degradation-enhancing alpha-ma...    358   4e-111   
ref|NP_060687.2|  ER degradation-enhancing alpha-mannosidase-like...    358   4e-111   
ref|XP_010384828.1|  PREDICTED: ER degradation-enhancing alpha-ma...    358   4e-111   
ref|XP_007338147.1|  hypothetical protein AURDEDRAFT_133497             366   5e-111   
ref|XP_003273611.1|  PREDICTED: ER degradation-enhancing alpha-ma...    358   5e-111   
gb|KGL98926.1|  ER degradation-enhancing alpha-mannosidase-like 2       357   5e-111   
gb|KFD52313.1|  hypothetical protein M513_06876                         359   6e-111   
ref|XP_010203499.1|  PREDICTED: ER degradation-enhancing alpha-ma...    355   6e-111   
ref|XP_642889.1|  glycoside hydrolase family 47 protein                 359   7e-111   
ref|XP_008068453.1|  PREDICTED: ER degradation-enhancing alpha-ma...    357   7e-111   
gb|KFP33065.1|  ER degradation-enhancing alpha-mannosidase-like 1       355   7e-111   
gb|AIG56334.1|  secreted protein                                        370   8e-111   
ref|XP_007653682.1|  PREDICTED: ER degradation-enhancing alpha-ma...    354   9e-111   
ref|XP_003831885.1|  PREDICTED: ER degradation-enhancing alpha-ma...    357   1e-110   
ref|XP_003410035.1|  PREDICTED: ER degradation-enhancing alpha-ma...    359   1e-110   
ref|XP_001982568.1|  GG12667                                            368   1e-110   
ref|XP_007315537.1|  glycoside hydrolase family 47 protein              363   2e-110   
ref|NP_001279594.1|  ER degradation enhancer, mannosidase alpha-l...    356   2e-110   
ref|XP_005748257.1|  PREDICTED: ER degradation-enhancing alpha-ma...    355   2e-110   
gb|KFZ45489.1|  ER degradation-enhancing alpha-mannosidase-like 1       352   2e-110   
ref|XP_002903641.1|  ER degradation-enhancing alpha-mannosidase-l...    360   2e-110   
emb|CDR32659.1|  Protein C47E12.3, isoform b                            353   2e-110   
ref|XP_009480356.1|  PREDICTED: ER degradation-enhancing alpha-ma...    353   3e-110   
ref|XP_002747297.1|  PREDICTED: ER degradation-enhancing alpha-ma...    356   3e-110   
ref|XP_009517557.1|  hypothetical protein PHYSODRAFT_310282             370   3e-110   
ref|XP_514601.1|  PREDICTED: ER degradation-enhancing alpha-manno...    356   3e-110   
ref|XP_007843083.1|  er degradation-enhancing alpha-mannosidase-l...    364   3e-110   



>ref|XP_009764734.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X1 [Nicotiana 
sylvestris]
Length=578

 Score =   981 bits (2535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/578 (82%), Positives = 519/578 (90%), Gaps = 3/578 (1%)
 Frame = -1

Query  1872  IMRKRVLICMLIFL---STFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHA  1702
             + R  V I +L++L    + F +  S   P N MAA+RKRMS +VR+MFYHAY+NYMM+A
Sbjct  1     MFRSAVAIWILLYLVISPSIFIICLSEQHPTNLMAAKRKRMSDRVREMFYHAYDNYMMYA  60

Query  1701  FPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVL  1522
             FPHDELKPL+K YTDSLSELGNLKLEHLPQ+Y+GSALTLIESLSSL ILGN+TEFEKA+L
Sbjct  61    FPHDELKPLSKAYTDSLSELGNLKLEHLPQQYNGSALTLIESLSSLAILGNYTEFEKAIL  120

Query  1521  WLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRR  1342
             WLS NLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLG+R
Sbjct  121   WLSENLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGQR  180

Query  1341  FLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALR  1162
             FLPAFDTPTGLPYAWINLK GVM +ETTETSTSGCGSLILEMG LSRLTGDP FE AALR
Sbjct  181   FLPAFDTPTGLPYAWINLKHGVMADETTETSTSGCGSLILEMGTLSRLTGDPRFETAALR  240

Query  1161  ALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMF  982
             ALRKLWSMRSSLNLLGTTLDVATG WIE+S+GIGAGVDSFYEYL+KAY+LFG DEFWKMF
Sbjct  241   ALRKLWSMRSSLNLLGTTLDVATGNWIEYSSGIGAGVDSFYEYLMKAYVLFGRDEFWKMF  300

Query  981   QSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFF  802
             QSAY+AVQKYFRHGPWYH+ADMRTGKATYWQLTSLQAFWPG+QV VGD+DAANSSHREFF
Sbjct  301   QSAYIAVQKYFRHGPWYHEADMRTGKATYWQLTSLQAFWPGLQVQVGDIDAANSSHREFF  360

Query  801   HVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSL  622
              VWK++GVLPERYLLDHQMLHPTEKYYPLRPE AESTFYLYQATKDPWYMEVGE IINSL
Sbjct  361   KVWKQYGVLPERYLLDHQMLHPTEKYYPLRPELAESTFYLYQATKDPWYMEVGESIINSL  420

Query  621   NQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPL  442
             N +T+V+GGFAS+RDVTTM+LEDHQHSFFLAETCKYLYLLFDDSFL+N+NYIFTTEGHPL
Sbjct  421   NAHTRVKGGFASIRDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFLLNQNYIFTTEGHPL  480

Query  441   PVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIP  262
             PV  +WH+RL EAY  SN +S K+ +  KR SAMS R+CPA  + HE   + LESACHIP
Sbjct  481   PVRRSWHERLPEAYNLSNGSSVKNGEQIKRTSAMSLRVCPAAMIHHESNERRLESACHIP  540

Query  261   DTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
             DTR DHRC +D DCG+D+ TCRRRSCSMAGYCGLW  I
Sbjct  541   DTRADHRCFSDVDCGLDANTCRRRSCSMAGYCGLWSYI  578



>ref|XP_011028624.1| PREDICTED: probable alpha-mannosidase I MNS5 [Populus euphratica]
Length=573

 Score =   973 bits (2515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/573 (82%), Positives = 522/573 (91%), Gaps = 6/573 (1%)
 Frame = -1

Query  1866  RKRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDE  1687
             R  VL+ ++IF S F P S S FD     +A++K+M +KVRKMFYHAYENYM HAFPHDE
Sbjct  7     RTWVLLLLVIFPSLFDP-SISHFD-----SAKKKQMREKVRKMFYHAYENYMTHAFPHDE  60

Query  1686  LKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVN  1507
             LKPL++++TDSLSELGNLKLEHLPQ Y+G+ALTLIESLSSLVILGN+TEFE+AVLWLS N
Sbjct  61    LKPLSRSFTDSLSELGNLKLEHLPQNYNGTALTLIESLSSLVILGNYTEFERAVLWLSEN  120

Query  1506  LSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAF  1327
             L+FDVDAR+NLFECNIRVLGGLVSAHILATDSTNRLVQG+YKNQLL LAEDLGRRFLPAF
Sbjct  121   LTFDVDARVNLFECNIRVLGGLVSAHILATDSTNRLVQGSYKNQLLVLAEDLGRRFLPAF  180

Query  1326  DTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKL  1147
             DTPTGLPYAWINLK GVM+NETTETSTSGCGSLILEMGALSRLTGDP +E AALRALRKL
Sbjct  181   DTPTGLPYAWINLKYGVMKNETTETSTSGCGSLILEMGALSRLTGDPRYESAALRALRKL  240

Query  1146  WSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYL  967
             WSMRSSLNLLGTTLDV TGEWIE S+GIGAGVDSFYEYL KA+ILFG ++FW+MF+SAYL
Sbjct  241   WSMRSSLNLLGTTLDVETGEWIEHSSGIGAGVDSFYEYLFKAHILFGKEDFWRMFRSAYL  300

Query  966   AVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKK  787
             AVQKYFRHGPWYH+ADMRTGKATYWQLTSLQAFWPG+QVLVGD+ AANSSHREF HVWKK
Sbjct  301   AVQKYFRHGPWYHEADMRTGKATYWQLTSLQAFWPGLQVLVGDIAAANSSHREFVHVWKK  360

Query  786   FGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTK  607
             FGVLPERYLLDHQMLHPTEKYYPLRPE AESTFYLYQATKDPWY+EVGE I+NSLN YTK
Sbjct  361   FGVLPERYLLDHQMLHPTEKYYPLRPELAESTFYLYQATKDPWYIEVGETIVNSLNSYTK  420

Query  606   VQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLST  427
             V+GGFAS+RDVTTM+ EDH HSFFLAETCKYLYLLFDDSFLV+RNYIFTTEGHPLPVLS 
Sbjct  421   VEGGFASIRDVTTMQTEDHMHSFFLAETCKYLYLLFDDSFLVDRNYIFTTEGHPLPVLSA  480

Query  426   WHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGD  247
             WH+RL E Y+PSNWT  K+E+  KR+SAMS ++CPA +L+     Q +ESACH+PD + D
Sbjct  481   WHERLPEIYIPSNWTHVKNERQTKRSSAMSLQVCPALSLNAGHGEQLVESACHVPDDQSD  540

Query  246   HRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
             H+C +DE+CGVDST+CRRRSCSMAGYCGLWL++
Sbjct  541   HKCFSDEECGVDSTSCRRRSCSMAGYCGLWLVV  573



>ref|XP_006439745.1| hypothetical protein CICLE_v10019471mg [Citrus clementina]
 gb|ESR52985.1| hypothetical protein CICLE_v10019471mg [Citrus clementina]
Length=577

 Score =   967 bits (2500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/578 (80%), Positives = 518/578 (90%), Gaps = 4/578 (1%)
 Frame = -1

Query  1872  IMRKRVLICMLIFL---STFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHA  1702
             ++ ++V+  +L+FL    + FP+S S  D  +  +A+++ M +KV  MFYHAYENY+ HA
Sbjct  1     MLPRQVVKWILVFLVISPSLFPVSVSEVDS-SYWSAKKRHMKKKVHDMFYHAYENYLTHA  59

Query  1701  FPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVL  1522
             FPHDELKPL+K++TDSLSELGNLKLEHLPQ Y+GSALTLIESLSSLVI+GN+TEFE+AVL
Sbjct  60    FPHDELKPLSKSFTDSLSELGNLKLEHLPQHYNGSALTLIESLSSLVIMGNNTEFERAVL  119

Query  1521  WLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRR  1342
             WLS NLSFDVDARINLFECNIRVLGGLVSAHILATDS NRLVQG+YKNQLL LAEDLGRR
Sbjct  120   WLSENLSFDVDARINLFECNIRVLGGLVSAHILATDSANRLVQGSYKNQLLTLAEDLGRR  179

Query  1341  FLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALR  1162
             FLPAFDTPTGLPYAWINLK GVM+NET ETSTSGCGSLILEMGALSRLTGDPI+E AALR
Sbjct  180   FLPAFDTPTGLPYAWINLKYGVMENETNETSTSGCGSLILEMGALSRLTGDPIYESAALR  239

Query  1161  ALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMF  982
             ALR+LWSMRSSLNLLGTTLDV TGEWIE+S+GIGAGVDSFYEYL KA+ILFG ++FW+MF
Sbjct  240   ALRRLWSMRSSLNLLGTTLDVTTGEWIEYSSGIGAGVDSFYEYLFKAHILFGKEDFWRMF  299

Query  981   QSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFF  802
              SAYLAVQKYFRHGPWYH+ADMR GKATYWQLTSLQAFWPG+QVLVGD+ AANSSHREF 
Sbjct  300   HSAYLAVQKYFRHGPWYHEADMRNGKATYWQLTSLQAFWPGLQVLVGDIAAANSSHREFV  359

Query  801   HVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSL  622
             HVWKKFGVLPERYLLDH MLHPTEKYYPLRPE AESTFYLYQATKDPWY+EVGE I+NSL
Sbjct  360   HVWKKFGVLPERYLLDHLMLHPTEKYYPLRPELAESTFYLYQATKDPWYLEVGESIVNSL  419

Query  621   NQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPL  442
             N YTKV GGFAS+RDVTTM+LEDHQHSFFLAETCKYLYLLFDDSFLV+RNY+FTTEGHPL
Sbjct  420   NSYTKVDGGFASIRDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFLVDRNYVFTTEGHPL  479

Query  441   PVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIP  262
             PVLS+WHDRL EAY+PSNWT    EK  +RASAM+ ++CPA +L      Q ++SACHIP
Sbjct  480   PVLSSWHDRLPEAYIPSNWTFLPSEKQARRASAMTLQVCPAMSLDCGHGCQQVKSACHIP  539

Query  261   DTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
             D R DHRC  DE+CGVD+TTCRRR+CSMAGYCGLWL I
Sbjct  540   DARSDHRCFGDEECGVDATTCRRRTCSMAGYCGLWLFI  577



>ref|XP_006476721.1| PREDICTED: probable alpha-mannosidase I MNS5-like isoform X1 
[Citrus sinensis]
Length=577

 Score =   966 bits (2497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/578 (80%), Positives = 519/578 (90%), Gaps = 4/578 (1%)
 Frame = -1

Query  1872  IMRKRVLICMLIFL---STFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHA  1702
             ++ ++V+  +L+FL    + FP+S S  D  +  +A+++ M +KV  MFYHAYENY+ HA
Sbjct  1     MLPRQVVKWILVFLVISPSLFPVSVSEADS-SYWSAKKRHMKKKVHDMFYHAYENYLTHA  59

Query  1701  FPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVL  1522
             FPHDELKPL+K++TDSLSELGNLKLEHLPQ Y+GSALTLIES+SSLVI+GN+TEFE+AVL
Sbjct  60    FPHDELKPLSKSFTDSLSELGNLKLEHLPQHYNGSALTLIESMSSLVIMGNNTEFERAVL  119

Query  1521  WLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRR  1342
             WLS NL+FDVDARINLFECNIRVLGGLVSAHILATDS NRLVQG+YKNQLL LAEDLGRR
Sbjct  120   WLSENLNFDVDARINLFECNIRVLGGLVSAHILATDSANRLVQGSYKNQLLTLAEDLGRR  179

Query  1341  FLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALR  1162
             FLPAFDTPTGLPYAWINLK GVM+NETTETSTSGCGSLILEMGALSRLTGDPI+E AALR
Sbjct  180   FLPAFDTPTGLPYAWINLKYGVMENETTETSTSGCGSLILEMGALSRLTGDPIYESAALR  239

Query  1161  ALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMF  982
             ALR+LWSMRSSLNLLGTTLDV TGEWIE+S+GIGAGVDSFYEYL KA+ILFG ++FW+MF
Sbjct  240   ALRRLWSMRSSLNLLGTTLDVTTGEWIEYSSGIGAGVDSFYEYLFKAHILFGKEDFWRMF  299

Query  981   QSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFF  802
              SAYLAVQKYFRHGPWYH+ADMR GKATYWQLTSLQAFWPG+QVLVGD+ AANSSHREF 
Sbjct  300   HSAYLAVQKYFRHGPWYHEADMRNGKATYWQLTSLQAFWPGLQVLVGDIAAANSSHREFV  359

Query  801   HVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSL  622
             HVWKKFGVLPERYLLDH MLHPTEKYYPLRPE AESTFYLYQATKDPWY+EVGE I+NSL
Sbjct  360   HVWKKFGVLPERYLLDHLMLHPTEKYYPLRPELAESTFYLYQATKDPWYLEVGESIVNSL  419

Query  621   NQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPL  442
             N YTKV GGFAS+RDVTTM+LEDHQHSFFLAETCKYLYLLFDDSFLV+RNY+FTTEGHPL
Sbjct  420   NSYTKVDGGFASIRDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFLVDRNYVFTTEGHPL  479

Query  441   PVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIP  262
             PVLS+WHDRL EAY+P NWT    EK  +RASAM+ ++CPAT+L      Q ++SACHIP
Sbjct  480   PVLSSWHDRLPEAYIPRNWTFLPSEKQARRASAMTLQVCPATSLDCRHRCQQVKSACHIP  539

Query  261   DTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
             D R DHRC  DE+CGVD+TTCRRR+CSMAGYCGLWL I
Sbjct  540   DARSDHRCFGDEECGVDATTCRRRTCSMAGYCGLWLFI  577



>gb|KDO69780.1| hypothetical protein CISIN_1g008122mg [Citrus sinensis]
Length=577

 Score =   965 bits (2494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/578 (80%), Positives = 518/578 (90%), Gaps = 4/578 (1%)
 Frame = -1

Query  1872  IMRKRVLICMLIFL---STFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHA  1702
             ++ ++V+  +L+FL    + FP+S S  D  +  +A+++ M +KV  MFYHAYENY+ HA
Sbjct  1     MLPRQVVKWILVFLVISPSLFPVSVSEVDS-SYWSAKKRHMKKKVHDMFYHAYENYLTHA  59

Query  1701  FPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVL  1522
             FPHDELKPL+K++TDSLSELGNLKLEHLPQ Y+GSALTLIES+SSLVI+GN+TEFE+AVL
Sbjct  60    FPHDELKPLSKSFTDSLSELGNLKLEHLPQHYNGSALTLIESMSSLVIMGNNTEFERAVL  119

Query  1521  WLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRR  1342
             WLS NL+FDVDARINLFECNIRVLGGLVSAHILATDS NRLVQG+YKNQLL LAEDLGRR
Sbjct  120   WLSENLNFDVDARINLFECNIRVLGGLVSAHILATDSANRLVQGSYKNQLLTLAEDLGRR  179

Query  1341  FLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALR  1162
             FLPAFDTPTGLPYAWINLK GVM+NET ETSTSGCGSLILEMGALSRLTGDPI+E AALR
Sbjct  180   FLPAFDTPTGLPYAWINLKYGVMENETNETSTSGCGSLILEMGALSRLTGDPIYESAALR  239

Query  1161  ALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMF  982
             ALR+LWSMRSSLNLLGTTLDV TGEWIE+S+GIGAGVDSFYEYL KA+ILFG ++FW+MF
Sbjct  240   ALRRLWSMRSSLNLLGTTLDVTTGEWIEYSSGIGAGVDSFYEYLFKAHILFGKEDFWRMF  299

Query  981   QSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFF  802
              SAYLAVQKYFRHGPWYH+ADMR GKATYWQLTSLQAFWPG+QVLVGD+ AANSSHREF 
Sbjct  300   HSAYLAVQKYFRHGPWYHEADMRNGKATYWQLTSLQAFWPGLQVLVGDIAAANSSHREFV  359

Query  801   HVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSL  622
             HVWKKFGVLPERYLLDH MLHPTEKYYPLRPE AESTFYLYQATKDPWY+EVGE I+NSL
Sbjct  360   HVWKKFGVLPERYLLDHLMLHPTEKYYPLRPELAESTFYLYQATKDPWYLEVGESIVNSL  419

Query  621   NQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPL  442
             N YTKV GGFAS+RDVTTM+LEDHQHSFFLAETCKYLYLLFDDSFLV+RNY+FTTEGHPL
Sbjct  420   NSYTKVDGGFASIRDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFLVDRNYVFTTEGHPL  479

Query  441   PVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIP  262
             PVLS+WHDRL EAY+PSNWT    EK  +RASAM+ ++CPA +L      Q ++SACHIP
Sbjct  480   PVLSSWHDRLPEAYIPSNWTFLPSEKQARRASAMTLQVCPAMSLDCGHGCQQVKSACHIP  539

Query  261   DTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
             D R DHRC  DE+CGVD+TTCRRR+CSMAGYCGLWL I
Sbjct  540   DARSDHRCFGDEECGVDATTCRRRTCSMAGYCGLWLFI  577



>ref|XP_007036112.1| Glycosyl hydrolase family 47 protein [Theobroma cacao]
 gb|EOY20613.1| Glycosyl hydrolase family 47 protein [Theobroma cacao]
Length=575

 Score =   962 bits (2486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/567 (81%), Positives = 514/567 (91%), Gaps = 2/567 (0%)
 Frame = -1

Query  1854  LICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL  1675
             L+  L+   T F  S S  D  +  AA+++ M +KVR+MFYHAYENYM HAFPHDELKPL
Sbjct  11    LLLFLLISPTLFSPSMSHLD--SRWAAKKRHMREKVREMFYHAYENYMTHAFPHDELKPL  68

Query  1674  TKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFD  1495
             TK++TDSLSELGNLKLEHLPQ Y+GSALTLIESLSSLVI+GN+TEFE+AV+WLS NL+F+
Sbjct  69    TKSFTDSLSELGNLKLEHLPQDYNGSALTLIESLSSLVIMGNNTEFERAVIWLSENLTFN  128

Query  1494  VDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPT  1315
             +DARINLFECNIRVLGGL+SAHILATDSTNRLV G+YKNQLL+LAEDLGRRFLPAFDTPT
Sbjct  129   IDARINLFECNIRVLGGLISAHILATDSTNRLVHGSYKNQLLNLAEDLGRRFLPAFDTPT  188

Query  1314  GLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMR  1135
             GLPYAWINLK GVM+NETTETSTSGCGSLILEMGALSRLTGDP +E AALRALRKLWSMR
Sbjct  189   GLPYAWINLKYGVMENETTETSTSGCGSLILEMGALSRLTGDPRYESAALRALRKLWSMR  248

Query  1134  SSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQK  955
             SSLNLLGTTLDV TGEWIE+S+GIGAGVDSFYEYL KAYILFG +++W+MF SAYLAVQK
Sbjct  249   SSLNLLGTTLDVITGEWIEYSSGIGAGVDSFYEYLCKAYILFGKEDYWRMFHSAYLAVQK  308

Query  954   YFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVL  775
             YFRHG WYH+ADMRTGKATYWQLTSLQAFWPG+QVLVGD+ AANSSHREF +VW+KFGVL
Sbjct  309   YFRHGSWYHEADMRTGKATYWQLTSLQAFWPGLQVLVGDIGAANSSHREFVYVWEKFGVL  368

Query  774   PERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGG  595
             PERYLLDHQMLHPTEKYYPLRPE AESTFYLYQATKDPWY++VGE I+NSLN YTKV+GG
Sbjct  369   PERYLLDHQMLHPTEKYYPLRPELAESTFYLYQATKDPWYIQVGESIVNSLNSYTKVEGG  428

Query  594   FASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDR  415
             FASVRDVTTM+LEDHQHSFFLAETCKYLYLLFDDSFLV+RNYIFTTEGHPLP+LS+WH+R
Sbjct  429   FASVRDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFLVDRNYIFTTEGHPLPILSSWHER  488

Query  414   LSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGDHRCL  235
             L E Y+P+NWT  K E+  + ASAMS ++CPAT L      Q +ESACH+PD+RGDHRC 
Sbjct  489   LPETYIPTNWTYAKSEQPTRPASAMSLQVCPATALRSGYAVQQIESACHVPDSRGDHRCF  548

Query  234   TDEDCGVDSTTCRRRSCSMAGYCGLWL  154
             +DE+CGVDST CRRRSCSMAGYCGLW+
Sbjct  549   SDEECGVDSTNCRRRSCSMAGYCGLWI  575



>ref|XP_011071786.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X1 [Sesamum 
indicum]
Length=576

 Score =   961 bits (2484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/573 (83%), Positives = 521/573 (91%), Gaps = 3/573 (1%)
 Frame = -1

Query  1866  RKRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDE  1687
             R   LI +LI  + +   S S  DP    AA++KRMS+KVRKMFYHAY+NYMM+AFPHDE
Sbjct  7     RTWALIFLLIISNFYIETSASKLDP---FAAKKKRMSEKVRKMFYHAYDNYMMYAFPHDE  63

Query  1686  LKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVN  1507
             LKPLTK++TDSLSELGNLKLEHLPQ Y+GSAL+LIESLSSL ILGNHTEFEKAVLWLS N
Sbjct  64    LKPLTKSFTDSLSELGNLKLEHLPQGYNGSALSLIESLSSLAILGNHTEFEKAVLWLSEN  123

Query  1506  LSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAF  1327
             LSFDVDARINLFECNIRVLGGLVSAHILATDSTNRL +GTYKNQLL LA++LG+RFLPAF
Sbjct  124   LSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLTKGTYKNQLLVLAKELGQRFLPAF  183

Query  1326  DTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKL  1147
             DTPTGLPYAWINLK GVM+NETTETSTSGCGSLILEMGALS LTGDP FE AALRAL KL
Sbjct  184   DTPTGLPYAWINLKYGVMENETTETSTSGCGSLILEMGALSHLTGDPRFESAALRALHKL  243

Query  1146  WSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYL  967
             WSMRSSLNLLGTTLDV TGEWIE S+GIGAGVDSFYEYL+KA++LFG DE W+MFQSAYL
Sbjct  244   WSMRSSLNLLGTTLDVETGEWIEHSSGIGAGVDSFYEYLLKAHLLFGRDELWRMFQSAYL  303

Query  966   AVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKK  787
             AVQKYFRHGPWYH+ADMRTG+ATYWQLTSLQAFWPG+QVLVGDV AANSSHREFF+VW+K
Sbjct  304   AVQKYFRHGPWYHEADMRTGRATYWQLTSLQAFWPGLQVLVGDVPAANSSHREFFYVWQK  363

Query  786   FGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTK  607
             FGVLPERYLLD QMLHPTEKYYPLRPE AESTFYLYQATKDPWY+EVGE I++SLN +T+
Sbjct  364   FGVLPERYLLDRQMLHPTEKYYPLRPELAESTFYLYQATKDPWYLEVGESIVDSLNLHTR  423

Query  606   VQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLST  427
             V+GGFAS+RDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVN+NYIFTTEGHPLP+LS+
Sbjct  424   VEGGFASIRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNKNYIFTTEGHPLPILSS  483

Query  426   WHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGD  247
             WH+RL EAYLPSNWTS K E+  KRASAMS RICPA+TL++      LES CHIPD R D
Sbjct  484   WHERLPEAYLPSNWTSVKSEEQPKRASAMSLRICPASTLNYRNSRPPLESVCHIPDARSD  543

Query  246   HRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
             HRCL+DEDCGVDSTTCRRRSCSMAGYCGLWL I
Sbjct  544   HRCLSDEDCGVDSTTCRRRSCSMAGYCGLWLSI  576



>ref|XP_004236144.1| PREDICTED: probable alpha-mannosidase I MNS5 [Solanum lycopersicum]
Length=578

 Score =   960 bits (2482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/569 (81%), Positives = 511/569 (90%), Gaps = 0/569 (0%)
 Frame = -1

Query  1854  LICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL  1675
             ++  L+   T F +  S     N +AA+RKRMS++VRKMFYHAY+NYMM+AFPHDELKPL
Sbjct  10    ILLYLVISPTIFIICLSDLHSNNLLAAKRKRMSERVRKMFYHAYDNYMMYAFPHDELKPL  69

Query  1674  TKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFD  1495
             TKT+TDSLSELGNLKLEHLPQ+Y+GSALTLIESLSSLVILGN+TEFEKA++WLS NLSFD
Sbjct  70    TKTFTDSLSELGNLKLEHLPQQYNGSALTLIESLSSLVILGNYTEFEKAIIWLSENLSFD  129

Query  1494  VDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPT  1315
             VDAR+NLFECNIRVLGGLVSAHILATDSTNRLVQ  YKNQLLDLAEDLGRRFLPAF TPT
Sbjct  130   VDARVNLFECNIRVLGGLVSAHILATDSTNRLVQLIYKNQLLDLAEDLGRRFLPAFKTPT  189

Query  1314  GLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMR  1135
             GLPYAWINLK GV+ +ETTETSTSGCGSLILEMGALSRLTGD  FE AALRALRKLWSMR
Sbjct  190   GLPYAWINLKHGVIVDETTETSTSGCGSLILEMGALSRLTGDTRFETAALRALRKLWSMR  249

Query  1134  SSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQK  955
             SSLNLLGTTLDVATG+WIE+S+GIGAGVDSFYEYL+KAY+LFG DE WKMFQSAY+ VQK
Sbjct  250   SSLNLLGTTLDVATGDWIEYSSGIGAGVDSFYEYLMKAYVLFGRDEIWKMFQSAYIGVQK  309

Query  954   YFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVL  775
             YFRHGPWYH+ADMRTG ATYWQLTSLQAFWPG+QVLVGD++AANSSHREFF VWKK+GVL
Sbjct  310   YFRHGPWYHEADMRTGTATYWQLTSLQAFWPGLQVLVGDIEAANSSHREFFKVWKKYGVL  369

Query  774   PERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGG  595
             PERYLLDHQ+LHPTEKYYPLRPE AESTFYLYQATKDPWYMEVGE I+NSLN +T+V+GG
Sbjct  370   PERYLLDHQVLHPTEKYYPLRPELAESTFYLYQATKDPWYMEVGESIMNSLNAHTRVKGG  429

Query  594   FASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDR  415
             FAS+RDVTTM+LEDHQHSFFLAETCKYLYLLFDDSFL N+NYIFTTEGHPLPV   WH++
Sbjct  430   FASIRDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFLRNQNYIFTTEGHPLPVRINWHEK  489

Query  414   LSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGDHRCL  235
             L   Y  S+ +S K  K RKR+SAMS +ICPA+ + HE   + LESACHIPDT  DHRC 
Sbjct  490   LPRVYNLSDGSSIKTGKQRKRSSAMSLQICPASMIHHEPNARRLESACHIPDTGADHRCF  549

Query  234   TDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
             +D+DCGVD+ TCRRRSCS+AGYCGLW LI
Sbjct  550   SDDDCGVDANTCRRRSCSLAGYCGLWSLI  578



>ref|XP_002321565.1| glycoside hydrolase family 47 family protein [Populus trichocarpa]
 gb|EEF05692.1| glycoside hydrolase family 47 family protein [Populus trichocarpa]
Length=567

 Score =   956 bits (2472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/572 (81%), Positives = 514/572 (90%), Gaps = 12/572 (2%)
 Frame = -1

Query  1866  RKRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDE  1687
             R  VL+ ++IF S F P SFS FD     +A++K+M +KVRKMFYHAYENYM HAFPHDE
Sbjct  7     RTWVLLLLVIFPSLFDP-SFSHFD-----SAKKKQMREKVRKMFYHAYENYMTHAFPHDE  60

Query  1686  LKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVN  1507
             LKPL++++TDSLSELGNLKLEHLPQ Y+G+ALTLIESLSSLVILGN+TEFE+AVLWLS N
Sbjct  61    LKPLSRSFTDSLSELGNLKLEHLPQNYNGTALTLIESLSSLVILGNYTEFERAVLWLSEN  120

Query  1506  LSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAF  1327
             L+FDVDAR+NLFECNIRVLGGLVSAHILATDSTNRLVQG+YKNQLL LAEDLGRRFLPAF
Sbjct  121   LTFDVDARVNLFECNIRVLGGLVSAHILATDSTNRLVQGSYKNQLLVLAEDLGRRFLPAF  180

Query  1326  DTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKL  1147
             DTPTGLPYAWINLK GVM+NETTETSTSGCGSLILEMGALSRLTGDP +E AALRALRKL
Sbjct  181   DTPTGLPYAWINLKYGVMKNETTETSTSGCGSLILEMGALSRLTGDPRYESAALRALRKL  240

Query  1146  WSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYL  967
             WSMRSSLNLLGTTLDV TGEWIE S+GIGAGVDSFYEYL KA+ILFG ++FW+MF SAYL
Sbjct  241   WSMRSSLNLLGTTLDVETGEWIEHSSGIGAGVDSFYEYLFKAHILFGKEDFWRMFHSAYL  300

Query  966   AVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKK  787
             AVQKYFRHGPWYH+ADMRTGKATYWQLTSLQAFWPG+Q        ANSSHREF HVWKK
Sbjct  301   AVQKYFRHGPWYHEADMRTGKATYWQLTSLQAFWPGLQA------TANSSHREFVHVWKK  354

Query  786   FGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTK  607
             FGVLPERYLLDHQMLHPTEKYYPLRPE AESTFYLYQATKDPWY+EVGE I+NSLN YTK
Sbjct  355   FGVLPERYLLDHQMLHPTEKYYPLRPELAESTFYLYQATKDPWYIEVGETIVNSLNSYTK  414

Query  606   VQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLST  427
             V+GGFAS+RDVTTM+ EDH HSFFLAETCKYLYLLFDDSFLV+RNYIFTTEGHPLPVLS 
Sbjct  415   VEGGFASIRDVTTMQTEDHMHSFFLAETCKYLYLLFDDSFLVDRNYIFTTEGHPLPVLSA  474

Query  426   WHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGD  247
             WH+RL E Y+PSNWT  K+E+  KR+SAMS ++CPA +L+     Q +ESACH+PD + D
Sbjct  475   WHERLPEIYIPSNWTYVKNERQTKRSSAMSLQVCPALSLNAGHGEQQVESACHVPDDQSD  534

Query  246   HRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLL  151
             H+C +DE+CGVDST+CRRRSCSMAGYCGLWL+
Sbjct  535   HKCFSDEECGVDSTSCRRRSCSMAGYCGLWLV  566



>ref|XP_002280345.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X1 [Vitis 
vinifera]
 emb|CBI15084.3| unnamed protein product [Vitis vinifera]
Length=573

 Score =   956 bits (2470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/570 (81%), Positives = 513/570 (90%), Gaps = 7/570 (1%)
 Frame = -1

Query  1854  LICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL  1675
             ++  L+  STF   S S  D      A+++ M +KVRKMFYHAY+NYM HAFPHDELKPL
Sbjct  10    VLMFLLVSSTFVHSSMSEID------AKKRYMREKVRKMFYHAYDNYMAHAFPHDELKPL  63

Query  1674  TKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFD  1495
             +KT+TDSLSELGNL LEHL + Y+GSALTLIESLSSLVILGN+TEFE+AV WLS NLSFD
Sbjct  64    SKTFTDSLSELGNLNLEHLSEHYNGSALTLIESLSSLVILGNNTEFERAVRWLSENLSFD  123

Query  1494  VDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPT  1315
             VD R NLFECNIRVLGGLVSAHILATDS NRLVQGTYKN+LL LAEDLGRRFLPAFDTPT
Sbjct  124   VDVRTNLFECNIRVLGGLVSAHILATDSRNRLVQGTYKNELLILAEDLGRRFLPAFDTPT  183

Query  1314  GLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMR  1135
             GLPYAWINLK GVM+NETTETSTSGCGSLILEMGALSRLTGDP +E AALRALRKLWSMR
Sbjct  184   GLPYAWINLKYGVMENETTETSTSGCGSLILEMGALSRLTGDPRYESAALRALRKLWSMR  243

Query  1134  SSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQK  955
             SSLNLLGTTLDVATGEWIE+S+GIGAGVDSFYEYL+KA+ILFG +E W+MFQSAYLAVQK
Sbjct  244   SSLNLLGTTLDVATGEWIEYSSGIGAGVDSFYEYLIKAHILFGKEELWRMFQSAYLAVQK  303

Query  954   YFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVL  775
             YFRHGPWYH+ADMRTGKATYWQLTSLQAFWPGVQVL+GD+ AANSSHREF +VW+KFGVL
Sbjct  304   YFRHGPWYHEADMRTGKATYWQLTSLQAFWPGVQVLIGDIAAANSSHREFVYVWEKFGVL  363

Query  774   PERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGG  595
             PERYLLDHQMLHPTEKYYPLRPE AESTFYLYQATKDPWY+EVG+ +++SLN Y KV+GG
Sbjct  364   PERYLLDHQMLHPTEKYYPLRPELAESTFYLYQATKDPWYIEVGKSMVDSLNLYAKVEGG  423

Query  594   FASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDR  415
             FAS++DVTTM+LEDHQHSFFLAETCKYLYLLFDDSFLV+RNY+FTTEGHPLPV+S WHDR
Sbjct  424   FASIKDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFLVDRNYVFTTEGHPLPVISAWHDR  483

Query  414   LSEAYLPSNWTSFKHEKH-RKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGDHRC  238
             L E Y+P+N TS K EK   +R+SAMS ++CPATTL+  +  Q +ESACHIPD + DHRC
Sbjct  484   LPENYIPTNGTSIKSEKQAARRSSAMSLQVCPATTLNSGRSSQQVESACHIPDAQSDHRC  543

Query  237   LTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
             LT+++CGVD+TTCRRRSCSMAGYCGLWL I
Sbjct  544   LTEDECGVDATTCRRRSCSMAGYCGLWLFI  573



>ref|XP_006345015.1| PREDICTED: probable alpha-mannosidase I MNS5-like [Solanum tuberosum]
Length=585

 Score =   952 bits (2461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/584 (79%), Positives = 515/584 (88%), Gaps = 7/584 (1%)
 Frame = -1

Query  1878  FRIMRKRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAF  1699
             F+    + ++  L+   T F +  S     N +AA+RKRMS++VRKMFYHAY+NYMM+AF
Sbjct  2     FQATVVKWILLYLVISPTIFILCLSDLHSNNLLAAKRKRMSERVRKMFYHAYDNYMMYAF  61

Query  1698  PHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLW  1519
             PHDELKPLTKT+TDSLSELGNLKLEHLPQ+Y+GSALTLIESLSSLVILGN+TEFEKA++W
Sbjct  62    PHDELKPLTKTFTDSLSELGNLKLEHLPQQYNGSALTLIESLSSLVILGNYTEFEKAIIW  121

Query  1518  LSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRF  1339
             LS NLSFDVDAR+NLFECNIRVLGGLVSAHILATDSTNRLVQ  YKNQLLDLAEDLGRRF
Sbjct  122   LSENLSFDVDARVNLFECNIRVLGGLVSAHILATDSTNRLVQLIYKNQLLDLAEDLGRRF  181

Query  1338  LPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRA  1159
             LPAF TPTGLPYAWINLK GV+ +ETTETSTSGCGSLILEMGALSRLTGD  FE AALRA
Sbjct  182   LPAFKTPTGLPYAWINLKHGVIVDETTETSTSGCGSLILEMGALSRLTGDTRFETAALRA  241

Query  1158  LRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGV-------DSFYEYLVKAYILFGGD  1000
             LRKLWSMRSSLNLLGTTLDVATG+WIE+S+GIGAG+         FYEYL+KAY+LFG D
Sbjct  242   LRKLWSMRSSLNLLGTTLDVATGDWIEYSSGIGAGMFLLCVLFSIFYEYLMKAYVLFGRD  301

Query  999   EFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANS  820
             E WKMFQSAY+ VQKYFRH PWYH+ADMRTG ATYWQLTSLQAFWPG+QVLVGD++AANS
Sbjct  302   EIWKMFQSAYIGVQKYFRHSPWYHEADMRTGTATYWQLTSLQAFWPGLQVLVGDIEAANS  361

Query  819   SHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGE  640
             SHREFF VWKK+GVLPERYLLDHQ+LHPTEKYYPLRPE AESTFYLYQATKDPWYMEVGE
Sbjct  362   SHREFFKVWKKYGVLPERYLLDHQVLHPTEKYYPLRPELAESTFYLYQATKDPWYMEVGE  421

Query  639   LIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFT  460
              I+NSLN +T+V+GGFAS+RDVTTM+LEDHQHSFFLAETCKYLYLLFDDSFL+N+NYIFT
Sbjct  422   SIMNSLNAHTRVKGGFASIRDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFLLNKNYIFT  481

Query  459   TEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLE  280
             TEGHPLPV S WH++L +AY  SN +S K  K RKR+SAMS +ICPA+ + HE   + LE
Sbjct  482   TEGHPLPVRSNWHEKLPKAYNLSNGSSIKTGKQRKRSSAMSLQICPASMIHHEPNARRLE  541

Query  279   SACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
             SACHIPDT  DHRC +D+DCGVD+ TCRRRSCS+AGYCGLW LI
Sbjct  542   SACHIPDTGADHRCFSDDDCGVDANTCRRRSCSLAGYCGLWSLI  585



>gb|EYU42528.1| hypothetical protein MIMGU_mgv1a025048mg [Erythranthe guttata]
Length=575

 Score =   951 bits (2458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/575 (79%), Positives = 515/575 (90%), Gaps = 6/575 (1%)
 Frame = -1

Query  1869  MRKRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHD  1690
             ++   +I ++I  + F   S S  DP    A ++KRMS KVRKMFYHAY+NYMM+AFPHD
Sbjct  6     IKTWAMIFLVISQTLFIETSSSKLDP---FAVKKKRMSDKVRKMFYHAYDNYMMYAFPHD  62

Query  1689  ELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSV  1510
             ELKPLTKTYT+SLSELGNLKLEHLPQ+Y+G+ALTLIESLSSLVI+GN TEFEK+VLWLS 
Sbjct  63    ELKPLTKTYTNSLSELGNLKLEHLPQEYNGTALTLIESLSSLVIMGNETEFEKSVLWLSE  122

Query  1509  NLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQ-GTYKNQLLDLAEDLGRRFLP  1333
             NL+FDVDARINLFECNIRVLGGLVSAHILATDSTNR  + G+Y+NQLL LAE+LG RFLP
Sbjct  123   NLTFDVDARINLFECNIRVLGGLVSAHILATDSTNRFTKKGSYRNQLLVLAEELGNRFLP  182

Query  1332  AFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALR  1153
             AFDTPTGLPYAW+NLK GVM+ ETTETSTSGCGSLILEMGALS LTGDP FE AALRALR
Sbjct  183   AFDTPTGLPYAWVNLKYGVMEKETTETSTSGCGSLILEMGALSHLTGDPKFESAALRALR  242

Query  1152  KLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSA  973
             KLWSMRSSLNLLGTTLDV TGEWIE+S+GIGAGVDSFYEYL+KA++LFG +EFW+MFQSA
Sbjct  243   KLWSMRSSLNLLGTTLDVQTGEWIEYSSGIGAGVDSFYEYLLKAHLLFGREEFWRMFQSA  302

Query  972   YLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVW  793
             YLAVQKYFRHGPWYH+ADMRTG+ATYWQLTSLQAFWPG+QVL GD+ AANSSHREFF+VW
Sbjct  303   YLAVQKYFRHGPWYHEADMRTGRATYWQLTSLQAFWPGLQVLAGDIAAANSSHREFFYVW  362

Query  792   KKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQY  613
             ++FGVLPERYLLDHQMLHPTEKYYPLRPE AESTFYLYQATKDPWY+EVGE I++SLN +
Sbjct  363   QQFGVLPERYLLDHQMLHPTEKYYPLRPELAESTFYLYQATKDPWYLEVGESIVDSLNLH  422

Query  612   TKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVL  433
             T+V+ GFAS+RDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVN NY+FTTEGHPLP+L
Sbjct  423   TRVEAGFASIRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNTNYVFTTEGHPLPIL  482

Query  432   STWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTR  253
             S+WH+RL EAY+PSNWTS K E+ +KRASAMS +ICPA    + +  Q +ES CH+PD R
Sbjct  483   SSWHERLPEAYIPSNWTSLKGEEQQKRASAMSMKICPALNCGNGR--QPVESICHVPDAR  540

Query  252   GDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
               HRCL DEDCGVDS +CRRRSCS++GYCGLWL +
Sbjct  541   AHHRCLADEDCGVDSISCRRRSCSISGYCGLWLSV  575



>gb|KHG00400.1| putative alpha-mannosidase I MNS5 -like protein [Gossypium arboreum]
Length=570

 Score =   949 bits (2452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/567 (79%), Positives = 508/567 (90%), Gaps = 8/567 (1%)
 Frame = -1

Query  1854  LICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL  1675
             L+  L+    F   S S  D  +P AA+++ M +KVRKMFYHAYENYM HAFPHDELKPL
Sbjct  11    LVLFLLISPAFIAPSMSQLD--SPWAAKKRNMREKVRKMFYHAYENYMKHAFPHDELKPL  68

Query  1674  TKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFD  1495
             TK++TDSLSELGNLKL+HLP+ Y+GSALTLIESLSSLVI+GN+TEFE+AV WLS NL+F+
Sbjct  69    TKSFTDSLSELGNLKLQHLPRNYNGSALTLIESLSSLVIMGNNTEFERAVTWLSENLTFN  128

Query  1494  VDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPT  1315
             +DARINLFECNIRVLGGL+SAHILATDSTNRLVQG YKNQLL+LAEDLGRRFLPAFDTPT
Sbjct  129   IDARINLFECNIRVLGGLISAHILATDSTNRLVQGCYKNQLLNLAEDLGRRFLPAFDTPT  188

Query  1314  GLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMR  1135
             GLPYAW+NLK GVM++ET ETSTSGCGSLILEMGALSRLT DP +E AALRALRKLWSMR
Sbjct  189   GLPYAWVNLKYGVMEDETPETSTSGCGSLILEMGALSRLTSDPRYESAALRALRKLWSMR  248

Query  1134  SSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQK  955
             SSLNLLGTTLDV TGEWIE+S+GIGAGVDSFYEYL KAYILFG +++W+MF SAYLAVQK
Sbjct  249   SSLNLLGTTLDVTTGEWIEYSSGIGAGVDSFYEYLCKAYILFGKEDYWRMFHSAYLAVQK  308

Query  954   YFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVL  775
             YFRHGPWYH+ADMRTGKATYWQLTSLQAFWPG+Q        ANSSHREFF+VWKKFGV+
Sbjct  309   YFRHGPWYHEADMRTGKATYWQLTSLQAFWPGLQA------TANSSHREFFYVWKKFGVI  362

Query  774   PERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGG  595
             PERYLLDHQMLHPTEKYYPLRPE AESTFYLYQATKDPWY++VGE I+NSLN YTKV+GG
Sbjct  363   PERYLLDHQMLHPTEKYYPLRPELAESTFYLYQATKDPWYIQVGESIVNSLNLYTKVKGG  422

Query  594   FASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDR  415
             FASVRDVTTM+LEDHQHSFFLAETCKYLYLLFDDSFLV+RNYIFTTEGHPLP+LS+WH++
Sbjct  423   FASVRDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFLVDRNYIFTTEGHPLPILSSWHEK  482

Query  414   LSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGDHRCL  235
             L EAY+P+NWT  K E+  +RASAMS+++CPA  L      Q +ESACHIPD+R DHRC 
Sbjct  483   LPEAYIPTNWTYAKSEQQTRRASAMSRQVCPAIALRSGYGVQQVESACHIPDSRADHRCF  542

Query  234   TDEDCGVDSTTCRRRSCSMAGYCGLWL  154
             +DE+CG+DS+TCRRRSCSMAGYCGLW+
Sbjct  543   SDEECGIDSSTCRRRSCSMAGYCGLWI  569



>gb|KDP31146.1| hypothetical protein JCGZ_11522 [Jatropha curcas]
Length=577

 Score =   948 bits (2450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/544 (82%), Positives = 504/544 (93%), Gaps = 0/544 (0%)
 Frame = -1

Query  1779  AARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSG  1600
             +A++++M ++VRKMFYHAYENYM HAFPHDELKPLTK++TDSLSELGNLKLEHLPQ Y+G
Sbjct  34    SAKKRQMREEVRKMFYHAYENYMTHAFPHDELKPLTKSFTDSLSELGNLKLEHLPQDYNG  93

Query  1599  SALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILA  1420
             SALTLIESLSSLVILGN+TEFE+AV+WLS NLSF+VDAR+NLFECNIRVLGGLVSAH+LA
Sbjct  94    SALTLIESLSSLVILGNYTEFERAVIWLSENLSFNVDARVNLFECNIRVLGGLVSAHLLA  153

Query  1419  TDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSG  1240
             TDSTN+LVQG+Y+NQLL LA+DLG+RFLPAFDTPTGLPYAWINLK GVM+NETTETSTSG
Sbjct  154   TDSTNKLVQGSYRNQLLVLAKDLGQRFLPAFDTPTGLPYAWINLKYGVMENETTETSTSG  213

Query  1239  CGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIG  1060
             CGSLILEMGALS+LTGDP +E AALRALRKLWSMRSSLNLLGTTLDV TGEWIE S+GIG
Sbjct  214   CGSLILEMGALSQLTGDPKYESAALRALRKLWSMRSSLNLLGTTLDVMTGEWIEHSSGIG  273

Query  1059  AGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTS  880
             AGVDSFYEYL KA+ILFG ++FW+MF SAYLA QKYFRHGPWYH+ADMR GKATYWQLTS
Sbjct  274   AGVDSFYEYLYKAHILFGKEDFWRMFHSAYLAAQKYFRHGPWYHEADMRNGKATYWQLTS  333

Query  879   LQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFA  700
             LQAFWPG+QVLVGD+ AANSSHREFF +W+KFGVLPERYLLDHQ++HPTE+YYPLRPE A
Sbjct  334   LQAFWPGLQVLVGDIAAANSSHREFFFLWQKFGVLPERYLLDHQIVHPTERYYPLRPELA  393

Query  699   ESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETC  520
             ESTFYLYQATKDPWY+EVGELI+NSLN YTKV+GGFAS+RDVTTM+ EDHQHSFFLAETC
Sbjct  394   ESTFYLYQATKDPWYIEVGELIVNSLNLYTKVEGGFASIRDVTTMQREDHQHSFFLAETC  453

Query  519   KYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAM  340
             KYLYLLFDDSFL +RNYIFTTEGHPLPVLSTW +RL EAY+P+NWT  K EK  +++SAM
Sbjct  454   KYLYLLFDDSFLTDRNYIFTTEGHPLPVLSTWQERLPEAYIPTNWTYVKSEKQIRQSSAM  513

Query  339   SQRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGL  160
             S+++CPAT+LS     Q +ESACH+PD R DHRC +DE+CGV S +CRRRSCS+AGYCGL
Sbjct  514   SRQVCPATSLSSRNGNQQIESACHVPDARSDHRCFSDEECGVASVSCRRRSCSVAGYCGL  573

Query  159   WLLI  148
             WL +
Sbjct  574   WLFV  577



>emb|CDP16406.1| unnamed protein product [Coffea canephora]
Length=579

 Score =   946 bits (2445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/571 (82%), Positives = 520/571 (91%), Gaps = 2/571 (0%)
 Frame = -1

Query  1857  VLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKP  1678
             V++ +LIF S FF +S S  D  + +AA+RKRMS+KVRKMFYHAY+NYM +AFPHDELKP
Sbjct  10    VILFLLIFPS-FFQISHSELDSYSLLAAKRKRMSEKVRKMFYHAYDNYMTYAFPHDELKP  68

Query  1677  LTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSF  1498
             LTKT+TDSLSELGNLKLE+LP++Y GSAL+LIESLSSLV+LGN TEFEK V WLS NL+F
Sbjct  69    LTKTFTDSLSELGNLKLEYLPEQYKGSALSLIESLSSLVVLGNQTEFEKGVFWLSENLTF  128

Query  1497  DVDARINLFECNIRVLGGLVSAHILATDST-NRLVQGTYKNQLLDLAEDLGRRFLPAFDT  1321
             DVDARINLFECNIRVLGGLVSAHILATDST NRLVQGTYKNQLLDLAE+LGRRFLPAFDT
Sbjct  129   DVDARINLFECNIRVLGGLVSAHILATDSTKNRLVQGTYKNQLLDLAENLGRRFLPAFDT  188

Query  1320  PTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWS  1141
             PTGLPYAWINLK GVM+NETTETSTSGCGSLILEMGALSRLTGDP FE AALRALRKLWS
Sbjct  189   PTGLPYAWINLKYGVMENETTETSTSGCGSLILEMGALSRLTGDPRFESAALRALRKLWS  248

Query  1140  MRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAV  961
             MRSSLNLLGTTLDV TGEWIE S+GIGAGVDSFYEYL+KA+ILFG DEFW+MFQ+AY+AV
Sbjct  249   MRSSLNLLGTTLDVVTGEWIEHSSGIGAGVDSFYEYLLKAHILFGRDEFWRMFQAAYIAV  308

Query  960   QKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
             Q+YFRHGPWYH+ADMRTGK+TYWQLTSLQAFWPG+QVLVGD+ AAN SHREF++VWKK+G
Sbjct  309   QRYFRHGPWYHEADMRTGKSTYWQLTSLQAFWPGLQVLVGDIPAANLSHREFYYVWKKYG  368

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
             VLPERYLLDH MLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELI++SLN Y +V+
Sbjct  369   VLPERYLLDHMMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIVDSLNLYARVE  428

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWH  421
             GGFAS+RDVT+MELEDHQHSFFL+ETCKYLYLL+DDSFL +RNYIFTTEGHPLPVLS+W 
Sbjct  429   GGFASIRDVTSMELEDHQHSFFLSETCKYLYLLYDDSFLGDRNYIFTTEGHPLPVLSSWR  488

Query  420   DRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGDHR  241
             ++L EAY+PSNWT  K E+  KRASAMS R+CPAT L   Q    +ESACHIPD+R DHR
Sbjct  489   EKLPEAYIPSNWTYVKSEEQVKRASAMSMRVCPATALECGQGQPRVESACHIPDSRADHR  548

Query  240   CLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
             C  D+DCGVDS+ CRRRSCS+AGYCG WL I
Sbjct  549   CFNDDDCGVDSSNCRRRSCSIAGYCGQWLFI  579



>ref|XP_004299586.1| PREDICTED: probable alpha-mannosidase I MNS5-like [Fragaria vesca 
subsp. vesca]
Length=574

 Score =   944 bits (2441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/560 (81%), Positives = 508/560 (91%), Gaps = 3/560 (1%)
 Frame = -1

Query  1824  FFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSE  1645
             FF +S S  DP    AA+++R+  KVR MFYHAY+NYM+HAFPHDELKPL+K++TDSLSE
Sbjct  17    FFNLSTSHSDPR--WAAKKRRLRNKVRTMFYHAYDNYMIHAFPHDELKPLSKSFTDSLSE  74

Query  1644  LGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFEC  1465
             LGNLKLEHLPQ Y+GSALTLIESLSSLVI+GN+TEF+ AV+WLS NL+FDVDAR+NLFEC
Sbjct  75    LGNLKLEHLPQDYNGSALTLIESLSSLVIMGNNTEFQSAVVWLSENLTFDVDARVNLFEC  134

Query  1464  NIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLK  1285
             NIRVLGGLVSAH+LATDST+RL QG YKNQLL LAEDLG RFLPAF+TPTGLPYAWINLK
Sbjct  135   NIRVLGGLVSAHLLATDSTHRLGQGVYKNQLLTLAEDLGNRFLPAFNTPTGLPYAWINLK  194

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTL  1105
              GV++NETTETSTSGCGSLILEMGALSRLTGDP +E AALRALRKLWSMRSSLNLLGTTL
Sbjct  195   YGVVENETTETSTSGCGSLILEMGALSRLTGDPKYESAALRALRKLWSMRSSLNLLGTTL  254

Query  1104  DVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHD  925
             DV+TGEWIE+S+GIGAGVDSFYEYL KA+ILFG +EFW+MF  AY+AVQKYF+HGPWYH+
Sbjct  255   DVSTGEWIEYSSGIGAGVDSFYEYLYKAHILFGKEEFWRMFHLAYIAVQKYFKHGPWYHE  314

Query  924   ADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQM  745
             ADMRTGKATYWQLTSLQAFWPG+QVLVGD+ AANSSHREFF+VW KFGVLPERYLLDHQM
Sbjct  315   ADMRTGKATYWQLTSLQAFWPGLQVLVGDIAAANSSHREFFYVWNKFGVLPERYLLDHQM  374

Query  744   LHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTM  565
             LHPTEKYYPLRPEFAESTFYLYQATKDPWY+EVGE I+NSLN +TKV+GGFAS+RDVTTM
Sbjct  375   LHPTEKYYPLRPEFAESTFYLYQATKDPWYIEVGESIVNSLNLHTKVEGGFASIRDVTTM  434

Query  564   ELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNW  385
             ELEDHQHSFFLAETCKYLYLLFDDSFL  +NY+FTTEGHPLPVLS+W DRL E Y+ SNW
Sbjct  435   ELEDHQHSFFLAETCKYLYLLFDDSFLAEQNYVFTTEGHPLPVLSSWQDRLPETYIQSNW  494

Query  384   TSFKHEKHRKRASAMSQRICPATTL-SHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDS  208
             T  K +K  +R SAMS+++CP+T+L S E   Q +ESACHI D  GDHRCLTDE+CGVDS
Sbjct  495   TFLKTDKEVRRTSAMSKQVCPSTSLNSWECAGQKIESACHILDFHGDHRCLTDEECGVDS  554

Query  207   TTCRRRSCSMAGYCGLWLLI  148
             T CRRRSCSMAGYCGLWL I
Sbjct  555   TNCRRRSCSMAGYCGLWLFI  574



>ref|XP_002511454.1| Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA, putative [Ricinus 
communis]
 gb|EEF52056.1| Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA, putative [Ricinus 
communis]
Length=575

 Score =   944 bits (2440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/566 (80%), Positives = 511/566 (90%), Gaps = 3/566 (1%)
 Frame = -1

Query  1845  MLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKT  1666
             +L+    F   S S  D  +  AA++++M +KVRKMFYHAYENYM +AFPHDELKPL+K+
Sbjct  13    LLVIFCIFTDPSMSLVD--SRWAAKKRQMREKVRKMFYHAYENYMTYAFPHDELKPLSKS  70

Query  1665  YTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDA  1486
             +TDSLSELGNLKLEHLPQ Y+GSALTLIESLSSL+ILGN+TEFE+AVLWLS NL+FDVDA
Sbjct  71    FTDSLSELGNLKLEHLPQHYNGSALTLIESLSSLIILGNYTEFERAVLWLSENLTFDVDA  130

Query  1485  RINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLP  1306
             R+NLFECNIRVLGGLVSAH+LA D +NRL QG+YKNQLL LAEDLG+RFLPAF TPTGLP
Sbjct  131   RVNLFECNIRVLGGLVSAHLLANDFSNRLAQGSYKNQLLVLAEDLGQRFLPAFATPTGLP  190

Query  1305  YAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSL  1126
             YAWINLK GV++NETTETSTSGCGSLILEMGALSRLTGDP +E AALRALRKLWSMRSSL
Sbjct  191   YAWINLKYGVLENETTETSTSGCGSLILEMGALSRLTGDPRYESAALRALRKLWSMRSSL  250

Query  1125  NLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFR  946
             NLLGTTLDV TGEWIE S+GIGAGVDSFYEYL KA+ILFG ++FW++F SAY+AVQKYFR
Sbjct  251   NLLGTTLDVTTGEWIEHSSGIGAGVDSFYEYLYKAHILFGKEDFWRIFHSAYIAVQKYFR  310

Query  945   HGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPER  766
             HGPWYH+ADMRTGKATYWQLTSLQAFWPG+QVLVGD+ AANSSHREFF+VWKKFGVLPER
Sbjct  311   HGPWYHEADMRTGKATYWQLTSLQAFWPGLQVLVGDIAAANSSHREFFYVWKKFGVLPER  370

Query  765   YLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFAS  586
             YLLDHQ +HPTEKYYPLRPE AESTFYLYQATKDPWY++VGE I+N+L+ YTKV+GGFAS
Sbjct  371   YLLDHQTVHPTEKYYPLRPELAESTFYLYQATKDPWYIQVGESIVNALDLYTKVEGGFAS  430

Query  585   VRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSE  406
             +RDVTTM+ EDHQHSFFLAETCKYLYLLFDDSFLV+RNYIFTTEGHPLPVLS WH+RL E
Sbjct  431   IRDVTTMQREDHQHSFFLAETCKYLYLLFDDSFLVDRNYIFTTEGHPLPVLSAWHERLPE  490

Query  405   AYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDE  226
             AY+PSNWTS K +K  KRASAM +++CPA +L+ + + Q +ESACHIPD   DHRC TDE
Sbjct  491   AYIPSNWTSVKSKKETKRASAMYKQVCPAMSLNRDGD-QRVESACHIPDAHIDHRCYTDE  549

Query  225   DCGVDSTTCRRRSCSMAGYCGLWLLI  148
             +CGVDS TCRRRSCSMAGYCGLWL +
Sbjct  550   ECGVDSITCRRRSCSMAGYCGLWLFV  575



>ref|XP_003549640.1| PREDICTED: probable alpha-mannosidase I MNS5-like [Glycine max]
Length=572

 Score =   941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/554 (80%), Positives = 504/554 (91%), Gaps = 3/554 (1%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLK  1630
             F+  +  +P AA++KRM  KVR MFYHAY+NYM HAFPHDELKP++KT+T+SLSELGNLK
Sbjct  22    FTISESQSPWAAKKKRMRDKVRNMFYHAYDNYMTHAFPHDELKPISKTFTNSLSELGNLK  81

Query  1629  LEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVL  1450
             LEHLPQ Y+GSALTLIESLSSLVI+GN+TEFE+AVLWLS NL+FDVDARINLFECNIRVL
Sbjct  82    LEHLPQDYNGSALTLIESLSSLVIMGNNTEFERAVLWLSENLTFDVDARINLFECNIRVL  141

Query  1449  GGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQ  1270
             GGLVSAH+LA+DS+ +L QG YKNQLL LAEDLG+RFLPAFDTPTGLPYAWINLK GVM+
Sbjct  142   GGLVSAHLLASDSSKKLFQGAYKNQLLALAEDLGKRFLPAFDTPTGLPYAWINLKYGVME  201

Query  1269  NettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATG  1090
             NETTETSTSGCGSLILEMGALS++TGDPI+E  ALRALRKLWSM+SSL L GTTLDVATG
Sbjct  202   NETTETSTSGCGSLILEMGALSKMTGDPIYESVALRALRKLWSMQSSLKLFGTTLDVATG  261

Query  1089  EWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRT  910
             +WIE+S+GIGAGVDSFYEYL+KA+ILFG ++FWKMF SAY+AVQKYFRHGPWYH+ADMRT
Sbjct  262   QWIEYSSGIGAGVDSFYEYLLKAHILFGKEDFWKMFHSAYVAVQKYFRHGPWYHEADMRT  321

Query  909   GKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTE  730
             G+ATYWQLTSLQAFWPG+QVL+GDV AANSSHREFFHVWK +GVLPERYLLD+QMLHPTE
Sbjct  322   GRATYWQLTSLQAFWPGLQVLIGDVIAANSSHREFFHVWKNYGVLPERYLLDYQMLHPTE  381

Query  729   KYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDH  550
             KYYPLRPE AESTFYLYQATKDPWY+EVGE I+NSLN YTKV+GGFAS++DVTTM+LEDH
Sbjct  382   KYYPLRPELAESTFYLYQATKDPWYIEVGESIVNSLNLYTKVEGGFASIKDVTTMQLEDH  441

Query  549   QHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKH  370
             QHSFFLAETCKYLYLLFDDSF+   NY+FTTEGHPLPVLSTWH+ L EAY+P+NWT  K 
Sbjct  442   QHSFFLAETCKYLYLLFDDSFVHENNYVFTTEGHPLPVLSTWHEELPEAYIPTNWTFVKR  501

Query  369   EKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRR  190
             +    R SAMS ++CPA  L   +  QH+ESACHIPD R ++RCLTDEDCGVD+TTCRRR
Sbjct  502   QPRVNRISAMSLQVCPAMNL---KSGQHIESACHIPDARSNYRCLTDEDCGVDATTCRRR  558

Query  189   SCSMAGYCGLWLLI  148
             SCSMAGYCGLWL+I
Sbjct  559   SCSMAGYCGLWLII  572



>ref|XP_010027922.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X1 [Eucalyptus 
grandis]
 gb|KCW83407.1| hypothetical protein EUGRSUZ_B00341 [Eucalyptus grandis]
Length=574

 Score =   938 bits (2425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/575 (79%), Positives = 505/575 (88%), Gaps = 6/575 (1%)
 Frame = -1

Query  1869  MRKRVLICMLIFLSTFFP--MSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFP  1696
             M  R L  +L+      P  +  S  +P     A+R+ + +KVR+MFYHAY+NYM HAFP
Sbjct  1     MAPRRLGALLVMFLVISPALLDRSVAEPDARWEAKRRLLREKVRRMFYHAYDNYMTHAFP  60

Query  1695  HDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWL  1516
             HDELKPLTKT+TDSLSELGNLKLEHLPQ Y+GSALTLIESLSSLVILGN+TEFEKAV WL
Sbjct  61    HDELKPLTKTFTDSLSELGNLKLEHLPQDYNGSALTLIESLSSLVILGNNTEFEKAVFWL  120

Query  1515  SVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFL  1336
             S NL FDVDARINLFECNIRVLGGLVSAHILATDST+RLVQG+YKNQLL LA+DLG RFL
Sbjct  121   SENLRFDVDARINLFECNIRVLGGLVSAHILATDSTDRLVQGSYKNQLLFLAKDLGERFL  180

Query  1335  PAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRAL  1156
             PAFDTPTGLPYAWINLK GV  +ETTETSTSGCGSLILEMG LSRLTGDP FE AALRAL
Sbjct  181   PAFDTPTGLPYAWINLKHGVTADETTETSTSGCGSLILEMGTLSRLTGDPRFESAALRAL  240

Query  1155  RKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQS  976
             RKLWSMRSSLNLLGTTLDV TGEWIE+S+GIGAGVDSFYEYL KAYILFG +++W+MF S
Sbjct  241   RKLWSMRSSLNLLGTTLDVETGEWIEYSSGIGAGVDSFYEYLFKAYILFGKEDYWRMFHS  300

Query  975   AYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHV  796
             AYLAVQKYFRHGPWYH+ADMRTGKATYWQLTSLQAFWPG+QVLVGDV AANS+HREF HV
Sbjct  301   AYLAVQKYFRHGPWYHEADMRTGKATYWQLTSLQAFWPGLQVLVGDVAAANSTHREFVHV  360

Query  795   WKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQ  616
             WKKFGV+PERYLLDHQM+HPTEKYYPLRPE AESTFYLYQATKDPWY+EVGE ++NSLNQ
Sbjct  361   WKKFGVIPERYLLDHQMVHPTEKYYPLRPELAESTFYLYQATKDPWYIEVGESMVNSLNQ  420

Query  615   YTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPV  436
             YTKV+GGFASVRDVTTM+LEDHQHSFFLAETCKYLYLLFDD FLVN+NY+FTTEGHPLPV
Sbjct  421   YTKVEGGFASVRDVTTMQLEDHQHSFFLAETCKYLYLLFDDQFLVNQNYVFTTEGHPLPV  480

Query  435   LSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPA-TTLSHEQEYQHLESACHIPD  259
                W +RL E ++PSNWT  + +K  +RASAMS R+CPA +T SH Q    +ESACH+PD
Sbjct  481   TRDWQERLPETFIPSNWTFVEADKRTRRASAMSLRLCPASSTPSHGQR---MESACHVPD  537

Query  258   TRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWL  154
                 HRC TDE+CG+DS+TCRRRSCSMAGYCGLWL
Sbjct  538   AWDSHRCSTDEECGIDSSTCRRRSCSMAGYCGLWL  572



>ref|XP_008239715.1| PREDICTED: probable alpha-mannosidase I MNS5 [Prunus mume]
Length=577

 Score =   937 bits (2422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/545 (82%), Positives = 499/545 (92%), Gaps = 1/545 (0%)
 Frame = -1

Query  1779  AARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSG  1600
             AA+++R+  KV KMFYHAY+NYM+HAFPHDELKPL+K++TDSLSELGNLKLE LPQ YSG
Sbjct  33    AAKKRRLRDKVHKMFYHAYDNYMIHAFPHDELKPLSKSFTDSLSELGNLKLERLPQDYSG  92

Query  1599  SALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILA  1420
             SALTLIESLSSLVI+GN+TEF+ AV+WLS NL+F+VDAR+NLFECNIRVLGGLVSAH+LA
Sbjct  93    SALTLIESLSSLVIMGNNTEFQSAVVWLSENLTFNVDARVNLFECNIRVLGGLVSAHLLA  152

Query  1419  TDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSG  1240
             TDST+RL +G YKNQLL LAEDLG+RFLPAFDTPTGLP+AW+NLK GVM+NETTETSTSG
Sbjct  153   TDSTDRLGKGVYKNQLLTLAEDLGKRFLPAFDTPTGLPFAWVNLKYGVMENETTETSTSG  212

Query  1239  CGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIG  1060
             CGSLILEMGALSRLTGDP +E AALRALRKLWSMRSSLNLLGTTLDV+TGEWIE+STGIG
Sbjct  213   CGSLILEMGALSRLTGDPKYESAALRALRKLWSMRSSLNLLGTTLDVSTGEWIEYSTGIG  272

Query  1059  AGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTS  880
             AGVDSFYEYL KA+ILFG +EFW+MF SAY+AVQKYFRHGPWYH+ADMRTGKATYWQLTS
Sbjct  273   AGVDSFYEYLFKAHILFGKEEFWRMFHSAYIAVQKYFRHGPWYHEADMRTGKATYWQLTS  332

Query  879   LQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFA  700
             LQAFWPG+QVLVGD+ AANSSHREF +VWKK+GVLPERYLLDHQMLHPTEKYYPLRPE A
Sbjct  333   LQAFWPGLQVLVGDIAAANSSHREFVYVWKKYGVLPERYLLDHQMLHPTEKYYPLRPELA  392

Query  699   ESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETC  520
             ESTFYLYQATKDPWY+EVGE I+NSLN YTKV GGFAS+RDVTTM+LEDHQHSFFLAETC
Sbjct  393   ESTFYLYQATKDPWYIEVGESIVNSLNLYTKVDGGFASIRDVTTMQLEDHQHSFFLAETC  452

Query  519   KYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAM  340
             KYL+LLFDDSFLV +NYIFTTEGHPLPVLS+WHDRL E Y+ +N T  K     +R S+M
Sbjct  453   KYLFLLFDDSFLVEKNYIFTTEGHPLPVLSSWHDRLPETYIQTNRTLLKTGNQARRTSSM  512

Query  339   SQRICPATTL-SHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCG  163
             S+++CP TTL S E   Q +ESACH+PD R DHRCLTD++CGVDS+ CRRRSCSMAGYCG
Sbjct  513   SKQVCPPTTLNSWECSGQQVESACHVPDARSDHRCLTDDECGVDSSNCRRRSCSMAGYCG  572

Query  162   LWLLI  148
             LWL I
Sbjct  573   LWLFI  577



>ref|XP_003525487.1| PREDICTED: probable alpha-mannosidase I MNS5-like [Glycine max]
Length=571

 Score =   936 bits (2418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/554 (80%), Positives = 501/554 (90%), Gaps = 3/554 (1%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLK  1630
             FS  +  +P AA++KRM  KVR MFYHAY+NYM HAFPHDELKP++KT+T+SLSELGNLK
Sbjct  21    FSISESQSPWAAKKKRMRDKVRNMFYHAYDNYMTHAFPHDELKPISKTFTNSLSELGNLK  80

Query  1629  LEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVL  1450
             LEHLPQ Y+GSALTLIESLSSLVI+GN+TEFE+AVLWLS NL+FDVDARINLFECNIRVL
Sbjct  81    LEHLPQDYNGSALTLIESLSSLVIMGNYTEFERAVLWLSENLTFDVDARINLFECNIRVL  140

Query  1449  GGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQ  1270
             GGLVSAH+LA+DS+ +  QG YKNQLL LAEDLG+RFLPAF+TPTGLPYAWINLK GVM+
Sbjct  141   GGLVSAHLLASDSSKKFFQGAYKNQLLALAEDLGKRFLPAFNTPTGLPYAWINLKYGVME  200

Query  1269  NettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATG  1090
             NETTETSTSGCGSLILEMGALS++TGDPI+E  ALRALRKLWSM+S+L L GTTLDV TG
Sbjct  201   NETTETSTSGCGSLILEMGALSKMTGDPIYESVALRALRKLWSMQSTLKLFGTTLDVTTG  260

Query  1089  EWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRT  910
             +WIE+S+GIGAGVDSFYEYL+KA+ILFG ++FWKMF SAY+AVQKYFRHGPWYH+ADMRT
Sbjct  261   QWIEYSSGIGAGVDSFYEYLLKAHILFGKEDFWKMFHSAYVAVQKYFRHGPWYHEADMRT  320

Query  909   GKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTE  730
             G+ATYWQLTSLQAFWPG+QVL+GDV AANSSHREFFHVWK++GVLPERYLLDHQMLHPTE
Sbjct  321   GRATYWQLTSLQAFWPGLQVLIGDVIAANSSHREFFHVWKRYGVLPERYLLDHQMLHPTE  380

Query  729   KYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDH  550
             KYYPLRPE AESTFYLYQATKDPWY+EVGE I+NSLN YTKV+GGFAS++DVTTM+LEDH
Sbjct  381   KYYPLRPELAESTFYLYQATKDPWYIEVGESIVNSLNLYTKVEGGFASIKDVTTMQLEDH  440

Query  549   QHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKH  370
             QHSFFLAETCKYLYLLFDDSF+   NY+FTTEGHPLPVLSTWH+ L EAY+P+NWT  K 
Sbjct  441   QHSFFLAETCKYLYLLFDDSFVHENNYVFTTEGHPLPVLSTWHEELPEAYIPTNWTFVKR  500

Query  369   EKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRR  190
             +    R  AMS ++CPA  L   +  QH+ESACHIPD R D+RCLTDEDCGVD+TTCR R
Sbjct  501   QPRVNRICAMSLQVCPAMNL---KSGQHIESACHIPDARSDYRCLTDEDCGVDATTCRPR  557

Query  189   SCSMAGYCGLWLLI  148
             SCS+AGYCGLWL+I
Sbjct  558   SCSIAGYCGLWLII  571



>ref|XP_010272051.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X1 [Nelumbo 
nucifera]
Length=583

 Score =   935 bits (2416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/581 (78%), Positives = 510/581 (88%), Gaps = 6/581 (1%)
 Frame = -1

Query  1890  DPKSFRIMRKRVLICMLIFLSTF-FPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENY  1714
             +PKS    R  VL+  L FL+T     S +GF      A +++ M +KVRKMFYHAY NY
Sbjct  5     NPKSTIRFRIWVLLFSLFFLATSNLAKSETGFR-----ATKKRFMREKVRKMFYHAYNNY  59

Query  1713  MMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFE  1534
             M +AFPHDELKPLTKT+ DSLSELGNLKLEHLPQ Y+GSALTLIESLSSLV+LGN+TEFE
Sbjct  60    MTYAFPHDELKPLTKTFADSLSELGNLKLEHLPQNYNGSALTLIESLSSLVVLGNNTEFE  119

Query  1533  KAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAED  1354
             +AVLWLS NL+FDVDARINLFECNIRVLGGL+SAHILATDS +RLVQG Y NQLL LAED
Sbjct  120   RAVLWLSENLTFDVDARINLFECNIRVLGGLLSAHILATDSRSRLVQGKYNNQLLALAED  179

Query  1353  LGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEI  1174
             LG+RFL AF TPTGLPYAW+NLK GVM+NETTETSTSGCGSLILEMGALSRLTGDP +E 
Sbjct  180   LGKRFLYAFATPTGLPYAWVNLKYGVMENETTETSTSGCGSLILEMGALSRLTGDPRYEA  239

Query  1173  AALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEF  994
             AALRAL KLWSMRS LNLLGTTLDV TGEWIE+S+GIGAGVDSFYEYL+KA+ILFG +EF
Sbjct  240   AALRALHKLWSMRSPLNLLGTTLDVVTGEWIEYSSGIGAGVDSFYEYLIKAHILFGREEF  299

Query  993   WKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSH  814
             W +F SAY+AVQKYFRHGPWYH+ADMRTG+ATYWQLTSLQAFWPG+QVLVGD+ AANSSH
Sbjct  300   WDIFHSAYVAVQKYFRHGPWYHEADMRTGRATYWQLTSLQAFWPGLQVLVGDILAANSSH  359

Query  813   REFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELI  634
              EFFHVW+KFGVLPERYLL+H+MLHPTEKYYPLRPE AESTFYLYQATKDPWYMEVGE I
Sbjct  360   HEFFHVWEKFGVLPERYLLNHEMLHPTEKYYPLRPELAESTFYLYQATKDPWYMEVGESI  419

Query  633   INSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTE  454
             +NSLN YTKV+GGFAS++DVTTM+LEDHQHSFFLAETCKYLYLLFDDSFL ++NYIFTTE
Sbjct  420   VNSLNLYTKVEGGFASIKDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFLADQNYIFTTE  479

Query  453   GHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESA  274
             GHPLPVLS+WH+RL E +  +NWT  K     KRASAMS ++CPA+TL      Q +ESA
Sbjct  480   GHPLPVLSSWHERLPETFTSTNWTFVKGISQVKRASAMSLQVCPASTLVRGTTAQLVESA  539

Query  273   CHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLL  151
             CH+PD R DHRC+TDE+CG+DST+CR+R+CSMAGYCGLWLL
Sbjct  540   CHVPDARADHRCMTDEECGIDSTSCRQRTCSMAGYCGLWLL  580



>ref|XP_007155391.1| hypothetical protein PHAVU_003G197300g [Phaseolus vulgaris]
 gb|ESW27385.1| hypothetical protein PHAVU_003G197300g [Phaseolus vulgaris]
Length=572

 Score =   932 bits (2408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/547 (80%), Positives = 496/547 (91%), Gaps = 3/547 (1%)
 Frame = -1

Query  1788  NPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQK  1609
             +P AA+RKRM +KVR MFYHAY+NYM +AFPHDELKPL+KT+T+SLSELGNLKLEHLPQ 
Sbjct  29    SPSAAKRKRMKEKVRNMFYHAYDNYMTYAFPHDELKPLSKTFTNSLSELGNLKLEHLPQD  88

Query  1608  YSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAH  1429
             Y GSALTLIESLSSLVI+GN TEFE+AVLWLS NL+FDVDARINLFECNIRVLGGLVSAH
Sbjct  89    YHGSALTLIESLSSLVIMGNSTEFERAVLWLSENLTFDVDARINLFECNIRVLGGLVSAH  148

Query  1428  ILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettets  1249
             +LA+DS+ +L QG Y NQLL LAEDLG+RFLPAF+TPT LPYAWINLK GVM+NETTETS
Sbjct  149   LLASDSSKKLFQGAYNNQLLVLAEDLGKRFLPAFNTPTALPYAWINLKYGVMENETTETS  208

Query  1248  tSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFST  1069
             TSGCGSLILEMGALS++TGDPI+E  ALRALRKLWSM+SSL L GTTLDVATG+WIE+S+
Sbjct  209   TSGCGSLILEMGALSKMTGDPIYESVALRALRKLWSMQSSLKLFGTTLDVATGQWIEYSS  268

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQ  889
             GIGAGVDSFYEYL+KA+ILFG ++FWKMF SAY+AVQKYFRHG WYH+ADMRTG+ATYWQ
Sbjct  269   GIGAGVDSFYEYLLKAHILFGKEDFWKMFHSAYVAVQKYFRHGSWYHEADMRTGRATYWQ  328

Query  888   LTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRP  709
             LTSLQAFWPG+QVL+GD+ AANSSHREFFHVWK++GVLPERYLLDHQM+HPTEKYYPLRP
Sbjct  329   LTSLQAFWPGLQVLIGDLSAANSSHREFFHVWKRYGVLPERYLLDHQMIHPTEKYYPLRP  388

Query  708   EFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLA  529
             E AESTFYLYQATKDPWYMEVGE I+NS+N YTKV+GGFAS++DVTTM+LEDHQHSFFLA
Sbjct  389   ELAESTFYLYQATKDPWYMEVGESIVNSINLYTKVEGGFASIKDVTTMQLEDHQHSFFLA  448

Query  528   ETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRA  349
             ETCKYLYLLFDDSF+   NY+FTTEGHPLPVLS WH+ L +AY+P+NWT  K +    R 
Sbjct  449   ETCKYLYLLFDDSFVHENNYVFTTEGHPLPVLSNWHEELPQAYVPTNWTFVKRQPRVSRI  508

Query  348   SAMSQRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGY  169
             S+MS ++CPA  L   +  QH+ESACHIPD R D RCLTDEDCGVD+TTCRRRSCSMAGY
Sbjct  509   SSMSLQVCPALNL---KSGQHIESACHIPDARSDFRCLTDEDCGVDATTCRRRSCSMAGY  565

Query  168   CGLWLLI  148
             CGLWL++
Sbjct  566   CGLWLIV  572



>ref|XP_009419876.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=576

 Score =   930 bits (2404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/544 (81%), Positives = 492/544 (90%), Gaps = 1/544 (0%)
 Frame = -1

Query  1779  AARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSG  1600
             +A++  M +KVRKMFYHAYENYM+HAFPHDELKPLTKT+TDSLSELGNLKLE LPQ Y+G
Sbjct  33    SAKKVYMREKVRKMFYHAYENYMVHAFPHDELKPLTKTFTDSLSELGNLKLERLPQNYNG  92

Query  1599  SALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILA  1420
             SALTL+ESLSSLV+LGN+TEFE+ VLWLS NL+FDVDAR+NLFECNIRVLGGLVSAHILA
Sbjct  93    SALTLVESLSSLVVLGNYTEFERGVLWLSDNLTFDVDARVNLFECNIRVLGGLVSAHILA  152

Query  1419  TDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSG  1240
             TDS +RL  G YKNQLLDLA DLG+RFLPAF+TPTGLPYAWINLK GVM++ETTETSTSG
Sbjct  153   TDSKSRLEHGLYKNQLLDLARDLGQRFLPAFETPTGLPYAWINLKYGVMEDETTETSTSG  212

Query  1239  CGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIG  1060
             CGSLILEMGALSRLTGDP F+ AALRALRKLWSMRS LNLLGTTLDV TG+WIE+S+G+G
Sbjct  213   CGSLILEMGALSRLTGDPRFQAAALRALRKLWSMRSPLNLLGTTLDVVTGDWIEYSSGVG  272

Query  1059  AGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTS  880
             AGVDSFYEYL+KAYILFG DEFW MF S+YLAVQKYFRHGPWYH+ADMRTGKATYWQLTS
Sbjct  273   AGVDSFYEYLIKAYILFGNDEFWDMFHSSYLAVQKYFRHGPWYHEADMRTGKATYWQLTS  332

Query  879   LQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFA  700
             LQAFWPG+Q+LVGD+ AANSSHREFF+VW KFGVLPERYLLDH MLHPTEKYYPLRPE A
Sbjct  333   LQAFWPGLQILVGDIAAANSSHREFFYVWDKFGVLPERYLLDHGMLHPTEKYYPLRPELA  392

Query  699   ESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETC  520
             ESTFYLYQAT+DPWYMEVGE IINSLN YT+V GGFASVRDVTTMELEDHQHSFFL+ETC
Sbjct  393   ESTFYLYQATRDPWYMEVGETIINSLNYYTRVDGGFASVRDVTTMELEDHQHSFFLSETC  452

Query  519   KYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAM  340
             KYLYLLFDDSFL  +NY+FTTEGHPLP+  +WH++L EAY+P+NWTS K+E    R SA+
Sbjct  453   KYLYLLFDDSFLAGQNYVFTTEGHPLPIRGSWHEKLPEAYIPANWTSVKNENQAIRLSAL  512

Query  339   SQRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGL  160
             SQ++CPATT       Q +ESACHIPD   DHRC TD++CG+DSTTCR+R CSMAG+CGL
Sbjct  513   SQQVCPATTTGGSISLQ-IESACHIPDLHADHRCRTDDECGIDSTTCRKRVCSMAGFCGL  571

Query  159   WLLI  148
             WL I
Sbjct  572   WLFI  575



>ref|XP_010254901.1| PREDICTED: probable alpha-mannosidase I MNS5 [Nelumbo nucifera]
Length=580

 Score =   927 bits (2397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/574 (79%), Positives = 511/574 (89%), Gaps = 6/574 (1%)
 Frame = -1

Query  1866  RKRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDE  1687
             R RV + +LI   T F ++    D     A +++ M +KVRKMFYHAY+NY+ HAFPHDE
Sbjct  11    RTRVHLFLLISF-TIFNLAHCELDF---RATKKRYMREKVRKMFYHAYDNYLTHAFPHDE  66

Query  1686  LKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVN  1507
             LKPL+KT+TDSLSELGNLKLEHLPQ Y+GSALTLIESLSSLV+LGN+TEFE+AVLWLS N
Sbjct  67    LKPLSKTFTDSLSELGNLKLEHLPQNYNGSALTLIESLSSLVVLGNNTEFERAVLWLSEN  126

Query  1506  LSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAF  1327
             LSFDVDARI+LFECNIRVLGGLVSAHILATDS+NRLVQG YKNQLL LAEDLG+RFL AF
Sbjct  127   LSFDVDARISLFECNIRVLGGLVSAHILATDSSNRLVQGKYKNQLLTLAEDLGQRFLCAF  186

Query  1326  DTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKL  1147
             DTPTGLPYAWINLK GVM+NETTETSTSGCGSLILEMGALSRLTGDP +E AAL ALRKL
Sbjct  187   DTPTGLPYAWINLKYGVMENETTETSTSGCGSLILEMGALSRLTGDPRYEAAALCALRKL  246

Query  1146  WSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYL  967
             WSMRS L+LLGTTLDV  GEWIE+S+GIGAGVDSFYEYL+KA+ILFG +E+W MF SAY+
Sbjct  247   WSMRSPLDLLGTTLDVVKGEWIEYSSGIGAGVDSFYEYLIKAHILFGREEYWDMFCSAYV  306

Query  966   AVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKK  787
             AVQKYFRHGPWYH+ADMRTGKATYWQLTSLQAFWPG+QVLVGD+ AANSSHREFFHVW++
Sbjct  307   AVQKYFRHGPWYHEADMRTGKATYWQLTSLQAFWPGLQVLVGDILAANSSHREFFHVWER  366

Query  786   FGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTK  607
             FGVLPERYLLD ++LHPTEKYYPLRPE AESTFYLYQATKDPWYMEVGE IINSLN YTK
Sbjct  367   FGVLPERYLLDREILHPTEKYYPLRPELAESTFYLYQATKDPWYMEVGESIINSLNLYTK  426

Query  606   VQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLST  427
             V+GGFAS++DVTTM+LEDHQHSFFLAETCKYLYLLFDDSFLV++NYIFTTEGHPLPVLS 
Sbjct  427   VEGGFASIKDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFLVDQNYIFTTEGHPLPVLSA  486

Query  426   WHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQH-LESACHIPDTRG  250
             WH+RL E ++P NW S K  +  KRAS+MS ++CPA+TLS      H +ESACH+PD R 
Sbjct  487   WHERLPEIFIPRNWNSVKRNQ-AKRASSMSLQVCPASTLSRGGSIAHCVESACHVPDARA  545

Query  249   DHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
             DH C ++E+CG+DST+CR+R+CS+AGYCGLWLLI
Sbjct  546   DHGCTSEEECGIDSTSCRQRTCSIAGYCGLWLLI  579



>ref|XP_009419875.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=578

 Score =   926 bits (2394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/546 (81%), Positives = 492/546 (90%), Gaps = 3/546 (1%)
 Frame = -1

Query  1779  AARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSG  1600
             +A++  M +KVRKMFYHAYENYM+HAFPHDELKPLTKT+TDSLSELGNLKLE LPQ Y+G
Sbjct  33    SAKKVYMREKVRKMFYHAYENYMVHAFPHDELKPLTKTFTDSLSELGNLKLERLPQNYNG  92

Query  1599  SALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILA  1420
             SALTL+ESLSSLV+LGN+TEFE+ VLWLS NL+FDVDAR+NLFECNIRVLGGLVSAHILA
Sbjct  93    SALTLVESLSSLVVLGNYTEFERGVLWLSDNLTFDVDARVNLFECNIRVLGGLVSAHILA  152

Query  1419  TDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSG  1240
             TDS +RL  G YKNQLLDLA DLG+RFLPAF+TPTGLPYAWINLK GVM++ETTETSTSG
Sbjct  153   TDSKSRLEHGLYKNQLLDLARDLGQRFLPAFETPTGLPYAWINLKYGVMEDETTETSTSG  212

Query  1239  C--GSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTG  1066
             C  GSLILEMGALSRLTGDP F+ AALRALRKLWSMRS LNLLGTTLDV TG+WIE+S+G
Sbjct  213   CASGSLILEMGALSRLTGDPRFQAAALRALRKLWSMRSPLNLLGTTLDVVTGDWIEYSSG  272

Query  1065  IGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQL  886
             +GAGVDSFYEYL+KAYILFG DEFW MF S+YLAVQKYFRHGPWYH+ADMRTGKATYWQL
Sbjct  273   VGAGVDSFYEYLIKAYILFGNDEFWDMFHSSYLAVQKYFRHGPWYHEADMRTGKATYWQL  332

Query  885   TSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPE  706
             TSLQAFWPG+Q+LVGD+ AANSSHREFF+VW KFGVLPERYLLDH MLHPTEKYYPLRPE
Sbjct  333   TSLQAFWPGLQILVGDIAAANSSHREFFYVWDKFGVLPERYLLDHGMLHPTEKYYPLRPE  392

Query  705   FAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAE  526
              AESTFYLYQAT+DPWYMEVGE IINSLN YT+V GGFASVRDVTTMELEDHQHSFFL+E
Sbjct  393   LAESTFYLYQATRDPWYMEVGETIINSLNYYTRVDGGFASVRDVTTMELEDHQHSFFLSE  452

Query  525   TCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRAS  346
             TCKYLYLLFDDSFL  +NY+FTTEGHPLP+  +WH++L EAY+P+NWTS K+E    R S
Sbjct  453   TCKYLYLLFDDSFLAGQNYVFTTEGHPLPIRGSWHEKLPEAYIPANWTSVKNENQAIRLS  512

Query  345   AMSQRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYC  166
             A+SQ++CPATT       Q +ESACHIPD   DHRC TD++CG+DSTTCR+R CSMAG+C
Sbjct  513   ALSQQVCPATTTGGSISLQ-IESACHIPDLHADHRCRTDDECGIDSTTCRKRVCSMAGFC  571

Query  165   GLWLLI  148
             GLWL I
Sbjct  572   GLWLFI  577



>ref|XP_008798070.1| PREDICTED: LOW QUALITY PROTEIN: probable alpha-mannosidase I 
MNS5 [Phoenix dactylifera]
Length=576

 Score =   920 bits (2379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/544 (81%), Positives = 486/544 (89%), Gaps = 1/544 (0%)
 Frame = -1

Query  1779  AARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSG  1600
             AAR+  M +KVRKMFYHAYENYM HAFPHDELKPLTKT+TDSLSELGNLKLEHLPQ Y+G
Sbjct  33    AARKAYMREKVRKMFYHAYENYMAHAFPHDELKPLTKTFTDSLSELGNLKLEHLPQNYNG  92

Query  1599  SALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILA  1420
             SALTLIESLSSLV+LGN TEF++ VLWLS NL+FDV+AR+NLFECNIRVLGGL+SAHILA
Sbjct  93    SALTLIESLSSLVVLGNFTEFQRGVLWLSDNLTFDVNARVNLFECNIRVLGGLISAHILA  152

Query  1419  TDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSG  1240
             TDS  RL  G YKNQLL+LAEDLG+RFLPAF+TPTGLPYAWINLK GVM+NETTETSTSG
Sbjct  153   TDSKGRLDHGLYKNQLLNLAEDLGQRFLPAFETPTGLPYAWINLKNGVMENETTETSTSG  212

Query  1239  CGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIG  1060
             CGSLILEMGALSRLTGD  +E  ALRALRKLWSMRSSLNLLGTTLDV TGEW+E+S+GIG
Sbjct  213   CGSLILEMGALSRLTGDSRYEAVALRALRKLWSMRSSLNLLGTTLDVVTGEWMEYSSGIG  272

Query  1059  AGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTS  880
             AGVDSFYEYL+KAYILFG DE+W +F SAYLAVQKYFRHGPWYH+ADMRTG+ATYWQLTS
Sbjct  273   AGVDSFYEYLIKAYILFGSDEYWDIFHSAYLAVQKYFRHGPWYHEADMRTGRATYWQLTS  332

Query  879   LQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFA  700
             LQAFWPG+Q+LVGDV AANSSHREFFHVWK FGVLPERYLLDH  LHPTE+YYPLRPE A
Sbjct  333   LQAFWPGLQILVGDVAAANSSHREFFHVWKMFGVLPERYLLDHDTLHPTERYYPLRPELA  392

Query  699   ESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETC  520
             EST+YLYQATKDPWYMEVGE IINSLN YTKV GGFAS+RDVTTM+ EDHQHSFFL+ETC
Sbjct  393   ESTYYLYQATKDPWYMEVGESIINSLNYYTKVDGGFASIRDVTTMQHEDHQHSFFLSETC  452

Query  519   KYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAM  340
             KYLYLLFDDSFL ++NY+FTTEGHPLP+ S WH++L E+Y+PSNWTS K+      ASAM
Sbjct  453   KYLYLLFDDSFLADKNYVFTTEGHPLPIRSAWHEKLPESYIPSNWTSIKNGTQVTHASAM  512

Query  339   SQRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGL  160
             S ++CPA  +        +ESACHIPD R DHRC+TD DCG+DSTTCRRR+CSMAGYCG 
Sbjct  513   SLQVCPAMFIGGNIT-PWVESACHIPDARVDHRCITDVDCGIDSTTCRRRTCSMAGYCGS  571

Query  159   WLLI  148
             WL I
Sbjct  572   WLFI  575



>ref|XP_004138129.1| PREDICTED: probable alpha-mannosidase I MNS5-like [Cucumis sativus]
 ref|XP_004155005.1| PREDICTED: probable alpha-mannosidase I MNS5-like [Cucumis sativus]
 gb|KGN63610.1| hypothetical protein Csa_1G005710 [Cucumis sativus]
Length=575

 Score =   920 bits (2379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/569 (79%), Positives = 506/569 (89%), Gaps = 6/569 (1%)
 Frame = -1

Query  1857  VLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKP  1678
             +L+  +IF + F P S S +     + ++R RM +K R+MFYHAY+NYM +AFP+DELKP
Sbjct  10    ILLLFIIFFTLFNPSSSSSY-----LTSKRMRMREKARRMFYHAYDNYMTYAFPNDELKP  64

Query  1677  LTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSF  1498
             LTKT+T+SLSELGNLKLEHLPQ Y+GSALTLIESLSSLVILGN+TEF+KAVLWLS NL F
Sbjct  65    LTKTFTNSLSELGNLKLEHLPQNYTGSALTLIESLSSLVILGNNTEFQKAVLWLSENLHF  124

Query  1497  DVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTP  1318
             DVDARINLFECNIRVLGGLVSAH+LATDSTNRL + +YKNQLL LAEDLG RFLPAF+TP
Sbjct  125   DVDARINLFECNIRVLGGLVSAHVLATDSTNRLARQSYKNQLLVLAEDLGNRFLPAFNTP  184

Query  1317  TGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSM  1138
             TGLPYAWINLK GVM++ETTETSTSGCGSLILEMGALSRLTGDP FE AALRALRKLWSM
Sbjct  185   TGLPYAWINLKHGVMEDETTETSTSGCGSLILEMGALSRLTGDPRFEHAALRALRKLWSM  244

Query  1137  RSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQ  958
             RSSLNLLGTTLDV TGEWIEFS+GIGAGVDSFYEYL+KA++LFG +EFW+MF +AYLAVQ
Sbjct  245   RSSLNLLGTTLDVETGEWIEFSSGIGAGVDSFYEYLLKAHVLFGKEEFWRMFHAAYLAVQ  304

Query  957   KYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGV  778
             KYFRHGPWYH+ADMRTG+ATYWQLTSLQAFWPG+QVLVGD+ AANSSHREFF+VW+K+GV
Sbjct  305   KYFRHGPWYHEADMRTGRATYWQLTSLQAFWPGLQVLVGDIPAANSSHREFFYVWEKYGV  364

Query  777   LPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQG  598
             LPERYLLD QMLHPTEKYYPLRPE AESTFYLYQATKDPWY EVGE II SL  +TKV+G
Sbjct  365   LPERYLLDRQMLHPTEKYYPLRPELAESTFYLYQATKDPWYFEVGESIIKSLISHTKVEG  424

Query  597   GFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHD  418
             GFASVRDVTTM+LEDHQHSFFL+ETCKYLYLLFDDSFLV++NYIFTTEGHPLPVLS+WH+
Sbjct  425   GFASVRDVTTMQLEDHQHSFFLSETCKYLYLLFDDSFLVDQNYIFTTEGHPLPVLSSWHE  484

Query  417   RLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQE-YQHLESACHIPDTRGDHR  241
             RL E Y  +N TS K E   +R SAMS ++CPAT+L+   +  Q +ESACHI D R DH+
Sbjct  485   RLPEVYGLTNGTSIKGENSSRRLSAMSLQVCPATSLNTAGDGGQQIESACHILDARADHK  544

Query  240   CLTDEDCGVDSTTCRRRSCSMAGYCGLWL  154
             C +DE+CGVDSTTCRRRSCS +GYCG WL
Sbjct  545   CFSDEECGVDSTTCRRRSCSSSGYCGQWL  573



>ref|XP_010027930.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X2 [Eucalyptus 
grandis]
Length=537

 Score =   919 bits (2375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/529 (84%), Positives = 483/529 (91%), Gaps = 4/529 (1%)
 Frame = -1

Query  1737  FYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVI  1558
             FYHAY+NYM HAFPHDELKPLTKT+TDSLSELGNLKLEHLPQ Y+GSALTLIESLSSLVI
Sbjct  10    FYHAYDNYMTHAFPHDELKPLTKTFTDSLSELGNLKLEHLPQDYNGSALTLIESLSSLVI  69

Query  1557  LGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKN  1378
             LGN+TEFEKAV WLS NL FDVDARINLFECNIRVLGGLVSAHILATDST+RLVQG+YKN
Sbjct  70    LGNNTEFEKAVFWLSENLRFDVDARINLFECNIRVLGGLVSAHILATDSTDRLVQGSYKN  129

Query  1377  QLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRL  1198
             QLL LA+DLG RFLPAFDTPTGLPYAWINLK GV  +ETTETSTSGCGSLILEMG LSRL
Sbjct  130   QLLFLAKDLGERFLPAFDTPTGLPYAWINLKHGVTADETTETSTSGCGSLILEMGTLSRL  189

Query  1197  TGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAY  1018
             TGDP FE AALRALRKLWSMRSSLNLLGTTLDV TGEWIE+S+GIGAGVDSFYEYL KAY
Sbjct  190   TGDPRFESAALRALRKLWSMRSSLNLLGTTLDVETGEWIEYSSGIGAGVDSFYEYLFKAY  249

Query  1017  ILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGD  838
             ILFG +++W+MF SAYLAVQKYFRHGPWYH+ADMRTGKATYWQLTSLQAFWPG+QVLVGD
Sbjct  250   ILFGKEDYWRMFHSAYLAVQKYFRHGPWYHEADMRTGKATYWQLTSLQAFWPGLQVLVGD  309

Query  837   VDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPW  658
             V AANS+HREF HVWKKFGV+PERYLLDHQM+HPTEKYYPLRPE AESTFYLYQATKDPW
Sbjct  310   VAAANSTHREFVHVWKKFGVIPERYLLDHQMVHPTEKYYPLRPELAESTFYLYQATKDPW  369

Query  657   YMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVN  478
             Y+EVGE ++NSLNQYTKV+GGFASVRDVTTM+LEDHQHSFFLAETCKYLYLLFDD FLVN
Sbjct  370   YIEVGESMVNSLNQYTKVEGGFASVRDVTTMQLEDHQHSFFLAETCKYLYLLFDDQFLVN  429

Query  477   RNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPA-TTLSHE  301
             +NY+FTTEGHPLPV   W +RL E ++PSNWT  + +K  +RASAMS R+CPA +T SH 
Sbjct  430   QNYVFTTEGHPLPVTRDWQERLPETFIPSNWTFVEADKRTRRASAMSLRLCPASSTPSHG  489

Query  300   QEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWL  154
             Q    +ESACH+PD    HRC TDE+CG+DS+TCRRRSCSMAGYCGLWL
Sbjct  490   QR---MESACHVPDAWDSHRCSTDEECGIDSSTCRRRSCSMAGYCGLWL  535



>ref|XP_003608915.1| ER degradation-enhancing alpha-mannosidase-like protein [Medicago 
truncatula]
 gb|AES91112.1| glycosyl hydrolase family 47 protein [Medicago truncatula]
Length=570

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/575 (78%), Positives = 514/575 (89%), Gaps = 6/575 (1%)
 Frame = -1

Query  1872  IMRKRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPH  1693
             I R+  L C+LIFL      SFS   P    ++++KR+ +KVR MF+HAY+NYM HAFPH
Sbjct  2     IPRRYFLTCLLIFLLVLSTFSFSHSQPH--WSSKKKRLGEKVRNMFHHAYDNYMTHAFPH  59

Query  1692  DELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLS  1513
             DELKPLTKT+TDSLSELGNLKLE LPQ Y+GSAL+LIESLSSLVI+GN+TEFEK V WLS
Sbjct  60    DELKPLTKTFTDSLSELGNLKLERLPQDYNGSALSLIESLSSLVIMGNNTEFEKGVRWLS  119

Query  1512  VNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLP  1333
              NL FDVDARINLFECNIRVLGGLVSAH+LA+DS+ +L+QG+YKN+LL LAEDLG+RFLP
Sbjct  120   ENLKFDVDARINLFECNIRVLGGLVSAHLLASDSSKKLLQGSYKNELLGLAEDLGKRFLP  179

Query  1332  AFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALR  1153
             AF+TPTGLPYAWINLK GVM+NETTETSTSGCGSLILEMGALS+LTGDPI+E  ALRALR
Sbjct  180   AFNTPTGLPYAWINLKYGVMENETTETSTSGCGSLILEMGALSKLTGDPIYESVALRALR  239

Query  1152  KLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSA  973
             KLWSM+S L L GTTLDV+TG+WIE S+GIGAGVDSFYEYL+KA+ILFG +++W+MF SA
Sbjct  240   KLWSMQSLLKLFGTTLDVSTGQWIEHSSGIGAGVDSFYEYLLKAHILFGKEDYWRMFHSA  299

Query  972   YLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVW  793
             Y+AVQK+FRHGPWYH+ADMRTG+ATYWQLTSLQAFWPG+QVL+GD+ AANSSHREFF+VW
Sbjct  300   YVAVQKHFRHGPWYHEADMRTGRATYWQLTSLQAFWPGLQVLIGDISAANSSHREFFYVW  359

Query  792   KKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQY  613
             KKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWY+EVGELI+NSLN +
Sbjct  360   KKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYIEVGELIVNSLNLH  419

Query  612   TKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVL  433
             T+V+GGFAS++DVTTM+LEDHQHSFFLAETCKYLYLLFDDSF+V+ NY+FTTEGHPLPVL
Sbjct  420   TRVEGGFASIKDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFMVDSNYVFTTEGHPLPVL  479

Query  432   STWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTR  253
             STWH+ L + Y+P+NWT+ K +    RASAMS ++CPA TL+     QH+ESACHI D R
Sbjct  480   STWHEELPQTYIPTNWTTLKRQP-ANRASAMSLQVCPAMTLNSG---QHIESACHISDVR  535

Query  252   GDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
              DHRCLTD DCGVD+TTCRRRSCSMAGYCGLWL I
Sbjct  536   SDHRCLTDNDCGVDATTCRRRSCSMAGYCGLWLFI  570



>ref|XP_008453129.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X1 [Cucumis 
melo]
Length=575

 Score =   911 bits (2354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/542 (81%), Positives = 493/542 (91%), Gaps = 1/542 (0%)
 Frame = -1

Query  1776  ARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGS  1597
             ++R RM +K R+MFYHAY+NYM +AFP+DELKPLTKT+T+SLSELGNLKLEHLPQ Y+GS
Sbjct  32    SKRMRMREKARRMFYHAYDNYMTYAFPNDELKPLTKTFTNSLSELGNLKLEHLPQNYTGS  91

Query  1596  ALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILAT  1417
             ALTLIESLSSLVILGN+TEF+KAVLWLS NL FDVDARINLFECNIRVLGGL+SAH+LAT
Sbjct  92    ALTLIESLSSLVILGNNTEFQKAVLWLSENLHFDVDARINLFECNIRVLGGLISAHVLAT  151

Query  1416  DSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGC  1237
             DSTNRL + +YKNQLL LAEDLG RFLPAF+TPTGLPYAWINLK GV+++ETTETSTSGC
Sbjct  152   DSTNRLAKQSYKNQLLVLAEDLGNRFLPAFNTPTGLPYAWINLKHGVVEDETTETSTSGC  211

Query  1236  GSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGA  1057
             GSLILEMGALSRLTGDP FE AALRALRKLWSMRSSLNLLGTTLDV TGEWIEFS+GIGA
Sbjct  212   GSLILEMGALSRLTGDPRFEYAALRALRKLWSMRSSLNLLGTTLDVETGEWIEFSSGIGA  271

Query  1056  GVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSL  877
             GVDSFYEYL+KA++LFG +EFW+MF +AYLAVQKYFRHGPWYH+ADMRTG+ATYWQLTSL
Sbjct  272   GVDSFYEYLLKAHVLFGKEEFWRMFHTAYLAVQKYFRHGPWYHEADMRTGRATYWQLTSL  331

Query  876   QAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAE  697
             QAFWPG+QVLVGD+ AANSSHREFF+VW+K+GVLPERYLLD QMLHPTEKYYPLRPE AE
Sbjct  332   QAFWPGLQVLVGDIPAANSSHREFFYVWEKYGVLPERYLLDRQMLHPTEKYYPLRPELAE  391

Query  696   STFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCK  517
             STFYLYQATKDPWY EVGE I+ SL  +TKV+GGFASVRDVTTM+LEDHQHSFFL+ETCK
Sbjct  392   STFYLYQATKDPWYFEVGESIMKSLISHTKVEGGFASVRDVTTMQLEDHQHSFFLSETCK  451

Query  516   YLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMS  337
             YLYLLFDDSFLV++NYIFTTEGHPLPVLS+WH+RL E Y  +N TS K E   +R SAMS
Sbjct  452   YLYLLFDDSFLVDQNYIFTTEGHPLPVLSSWHERLPEVYGLTNGTSIKGENSSRRLSAMS  511

Query  336   QRICPATTLSHEQE-YQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGL  160
              ++CPAT+L+   +  Q +ESACHI D R DH+C +DE+CGVDSTTCRRRSCS +GYCG 
Sbjct  512   LQVCPATSLNTAGDGGQQIESACHILDARADHKCFSDEECGVDSTTCRRRSCSSSGYCGQ  571

Query  159   WL  154
             WL
Sbjct  572   WL  573



>ref|XP_010663211.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X2 [Vitis 
vinifera]
Length=551

 Score =   907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/517 (84%), Positives = 479/517 (93%), Gaps = 1/517 (0%)
 Frame = -1

Query  1695  HDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWL  1516
             HDELKPL+KT+TDSLSELGNL LEHL + Y+GSALTLIESLSSLVILGN+TEFE+AV WL
Sbjct  35    HDELKPLSKTFTDSLSELGNLNLEHLSEHYNGSALTLIESLSSLVILGNNTEFERAVRWL  94

Query  1515  SVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFL  1336
             S NLSFDVD R NLFECNIRVLGGLVSAHILATDS NRLVQGTYKN+LL LAEDLGRRFL
Sbjct  95    SENLSFDVDVRTNLFECNIRVLGGLVSAHILATDSRNRLVQGTYKNELLILAEDLGRRFL  154

Query  1335  PAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRAL  1156
             PAFDTPTGLPYAWINLK GVM+NETTETSTSGCGSLILEMGALSRLTGDP +E AALRAL
Sbjct  155   PAFDTPTGLPYAWINLKYGVMENETTETSTSGCGSLILEMGALSRLTGDPRYESAALRAL  214

Query  1155  RKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQS  976
             RKLWSMRSSLNLLGTTLDVATGEWIE+S+GIGAGVDSFYEYL+KA+ILFG +E W+MFQS
Sbjct  215   RKLWSMRSSLNLLGTTLDVATGEWIEYSSGIGAGVDSFYEYLIKAHILFGKEELWRMFQS  274

Query  975   AYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHV  796
             AYLAVQKYFRHGPWYH+ADMRTGKATYWQLTSLQAFWPGVQVL+GD+ AANSSHREF +V
Sbjct  275   AYLAVQKYFRHGPWYHEADMRTGKATYWQLTSLQAFWPGVQVLIGDIAAANSSHREFVYV  334

Query  795   WKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQ  616
             W+KFGVLPERYLLDHQMLHPTEKYYPLRPE AESTFYLYQATKDPWY+EVG+ +++SLN 
Sbjct  335   WEKFGVLPERYLLDHQMLHPTEKYYPLRPELAESTFYLYQATKDPWYIEVGKSMVDSLNL  394

Query  615   YTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPV  436
             Y KV+GGFAS++DVTTM+LEDHQHSFFLAETCKYLYLLFDDSFLV+RNY+FTTEGHPLPV
Sbjct  395   YAKVEGGFASIKDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFLVDRNYVFTTEGHPLPV  454

Query  435   LSTWHDRLSEAYLPSNWTSFKHEKH-RKRASAMSQRICPATTLSHEQEYQHLESACHIPD  259
             +S WHDRL E Y+P+N TS K EK   +R+SAMS ++CPATTL+  +  Q +ESACHIPD
Sbjct  455   ISAWHDRLPENYIPTNGTSIKSEKQAARRSSAMSLQVCPATTLNSGRSSQQVESACHIPD  514

Query  258   TRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
              + DHRCLT+++CGVD+TTCRRRSCSMAGYCGLWL I
Sbjct  515   AQSDHRCLTEDECGVDATTCRRRSCSMAGYCGLWLFI  551



>ref|XP_010678691.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=572

 Score =   905 bits (2339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/574 (77%), Positives = 499/574 (87%), Gaps = 9/574 (2%)
 Frame = -1

Query  1866  RKRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDE  1687
             R  VLI  +IF + F   + S  DP +    ++  M +KVR+MFYHAY+NYM +AFPHDE
Sbjct  7     RTWVLIIFVIFAAIF---NLSQSDPDSHHFRKKILMKEKVRRMFYHAYDNYMKYAFPHDE  63

Query  1686  LKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVN  1507
             LKPLTKT+TDSLSELGNL+LEHLPQ Y+GSALTLIESLSSL+ILGN+TEFE+ V WLS N
Sbjct  64    LKPLTKTFTDSLSELGNLRLEHLPQNYNGSALTLIESLSSLLILGNNTEFERGVSWLSEN  123

Query  1506  LSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAF  1327
             L+FDVDAR+NLFECNIRVLGGLVSAH+LA DS NR  QGTYKN+LL LAEDLGRR LPAF
Sbjct  124   LTFDVDARVNLFECNIRVLGGLVSAHMLAIDSRNRFSQGTYKNELLILAEDLGRRLLPAF  183

Query  1326  DTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKL  1147
              TPTGLPYAWINLK GVM NETTETSTS  GSLILEMGALSRLTGDP FE AALRALRKL
Sbjct  184   STPTGLPYAWINLKYGVMANETTETSTSCSGSLILEMGALSRLTGDPQFEDAALRALRKL  243

Query  1146  WSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYL  967
             WS+RSS+NLLGTT+DV +G+WIE+S+GIGAGVDSFYEYLVKAYILFG +E+W+MFQSAY+
Sbjct  244   WSLRSSMNLLGTTVDVVSGKWIEYSSGIGAGVDSFYEYLVKAYILFGKEEYWRMFQSAYV  303

Query  966   AVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKK  787
             AVQKYFRHGPWYH+ADMRTG ATYWQLTSLQAFWPG+QVLVGD+ AANSSHREF  VW++
Sbjct  304   AVQKYFRHGPWYHEADMRTGHATYWQLTSLQAFWPGLQVLVGDIAAANSSHREFVKVWER  363

Query  786   FGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTK  607
             FGVLPERYLLDHQMLHPTEKYYPLRPE AESTFYLYQATKDPWY+EVGE I +SLN YTK
Sbjct  364   FGVLPERYLLDHQMLHPTEKYYPLRPELAESTFYLYQATKDPWYLEVGESITDSLNLYTK  423

Query  606   VQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLST  427
             V GGFASVRDV+TM LEDHQHSFFL+ETCKYLYLL+DDSFLV++NY+FTTEGHPLPVLS 
Sbjct  424   VDGGFASVRDVSTMVLEDHQHSFFLSETCKYLYLLYDDSFLVDQNYVFTTEGHPLPVLSA  483

Query  426   WHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEY-QHLESACHIPDTRG  250
             W DRL E Y  +N+T  +     +RASAMS +ICPA T S  +E  +  ESACHI DTR 
Sbjct  484   WQDRLPEVYTSANYTFIQ-----RRASAMSLQICPAMTSSTSREVDEKHESACHICDTRR  538

Query  249   DHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
             DHRCLTDEDCGVD+TTCRRRSCS+AG+CGLWL +
Sbjct  539   DHRCLTDEDCGVDATTCRRRSCSIAGFCGLWLYL  572



>ref|XP_004508837.1| PREDICTED: probable alpha-mannosidase I MNS5-like [Cicer arietinum]
Length=569

 Score =   905 bits (2338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/545 (81%), Positives = 500/545 (92%), Gaps = 5/545 (1%)
 Frame = -1

Query  1779  AARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSG  1600
             A ++ RM +KVR MF+HAY+NYM HAFPHDELKPLTKT+TDSLSELGNLKLE LPQ Y G
Sbjct  29    ATKKIRMREKVRNMFHHAYDNYMTHAFPHDELKPLTKTFTDSLSELGNLKLERLPQDYHG  88

Query  1599  SALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILA  1420
             SAL+LIESLSSLVI+GN+TEFEK VLWLS NL+FDVDARINLFECNIRVLGGLVSAH+LA
Sbjct  89    SALSLIESLSSLVIMGNNTEFEKGVLWLSENLTFDVDARINLFECNIRVLGGLVSAHLLA  148

Query  1419  TDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSG  1240
             +DS+ +L QG+YKNQLL LAEDLG+RFLPAF+TPTGLPYAWINLK GVM+NETTETSTSG
Sbjct  149   SDSSKKLFQGSYKNQLLGLAEDLGKRFLPAFNTPTGLPYAWINLKYGVMENETTETSTSG  208

Query  1239  CGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIG  1060
             CGSLILEMGALS++TGDP +E AALRALRKLWSM+SSL L GTTLDV+TG+WIE+S+GIG
Sbjct  209   CGSLILEMGALSKMTGDPRYESAALRALRKLWSMQSSLKLFGTTLDVSTGQWIEYSSGIG  268

Query  1059  AGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTS  880
             AGVDSFYEYL+KA+ILFG ++FW+MF SAY+AVQK+FRHGPWYH+ADMRTG+ATYWQLTS
Sbjct  269   AGVDSFYEYLLKAHILFGKEDFWRMFHSAYVAVQKHFRHGPWYHEADMRTGRATYWQLTS  328

Query  879   LQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFA  700
             LQAFWPG+QVL+GDV AANSSHREFF+VW++FGVLPERYLLDHQMLHPTEKYYPLRPEFA
Sbjct  329   LQAFWPGLQVLIGDVSAANSSHREFFNVWERFGVLPERYLLDHQMLHPTEKYYPLRPEFA  388

Query  699   ESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETC  520
             ESTFYLYQATKDPWY+EVGELI+NSLN YT+V+GGFAS++DVTTM+LEDHQHSFFLAETC
Sbjct  389   ESTFYLYQATKDPWYIEVGELIVNSLNLYTRVEGGFASIKDVTTMQLEDHQHSFFLAETC  448

Query  519   KYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAM  340
             KYLYLLFDDSF++  NY+FTTEGHPLPVLSTWH++L E Y+P+NWT+ K +    R S M
Sbjct  449   KYLYLLFDDSFMLENNYVFTTEGHPLPVLSTWHEKLPETYIPTNWTTLKRQP-ENRVSPM  507

Query  339   SQRICPATTLSHEQEYQHLESACHIPDTR-GDHRCLTDEDCGVDSTTCRRRSCSMAGYCG  163
             S ++CPA TL+     QH+ESACHIPD R  DHRCLTDEDCGVD+TTCRRRSCSMAGYCG
Sbjct  508   SLQVCPAMTLNSG---QHIESACHIPDVRISDHRCLTDEDCGVDATTCRRRSCSMAGYCG  564

Query  162   LWLLI  148
             LWL I
Sbjct  565   LWLFI  569



>ref|XP_010027939.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X3 [Eucalyptus 
grandis]
 ref|XP_010027947.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X3 [Eucalyptus 
grandis]
Length=520

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/521 (84%), Positives = 475/521 (91%), Gaps = 4/521 (1%)
 Frame = -1

Query  1713  MMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFE  1534
             M HAFPHDELKPLTKT+TDSLSELGNLKLEHLPQ Y+GSALTLIESLSSLVILGN+TEFE
Sbjct  1     MTHAFPHDELKPLTKTFTDSLSELGNLKLEHLPQDYNGSALTLIESLSSLVILGNNTEFE  60

Query  1533  KAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAED  1354
             KAV WLS NL FDVDARINLFECNIRVLGGLVSAHILATDST+RLVQG+YKNQLL LA+D
Sbjct  61    KAVFWLSENLRFDVDARINLFECNIRVLGGLVSAHILATDSTDRLVQGSYKNQLLFLAKD  120

Query  1353  LGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEI  1174
             LG RFLPAFDTPTGLPYAWINLK GV  +ETTETSTSGCGSLILEMG LSRLTGDP FE 
Sbjct  121   LGERFLPAFDTPTGLPYAWINLKHGVTADETTETSTSGCGSLILEMGTLSRLTGDPRFES  180

Query  1173  AALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEF  994
             AALRALRKLWSMRSSLNLLGTTLDV TGEWIE+S+GIGAGVDSFYEYL KAYILFG +++
Sbjct  181   AALRALRKLWSMRSSLNLLGTTLDVETGEWIEYSSGIGAGVDSFYEYLFKAYILFGKEDY  240

Query  993   WKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSH  814
             W+MF SAYLAVQKYFRHGPWYH+ADMRTGKATYWQLTSLQAFWPG+QVLVGDV AANS+H
Sbjct  241   WRMFHSAYLAVQKYFRHGPWYHEADMRTGKATYWQLTSLQAFWPGLQVLVGDVAAANSTH  300

Query  813   REFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELI  634
             REF HVWKKFGV+PERYLLDHQM+HPTEKYYPLRPE AESTFYLYQATKDPWY+EVGE +
Sbjct  301   REFVHVWKKFGVIPERYLLDHQMVHPTEKYYPLRPELAESTFYLYQATKDPWYIEVGESM  360

Query  633   INSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTE  454
             +NSLNQYTKV+GGFASVRDVTTM+LEDHQHSFFLAETCKYLYLLFDD FLVN+NY+FTTE
Sbjct  361   VNSLNQYTKVEGGFASVRDVTTMQLEDHQHSFFLAETCKYLYLLFDDQFLVNQNYVFTTE  420

Query  453   GHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPA-TTLSHEQEYQHLES  277
             GHPLPV   W +RL E ++PSNWT  + +K  +RASAMS R+CPA +T SH Q    +ES
Sbjct  421   GHPLPVTRDWQERLPETFIPSNWTFVEADKRTRRASAMSLRLCPASSTPSHGQR---MES  477

Query  276   ACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWL  154
             ACH+PD    HRC TDE+CG+DS+TCRRRSCSMAGYCGLWL
Sbjct  478   ACHVPDAWDSHRCSTDEECGIDSSTCRRRSCSMAGYCGLWL  518



>ref|XP_010532268.1| PREDICTED: probable alpha-mannosidase I MNS5 [Tarenaya hassleriana]
Length=579

 Score =   901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/573 (76%), Positives = 498/573 (87%), Gaps = 6/573 (1%)
 Frame = -1

Query  1863  KRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDEL  1684
             K +L+ ++I  +TF   S S   P   + A++K+M +KVRKMFYHAY+NY+ +AFPHDEL
Sbjct  12    KWILLLLVISYTTFLQPSSSSSSPE--VEAKKKQMREKVRKMFYHAYDNYLTYAFPHDEL  69

Query  1683  KPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNL  1504
             KPLTK++TDSLSELGNLKLEHLP  Y GSALTL+ESLSSL ILGN TEFE+ VLWLS NL
Sbjct  70    KPLTKSFTDSLSELGNLKLEHLPTDYKGSALTLVESLSSLAILGNRTEFERGVLWLSENL  129

Query  1503  SFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFD  1324
             +FDVDAR+NLFECNIRVLGGL+SAH+LA D TNRL+QG+Y NQLL LAEDLGRRFL AFD
Sbjct  130   TFDVDARVNLFECNIRVLGGLISAHLLAIDPTNRLIQGSYDNQLLRLAEDLGRRFLLAFD  189

Query  1323  TPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLW  1144
             TPTGLPYAWINLK GVM+ ETTETSTSGCGSLILEMGALSRLTGDP FE AALRALRKLW
Sbjct  190   TPTGLPYAWINLKNGVMEKETTETSTSGCGSLILEMGALSRLTGDPRFESAALRALRKLW  249

Query  1143  SMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLA  964
             SMRSSLNLLGTTLDV TGEWIE+S+GIGAGVDSFYEYL KAY+LFG +++W+MF +AYLA
Sbjct  250   SMRSSLNLLGTTLDVVTGEWIEYSSGIGAGVDSFYEYLFKAYLLFGKEDYWRMFHTAYLA  309

Query  963   VQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKF  784
             VQKYFRHGPWYH+A+M TGKATYWQLTSLQAFWPG+QVL GDV AANS+HREFFHVW++F
Sbjct  310   VQKYFRHGPWYHEANMWTGKATYWQLTSLQAFWPGLQVLAGDVTAANSTHREFFHVWERF  369

Query  783   GVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKV  604
             GVLPERYLLDHQM+HPTEKYYPLRPEFAESTFYLYQATKDPWY+EVGELI+ SLN YTKV
Sbjct  370   GVLPERYLLDHQMIHPTEKYYPLRPEFAESTFYLYQATKDPWYIEVGELIVKSLNLYTKV  429

Query  603   QGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTW  424
             +GGFASV+DVTTM+LEDHQHSFFLAETCKYLYLLFDDSF+  +NY+FTTEGHP+ + S+W
Sbjct  430   EGGFASVKDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFMAKKNYVFTTEGHPIQISSSW  489

Query  423   HDRLSEAYLPSNWTSFKHEK-HRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGD  247
             H+RL E+YL +NWT  K E    +R SAMS ++CPA   +  Q+   +ESACH+ D    
Sbjct  490   HERLPESYLSANWTFSKGETWGGRRVSAMSLQVCPALGTASGQQ---VESACHVRDALSS  546

Query  246   HRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
             HRCL DEDCGVD+ TCRRR CS AGYCGLW+ +
Sbjct  547   HRCLGDEDCGVDAMTCRRRHCSAAGYCGLWIAM  579



>ref|XP_010091047.1| putative alpha-mannosidase I MNS5 [Morus notabilis]
 gb|EXB42065.1| putative alpha-mannosidase I MNS5 [Morus notabilis]
Length=569

 Score =   899 bits (2323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/573 (77%), Positives = 498/573 (87%), Gaps = 12/573 (2%)
 Frame = -1

Query  1863  KRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDEL  1684
             K VL+ ++I +S F  +S S  DP    AA+++RM +KVRKMFYHAY+NYM+HAFPHDEL
Sbjct  8     KWVLLLLVISMSVF-ELSSSKADPR--WAAKKRRMREKVRKMFYHAYDNYMVHAFPHDEL  64

Query  1683  KPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNL  1504
             KP+TKT+TDSLSELGNLK   L      S + L     SLVI+GN+TEFE+AVLWLS NL
Sbjct  65    KPITKTFTDSLSELGNLKCNKLGVMDHHSDVKLF--FDSLVIMGNNTEFERAVLWLSDNL  122

Query  1503  SFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFD  1324
              F+VDARINLFECNIRVLGGLVSAH+LATDST+RLV+G YKNQ+L LAEDLGRRFLPAF+
Sbjct  123   KFNVDARINLFECNIRVLGGLVSAHMLATDSTSRLVKGAYKNQMLSLAEDLGRRFLPAFN  182

Query  1323  TPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLW  1144
             TPTGLPYAWINLK GVM+NETTETSTSGCGSLILEMGALSRLTGDP +E AALRALRKLW
Sbjct  183   TPTGLPYAWINLKYGVMENETTETSTSGCGSLILEMGALSRLTGDPRYESAALRALRKLW  242

Query  1143  SMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLA  964
             SMRSSLNL GTTLDV TGEWIE+S+GIGAGVDSFYEYL KA+I+FG +EFWKMF  AY+A
Sbjct  243   SMRSSLNLFGTTLDVVTGEWIEYSSGIGAGVDSFYEYLFKAHIVFGKEEFWKMFHLAYVA  302

Query  963   VQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKF  784
             VQKYFRHGPWYH+ADMRTGKATYWQLTSLQAFWPG+Q        ANSSHR+FFHVW+KF
Sbjct  303   VQKYFRHGPWYHEADMRTGKATYWQLTSLQAFWPGLQA------TANSSHRKFFHVWEKF  356

Query  783   GVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKV  604
             GV+PERYLLDHQMLHPTEKYYPLRPE AESTFYLYQATKDPWY+EVGE I+NSLN +TKV
Sbjct  357   GVIPERYLLDHQMLHPTEKYYPLRPELAESTFYLYQATKDPWYIEVGETIVNSLNAHTKV  416

Query  603   QGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTW  424
             +GGFASVRDVTTM+LEDHQHSFFLAETCKYL+LLFDDSFL  +NYIFTTEGHPLPVLS W
Sbjct  417   EGGFASVRDVTTMQLEDHQHSFFLAETCKYLFLLFDDSFLAEQNYIFTTEGHPLPVLSAW  476

Query  423   HDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTL-SHEQEYQHLESACHIPDTRGD  247
             HDRL EAY+P+NW+  K E+  ++AS+MS ++CPATTL + E   Q +ESACH+PD R D
Sbjct  477   HDRLPEAYIPTNWSFVKKERLVRQASSMSLQVCPATTLNTGEHGGQWVESACHVPDARSD  536

Query  246   HRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
             HRC+ DEDCG+DSTTCRRRSCS+AGYCG WL +
Sbjct  537   HRCIADEDCGIDSTTCRRRSCSIAGYCGPWLFL  569



>ref|XP_006836746.1| hypothetical protein AMTR_s00088p00147420 [Amborella trichopoda]
 gb|ERM99599.1| hypothetical protein AMTR_s00088p00147420 [Amborella trichopoda]
Length=579

 Score =   890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/581 (75%), Positives = 505/581 (87%), Gaps = 6/581 (1%)
 Frame = -1

Query  1887  PKSFRIMRKRVLICMLIF-LSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYM  1711
             P+   ++R+ V +C++   L   F MS    D  + +AA+RK +SQ+ RKMFYHAY+NY+
Sbjct  4     PRFTNLVRRWVPLCIITLPLLCGFAMS----DFNDHIAAKRKYLSQEARKMFYHAYDNYL  59

Query  1710  MHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEK  1531
              +AFPHDELKPL+K++TDSLSELGNLKLEHLPQ Y+GSALTLIESLSSLV++GN+TEFE+
Sbjct  60    TYAFPHDELKPLSKSFTDSLSELGNLKLEHLPQSYNGSALTLIESLSSLVVMGNNTEFER  119

Query  1530  AVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDL  1351
             AVLWLS NL+FDVDARI+LFECNIRVLGGLVSAH+LATDS+ RL QG Y N+LLDLA DL
Sbjct  120   AVLWLSENLTFDVDARISLFECNIRVLGGLVSAHLLATDSSKRLSQGKYNNELLDLANDL  179

Query  1350  GRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIA  1171
             GRRFL AF+T TGLPYAWINLK GVM++ETTETSTSGCGSLILEMGALSRLTG+PI++ A
Sbjct  180   GRRFLWAFNTSTGLPYAWINLKHGVMEDETTETSTSGCGSLILEMGALSRLTGNPIYDAA  239

Query  1170  ALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFW  991
             ALRALRKLWSMRSSLNLLGTTLDV TGEW+E+S+GIGAG+DSFYEYL+KAYILFG DEFW
Sbjct  240   ALRALRKLWSMRSSLNLLGTTLDVETGEWLEYSSGIGAGIDSFYEYLLKAYILFGRDEFW  299

Query  990   KMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHR  811
              MF S+YLAVQK+FRHGPWYH+ADMRTGKATYWQLTSLQAFWPG+QVLVGD+ AAN +HR
Sbjct  300   HMFHSSYLAVQKHFRHGPWYHEADMRTGKATYWQLTSLQAFWPGLQVLVGDIPAANLTHR  359

Query  810   EFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELII  631
             EFF+VWK+FGVLPERYLLD  MLHPTEKYYPLRPE AEST YLYQATKDPWY++VGE I+
Sbjct  360   EFFYVWKRFGVLPERYLLDRAMLHPTEKYYPLRPELAESTLYLYQATKDPWYIDVGESIM  419

Query  630   NSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEG  451
              SLN YTKV GGFAS+RDV+TM+LEDHQHSFFLAETCKYLYLLFD SFL + NY+FTTEG
Sbjct  420   KSLNMYTKVDGGFASIRDVSTMQLEDHQHSFFLAETCKYLYLLFDSSFLASENYVFTTEG  479

Query  450   HPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESAC  271
             HPLPV S+WHD L +  +P++ TS K      ++SA+S +ICPA  L+  +E Q +ESAC
Sbjct  480   HPLPVRSSWHDWLPDVSMPTDVTSVKINNLSTKSSALSSQICPA-LLATLKEDQPVESAC  538

Query  270   HIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
             HI D R  HRC + E+CG+DSTTCR+RSCS+AGYCGLWLLI
Sbjct  539   HIHDGRASHRCESHEECGIDSTTCRQRSCSLAGYCGLWLLI  579



>ref|XP_002890731.1| glycoside hydrolase family 47 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66990.1| glycoside hydrolase family 47 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=574

 Score =   890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/570 (74%), Positives = 495/570 (87%), Gaps = 7/570 (1%)
 Frame = -1

Query  1863  KRVLICMLIFLSTFFPMSFSGFDPPNP-MAARRKRMSQKVRKMFYHAYENYMMHAFPHDE  1687
             KR+ +C+LI L+ F        DP +  +  ++K+M +KVR+MFYHAY+NYM +AFPHDE
Sbjct  8     KRLFLCLLISLAFFV------VDPSSQHLEVKKKQMREKVREMFYHAYDNYMTYAFPHDE  61

Query  1686  LKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVN  1507
             LKPLTK++TDSLSELGNLKLEHLP  Y+GSA+TL+ESLSSL ILGN TEFEK +LWLS N
Sbjct  62    LKPLTKSFTDSLSELGNLKLEHLPTDYNGSAVTLVESLSSLAILGNSTEFEKGILWLSEN  121

Query  1506  LSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAF  1327
             L+FD+DAR+NLFECNIRVLGGL+SAH+LA D TNRL+QG+Y NQLL LAEDLG+RFLPAF
Sbjct  122   LTFDIDARVNLFECNIRVLGGLISAHLLAIDPTNRLIQGSYNNQLLRLAEDLGKRFLPAF  181

Query  1326  DTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKL  1147
             +TPTGLPYAWINLK GVM+NETTETSTSGCGSLILEMG+LSRLTGDP FE AALRALR+L
Sbjct  182   ETPTGLPYAWINLKNGVMENETTETSTSGCGSLILEMGSLSRLTGDPRFESAALRALRQL  241

Query  1146  WSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYL  967
             W MRSSL+LLGTTLDV TGEWIE+S+ IGAGVDSFYEYL+KAYILFG +++W+MF+SAY+
Sbjct  242   WRMRSSLDLLGTTLDVVTGEWIEYSSSIGAGVDSFYEYLLKAYILFGKEDYWRMFRSAYM  301

Query  966   AVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKK  787
             A QKYFRHGPWYH+A+M +GK TYWQLTSLQAFWPG+QVLVGD+ AANSSHREFFHVW+K
Sbjct  302   ASQKYFRHGPWYHEANMWSGKPTYWQLTSLQAFWPGLQVLVGDIAAANSSHREFFHVWEK  361

Query  786   FGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTK  607
             FGVLPERYLLDHQ++HPT KYYPLRPE AESTFYLYQATKDPWY++VGE I+ SLN YTK
Sbjct  362   FGVLPERYLLDHQIIHPTMKYYPLRPELAESTFYLYQATKDPWYLDVGETIVKSLNLYTK  421

Query  606   VQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLST  427
             V GGFASVRDVTTM+LEDHQHSFFLAETCKYLYLLFDDSF+  RNYIFTTEGHP+ V+S+
Sbjct  422   VPGGFASVRDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFVAKRNYIFTTEGHPIQVVSS  481

Query  426   WHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGD  247
             WH++L E Y   NWT  K      RASA+S ++CP+  L+  +  QH ESACH+PD + +
Sbjct  482   WHEKLPENYFSGNWTLSKSGSWESRASALSLQVCPSIALNSRRPKQHRESACHVPDEQIN  541

Query  246   HRCLTDEDCGVDSTTCRRRSCSMAGYCGLW  157
             H+C ++++CGVD+TTCR R+CS  GYCGLW
Sbjct  542   HKCWSNKECGVDATTCRLRTCSGVGYCGLW  571



>ref|XP_006415751.1| hypothetical protein EUTSA_v10007201mg [Eutrema salsugineum]
 gb|ESQ34104.1| hypothetical protein EUTSA_v10007201mg [Eutrema salsugineum]
Length=575

 Score =   890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/570 (74%), Positives = 493/570 (86%), Gaps = 6/570 (1%)
 Frame = -1

Query  1863  KRVLICMLIFLSTFF-PMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDE  1687
             K V +C LI  + F  P S    D      A++K+M +KVR+MFYHAY+NYM +AFPHDE
Sbjct  8     KHVFLCFLISFAFFIDPSSLQRLDD-----AKKKQMREKVREMFYHAYDNYMTYAFPHDE  62

Query  1686  LKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVN  1507
             LKPLTK++TDSLSELGNLKLEHLP  YSGSA+TL+ESLSSL ILGN TEFEK + WLS N
Sbjct  63    LKPLTKSFTDSLSELGNLKLEHLPTDYSGSAVTLVESLSSLAILGNKTEFEKGIHWLSEN  122

Query  1506  LSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAF  1327
             L+FD+DAR+NLFECNIR+LGGL+SAH+LA D TNRL+QG+Y NQLL L+EDLG+RFLPAF
Sbjct  123   LTFDIDARVNLFECNIRLLGGLISAHLLAIDPTNRLIQGSYNNQLLRLSEDLGKRFLPAF  182

Query  1326  DTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKL  1147
             +TPTGLPYAWINLK GVM+NETTETSTSGCGSLILEMGALSRLTGDP FE AALRALR+L
Sbjct  183   ETPTGLPYAWINLKNGVMENETTETSTSGCGSLILEMGALSRLTGDPRFESAALRALRQL  242

Query  1146  WSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYL  967
             W MRSSL+LLGTTLDV TG+W+E+S+ IGAGVDSFYEYL+KAYILFG +++W+MF+SAYL
Sbjct  243   WRMRSSLDLLGTTLDVVTGKWLEYSSSIGAGVDSFYEYLLKAYILFGKEDYWRMFRSAYL  302

Query  966   AVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKK  787
             A QKYFRHGPWYH+A+M +GK TYWQLTSLQAFWPG+QVLVGD+ AANSSHREFFHVW++
Sbjct  303   ASQKYFRHGPWYHEANMWSGKPTYWQLTSLQAFWPGLQVLVGDIAAANSSHREFFHVWER  362

Query  786   FGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTK  607
             FGVLPERYLLDHQM+HPTEKYYPLRPE AESTFYLYQATKDPWY++VGE ++ SLN YTK
Sbjct  363   FGVLPERYLLDHQMIHPTEKYYPLRPELAESTFYLYQATKDPWYLDVGETMVKSLNLYTK  422

Query  606   VQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLST  427
             V GGFASVRDVTTM+LEDHQHSFFLAETCKYLYLLFDDSF+  RNYIFTTEGHP+ V+S+
Sbjct  423   VAGGFASVRDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFVAKRNYIFTTEGHPIQVMSS  482

Query  426   WHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGD  247
             WH++L E+Y   NWT  K      RASA+S ++CP+   +  +  QH ESACH+PD + D
Sbjct  483   WHEKLPESYFSGNWTFSKSGAWESRASALSMQVCPSIAPNSRRPEQHRESACHVPDEKMD  542

Query  246   HRCLTDEDCGVDSTTCRRRSCSMAGYCGLW  157
             HRC ++++CGVD+TTCR+RSCS  G+CGLW
Sbjct  543   HRCWSNKECGVDATTCRQRSCSGVGFCGLW  572



>gb|KHN18487.1| Putative alpha-mannosidase I MNS5 [Glycine soja]
Length=570

 Score =   885 bits (2286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/555 (76%), Positives = 487/555 (88%), Gaps = 7/555 (1%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLK  1630
             F+  +  +P AA++KRM  KVR MFYHAY+NYM HAFPHDELKP++KT+T+SLSELGNLK
Sbjct  22    FTISESQSPWAAKKKRMRDKVRNMFYHAYDNYMTHAFPHDELKPISKTFTNSLSELGNLK  81

Query  1629  LEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVL  1450
             LEHLPQ Y+GSALTLIESLSSLVI+GN+TEFE+AVLWLS NL+FDVDARINLFECNIRVL
Sbjct  82    LEHLPQDYNGSALTLIESLSSLVIMGNNTEFERAVLWLSENLTFDVDARINLFECNIRVL  141

Query  1449  GGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQ  1270
             GGLVSAH+LA+DS+ +L QG YKNQLL LAEDLG+RFLPAFDTPTGLPYAWINLK GVM+
Sbjct  142   GGLVSAHLLASDSSKKLFQGAYKNQLLALAEDLGKRFLPAFDTPTGLPYAWINLKYGVME  201

Query  1269  NettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATG  1090
             NETTETSTSGCGSLILEMGALS++TGDPI+E  ALRALRKLWSM+SSL L GTTLDVATG
Sbjct  202   NETTETSTSGCGSLILEMGALSKMTGDPIYESVALRALRKLWSMQSSLKLFGTTLDVATG  261

Query  1089  EWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRT  910
             +WIE+S+GIGAGVDSFYEYL+KA+ILFG ++FWKMF SAY+AVQKYFRHGPWYH      
Sbjct  262   QWIEYSSGIGAGVDSFYEYLLKAHILFGKEDFWKMFHSAYVAVQKYFRHGPWYH---TNC  318

Query  909   GKATYWQLTSLQAF-WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPT  733
                 ++ + S+  + +   +VL+GDV AANSSHREFFHVWK +GVLPERYLLD+QMLHPT
Sbjct  319   KSRCFFVMLSIAVYLYSTYKVLIGDVIAANSSHREFFHVWKNYGVLPERYLLDYQMLHPT  378

Query  732   EKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELED  553
             EKYYPLRPE AESTFYLYQATKDPWY+EVGE I+NSLN YTKV+GGFAS++DVTTM+LED
Sbjct  379   EKYYPLRPELAESTFYLYQATKDPWYIEVGESIVNSLNLYTKVEGGFASIKDVTTMQLED  438

Query  552   HQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFK  373
             HQHSFFLAETCKYLYLLFDDSF+   NY+FTTEGHPLPVLSTWH+ L EAY+P+NWT  K
Sbjct  439   HQHSFFLAETCKYLYLLFDDSFVHENNYVFTTEGHPLPVLSTWHEELPEAYIPTNWTFVK  498

Query  372   HEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRR  193
              +    R SAMS ++CPA  L   +  QH+ESACHIPD R ++RCLTDEDCGVD+TTCRR
Sbjct  499   RQPRVNRISAMSLQVCPAMNL---KSGQHIESACHIPDARSNYRCLTDEDCGVDATTCRR  555

Query  192   RSCSMAGYCGLWLLI  148
             RSCSMAGYCGLWL+I
Sbjct  556   RSCSMAGYCGLWLII  570



>emb|CDX84922.1| BnaC05g21330D [Brassica napus]
Length=650

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/569 (73%), Positives = 485/569 (85%), Gaps = 5/569 (1%)
 Frame = -1

Query  1863  KRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDEL  1684
             K V IC LI  + F   S    D       ++++M +KVR+MFYHAY+NYM +AFPHDEL
Sbjct  84    KHVYICFLISFAFFIDPSSQHVDD-----VKKQQMREKVREMFYHAYDNYMTYAFPHDEL  138

Query  1683  KPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNL  1504
             KP+TK++TDSLSELGNLKLEHLP  Y+GSA+TL+ESLSSL I GN TEFEK VLWLS NL
Sbjct  139   KPITKSFTDSLSELGNLKLEHLPTDYNGSAVTLVESLSSLAIFGNKTEFEKGVLWLSENL  198

Query  1503  SFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFD  1324
              FDVD R+NLFECNIR+LGGL+SAH+LA D TNRL+QG+Y NQLL LAEDLG+RFLPAF+
Sbjct  199   KFDVDVRVNLFECNIRLLGGLISAHLLAIDPTNRLIQGSYDNQLLRLAEDLGKRFLPAFE  258

Query  1323  TPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLW  1144
             TPTG+PYAWIN K+GVM+NETTETSTSGCGSLILEMGALSRLTGDP FE AALR LR+LW
Sbjct  259   TPTGIPYAWINFKKGVMENETTETSTSGCGSLILEMGALSRLTGDPRFESAALRTLRQLW  318

Query  1143  SMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLA  964
              MRSSL+LLGTTLDV TGEW+E+S+GIGAGVDSFYEYL+KAYILFG +++W+MF+SAYLA
Sbjct  319   RMRSSLDLLGTTLDVVTGEWLEYSSGIGAGVDSFYEYLMKAYILFGKEDYWRMFRSAYLA  378

Query  963   VQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKF  784
              QKYFR+GPWYH+A+M +GK TYWQLTSLQAFWPG+QVLVGDV AANSSHREFFH W+KF
Sbjct  379   SQKYFRYGPWYHEANMWSGKPTYWQLTSLQAFWPGLQVLVGDVAAANSSHREFFHAWEKF  438

Query  783   GVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKV  604
             GV+PERYLLDHQM+HPTE+YYPLRPE AESTFYLYQATKDPWY++VGE ++ SLN+YTKV
Sbjct  439   GVIPERYLLDHQMIHPTERYYPLRPELAESTFYLYQATKDPWYLDVGEAMVKSLNRYTKV  498

Query  603   QGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTW  424
              GGFASVRDVTTM+LEDHQHSFFLAETCKYLYLLFDDSF+  RNYIFTTEGHPL V+S+W
Sbjct  499   AGGFASVRDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFVAKRNYIFTTEGHPLQVMSSW  558

Query  423   HDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGDH  244
             HD+L E+Y   NWT  K       ASAMS ++CP+   +     QH ES CH+PD + DH
Sbjct  559   HDKLPESYFSGNWTFSKSGAWESGASAMSMKVCPSIAPNSRLHEQHRESVCHVPDQKIDH  618

Query  243   RCLTDEDCGVDSTTCRRRSCSMAGYCGLW  157
             +C ++ DCGVD+TTCR+RSCS  G+CGLW
Sbjct  619   KCWSNRDCGVDATTCRQRSCSEVGFCGLW  647



>ref|XP_010913486.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X1 [Elaeis 
guineensis]
Length=575

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/538 (80%), Positives = 484/538 (90%), Gaps = 2/538 (0%)
 Frame = -1

Query  1761  MSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLI  1582
             M +KVRKMFYHAYENYM HAFPHDELKPLTKT+TDSLSELGNLKLE+LPQ Y+GSAL+LI
Sbjct  39    MREKVRKMFYHAYENYMAHAFPHDELKPLTKTFTDSLSELGNLKLEYLPQNYNGSALSLI  98

Query  1581  ESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNR  1402
             ESLSSLV+LGN TEF++ VLWLS NL+FDVDAR+NLFECNIRVLGGL+SAHILATD+ +R
Sbjct  99    ESLSSLVVLGNFTEFQRGVLWLSDNLTFDVDARVNLFECNIRVLGGLISAHILATDTKSR  158

Query  1401  LVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLIL  1222
             L  G YKNQLL+LAEDLG+RFLPAFD+PTGLPYAWINLK GVM+NETTETSTSGCGSLIL
Sbjct  159   LDHGLYKNQLLNLAEDLGQRFLPAFDSPTGLPYAWINLKNGVMENETTETSTSGCGSLIL  218

Query  1221  EMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSF  1042
             EMGALSRLTGD  +E  ALRALRKLWSMRSSLNLLGTTLDV TGEWIE S+GIGAGVDSF
Sbjct  219   EMGALSRLTGDSKYEAVALRALRKLWSMRSSLNLLGTTLDVVTGEWIECSSGIGAGVDSF  278

Query  1041  YEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWP  862
             YEYL+KAYILFG DE+W +F SAYLAVQKYFRHGPWYH+ADMRTG+ATYWQLTSLQAFWP
Sbjct  279   YEYLIKAYILFGSDEYWDIFHSAYLAVQKYFRHGPWYHEADMRTGRATYWQLTSLQAFWP  338

Query  861   GVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYL  682
             G+Q+LVGD+ AANSSHREFFHVW++FGVLPERYLLDH MLHPTE+YYPLRPE AESTFYL
Sbjct  339   GLQILVGDIAAANSSHREFFHVWQRFGVLPERYLLDHDMLHPTERYYPLRPELAESTFYL  398

Query  681   YQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLL  502
             YQATKDPWYMEVGE IINSLN Y KV GGFAS+RDV TM+ EDHQHSFFL+ETCKYLYLL
Sbjct  399   YQATKDPWYMEVGESIINSLNSYAKVDGGFASIRDVMTMQQEDHQHSFFLSETCKYLYLL  458

Query  501   FDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICP  322
             FDDSFL ++NY+FTTEGH LP+ S+WH++L E+Y+ SNWTS K+      ASAMS ++CP
Sbjct  459   FDDSFLADKNYVFTTEGHLLPIRSSWHEKLPESYI-SNWTSIKNGNQGTHASAMSLQVCP  517

Query  321   ATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
             A  +        +ESACH+PD+R DHRC+TD+DCG+DSTTCRRR+CSMAGYCGLWL I
Sbjct  518   AMFIGGNIT-PWVESACHVPDSRVDHRCITDDDCGIDSTTCRRRTCSMAGYCGLWLFI  574



>gb|KFK44632.1| hypothetical protein AALP_AA1G284100 [Arabis alpina]
Length=576

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/569 (73%), Positives = 493/569 (87%), Gaps = 3/569 (1%)
 Frame = -1

Query  1863  KRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDEL  1684
              R+L   L+ +S+   +SF+ F     +  ++++M +KVRKMFYHAY+NYM +AFPHDEL
Sbjct  8     NRILFLFLLIISS---VSFADFSSQQHLHVKKQQMREKVRKMFYHAYDNYMTYAFPHDEL  64

Query  1683  KPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNL  1504
             KPLTK++TDSLSELGNLKLEHLP  Y+GSA+TL+ESLSSL ILGN+TEFEK VLWLS NL
Sbjct  65    KPLTKSFTDSLSELGNLKLEHLPTDYNGSAVTLVESLSSLAILGNNTEFEKGVLWLSENL  124

Query  1503  SFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFD  1324
             +FD+DAR+NLFECNIRVLGGL+SAH+LA D TNRL+QG+Y NQLL L+EDLGRRFLPAF+
Sbjct  125   TFDIDARVNLFECNIRVLGGLISAHLLAIDPTNRLIQGSYNNQLLRLSEDLGRRFLPAFE  184

Query  1323  TPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLW  1144
             TPTGLPYAWINLK GVM+NETTETSTSGCGSLILEMGALSRLTGDP FE AALRALR+LW
Sbjct  185   TPTGLPYAWINLKNGVMENETTETSTSGCGSLILEMGALSRLTGDPRFESAALRALRQLW  244

Query  1143  SMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLA  964
              MRS L+LLGTTLDV TGEW+E+S+ IGAGVDSFYEYL+KAY+LFG +++W+MF++AYLA
Sbjct  245   RMRSPLDLLGTTLDVVTGEWLEYSSSIGAGVDSFYEYLLKAYLLFGKEDYWQMFRTAYLA  304

Query  963   VQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKF  784
              QKYFRHGPWYH+A+M +G+ TYWQLTSLQAFWPG+QVLVGDV AAN+SHREFFHVW+KF
Sbjct  305   SQKYFRHGPWYHEANMWSGEPTYWQLTSLQAFWPGLQVLVGDVAAANASHREFFHVWEKF  364

Query  783   GVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKV  604
             GVLPERYLLDHQM+HPTEKYYPLRPE AESTFYLYQATKDPWY++VGE ++ SLN YTKV
Sbjct  365   GVLPERYLLDHQMIHPTEKYYPLRPELAESTFYLYQATKDPWYLDVGESMVKSLNLYTKV  424

Query  603   QGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTW  424
              GGFASVRDVTTM+LEDHQHSFFLAETCKYLYLLFDDSF+  +NYIFTTEGHP+ V S+W
Sbjct  425   AGGFASVRDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFVAKKNYIFTTEGHPIQVTSSW  484

Query  423   HDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGDH  244
             H++L E++   NWTS K      +ASA+S R+CP+  L+     Q  ESACH+PD +  H
Sbjct  485   HEKLPESFFSGNWTSSKSGAWESQASALSMRVCPSMALNSRHPEQQRESACHVPDEQISH  544

Query  243   RCLTDEDCGVDSTTCRRRSCSMAGYCGLW  157
             +C ++++CGVD+T+CR+R CS  G+CGLW
Sbjct  545   KCWSNKECGVDATSCRQRICSGVGFCGLW  573



>ref|NP_564288.1| putative alpha-mannosidase I MNS5 [Arabidopsis thaliana]
 sp|Q9SXC9.1|MNS5_ARATH RecName: Full=Probable alpha-mannosidase I MNS5 [Arabidopsis 
thaliana]
 gb|AAD45990.1|AC005916_2 Similar to gb|U04299 mannosyl-oligosaccharide alpha-1,2-mannosidase 
from Mus musculus. ESTs gb|R84145 and gb|AA394707 come 
from this gene [Arabidopsis thaliana]
 gb|AAL08238.1| At1g27520/T17H3_2 [Arabidopsis thaliana]
 gb|AEE30841.1| putative alpha-mannosidase I MNS5 [Arabidopsis thaliana]
Length=574

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/573 (73%), Positives = 493/573 (86%), Gaps = 7/573 (1%)
 Frame = -1

Query  1872  IMRKRVLICMLIFLSTFFPMSFSGFDPPNP-MAARRKRMSQKVRKMFYHAYENYMMHAFP  1696
             I  +R+ +C+LI L TFF +     DP +  +  ++K+M +KVR+MFYHAY+NYM +AFP
Sbjct  5     IHPRRLFLCLLISL-TFFVV-----DPSSQHIEVKKKQMREKVREMFYHAYDNYMTYAFP  58

Query  1695  HDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWL  1516
             HDELKPLTK++TDSLSELGNLKLEHLP  Y+GSA+TL+ESLSSL ILGN TEFEK VLWL
Sbjct  59    HDELKPLTKSFTDSLSELGNLKLEHLPTDYNGSAVTLVESLSSLAILGNSTEFEKGVLWL  118

Query  1515  SVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFL  1336
             S NL+FD+DAR+NLFECNIRVLGGL+SAH+LA D  NRL+QG+Y NQLL LAEDLG+RFL
Sbjct  119   SENLTFDIDARVNLFECNIRVLGGLISAHLLAIDPNNRLIQGSYNNQLLRLAEDLGKRFL  178

Query  1335  PAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRAL  1156
             PAF+TPTGLPYAWINLK GVM+NETTETSTSGCGSL+LEMGALSRLTGDP FE AALRAL
Sbjct  179   PAFETPTGLPYAWINLKNGVMENETTETSTSGCGSLVLEMGALSRLTGDPRFESAALRAL  238

Query  1155  RKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQS  976
             R+LW MRSSL+LLGTTLDV TGEWIE+S+ IGAGVDSFYEYL+KAYILFG +++W+MF S
Sbjct  239   RQLWRMRSSLDLLGTTLDVVTGEWIEYSSSIGAGVDSFYEYLLKAYILFGKEDYWRMFHS  298

Query  975   AYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHV  796
             AYLA QKYFRHGPWYH+A+M +GK TYWQLTSLQAFWPG+QVLVGD+ AANSSHREFFHV
Sbjct  299   AYLASQKYFRHGPWYHEANMWSGKPTYWQLTSLQAFWPGLQVLVGDIAAANSSHREFFHV  358

Query  795   WKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQ  616
             W+KFGVLPERYLLDHQ++HPT KYYPLRPE AESTFYLYQATKDPWY++VGE ++ SLN 
Sbjct  359   WEKFGVLPERYLLDHQIIHPTMKYYPLRPELAESTFYLYQATKDPWYLDVGESMVKSLNL  418

Query  615   YTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPV  436
             YTKV GGFASVRDVTTM+LEDHQHSFFLAETCKYLYLLFDDSF+  RNYIFTTEGHP+ V
Sbjct  419   YTKVPGGFASVRDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFVAKRNYIFTTEGHPIQV  478

Query  435   LSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDT  256
             +S+WH++L E Y   NWT  K      RASA+S ++CP  +L+     Q  ESACH+ D 
Sbjct  479   VSSWHEKLPETYFSGNWTLSKSGAWESRASALSLQVCPLISLNSRHPEQQRESACHVLDE  538

Query  255   RGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLW  157
             + +H+C ++++CGVD+TTCR R+CS  GYCGLW
Sbjct  539   QINHKCWSNKECGVDATTCRLRTCSGVGYCGLW  571



>ref|XP_006307064.1| hypothetical protein CARUB_v10008651mg [Capsella rubella]
 gb|EOA39962.1| hypothetical protein CARUB_v10008651mg [Capsella rubella]
Length=595

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/542 (76%), Positives = 480/542 (89%), Gaps = 0/542 (0%)
 Frame = -1

Query  1782  MAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYS  1603
             +  ++K M +KVR+MFYHAY+NYM +AFPHDELKPLTK++TDSLSELGNLKLEHLP  Y+
Sbjct  51    LEVKKKLMREKVREMFYHAYDNYMTYAFPHDELKPLTKSFTDSLSELGNLKLEHLPTDYN  110

Query  1602  GSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHIL  1423
             GSA+TL+ESLSSL ILGN +EFEK V WLS NL+FD+DAR+NLFECNIRVLGGL+SAH+L
Sbjct  111   GSAVTLVESLSSLAILGNSSEFEKGVHWLSDNLTFDIDARVNLFECNIRVLGGLISAHLL  170

Query  1422  ATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstS  1243
             A D TNRL+QG+Y NQLL LAEDLG+RFLPAF+TPTGLPYAWINLK GVM+NETTETSTS
Sbjct  171   AIDPTNRLIQGSYNNQLLRLAEDLGKRFLPAFETPTGLPYAWINLKNGVMENETTETSTS  230

Query  1242  GCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGI  1063
             GCGSLILEMGALSRLTGDP FE AALRALR+LW MRSSL+LLGTTLDV TGEW+E+S+ I
Sbjct  231   GCGSLILEMGALSRLTGDPRFESAALRALRQLWRMRSSLDLLGTTLDVVTGEWLEYSSSI  290

Query  1062  GAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLT  883
             GAGVDSFYEYL+KAYILFG +++W+MF SAYLA QKYFRHGPWYH+A+M +GK TYWQLT
Sbjct  291   GAGVDSFYEYLLKAYILFGKEDYWRMFSSAYLASQKYFRHGPWYHEANMWSGKPTYWQLT  350

Query  882   SLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEF  703
             SLQAFWPG+QVL GD+ AANSSHREFFHVW+KFGVLPERYLLDHQM+HPT KYYPLRPE 
Sbjct  351   SLQAFWPGLQVLTGDIAAANSSHREFFHVWEKFGVLPERYLLDHQMIHPTMKYYPLRPEL  410

Query  702   AESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAET  523
             AESTFYLYQATKDPWY++VGE ++ SLN YTKV GGFASVRDVTTM+LEDHQHSFFLAET
Sbjct  411   AESTFYLYQATKDPWYLDVGETMVKSLNLYTKVPGGFASVRDVTTMQLEDHQHSFFLAET  470

Query  522   CKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASA  343
             CKYLYLLFDDSF+  RNYIFTTEGHP+ V+S+WH++L + Y+  NWT  K  +   RASA
Sbjct  471   CKYLYLLFDDSFVAKRNYIFTTEGHPIQVVSSWHEKLPKNYISGNWTLSKRGEWEGRASA  530

Query  342   MSQRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCG  163
             +S ++CP+  L+  +  QH ESACH+PD + +HRC ++++CGVD+TTCR+RSCS  GYCG
Sbjct  531   LSLQVCPSIALNSRRPEQHRESACHVPDEKTNHRCWSNKECGVDATTCRQRSCSGVGYCG  590

Query  162   LW  157
             LW
Sbjct  591   LW  592



>ref|XP_010499236.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X2 [Camelina 
sativa]
Length=588

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/570 (73%), Positives = 491/570 (86%), Gaps = 3/570 (1%)
 Frame = -1

Query  1866  RKRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDE  1687
             +KR+ +C+L+ L+ F  +  +       +  ++K M +KVR+MFYHAY+NYM +AFPHDE
Sbjct  19    KKRLFLCLLVSLAFFLVVVDT--SSQQHLEVKKKLMREKVRQMFYHAYDNYMAYAFPHDE  76

Query  1686  LKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVN  1507
             LKPLTK++TDSLSELGNLKLEHLP  Y+GSA+TL+ESLSSL ILGN +EFEK V WLS N
Sbjct  77    LKPLTKSFTDSLSELGNLKLEHLPTDYNGSAVTLVESLSSLAILGNSSEFEKGVHWLSDN  136

Query  1506  LSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAF  1327
             L FD+DAR+NLFECNIRVLGGL+SAH+LA D TNRL+QG+Y NQLL LAEDLG+RFLPAF
Sbjct  137   LIFDIDARVNLFECNIRVLGGLISAHLLAIDPTNRLIQGSYNNQLLQLAEDLGKRFLPAF  196

Query  1326  DTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKL  1147
             +TPTGLPYAWINLK GVM+NETTETSTSGCGSLILEMGALSRLTGDP FE AALRALR+L
Sbjct  197   ETPTGLPYAWINLKNGVMENETTETSTSGCGSLILEMGALSRLTGDPRFESAALRALRQL  256

Query  1146  WSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYL  967
             W MRSSL+LLGTTLDV TGEW+E+S+ IGAGVDSFYEYL+KAYILFG +++W+MF SAYL
Sbjct  257   WRMRSSLDLLGTTLDVVTGEWLEYSSSIGAGVDSFYEYLLKAYILFGKEDYWQMFSSAYL  316

Query  966   AVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKK  787
             A QKYFRHGPWYH+A+M +GK TYWQLTSLQAFWPG+QVL GD+ AANS+HREFFHVW+K
Sbjct  317   ASQKYFRHGPWYHEANMWSGKPTYWQLTSLQAFWPGLQVLAGDIAAANSTHREFFHVWEK  376

Query  786   FGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTK  607
             FGVLPERYLLDHQM+HPT KYYPLRPE AESTFYLYQATKDPWY++VGE ++ SLN YTK
Sbjct  377   FGVLPERYLLDHQMIHPTMKYYPLRPELAESTFYLYQATKDPWYLDVGEAMVKSLNLYTK  436

Query  606   VQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLST  427
             V GGFASVRDVTTM+LEDHQHSFFLAETCKYLYLLFDDSF+  RNYIFTTEGHP+ V+S+
Sbjct  437   VPGGFASVRDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFVAKRNYIFTTEGHPIQVVSS  496

Query  426   WHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGD  247
             WH++L ++Y   NWT  K       ASA+S ++CP+  L+  +  QH ESACH+PD + +
Sbjct  497   WHEKLPKSY-SGNWTLSKRGAWESGASALSLQVCPSIALNSRRPEQHRESACHVPDEKIN  555

Query  246   HRCLTDEDCGVDSTTCRRRSCSMAGYCGLW  157
             HRC ++++CGVD+TTCR+RSCS  GYCGLW
Sbjct  556   HRCWSNKECGVDATTCRQRSCSGVGYCGLW  585



>emb|CDY27620.1| BnaA09g27870D [Brassica napus]
Length=571

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/569 (73%), Positives = 487/569 (86%), Gaps = 5/569 (1%)
 Frame = -1

Query  1863  KRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDEL  1684
             K V IC LI  + F   S    D       ++++M +KVR+MFYHAY+NYM +AFPHDEL
Sbjct  5     KHVFICFLISFAFFIDPSSQHVDD-----VKKQQMREKVREMFYHAYDNYMTYAFPHDEL  59

Query  1683  KPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNL  1504
             KP+TK++TDSLSELGNLKLEHLP  Y+GSA+TL+ESLSSL ILGN TEFEK VLWLS NL
Sbjct  60    KPITKSFTDSLSELGNLKLEHLPTGYNGSAVTLVESLSSLAILGNKTEFEKGVLWLSENL  119

Query  1503  SFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFD  1324
              FDVD R+NLFECNIR+LGGL+SAH+LA D TNRL+QG+Y NQLL LAEDLG+RFLPAF+
Sbjct  120   KFDVDVRVNLFECNIRLLGGLISAHLLAIDPTNRLIQGSYDNQLLRLAEDLGKRFLPAFE  179

Query  1323  TPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLW  1144
             TPT +PYAWIN K+GVM+NETTETSTSGCGSLILEMGALSRLTGDP FE AALRALR+LW
Sbjct  180   TPTRIPYAWINFKKGVMENETTETSTSGCGSLILEMGALSRLTGDPRFESAALRALRQLW  239

Query  1143  SMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLA  964
              MRSSL+LLGTTLDV TGEW+E+S+GIGAGVDSFYEYL+KAYILFG +++W+MF+SAYLA
Sbjct  240   RMRSSLDLLGTTLDVVTGEWLEYSSGIGAGVDSFYEYLMKAYILFGKEDYWQMFRSAYLA  299

Query  963   VQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKF  784
              QKYFR+GPWYH+A+M +GK TYWQLTSLQAFWPG+QVLVGDV AANSSHREFFH W+KF
Sbjct  300   SQKYFRYGPWYHEANMWSGKPTYWQLTSLQAFWPGLQVLVGDVAAANSSHREFFHAWEKF  359

Query  783   GVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKV  604
             GV+PERYLLDHQM+HPTE+YYPLRPE AESTFYLYQATKDPWY++VGE ++ SLN+YTKV
Sbjct  360   GVIPERYLLDHQMIHPTERYYPLRPELAESTFYLYQATKDPWYLDVGEAMVKSLNRYTKV  419

Query  603   QGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTW  424
              GGFASVRDVTTM+LEDHQHSFFLAETCKYLYLLFDDSF+  RNYIFTTEGHP+ V+S+W
Sbjct  420   AGGFASVRDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFVAKRNYIFTTEGHPIQVMSSW  479

Query  423   HDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGDH  244
             H++L E+Y   NWT  K  +    ASA+S ++CP+   +     QH ES CH+PD + DH
Sbjct  480   HEKLPESYFSGNWTFSKSGEWESGASALSMKVCPSVAPNSRLREQHRESVCHVPDQKIDH  539

Query  243   RCLTDEDCGVDSTTCRRRSCSMAGYCGLW  157
             +C ++ +CGVD+TTCR+RSCS  G+CGLW
Sbjct  540   KCWSNRECGVDATTCRQRSCSEVGFCGLW  568



>ref|XP_010499235.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X1 [Camelina 
sativa]
Length=588

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/570 (73%), Positives = 491/570 (86%), Gaps = 3/570 (1%)
 Frame = -1

Query  1866  RKRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDE  1687
             +KR+ +C+L+ L+ F  +  +       +  ++K M +KVR+MFYHAY+NYM +AFPHDE
Sbjct  19    KKRLFLCLLVSLAFFLVVVDT--SSQQHLEVKKKLMREKVRQMFYHAYDNYMAYAFPHDE  76

Query  1686  LKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVN  1507
             LKPLTK++TDSLSELGNLKLEHLP  Y+GSA+TL+ESLSSL ILGN +EFEK V WLS N
Sbjct  77    LKPLTKSFTDSLSELGNLKLEHLPTDYNGSAVTLVESLSSLAILGNSSEFEKGVHWLSDN  136

Query  1506  LSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAF  1327
             L FD+DAR+NLFECNIRVLGGL+SAH+LA D TNRL+QG+Y NQLL LAEDLG+RFLPAF
Sbjct  137   LIFDIDARVNLFECNIRVLGGLISAHLLAIDPTNRLIQGSYNNQLLQLAEDLGKRFLPAF  196

Query  1326  DTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKL  1147
             +TPTGLPYAWINLK GVM+NETTETSTSGCGSLILEMGALSRLTGDP FE AALRALR+L
Sbjct  197   ETPTGLPYAWINLKNGVMENETTETSTSGCGSLILEMGALSRLTGDPRFESAALRALRQL  256

Query  1146  WSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYL  967
             W MRSSL+LLGTTLDV TGEW+E+S+ IGAGVDSFYEYL+KAYILFG +++W+MF SAYL
Sbjct  257   WRMRSSLDLLGTTLDVVTGEWLEYSSSIGAGVDSFYEYLLKAYILFGKEDYWQMFSSAYL  316

Query  966   AVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKK  787
             A QKYFRHGPWYH+A+M +GK TYWQLTSLQAFWPG+QVL GD+ AANS+HREFF+VW+K
Sbjct  317   ASQKYFRHGPWYHEANMWSGKPTYWQLTSLQAFWPGLQVLAGDIAAANSTHREFFYVWEK  376

Query  786   FGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTK  607
             FGVLPERYLLDHQM+HPT KYYPLRPE AESTFYLYQATKDPWY++VGE ++ SLN YTK
Sbjct  377   FGVLPERYLLDHQMIHPTMKYYPLRPELAESTFYLYQATKDPWYLDVGEAMVKSLNLYTK  436

Query  606   VQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLST  427
             V GGFASVRDVTTM+LEDHQHSFFLAETCKYLYLLFDDSF+  RNYIFTTEGHP+ V+S+
Sbjct  437   VPGGFASVRDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFVAKRNYIFTTEGHPIQVVSS  496

Query  426   WHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGD  247
             WH++L ++Y   NWT  K       ASA+S ++CP+  L+  +  QH ESACH+PD + +
Sbjct  497   WHEKLPKSY-SGNWTLSKRGAWESGASALSLQVCPSIALNSRRPEQHRESACHVPDEKIN  555

Query  246   HRCLTDEDCGVDSTTCRRRSCSMAGYCGLW  157
             HRC ++++CGVD+TTCR+RSCS  GYCGLW
Sbjct  556   HRCWSNKECGVDATTCRQRSCSGVGYCGLW  585



>ref|XP_007209089.1| hypothetical protein PRUPE_ppa003534mg [Prunus persica]
 gb|EMJ10288.1| hypothetical protein PRUPE_ppa003534mg [Prunus persica]
Length=567

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/545 (77%), Positives = 480/545 (88%), Gaps = 11/545 (2%)
 Frame = -1

Query  1779  AARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSG  1600
             AA+++R+  KV KMFYHAY+NYM+HAFPHDELKPL+K++TDSLSELGNLKLE LPQ YSG
Sbjct  33    AAKKRRLRDKVHKMFYHAYDNYMIHAFPHDELKPLSKSFTDSLSELGNLKLERLPQDYSG  92

Query  1599  SALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILA  1420
             SALTLIESLSSLVI+GN+TEF+ AV+WLS NL+F+VDAR+NLFECNIRVLGGLVSAH+LA
Sbjct  93    SALTLIESLSSLVIMGNNTEFQSAVVWLSENLTFNVDARVNLFECNIRVLGGLVSAHLLA  152

Query  1419  TDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSG  1240
             TDST+RL +G YKNQLL LAEDLG+RFLPAF+TPTGLPYAW+NLK GVM+NETTETSTSG
Sbjct  153   TDSTDRLGKGVYKNQLLTLAEDLGKRFLPAFNTPTGLPYAWVNLKYGVMENETTETSTSG  212

Query  1239  CGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIG  1060
             CGSLILEMGALSRLTGDP +E AALRALRKLWSMRSSLNLLGTTLDV+TGEWIE+STGIG
Sbjct  213   CGSLILEMGALSRLTGDPKYESAALRALRKLWSMRSSLNLLGTTLDVSTGEWIEYSTGIG  272

Query  1059  AGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTS  880
             AGVDSFYEYL KA+ILFG +EFW+MF SAY+AVQKYFRHGPWY              L+ 
Sbjct  273   AGVDSFYEYLFKAHILFGKEEFWRMFHSAYIAVQKYFRHGPWYSTT----------SLSL  322

Query  879   LQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFA  700
             +Q F   ++VLVGD+ AANSSHREF +VWKK+GVLPERYLLDHQMLHPTEKYYPLRPE A
Sbjct  323   IQFFIGTLKVLVGDIAAANSSHREFVYVWKKYGVLPERYLLDHQMLHPTEKYYPLRPELA  382

Query  699   ESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETC  520
             ESTFYLYQATKDPWY+EVGE I+NSLN YTKV GGFAS+RDVTTM+LEDHQHSFFLAETC
Sbjct  383   ESTFYLYQATKDPWYIEVGESIVNSLNLYTKVDGGFASIRDVTTMQLEDHQHSFFLAETC  442

Query  519   KYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAM  340
             KYL+LLFDDSFLV +NYIFTTEGHPLPVLS+WHDRL + Y+ +N T  K     ++ S+M
Sbjct  443   KYLFLLFDDSFLVEKNYIFTTEGHPLPVLSSWHDRLPDTYIQTNRTLLKTGNQARQTSSM  502

Query  339   SQRICPATTL-SHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCG  163
             S+++CP TTL S E   Q +ESACH+PD R DHRCLTD++CGVDS+ CRRRSCSMAGYCG
Sbjct  503   SKQVCPPTTLNSWECSGQQVESACHVPDARSDHRCLTDDECGVDSSNCRRRSCSMAGYCG  562

Query  162   LWLLI  148
             LWL I
Sbjct  563   LWLFI  567



>ref|XP_009113757.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X1 [Brassica 
rapa]
Length=586

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/584 (71%), Positives = 491/584 (84%), Gaps = 7/584 (1%)
 Frame = -1

Query  1908  LLPFSIDPKSFRIMRKRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYH  1729
              + FS     FR   K V IC LI  + F   S    D       ++++M +KVR+MFYH
Sbjct  7     FISFSCSLAMFR--PKHVFICFLISFAFFIDPSSQHVDD-----VKKQQMREKVREMFYH  59

Query  1728  AYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGN  1549
             AY+NYM +AFPHDELKP+TK++TDSLSELGNLKLEHLP  Y+GSA+TL+ESLSSL ILGN
Sbjct  60    AYDNYMTYAFPHDELKPITKSFTDSLSELGNLKLEHLPTDYNGSAVTLVESLSSLAILGN  119

Query  1548  HTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLL  1369
              TEFEK VLWLS NL+FDVD R+NLFECNIR+LGGL+SAH+LA D TNRL+QG+Y N+LL
Sbjct  120   KTEFEKGVLWLSENLTFDVDVRVNLFECNIRLLGGLISAHLLAIDPTNRLIQGSYNNELL  179

Query  1368  DLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGD  1189
              LAEDLG+RFLPAF+TPT +PYAWIN K+GVM+NETTETSTSGCGSLILEMGALSRLTGD
Sbjct  180   RLAEDLGKRFLPAFETPTRIPYAWINFKKGVMENETTETSTSGCGSLILEMGALSRLTGD  239

Query  1188  PIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILF  1009
             P FE AALRALR+LW MRSSL+LLGTTLDV TGEW+E+S+GIGAGVDSFYEYL+KAYILF
Sbjct  240   PRFESAALRALRQLWRMRSSLDLLGTTLDVVTGEWLEYSSGIGAGVDSFYEYLMKAYILF  299

Query  1008  GGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDA  829
             G +++W+MF+SAYLA QKYFR+GPWYH+A+M +GK TYWQLTSLQAFWPG+QVLVGDV A
Sbjct  300   GKEDYWRMFRSAYLASQKYFRYGPWYHEANMWSGKPTYWQLTSLQAFWPGLQVLVGDVAA  359

Query  828   ANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYME  649
             ANSSH EFFH W+KFGV+PERYLLDHQM+HPTE+YYPLRPE AESTFYLYQATKDPWY++
Sbjct  360   ANSSHWEFFHAWEKFGVIPERYLLDHQMIHPTERYYPLRPELAESTFYLYQATKDPWYLD  419

Query  648   VGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNY  469
             VGE ++ SLN+YTKV GGFASVRDVTTM+LEDHQHSFFLAETCKYLYLLFDDSF+  RNY
Sbjct  420   VGEAMVKSLNRYTKVAGGFASVRDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFVAKRNY  479

Query  468   IFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQ  289
             IFTTEGHP+ V+ +WH++L E+Y   NWT  K  +    ASA+S ++CP+   +     Q
Sbjct  480   IFTTEGHPIQVMRSWHEKLPESYFSGNWTFSKSGEWESGASALSMKVCPSIAPNSRLREQ  539

Query  288   HLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLW  157
             H ES CH+PD + DH+C ++ +CGVD+TTCR+RSCS  G+CGLW
Sbjct  540   HRESVCHVPDQKIDHKCWSNRECGVDATTCRQRSCSEVGFCGLW  583



>gb|KHN48621.1| Putative alpha-mannosidase I MNS5 [Glycine soja]
Length=556

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/554 (76%), Positives = 481/554 (87%), Gaps = 18/554 (3%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLK  1630
             FS  +  +P AA++KRM  KVR MFYHAY+NYM HAFPHDELKP++KT+T+SLSELGNLK
Sbjct  21    FSISESQSPWAAKKKRMRDKVRNMFYHAYDNYMTHAFPHDELKPISKTFTNSLSELGNLK  80

Query  1629  LEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVL  1450
             LEHLPQ Y+GSALTLIESLSSLVI+GN+TEFE+AVLWLS NL+FDVDARINLFECNIRVL
Sbjct  81    LEHLPQDYNGSALTLIESLSSLVIMGNYTEFERAVLWLSENLTFDVDARINLFECNIRVL  140

Query  1449  GGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQ  1270
             GGLVSAH+LA+DS+ +  QG YKNQLL LAEDLG+RFLPAF+TPTGLPYAWINLK GVM+
Sbjct  141   GGLVSAHLLASDSSKKFFQGAYKNQLLALAEDLGKRFLPAFNTPTGLPYAWINLKYGVME  200

Query  1269  NettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATG  1090
             NETTETSTSGCGSLILEMGALS++TGDPI+E  ALRALRKLWSM+S+L L GTTLDV TG
Sbjct  201   NETTETSTSGCGSLILEMGALSKMTGDPIYESVALRALRKLWSMQSTLKLFGTTLDVTTG  260

Query  1089  EWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRT  910
             +WIE+S+GIGAGVDSFYEYL+KA+ILFG ++FWKMF SAY+AVQKYFRHGPWYH+ADMRT
Sbjct  261   QWIEYSSGIGAGVDSFYEYLLKAHILFGKEDFWKMFHSAYVAVQKYFRHGPWYHEADMRT  320

Query  909   GKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTE  730
             G+ATYWQLTSLQAFWPG+Q        A+S    F+       +L  RYLLDHQMLHPTE
Sbjct  321   GRATYWQLTSLQAFWPGLQ--------ASSWTLNFY-------LLKIRYLLDHQMLHPTE  365

Query  729   KYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDH  550
             KYYPLRPE AESTFYLYQATKDPWY+EVGE I+NSLN YTKV+GGFAS++DVTTM+LEDH
Sbjct  366   KYYPLRPELAESTFYLYQATKDPWYIEVGESIVNSLNLYTKVEGGFASIKDVTTMQLEDH  425

Query  549   QHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKH  370
             QHSFFLAETCKYLYLLFDDSF+   NY+FTTEGHPLPVLSTWH+ L EAY+P+NWT  K 
Sbjct  426   QHSFFLAETCKYLYLLFDDSFVHENNYVFTTEGHPLPVLSTWHEELPEAYIPTNWTFVKR  485

Query  369   EKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRR  190
             +    R  AMS ++CPA  L   +  QH+ESACHIPD R D+RCLTDEDCGVD+TTCR R
Sbjct  486   QPRVNRICAMSLQVCPAMNL---KSGQHIESACHIPDARSDYRCLTDEDCGVDATTCRPR  542

Query  189   SCSMAGYCGLWLLI  148
             SCS+AGYCGLWL+I
Sbjct  543   SCSIAGYCGLWLII  556



>ref|XP_008646239.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X1 [Zea 
mays]
Length=604

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/541 (76%), Positives = 473/541 (87%), Gaps = 1/541 (0%)
 Frame = -1

Query  1776  ARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGS  1597
             ARR  M  KV +MFYHAY+NYM +AFPHDELKPLTK++TDSLSELGNL LEHLPQ YSGS
Sbjct  37    ARRVYMKNKVLEMFYHAYDNYMTYAFPHDELKPLTKSFTDSLSELGNLNLEHLPQDYSGS  96

Query  1596  ALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILAT  1417
             ALTL+ESLSSLV+LGN TEFE+ VLWLS NL+FDVDARINLFECNIR+LGGL+SAHILA 
Sbjct  97    ALTLVESLSSLVVLGNLTEFERGVLWLSENLTFDVDARINLFECNIRLLGGLISAHILAK  156

Query  1416  DSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGC  1237
             D +++   G Y++QLL LAE LG RFLPAF+TPTGLPY+WINLK GVM+NETTETSTSGC
Sbjct  157   DYSSQFKHGLYQDQLLRLAESLGNRFLPAFETPTGLPYSWINLKYGVMENETTETSTSGC  216

Query  1236  GSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGA  1057
             GSLILEMG LSRLTGD  +E AALRALRKLWSMRSSLNL+GTTLDV TG+WI++S+GIGA
Sbjct  217   GSLILEMGVLSRLTGDSRYEAAALRALRKLWSMRSSLNLVGTTLDVFTGKWIQYSSGIGA  276

Query  1056  GVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSL  877
             GVDSFYEYL+KAYILFG DE+W MF SAYLAVQKYFRHGPWYH+ADMRTG+AT+WQLTSL
Sbjct  277   GVDSFYEYLIKAYILFGSDEYWDMFHSAYLAVQKYFRHGPWYHEADMRTGEATHWQLTSL  336

Query  876   QAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAE  697
             QAFWPG+Q L+GDV AAN SHREF+++W++FGVLPERYLLD+ MLHPTEKYYPLRPEFAE
Sbjct  337   QAFWPGLQTLLGDVTAANLSHREFYNIWQRFGVLPERYLLDYGMLHPTEKYYPLRPEFAE  396

Query  696   STFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCK  517
             STFYLYQATKDPWY+EVGE I+ SLN YTKV GGFAS+RDV+TM+LEDHQHSFFL+ETCK
Sbjct  397   STFYLYQATKDPWYLEVGETIVRSLNYYTKVDGGFASIRDVSTMKLEDHQHSFFLSETCK  456

Query  516   YLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMS  337
             YL+LL+DDSFL N+NYIFTTEGHPLP+ STWH++   AY+PSNWTS K E    RASA+S
Sbjct  457   YLFLLYDDSFLRNQNYIFTTEGHPLPIRSTWHEKFPAAYVPSNWTSVKDEIQPIRASALS  516

Query  336   QRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLW  157
              ++CP T           ESACH+PD    HRC TD+DCG+++ TC++R+CSMAGYCGL+
Sbjct  517   SQVCPETIFGRSVG-TPWESACHVPDAHASHRCRTDDDCGIEAITCKKRTCSMAGYCGLF  575

Query  156   L  154
              
Sbjct  576   F  576



>ref|XP_010272052.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X2 [Nelumbo 
nucifera]
Length=551

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/581 (73%), Positives = 479/581 (82%), Gaps = 38/581 (7%)
 Frame = -1

Query  1890  DPKSFRIMRKRVLICMLIFLSTF-FPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENY  1714
             +PKS    R  VL+  L FL+T     S +GF      A +++ M +KVRKMFYHAY NY
Sbjct  5     NPKSTIRFRIWVLLFSLFFLATSNLAKSETGFR-----ATKKRFMREKVRKMFYHAYNNY  59

Query  1713  MMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFE  1534
             M +AFPHDELKPLTKT+ DSLSELGNLKLEHLPQ Y+GSALTLIESLSSLV+LGN+TEFE
Sbjct  60    MTYAFPHDELKPLTKTFADSLSELGNLKLEHLPQNYNGSALTLIESLSSLVVLGNNTEFE  119

Query  1533  KAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAED  1354
             +AVLWLS NL+FDVDARINLFECNIRVLGGL+SAHILATDS +RLVQG Y NQLL LAED
Sbjct  120   RAVLWLSENLTFDVDARINLFECNIRVLGGLLSAHILATDSRSRLVQGKYNNQLLALAED  179

Query  1353  LGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEI  1174
             LG+RFL AF TPTGLPYAW+NLK GVM+NETTETSTSGCGSLILEMGALSRLTGDP +E 
Sbjct  180   LGKRFLYAFATPTGLPYAWVNLKYGVMENETTETSTSGCGSLILEMGALSRLTGDPRYEA  239

Query  1173  AALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEF  994
             AALRAL KLWSMRS LNLLGTTLDV TGEWIE+S+GIGAGVDSFYEYL+KA+ILFG +EF
Sbjct  240   AALRALHKLWSMRSPLNLLGTTLDVVTGEWIEYSSGIGAGVDSFYEYLIKAHILFGREEF  299

Query  993   WKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSH  814
             W +F SAY+AVQKYFRHGPWYH+ADMRTG+ATYWQLTSLQAFWPG+QVLVGD+ AANSSH
Sbjct  300   WDIFHSAYVAVQKYFRHGPWYHEADMRTGRATYWQLTSLQAFWPGLQVLVGDILAANSSH  359

Query  813   REFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELI  634
              EFFHVW+KFGVLPERYLL+H+MLHPTEKYYPLRPE AESTFYLYQATKDPWYMEVGE I
Sbjct  360   HEFFHVWEKFGVLPERYLLNHEMLHPTEKYYPLRPELAESTFYLYQATKDPWYMEVGESI  419

Query  633   INSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTE  454
             +NSLN YTKV+GGFAS++DVTTM+LEDHQHSFFLAE                        
Sbjct  420   VNSLNLYTKVEGGFASIKDVTTMQLEDHQHSFFLAE------------------------  455

Query  453   GHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESA  274
                     TWH+RL E +  +NWT  K     KRASAMS ++CPA+TL      Q +ESA
Sbjct  456   --------TWHERLPETFTSTNWTFVKGISQVKRASAMSLQVCPASTLVRGTTAQLVESA  507

Query  273   CHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLL  151
             CH+PD R DHRC+TDE+CG+DST+CR+R+CSMAGYCGLWLL
Sbjct  508   CHVPDARADHRCMTDEECGIDSTSCRQRTCSMAGYCGLWLL  548



>gb|EEC73977.1| hypothetical protein OsI_08885 [Oryza sativa Indica Group]
Length=585

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/541 (76%), Positives = 470/541 (87%), Gaps = 1/541 (0%)
 Frame = -1

Query  1776  ARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGS  1597
              RR  M  KV +MFYHAY+NYM +AFPHDELKPLTK++TDSLSELGNL LEHLP  Y+GS
Sbjct  43    GRRLYMRNKVLEMFYHAYDNYMTYAFPHDELKPLTKSFTDSLSELGNLNLEHLPNDYNGS  102

Query  1596  ALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILAT  1417
             ALTL+ESLSSLV+LGN TEFE+ VLWLS NL+FDVDARINLFECNIR+LGGL+S HILA 
Sbjct  103   ALTLVESLSSLVVLGNLTEFERGVLWLSENLTFDVDARINLFECNIRLLGGLISGHILAK  162

Query  1416  DSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGC  1237
             + ++ L  G Y++QLL LAE+LG RFLPAF+TPTGLPYAWINLK GVM+NETTETSTSGC
Sbjct  163   EHSSHLKDGPYQDQLLHLAENLGSRFLPAFETPTGLPYAWINLKYGVMENETTETSTSGC  222

Query  1236  GSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGA  1057
             GSLILEMGALSRLTGD  +E AALRALRKLWSMRSSLNL+GTTLDV TG+WIE+S+GIGA
Sbjct  223   GSLILEMGALSRLTGDSRYEAAALRALRKLWSMRSSLNLVGTTLDVLTGKWIEYSSGIGA  282

Query  1056  GVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSL  877
             GVDSFYEYL+KAY+LFG +E+W MF SAYLAVQKYFRHGPWYH+ADMRTG+AT+WQLTSL
Sbjct  283   GVDSFYEYLIKAYVLFGSEEYWDMFHSAYLAVQKYFRHGPWYHEADMRTGEATHWQLTSL  342

Query  876   QAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAE  697
             QAFWPG+Q L+GDV AAN SHREF++VW++FGVLPERYLLD  MLHPTEKYYPLRPEFAE
Sbjct  343   QAFWPGLQTLLGDVAAANISHREFYNVWQRFGVLPERYLLDFGMLHPTEKYYPLRPEFAE  402

Query  696   STFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCK  517
             STFYLYQATKDPWY+EVGE II SLN YTKV GGFASVRDV+TM+LEDHQHSFFL+ETCK
Sbjct  403   STFYLYQATKDPWYLEVGEAIIGSLNYYTKVDGGFASVRDVSTMKLEDHQHSFFLSETCK  462

Query  516   YLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMS  337
             YL+LL+DDSFL N+NYIFTTEGHPLP+ STWH+ +   ++PSNWT  K +    R SA+S
Sbjct  463   YLFLLYDDSFLRNQNYIFTTEGHPLPIRSTWHEIIPTTHVPSNWTFVKDDSQPFRVSALS  522

Query  336   QRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLW  157
              ++CP T    +      ESACH+PD    HRC TD+DCGV++ +CRRR+CSMAGYCGLW
Sbjct  523   SQVCPETIF-RQSVGSPWESACHVPDVLPTHRCRTDDDCGVEAVSCRRRTCSMAGYCGLW  581

Query  156   L  154
             L
Sbjct  582   L  582



>ref|NP_001048080.1| Os02g0741300 [Oryza sativa Japonica Group]
 dbj|BAD15724.1| putative Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB [Oryza 
sativa Japonica Group]
 dbj|BAD15767.1| putative Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB [Oryza 
sativa Japonica Group]
 dbj|BAF09994.1| Os02g0741300 [Oryza sativa Japonica Group]
 dbj|BAG97342.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00118.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57782.1| hypothetical protein OsJ_08331 [Oryza sativa Japonica Group]
Length=585

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/541 (76%), Positives = 470/541 (87%), Gaps = 1/541 (0%)
 Frame = -1

Query  1776  ARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGS  1597
              RR  M  KV +MFYHAY+NYM +AFPHDELKPLTK++TDSLSELGNL LEHLP  Y+GS
Sbjct  43    GRRLYMRNKVLEMFYHAYDNYMTYAFPHDELKPLTKSFTDSLSELGNLNLEHLPNDYNGS  102

Query  1596  ALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILAT  1417
             ALTL+ESLSSLV+LGN TEFE+ VLWLS NL+FDVDARINLFECNIR+LGGL+S HILA 
Sbjct  103   ALTLVESLSSLVVLGNLTEFERGVLWLSENLTFDVDARINLFECNIRLLGGLISGHILAK  162

Query  1416  DSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGC  1237
             + ++ L  G Y++QLL LAE+LG RFLPAF+TPTGLPYAWINLK GVM+NETTETSTSGC
Sbjct  163   EHSSHLKDGPYQDQLLHLAENLGSRFLPAFETPTGLPYAWINLKYGVMENETTETSTSGC  222

Query  1236  GSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGA  1057
             GSLILEMGALSRLTGD  +E AALRALRKLWSMRSSLNL+GTTLDV TG+WIE+S+GIGA
Sbjct  223   GSLILEMGALSRLTGDSRYEAAALRALRKLWSMRSSLNLVGTTLDVLTGKWIEYSSGIGA  282

Query  1056  GVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSL  877
             GVDSFYEYL+KAY+LFG +E+W MF SAYLAVQKYFRHGPWYH+ADMRTG+AT+WQLTSL
Sbjct  283   GVDSFYEYLIKAYVLFGSEEYWDMFHSAYLAVQKYFRHGPWYHEADMRTGEATHWQLTSL  342

Query  876   QAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAE  697
             QAFWPG+Q L+GDV AAN SHREF++VW++FGVLPERYLLD  MLHPTEKYYPLRPEFAE
Sbjct  343   QAFWPGLQTLLGDVAAANISHREFYNVWQRFGVLPERYLLDFGMLHPTEKYYPLRPEFAE  402

Query  696   STFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCK  517
             STFYLYQATKDPWY+EVGE II SLN YTKV GGFASVRDV+TM+LEDHQHSFFL+ETCK
Sbjct  403   STFYLYQATKDPWYLEVGEAIIGSLNYYTKVDGGFASVRDVSTMKLEDHQHSFFLSETCK  462

Query  516   YLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMS  337
             YL+LL+DDSFL N+NYIFTTEGHPLP+ STWH+ +   ++PSNWT  K +    R SA+S
Sbjct  463   YLFLLYDDSFLRNQNYIFTTEGHPLPIRSTWHEIIPTTHVPSNWTFVKDDSQPFRVSALS  522

Query  336   QRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLW  157
              ++CP T    +      ESACH+PD    HRC TD+DCGV++ +CRRR+CSMAGYCGLW
Sbjct  523   SQVCPETIF-RQSVGSPWESACHVPDVLPTHRCRTDDDCGVEAVSCRRRTCSMAGYCGLW  581

Query  156   L  154
             L
Sbjct  582   L  582



>ref|XP_004953893.1| PREDICTED: probable alpha-mannosidase I MNS5-like [Setaria italica]
Length=579

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/543 (75%), Positives = 470/543 (87%), Gaps = 1/543 (0%)
 Frame = -1

Query  1776  ARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGS  1597
             ARR  M  KV +MFYHAY+NYM +AFPHDELKPLTK++TDSLSELGNL LEHLPQ Y+GS
Sbjct  37    ARRLHMKNKVLEMFYHAYDNYMTYAFPHDELKPLTKSFTDSLSELGNLNLEHLPQDYNGS  96

Query  1596  ALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILAT  1417
             ALTL+ESLSSLV+LGN TEFE+ +LWLS NL+FDVDARINLFECNIR+LGGL+SAH+LA 
Sbjct  97    ALTLVESLSSLVVLGNITEFERGILWLSENLTFDVDARINLFECNIRLLGGLISAHLLAK  156

Query  1416  DSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGC  1237
             D +++L    Y++QLL LAE LG RFLPAF+TPTGLPYAWINLK GVM+NETTETSTSGC
Sbjct  157   DYSSQLKDEPYQDQLLHLAESLGNRFLPAFETPTGLPYAWINLKYGVMENETTETSTSGC  216

Query  1236  GSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGA  1057
             GSLILEMG LSRLTGD  +E AALRALRKLWSMRSSLNL+GTTLDV TG+WIE+S+GIGA
Sbjct  217   GSLILEMGVLSRLTGDSRYEAAALRALRKLWSMRSSLNLVGTTLDVLTGKWIEYSSGIGA  276

Query  1056  GVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSL  877
             GVDSFYEYL+KAYILFG DE+W MF SAYLAVQKYFRHGPWYH+ADMRTG+AT+WQLTSL
Sbjct  277   GVDSFYEYLIKAYILFGSDEYWDMFHSAYLAVQKYFRHGPWYHEADMRTGEATHWQLTSL  336

Query  876   QAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAE  697
             QAFWPG+Q L+GDV AAN SHREF++VW++FGVLPERYLLD+ +LHPTEKYYPLRPEFAE
Sbjct  337   QAFWPGLQTLLGDVAAANLSHREFYNVWQRFGVLPERYLLDYGVLHPTEKYYPLRPEFAE  396

Query  696   STFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCK  517
             STFYLYQATKDPWY+EVGE II SLN YTKV GGFASVRDV+TM+LEDHQHSFFL+ETCK
Sbjct  397   STFYLYQATKDPWYLEVGETIIGSLNYYTKVDGGFASVRDVSTMKLEDHQHSFFLSETCK  456

Query  516   YLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMS  337
             YL+LL+DDSFL N+NYIFTTEGHPLPV STWH +    ++ SNWT  K E    R SA+S
Sbjct  457   YLFLLYDDSFLRNQNYIFTTEGHPLPVRSTWHAKFPATHVLSNWTFVKDENQPIRVSALS  516

Query  336   QRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLW  157
              ++CP T    +      ESACH+PD    HRC TD+DCG ++ TC++R+CSMAGYC LW
Sbjct  517   SQVCPETVF-RKSIGSPWESACHVPDVYASHRCRTDDDCGTEAVTCKKRTCSMAGYCSLW  575

Query  156   LLI  148
             L+I
Sbjct  576   LVI  578



>emb|CAN68187.1| hypothetical protein VITISV_013675 [Vitis vinifera]
Length=535

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/566 (75%), Positives = 475/566 (84%), Gaps = 34/566 (6%)
 Frame = -1

Query  1842  LIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTY  1663
             L+  STF   S S  D      A+++ M +KVRKMFYHAY+NYM HAFPHDELKPL+KT+
Sbjct  3     LLVSSTFVHSSMSEID------AKKRYMREKVRKMFYHAYDNYMAHAFPHDELKPLSKTF  56

Query  1662  TDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDAR  1483
             TDSLSELGNL LEHL + Y+GSALTLIESLSSLVILGN+TEFE+AV WLS NLSFDVD R
Sbjct  57    TDSLSELGNLNLEHLSEHYNGSALTLIESLSSLVILGNNTEFERAVRWLSENLSFDVDVR  116

Query  1482  INLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPY  1303
              NLFECNIRVLGGLVSAHILATDS NRLVQGTYKN+LL LAEDLGRRFLPAFDTPTGLPY
Sbjct  117   TNLFECNIRVLGGLVSAHILATDSRNRLVQGTYKNELLILAEDLGRRFLPAFDTPTGLPY  176

Query  1302  AWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLN  1123
             AWINLK GVM+NETTETSTSGCGSLILEMGALSRLTGDP +E AALRALRKLWSMRSSLN
Sbjct  177   AWINLKYGVMENETTETSTSGCGSLILEMGALSRLTGDPRYESAALRALRKLWSMRSSLN  236

Query  1122  LLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRH  943
             LLGTTLDVATGEWIE+S+GIGAGVDSFYEYL+KA+ILFG +E W+MFQSAYLAVQKYFRH
Sbjct  237   LLGTTLDVATGEWIEYSSGIGAGVDSFYEYLIKAHILFGKEELWRMFQSAYLAVQKYFRH  296

Query  942   GPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERY  763
             GPWYH+ADMRTGKATYWQLTSLQAFWPG  VL+GD+ AANSSHREF +VW+KFGVLPERY
Sbjct  297   GPWYHEADMRTGKATYWQLTSLQAFWPG--VLIGDIAAANSSHREFVYVWEKFGVLPERY  354

Query  762   LLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASV  583
             LLDHQMLHPTEKYYPLRPE AESTFYLYQATK+       E +  S+ ++T         
Sbjct  355   LLDHQMLHPTEKYYPLRPELAESTFYLYQATKE------SEGLTTSIARHTS--------  400

Query  582   RDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEA  403
                          SF L   CKYLYLLFDDSFLV+RNY+FTTEGHPLPV+S WHDRL E 
Sbjct  401   ---------SWIXSFHL--NCKYLYLLFDDSFLVDRNYVFTTEGHPLPVISAWHDRLPEN  449

Query  402   YLPSNWTSFKHEKH-RKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDE  226
             Y+P+N TS K EK   +R+SAMS ++CPATTL+  +  Q +ESACHIPD + DHRCLT++
Sbjct  450   YIPTNGTSIKSEKQAARRSSAMSLQVCPATTLNSGRSSQQVESACHIPDAQSDHRCLTED  509

Query  225   DCGVDSTTCRRRSCSMAGYCGLWLLI  148
             +CGVD+TTCRRRSCSMAGYCGLWL I
Sbjct  510   ECGVDATTCRRRSCSMAGYCGLWLFI  535



>ref|XP_002454305.1| hypothetical protein SORBIDRAFT_04g028330 [Sorghum bicolor]
 gb|EES07281.1| hypothetical protein SORBIDRAFT_04g028330 [Sorghum bicolor]
Length=573

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/543 (75%), Positives = 468/543 (86%), Gaps = 7/543 (1%)
 Frame = -1

Query  1776  ARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGS  1597
             ARR  M  KV +MFYHAY+NYM +AFPHDELKPLTK++TDSLSELGNL LEHLPQ YSGS
Sbjct  37    ARRLHMKTKVLEMFYHAYDNYMTYAFPHDELKPLTKSFTDSLSELGNLNLEHLPQDYSGS  96

Query  1596  ALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILAT  1417
             ALTL+ESLSSLV+LGN TEFE+ VLWLS NL+FDVDARINLFECNIR+LGGL+SAHILA 
Sbjct  97    ALTLVESLSSLVVLGNLTEFERGVLWLSENLTFDVDARINLFECNIRLLGGLISAHILAK  156

Query  1416  DSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGC  1237
             D  ++   G Y++QLL LAE LG RFLPAF+TPTGLPY       GVM+NETTETSTSGC
Sbjct  157   DYNSQFKHGLYQDQLLHLAESLGNRFLPAFETPTGLPY------YGVMENETTETSTSGC  210

Query  1236  GSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGA  1057
             GSLILEMG LSRLTGD  +E AALRALRKLWSMRSSLNL+GTTLDV TG+WIE+S+GIGA
Sbjct  211   GSLILEMGVLSRLTGDSRYEAAALRALRKLWSMRSSLNLVGTTLDVLTGKWIEYSSGIGA  270

Query  1056  GVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSL  877
             GVDSFYEYL+KAYILFG D++W MF SAYLAVQKYFRHGPWYH+ADMRTG+AT+WQLTSL
Sbjct  271   GVDSFYEYLIKAYILFGSDDYWDMFHSAYLAVQKYFRHGPWYHEADMRTGEATHWQLTSL  330

Query  876   QAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAE  697
             QAFWPG+Q L+GDV AAN SHREF+++W++FGVLPERYLLD+ MLHPTEKYYPLRPEFAE
Sbjct  331   QAFWPGLQTLLGDVTAANLSHREFYNIWQRFGVLPERYLLDYGMLHPTEKYYPLRPEFAE  390

Query  696   STFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCK  517
             STFYLYQATKDPWY+EVGE I+ SLN YTKV GGFASVRDV+TM+LEDHQHSFFL+ETCK
Sbjct  391   STFYLYQATKDPWYLEVGEAIVGSLNYYTKVDGGFASVRDVSTMKLEDHQHSFFLSETCK  450

Query  516   YLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMS  337
             YL+LL+DDSFL N+NYIFTTEGHPLP+ STWH++   AY+PSNWT  K E    R SA+S
Sbjct  451   YLFLLYDDSFLRNQNYIFTTEGHPLPIRSTWHEKFPAAYVPSNWTFVKDEIQPIRVSALS  510

Query  336   QRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLW  157
              ++CP T    +      ESACH+PD    HRC TD+DCG+++ TC++R+CSMAGYCGLW
Sbjct  511   SQVCPETIF-RKSVGTPWESACHVPDAHASHRCRTDDDCGIEAITCKKRTCSMAGYCGLW  569

Query  156   LLI  148
             L+I
Sbjct  570   LVI  572



>ref|XP_006649035.1| PREDICTED: probable alpha-mannosidase I MNS5-like, partial [Oryza 
brachyantha]
Length=553

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/541 (75%), Positives = 466/541 (86%), Gaps = 1/541 (0%)
 Frame = -1

Query  1776  ARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGS  1597
              RR  M  KV +MFYHAY+NYM +AFPHDELKPLTK++TDSLSELGNL LEHLP  Y+GS
Sbjct  11    GRRLYMRNKVLEMFYHAYDNYMTYAFPHDELKPLTKSFTDSLSELGNLNLEHLPNDYNGS  70

Query  1596  ALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILAT  1417
             ALTL+ESLSSLV+LGN TEFE+ +LWLS NL+FDVDARINLFECNIR+LGGL+S HILA 
Sbjct  71    ALTLVESLSSLVVLGNLTEFERGILWLSENLTFDVDARINLFECNIRLLGGLISGHILAK  130

Query  1416  DSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGC  1237
             +    L  G Y++QLL LAE+LG RFLPAF+TPTGLPYAWINLK GVM+NETTETSTSGC
Sbjct  131   EHKIHLKDGLYQDQLLLLAENLGNRFLPAFETPTGLPYAWINLKYGVMENETTETSTSGC  190

Query  1236  GSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGA  1057
             GSLILEMGALSRLTGD  +E AALRALRKLW+MRSSLNL+GTTLDV TG+WIE+S+GIGA
Sbjct  191   GSLILEMGALSRLTGDSRYEAAALRALRKLWNMRSSLNLVGTTLDVLTGKWIEYSSGIGA  250

Query  1056  GVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSL  877
             GVDSFYEYL+KAY LFG +E+W MF SAYLAVQKYFRHGPWYH+ADMRTG+AT+WQLTSL
Sbjct  251   GVDSFYEYLIKAYFLFGSEEYWDMFHSAYLAVQKYFRHGPWYHEADMRTGEATHWQLTSL  310

Query  876   QAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAE  697
             QAFWPG+Q L+GDV AAN SHREF+ VW++FGVLPERYLLD  MLHPTE YYPLRPEFAE
Sbjct  311   QAFWPGLQTLLGDVSAANISHREFYSVWQRFGVLPERYLLDLGMLHPTENYYPLRPEFAE  370

Query  696   STFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCK  517
             STFYLYQATKDPWY+EVGE I+ SLN YTKV+GGFASVRDV+TM+LEDHQHSFFL+ETCK
Sbjct  371   STFYLYQATKDPWYLEVGEAIVGSLNYYTKVEGGFASVRDVSTMKLEDHQHSFFLSETCK  430

Query  516   YLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMS  337
             YL+LL+DDSFL  +NYIFTTEGHPLP+ STWH+++   ++PSNWT  K +    R SA+S
Sbjct  431   YLFLLYDDSFLKKQNYIFTTEGHPLPIRSTWHEKIPTTHVPSNWTFVKDDDQPIRVSALS  490

Query  336   QRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLW  157
              ++CP T      +    ESACHIPD    HRC TD++CGV+S +CRRR+CSMAGYCGLW
Sbjct  491   SQVCPETIFRQSVD-SPWESACHIPDVFPTHRCRTDDECGVESVSCRRRTCSMAGYCGLW  549

Query  156   L  154
             L
Sbjct  550   L  550



>ref|XP_003573110.1| PREDICTED: probable alpha-mannosidase I MNS5 [Brachypodium distachyon]
Length=584

 Score =   845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/544 (74%), Positives = 472/544 (87%), Gaps = 3/544 (1%)
 Frame = -1

Query  1776  ARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGS  1597
             ARR  M  KV +MFYHAY+NYM +AFPHDELKPLTK++TDSLSELGNL LEHLP  Y+GS
Sbjct  42    ARRLHMRDKVVEMFYHAYDNYMAYAFPHDELKPLTKSFTDSLSELGNLNLEHLPHDYNGS  101

Query  1596  ALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILAT  1417
             ALTL+ESLSSLV+LGN TEFE+ V WLS NL+FDVDAR+NLFECNIR+LGGL+SAHILA 
Sbjct  102   ALTLVESLSSLVVLGNLTEFERGVTWLSENLTFDVDARVNLFECNIRLLGGLISAHILAK  161

Query  1416  DSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGC  1237
             D  ++   G Y++QLL LAE+LG RFLPAF+TPTGLPYAWINLK GV++NETTETSTSGC
Sbjct  162   DYISQRKDGVYQDQLLHLAENLGSRFLPAFETPTGLPYAWINLKYGVIENETTETSTSGC  221

Query  1236  GSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGA  1057
             GSLILEMGALSRLTGD  +E AA RALRKLWSMRSSLNL+G+TLDV +G+WIE+S+GIGA
Sbjct  222   GSLILEMGALSRLTGDSRYEAAAHRALRKLWSMRSSLNLVGSTLDVLSGKWIEYSSGIGA  281

Query  1056  GVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSL  877
             GVDSFYEYL+KAYILFG DE+W MF SAYLAVQKYFRHGPWYH+AD+RTG+AT+WQLTSL
Sbjct  282   GVDSFYEYLIKAYILFGSDEYWDMFHSAYLAVQKYFRHGPWYHEADIRTGEATHWQLTSL  341

Query  876   QAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAE  697
             QAFWPGVQ L+GDV AAN SHREF++VW++FGVLPERYLLD+ +LHPTEKYYPLRPEFAE
Sbjct  342   QAFWPGVQTLLGDVAAANLSHREFYNVWQRFGVLPERYLLDYGILHPTEKYYPLRPEFAE  401

Query  696   STFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCK  517
             STFYLYQATKDPWY+EVGE II SLN YTKV+GGFAS+RDV+TM+ EDHQHSFFL+ETCK
Sbjct  402   STFYLYQATKDPWYLEVGEAIIGSLNYYTKVEGGFASIRDVSTMKQEDHQHSFFLSETCK  461

Query  516   YLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMS  337
             YL+LL+DDSFL  +NYIFTTEGHPLP+ STWH+++  + +PSNWTS K  +   R SA+S
Sbjct  462   YLFLLYDDSFLRKQNYIFTTEGHPLPIRSTWHEKIPASDVPSNWTSVKDAEQPIRVSALS  521

Query  336   QRICPATTLSHEQEYQHL-ESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGL  160
              ++CP T     Q +    ESACH+PD   +H+C  D+DCG++S +C+RR+CS AGYCGL
Sbjct  522   SQVCPETIF--RQSFGSTWESACHVPDVFPNHKCRADDDCGIESVSCKRRTCSTAGYCGL  579

Query  159   WLLI  148
             WL +
Sbjct  580   WLAV  583



>ref|XP_006476722.1| PREDICTED: probable alpha-mannosidase I MNS5-like isoform X2 
[Citrus sinensis]
Length=491

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/474 (85%), Positives = 436/474 (92%), Gaps = 0/474 (0%)
 Frame = -1

Query  1569  SLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQG  1390
             SLVI+GN+TEFE+AVLWLS NL+FDVDARINLFECNIRVLGGLVSAHILATDS NRLVQG
Sbjct  18    SLVIMGNNTEFERAVLWLSENLNFDVDARINLFECNIRVLGGLVSAHILATDSANRLVQG  77

Query  1389  TYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGA  1210
             +YKNQLL LAEDLGRRFLPAFDTPTGLPYAWINLK GVM+NETTETSTSGCGSLILEMGA
Sbjct  78    SYKNQLLTLAEDLGRRFLPAFDTPTGLPYAWINLKYGVMENETTETSTSGCGSLILEMGA  137

Query  1209  LSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYL  1030
             LSRLTGDPI+E AALRALR+LWSMRSSLNLLGTTLDV TGEWIE+S+GIGAGVDSFYEYL
Sbjct  138   LSRLTGDPIYESAALRALRRLWSMRSSLNLLGTTLDVTTGEWIEYSSGIGAGVDSFYEYL  197

Query  1029  VKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQV  850
              KA+ILFG ++FW+MF SAYLAVQKYFRHGPWYH+ADMR GKATYWQLTSLQAFWPG+QV
Sbjct  198   FKAHILFGKEDFWRMFHSAYLAVQKYFRHGPWYHEADMRNGKATYWQLTSLQAFWPGLQV  257

Query  849   LVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQAT  670
             LVGD+ AANSSHREF HVWKKFGVLPERYLLDH MLHPTEKYYPLRPE AESTFYLYQAT
Sbjct  258   LVGDIAAANSSHREFVHVWKKFGVLPERYLLDHLMLHPTEKYYPLRPELAESTFYLYQAT  317

Query  669   KDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDS  490
             KDPWY+EVGE I+NSLN YTKV GGFAS+RDVTTM+LEDHQHSFFLAETCKYLYLLFDDS
Sbjct  318   KDPWYLEVGESIVNSLNSYTKVDGGFASIRDVTTMQLEDHQHSFFLAETCKYLYLLFDDS  377

Query  489   FLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTL  310
             FLV+RNY+FTTEGHPLPVLS+WHDRL EAY+P NWT    EK  +RASAM+ ++CPAT+L
Sbjct  378   FLVDRNYVFTTEGHPLPVLSSWHDRLPEAYIPRNWTFLPSEKQARRASAMTLQVCPATSL  437

Query  309   SHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
                   Q ++SACHIPD R DHRC  DE+CGVD+TTCRRR+CSMAGYCGLWL I
Sbjct  438   DCRHRCQQVKSACHIPDARSDHRCFGDEECGVDATTCRRRTCSMAGYCGLWLFI  491



>gb|EMT01140.1| ER degradation-enhancing alpha-mannosidase-like protein 1 [Aegilops 
tauschii]
Length=780

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/531 (76%), Positives = 465/531 (88%), Gaps = 1/531 (0%)
 Frame = -1

Query  1740  MFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLV  1561
             +FYHAY+NYM +AFPHDELKPLTK +TDSLSELGNL LEHLPQ Y+GSALTL+ESLSSLV
Sbjct  250   LFYHAYDNYMAYAFPHDELKPLTKGFTDSLSELGNLNLEHLPQDYNGSALTLVESLSSLV  309

Query  1560  ILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYK  1381
             +LGN TEF++ V WLS NL+FDVDAR+NLFECNIR+LGGL+SAHILA D +++   G Y+
Sbjct  310   VLGNLTEFDRGVSWLSENLTFDVDARVNLFECNIRLLGGLISAHILAKDYSSQNKDGVYQ  369

Query  1380  NQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSR  1201
             NQLL LAE+LG RFLPAF+TPTGLPYAWINLK GVM+NETTETSTSGCGSLILEMGALSR
Sbjct  370   NQLLHLAENLGSRFLPAFETPTGLPYAWINLKYGVMENETTETSTSGCGSLILEMGALSR  429

Query  1200  LTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKA  1021
             LTGDP +E AALRALRKLWSMRSSLNL+G+TLDV +G WIE+S+GIGAGVDSFYEYL+KA
Sbjct  430   LTGDPRYEAAALRALRKLWSMRSSLNLVGSTLDVLSGNWIEYSSGIGAGVDSFYEYLIKA  489

Query  1020  YILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVG  841
             YILFG DE+W MF SAYLAVQKYFRHGPWYH+AD+RTG+AT+WQLTSLQAFWPGVQ L+G
Sbjct  490   YILFGSDEYWDMFHSAYLAVQKYFRHGPWYHEADIRTGEATHWQLTSLQAFWPGVQTLLG  549

Query  840   DVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDP  661
             DV AAN SHREF++VW++FGVLPERYLLD+ +LHPTEKYYPLRPEFAESTFYLYQATKDP
Sbjct  550   DVAAANLSHREFYNVWQRFGVLPERYLLDYGILHPTEKYYPLRPEFAESTFYLYQATKDP  609

Query  660   WYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLV  481
             WY+EVGE II SLN YTKV+GGFAS+RDV+TM LEDHQHSFFL+ETCKYL+LL+DDSFL 
Sbjct  610   WYLEVGESIIGSLNYYTKVEGGFASIRDVSTMNLEDHQHSFFLSETCKYLFLLYDDSFLR  669

Query  480   NRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHE  301
             N+NYIFTTEGHPLPV+STWH++     +P+NWT  K      RASA+S ++CP T    +
Sbjct  670   NKNYIFTTEGHPLPVMSTWHEKTPRLDVPTNWTVVKDGNQPIRASALSSKVCPETIF-RQ  728

Query  300   QEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
                   ESACHIPD    HRC  D+DCG++S TC+RR+CSMAGYCGLWL +
Sbjct  729   NVGSPWESACHIPDVFPSHRCRADDDCGIESVTCKRRTCSMAGYCGLWLAV  779



>ref|XP_010913488.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X3 [Elaeis 
guineensis]
Length=549

 Score =   841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/516 (80%), Positives = 464/516 (90%), Gaps = 2/516 (0%)
 Frame = -1

Query  1695  HDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWL  1516
             HDELKPLTKT+TDSLSELGNLKLE+LPQ Y+GSAL+LIESLSSLV+LGN TEF++ VLWL
Sbjct  35    HDELKPLTKTFTDSLSELGNLKLEYLPQNYNGSALSLIESLSSLVVLGNFTEFQRGVLWL  94

Query  1515  SVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFL  1336
             S NL+FDVDAR+NLFECNIRVLGGL+SAHILATD+ +RL  G YKNQLL+LAEDLG+RFL
Sbjct  95    SDNLTFDVDARVNLFECNIRVLGGLISAHILATDTKSRLDHGLYKNQLLNLAEDLGQRFL  154

Query  1335  PAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRAL  1156
             PAFD+PTGLPYAWINLK GVM+NETTETSTSGCGSLILEMGALSRLTGD  +E  ALRAL
Sbjct  155   PAFDSPTGLPYAWINLKNGVMENETTETSTSGCGSLILEMGALSRLTGDSKYEAVALRAL  214

Query  1155  RKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQS  976
             RKLWSMRSSLNLLGTTLDV TGEWIE S+GIGAGVDSFYEYL+KAYILFG DE+W +F S
Sbjct  215   RKLWSMRSSLNLLGTTLDVVTGEWIECSSGIGAGVDSFYEYLIKAYILFGSDEYWDIFHS  274

Query  975   AYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHV  796
             AYLAVQKYFRHGPWYH+ADMRTG+ATYWQLTSLQAFWPG+Q+LVGD+ AANSSHREFFHV
Sbjct  275   AYLAVQKYFRHGPWYHEADMRTGRATYWQLTSLQAFWPGLQILVGDIAAANSSHREFFHV  334

Query  795   WKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQ  616
             W++FGVLPERYLLDH MLHPTE+YYPLRPE AESTFYLYQATKDPWYMEVGE IINSLN 
Sbjct  335   WQRFGVLPERYLLDHDMLHPTERYYPLRPELAESTFYLYQATKDPWYMEVGESIINSLNS  394

Query  615   YTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPV  436
             Y KV GGFAS+RDV TM+ EDHQHSFFL+ETCKYLYLLFDDSFL ++NY+FTTEGH LP+
Sbjct  395   YAKVDGGFASIRDVMTMQQEDHQHSFFLSETCKYLYLLFDDSFLADKNYVFTTEGHLLPI  454

Query  435   LSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDT  256
              S+WH++L E+Y+ SNWTS K+      ASAMS ++CPA  +        +ESACH+PD+
Sbjct  455   RSSWHEKLPESYI-SNWTSIKNGNQGTHASAMSLQVCPAMFIGGNIT-PWVESACHVPDS  512

Query  255   RGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
             R DHRC+TD+DCG+DSTTCRRR+CSMAGYCGLWL I
Sbjct  513   RVDHRCITDDDCGIDSTTCRRRTCSMAGYCGLWLFI  548



>ref|XP_008646240.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X2 [Zea 
mays]
 ref|XP_008646241.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X2 [Zea 
mays]
Length=547

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/520 (76%), Positives = 457/520 (88%), Gaps = 1/520 (0%)
 Frame = -1

Query  1713  MMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFE  1534
             M +AFPHDELKPLTK++TDSLSELGNL LEHLPQ YSGSALTL+ESLSSLV+LGN TEFE
Sbjct  1     MTYAFPHDELKPLTKSFTDSLSELGNLNLEHLPQDYSGSALTLVESLSSLVVLGNLTEFE  60

Query  1533  KAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAED  1354
             + VLWLS NL+FDVDARINLFECNIR+LGGL+SAHILA D +++   G Y++QLL LAE 
Sbjct  61    RGVLWLSENLTFDVDARINLFECNIRLLGGLISAHILAKDYSSQFKHGLYQDQLLRLAES  120

Query  1353  LGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEI  1174
             LG RFLPAF+TPTGLPY+WINLK GVM+NETTETSTSGCGSLILEMG LSRLTGD  +E 
Sbjct  121   LGNRFLPAFETPTGLPYSWINLKYGVMENETTETSTSGCGSLILEMGVLSRLTGDSRYEA  180

Query  1173  AALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEF  994
             AALRALRKLWSMRSSLNL+GTTLDV TG+WI++S+GIGAGVDSFYEYL+KAYILFG DE+
Sbjct  181   AALRALRKLWSMRSSLNLVGTTLDVFTGKWIQYSSGIGAGVDSFYEYLIKAYILFGSDEY  240

Query  993   WKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSH  814
             W MF SAYLAVQKYFRHGPWYH+ADMRTG+AT+WQLTSLQAFWPG+Q L+GDV AAN SH
Sbjct  241   WDMFHSAYLAVQKYFRHGPWYHEADMRTGEATHWQLTSLQAFWPGLQTLLGDVTAANLSH  300

Query  813   REFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELI  634
             REF+++W++FGVLPERYLLD+ MLHPTEKYYPLRPEFAESTFYLYQATKDPWY+EVGE I
Sbjct  301   REFYNIWQRFGVLPERYLLDYGMLHPTEKYYPLRPEFAESTFYLYQATKDPWYLEVGETI  360

Query  633   INSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTE  454
             + SLN YTKV GGFAS+RDV+TM+LEDHQHSFFL+ETCKYL+LL+DDSFL N+NYIFTTE
Sbjct  361   VRSLNYYTKVDGGFASIRDVSTMKLEDHQHSFFLSETCKYLFLLYDDSFLRNQNYIFTTE  420

Query  453   GHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESA  274
             GHPLP+ STWH++   AY+PSNWTS K E    RASA+S ++CP T           ESA
Sbjct  421   GHPLPIRSTWHEKFPAAYVPSNWTSVKDEIQPIRASALSSQVCPETIFGRSVG-TPWESA  479

Query  273   CHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWL  154
             CH+PD    HRC TD+DCG+++ TC++R+CSMAGYCGL+ 
Sbjct  480   CHVPDAHASHRCRTDDDCGIEAITCKKRTCSMAGYCGLFF  519



>ref|XP_010913487.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X2 [Elaeis 
guineensis]
Length=555

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/538 (77%), Positives = 466/538 (87%), Gaps = 22/538 (4%)
 Frame = -1

Query  1761  MSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLI  1582
             M +KVRKMFYHAYENYM HAFPHDELKPLTKT+TDSLSELGNLKLE+LPQ Y+GSAL+LI
Sbjct  39    MREKVRKMFYHAYENYMAHAFPHDELKPLTKTFTDSLSELGNLKLEYLPQNYNGSALSLI  98

Query  1581  ESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNR  1402
             ESLSSLV+LGN TEF++ VLWLS NL+FDVDAR+NLFECNIRVLGGL+SAHILATD+ +R
Sbjct  99    ESLSSLVVLGNFTEFQRGVLWLSDNLTFDVDARVNLFECNIRVLGGLISAHILATDTKSR  158

Query  1401  LVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLIL  1222
             L  G YKNQLL+LAEDLG+RFLPAFD+PTGLPYAWINLK GVM+NETTETSTSGCGSLIL
Sbjct  159   LDHGLYKNQLLNLAEDLGQRFLPAFDSPTGLPYAWINLKNGVMENETTETSTSGCGSLIL  218

Query  1221  EMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSF  1042
             EMGALSRLTGD  +E  ALRALRKLWSMRSSLNLLG                    VDSF
Sbjct  219   EMGALSRLTGDSKYEAVALRALRKLWSMRSSLNLLG--------------------VDSF  258

Query  1041  YEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWP  862
             YEYL+KAYILFG DE+W +F SAYLAVQKYFRHGPWYH+ADMRTG+ATYWQLTSLQAFWP
Sbjct  259   YEYLIKAYILFGSDEYWDIFHSAYLAVQKYFRHGPWYHEADMRTGRATYWQLTSLQAFWP  318

Query  861   GVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYL  682
             G+Q+LVGD+ AANSSHREFFHVW++FGVLPERYLLDH MLHPTE+YYPLRPE AESTFYL
Sbjct  319   GLQILVGDIAAANSSHREFFHVWQRFGVLPERYLLDHDMLHPTERYYPLRPELAESTFYL  378

Query  681   YQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLL  502
             YQATKDPWYMEVGE IINSLN Y KV GGFAS+RDV TM+ EDHQHSFFL+ETCKYLYLL
Sbjct  379   YQATKDPWYMEVGESIINSLNSYAKVDGGFASIRDVMTMQQEDHQHSFFLSETCKYLYLL  438

Query  501   FDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICP  322
             FDDSFL ++NY+FTTEGH LP+ S+WH++L E+Y+ SNWTS K+      ASAMS ++CP
Sbjct  439   FDDSFLADKNYVFTTEGHLLPIRSSWHEKLPESYI-SNWTSIKNGNQGTHASAMSLQVCP  497

Query  321   ATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
             A  +        +ESACH+PD+R DHRC+TD+DCG+DSTTCRRR+CSMAGYCGLWL I
Sbjct  498   AMFIGGNIT-PWVESACHVPDSRVDHRCITDDDCGIDSTTCRRRTCSMAGYCGLWLFI  554



>ref|XP_008453130.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X2 [Cucumis 
melo]
Length=531

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/493 (82%), Positives = 448/493 (91%), Gaps = 1/493 (0%)
 Frame = -1

Query  1629  LEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVL  1450
             LEHLPQ Y+GSALTLIESLSSLVILGN+TEF+KAVLWLS NL FDVDARINLFECNIRVL
Sbjct  37    LEHLPQNYTGSALTLIESLSSLVILGNNTEFQKAVLWLSENLHFDVDARINLFECNIRVL  96

Query  1449  GGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQ  1270
             GGL+SAH+LATDSTNRL + +YKNQLL LAEDLG RFLPAF+TPTGLPYAWINLK GV++
Sbjct  97    GGLISAHVLATDSTNRLAKQSYKNQLLVLAEDLGNRFLPAFNTPTGLPYAWINLKHGVVE  156

Query  1269  NettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATG  1090
             +ETTETSTSGCGSLILEMGALSRLTGDP FE AALRALRKLWSMRSSLNLLGTTLDV TG
Sbjct  157   DETTETSTSGCGSLILEMGALSRLTGDPRFEYAALRALRKLWSMRSSLNLLGTTLDVETG  216

Query  1089  EWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRT  910
             EWIEFS+GIGAGVDSFYEYL+KA++LFG +EFW+MF +AYLAVQKYFRHGPWYH+ADMRT
Sbjct  217   EWIEFSSGIGAGVDSFYEYLLKAHVLFGKEEFWRMFHTAYLAVQKYFRHGPWYHEADMRT  276

Query  909   GKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTE  730
             G+ATYWQLTSLQAFWPG+QVLVGD+ AANSSHREFF+VW+K+GVLPERYLLD QMLHPTE
Sbjct  277   GRATYWQLTSLQAFWPGLQVLVGDIPAANSSHREFFYVWEKYGVLPERYLLDRQMLHPTE  336

Query  729   KYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDH  550
             KYYPLRPE AESTFYLYQATKDPWY EVGE I+ SL  +TKV+GGFASVRDVTTM+LEDH
Sbjct  337   KYYPLRPELAESTFYLYQATKDPWYFEVGESIMKSLISHTKVEGGFASVRDVTTMQLEDH  396

Query  549   QHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKH  370
             QHSFFL+ETCKYLYLLFDDSFLV++NYIFTTEGHPLPVLS+WH+RL E Y  +N TS K 
Sbjct  397   QHSFFLSETCKYLYLLFDDSFLVDQNYIFTTEGHPLPVLSSWHERLPEVYGLTNGTSIKG  456

Query  369   EKHRKRASAMSQRICPATTLSHEQE-YQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRR  193
             E   +R SAMS ++CPAT+L+   +  Q +ESACHI D R DH+C +DE+CGVDSTTCRR
Sbjct  457   ENSSRRLSAMSLQVCPATSLNTAGDGGQQIESACHILDARADHKCFSDEECGVDSTTCRR  516

Query  192   RSCSMAGYCGLWL  154
             RSCS +GYCG WL
Sbjct  517   RSCSSSGYCGQWL  529



>ref|XP_009419877.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=509

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/471 (84%), Positives = 436/471 (93%), Gaps = 2/471 (0%)
 Frame = -1

Query  1779  AARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSG  1600
             +A++  M +KVRKMFYHAYENYM+HAFPHDELKPLTKT+TDSLSELGNLKLE LPQ Y+G
Sbjct  33    SAKKVYMREKVRKMFYHAYENYMVHAFPHDELKPLTKTFTDSLSELGNLKLERLPQNYNG  92

Query  1599  SALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILA  1420
             SALTL+ESLSSLV+LGN+TEFE+ VLWLS NL+FDVDAR+NLFECNIRVLGGLVSAHILA
Sbjct  93    SALTLVESLSSLVVLGNYTEFERGVLWLSDNLTFDVDARVNLFECNIRVLGGLVSAHILA  152

Query  1419  TDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSG  1240
             TDS +RL  G YKNQLLDLA DLG+RFLPAF+TPTGLPYAWINLK GVM++ETTETSTSG
Sbjct  153   TDSKSRLEHGLYKNQLLDLARDLGQRFLPAFETPTGLPYAWINLKYGVMEDETTETSTSG  212

Query  1239  C--GSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTG  1066
             C  GSLILEMGALSRLTGDP F+ AALRALRKLWSMRS LNLLGTTLDV TG+WIE+S+G
Sbjct  213   CASGSLILEMGALSRLTGDPRFQAAALRALRKLWSMRSPLNLLGTTLDVVTGDWIEYSSG  272

Query  1065  IGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQL  886
             +GAGVDSFYEYL+KAYILFG DEFW MF S+YLAVQKYFRHGPWYH+ADMRTGKATYWQL
Sbjct  273   VGAGVDSFYEYLIKAYILFGNDEFWDMFHSSYLAVQKYFRHGPWYHEADMRTGKATYWQL  332

Query  885   TSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPE  706
             TSLQAFWPG+Q+LVGD+ AANSSHREFF+VW KFGVLPERYLLDH MLHPTEKYYPLRPE
Sbjct  333   TSLQAFWPGLQILVGDIAAANSSHREFFYVWDKFGVLPERYLLDHGMLHPTEKYYPLRPE  392

Query  705   FAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAE  526
              AESTFYLYQAT+DPWYMEVGE IINSLN YT+V GGFASVRDVTTMELEDHQHSFFL+E
Sbjct  393   LAESTFYLYQATRDPWYMEVGETIINSLNYYTRVDGGFASVRDVTTMELEDHQHSFFLSE  452

Query  525   TCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFK  373
             TCKYLYLLFDDSFL  +NY+FTTEGHPLP+  +WH++L EAY+P+NWTS K
Sbjct  453   TCKYLYLLFDDSFLAGQNYVFTTEGHPLPIRGSWHEKLPEAYIPANWTSVK  503



>ref|XP_010913489.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X4 [Elaeis 
guineensis]
Length=510

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/463 (83%), Positives = 428/463 (92%), Gaps = 1/463 (0%)
 Frame = -1

Query  1761  MSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLI  1582
             M +KVRKMFYHAYENYM HAFPHDELKPLTKT+TDSLSELGNLKLE+LPQ Y+GSAL+LI
Sbjct  39    MREKVRKMFYHAYENYMAHAFPHDELKPLTKTFTDSLSELGNLKLEYLPQNYNGSALSLI  98

Query  1581  ESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNR  1402
             ESLSSLV+LGN TEF++ VLWLS NL+FDVDAR+NLFECNIRVLGGL+SAHILATD+ +R
Sbjct  99    ESLSSLVVLGNFTEFQRGVLWLSDNLTFDVDARVNLFECNIRVLGGLISAHILATDTKSR  158

Query  1401  LVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLIL  1222
             L  G YKNQLL+LAEDLG+RFLPAFD+PTGLPYAWINLK GVM+NETTETSTSGCGSLIL
Sbjct  159   LDHGLYKNQLLNLAEDLGQRFLPAFDSPTGLPYAWINLKNGVMENETTETSTSGCGSLIL  218

Query  1221  EMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSF  1042
             EMGALSRLTGD  +E  ALRALRKLWSMRSSLNLLGTTLDV TGEWIE S+GIGAGVDSF
Sbjct  219   EMGALSRLTGDSKYEAVALRALRKLWSMRSSLNLLGTTLDVVTGEWIECSSGIGAGVDSF  278

Query  1041  YEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWP  862
             YEYL+KAYILFG DE+W +F SAYLAVQKYFRHGPWYH+ADMRTG+ATYWQLTSLQAFWP
Sbjct  279   YEYLIKAYILFGSDEYWDIFHSAYLAVQKYFRHGPWYHEADMRTGRATYWQLTSLQAFWP  338

Query  861   GVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYL  682
             G+Q+LVGD+ AANSSHREFFHVW++FGVLPERYLLDH MLHPTE+YYPLRPE AESTFYL
Sbjct  339   GLQILVGDIAAANSSHREFFHVWQRFGVLPERYLLDHDMLHPTERYYPLRPELAESTFYL  398

Query  681   YQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLL  502
             YQATKDPWYMEVGE IINSLN Y KV GGFAS+RDV TM+ EDHQHSFFL+ETCKYLYLL
Sbjct  399   YQATKDPWYMEVGESIINSLNSYAKVDGGFASIRDVMTMQQEDHQHSFFLSETCKYLYLL  458

Query  501   FDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFK  373
             FDDSFL ++NY+FTTEGH LP+ S+WH++L E+Y+ SNWTS K
Sbjct  459   FDDSFLADKNYVFTTEGHLLPIRSSWHEKLPESYI-SNWTSIK  500



>ref|XP_010913490.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X5 [Elaeis 
guineensis]
Length=480

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/469 (79%), Positives = 418/469 (89%), Gaps = 2/469 (0%)
 Frame = -1

Query  1554  GNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQ  1375
             GN TEF++ VLWLS NL+FDVDAR+NLFECNIRVLGGL+SAHILATD+ +RL  G YKNQ
Sbjct  13    GNFTEFQRGVLWLSDNLTFDVDARVNLFECNIRVLGGLISAHILATDTKSRLDHGLYKNQ  72

Query  1374  LLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLT  1195
             LL+LAEDLG+RFLPAFD+PTGLPYAWINLK GVM+NETTETSTSGCGSLILEMGALSRLT
Sbjct  73    LLNLAEDLGQRFLPAFDSPTGLPYAWINLKNGVMENETTETSTSGCGSLILEMGALSRLT  132

Query  1194  GDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYI  1015
             GD  +E  ALRALRKLWSMRSSLNLLGTTLDV TGEWIE S+GIGAGVDSFYEYL+KAYI
Sbjct  133   GDSKYEAVALRALRKLWSMRSSLNLLGTTLDVVTGEWIECSSGIGAGVDSFYEYLIKAYI  192

Query  1014  LFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDV  835
             LFG DE+W +F SAYLAVQKYFRHGPWYH+ADMRTG+ATYWQLTSLQAFWPG+Q+LVGD+
Sbjct  193   LFGSDEYWDIFHSAYLAVQKYFRHGPWYHEADMRTGRATYWQLTSLQAFWPGLQILVGDI  252

Query  834   DAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWY  655
              AANSSHREFFHVW++FGVLPERYLLDH MLHPTE+YYPLRPE AESTFYLYQATKDPWY
Sbjct  253   AAANSSHREFFHVWQRFGVLPERYLLDHDMLHPTERYYPLRPELAESTFYLYQATKDPWY  312

Query  654   MEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNR  475
             MEVGE IINSLN Y KV GGFAS+RDV TM+ EDHQHSFFL+ETCKYLYLLFDDSFL ++
Sbjct  313   MEVGESIINSLNSYAKVDGGFASIRDVMTMQQEDHQHSFFLSETCKYLYLLFDDSFLADK  372

Query  474   NYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQE  295
             NY+FTTEGH LP+ S+WH++L E+Y+ SNWTS K+      ASAMS ++CPA  +     
Sbjct  373   NYVFTTEGHLLPIRSSWHEKLPESYI-SNWTSIKNGNQGTHASAMSLQVCPAMFIGGNIT  431

Query  294   YQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
                +ESACH+PD+R DHRC+TD+DCG+DSTTCRRR+CSMAGYCGLWL I
Sbjct  432   -PWVESACHVPDSRVDHRCITDDDCGIDSTTCRRRTCSMAGYCGLWLFI  479



>ref|XP_011071787.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X2 [Sesamum 
indicum]
Length=515

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/574 (71%), Positives = 456/574 (79%), Gaps = 66/574 (11%)
 Frame = -1

Query  1866  RKRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDE  1687
             R   LI +LI  + +   S S  DP    AA++KRMS+KVRKMFYHAY+NYMM+AFPHDE
Sbjct  7     RTWALIFLLIISNFYIETSASKLDP---FAAKKKRMSEKVRKMFYHAYDNYMMYAFPHDE  63

Query  1686  LKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVN  1507
             LKPLTK++TDSLSELGNLKLEHLPQ Y+GSAL+LIESLSSL ILGNHTE           
Sbjct  64    LKPLTKSFTDSLSELGNLKLEHLPQGYNGSALSLIESLSSLAILGNHTE-----------  112

Query  1506  LSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAF  1327
                                                     ++  +L L+E+L      +F
Sbjct  113   ----------------------------------------FEKAVLWLSENL------SF  126

Query  1326  DTPTGLPYAWINL-KRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRK  1150
             D       A INL + GVM+NETTETSTSGCGSLILEMGALS LTGDP FE AALRAL K
Sbjct  127   DVD-----ARINLFEYGVMENETTETSTSGCGSLILEMGALSHLTGDPRFESAALRALHK  181

Query  1149  LWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAY  970
             LWSMRSSLNLLGTTLDV TGEWIE S+GIGAGVDSFYEYL+KA++LFG DE W+MFQSAY
Sbjct  182   LWSMRSSLNLLGTTLDVETGEWIEHSSGIGAGVDSFYEYLLKAHLLFGRDELWRMFQSAY  241

Query  969   LAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWK  790
             LAVQKYFRHGPWYH+ADMRTG+ATYWQLTSLQAFWPG+QVLVGDV AANSSHREFF+VW+
Sbjct  242   LAVQKYFRHGPWYHEADMRTGRATYWQLTSLQAFWPGLQVLVGDVPAANSSHREFFYVWQ  301

Query  789   KFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYT  610
             KFGVLPERYLLD QMLHPTEKYYPLRPE AESTFYLYQATKDPWY+EVGE I++SLN +T
Sbjct  302   KFGVLPERYLLDRQMLHPTEKYYPLRPELAESTFYLYQATKDPWYLEVGESIVDSLNLHT  361

Query  609   KVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLS  430
             +V+GGFAS+RDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVN+NYIFTTEGHPLP+LS
Sbjct  362   RVEGGFASIRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNKNYIFTTEGHPLPILS  421

Query  429   TWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRG  250
             +WH+RL EAYLPSNWTS K E+  KRASAMS RICPA+TL++      LES CHIPD R 
Sbjct  422   SWHERLPEAYLPSNWTSVKSEEQPKRASAMSLRICPASTLNYRNSRPPLESVCHIPDARS  481

Query  249   DHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
             DHRCL+DEDCGVDSTTCRRRSCSMAGYCGLWL I
Sbjct  482   DHRCLSDEDCGVDSTTCRRRSCSMAGYCGLWLSI  515



>ref|XP_010678692.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010678693.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010678694.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010678695.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010678696.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=473

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/472 (79%), Positives = 417/472 (88%), Gaps = 6/472 (1%)
 Frame = -1

Query  1560  ILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYK  1381
             +L ++ EFE+ V WLS NL+FDVDAR+NLFECNIRVLGGLVSAH+LA DS NR  QGTYK
Sbjct  7     LLSHYPEFERGVSWLSENLTFDVDARVNLFECNIRVLGGLVSAHMLAIDSRNRFSQGTYK  66

Query  1380  NQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSR  1201
             N+LL LAEDLGRR LPAF TPTGLPYAWINLK GVM NETTETSTS  GSLILEMGALSR
Sbjct  67    NELLILAEDLGRRLLPAFSTPTGLPYAWINLKYGVMANETTETSTSCSGSLILEMGALSR  126

Query  1200  LTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKA  1021
             LTGDP FE AALRALRKLWS+RSS+NLLGTT+DV +G+WIE+S+GIGAGVDSFYEYLVKA
Sbjct  127   LTGDPQFEDAALRALRKLWSLRSSMNLLGTTVDVVSGKWIEYSSGIGAGVDSFYEYLVKA  186

Query  1020  YILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVG  841
             YILFG +E+W+MFQSAY+AVQKYFRHGPWYH+ADMRTG ATYWQLTSLQAFWPG+QVLVG
Sbjct  187   YILFGKEEYWRMFQSAYVAVQKYFRHGPWYHEADMRTGHATYWQLTSLQAFWPGLQVLVG  246

Query  840   DVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDP  661
             D+ AANSSHREF  VW++FGVLPERYLLDHQMLHPTEKYYPLRPE AESTFYLYQATKDP
Sbjct  247   DIAAANSSHREFVKVWERFGVLPERYLLDHQMLHPTEKYYPLRPELAESTFYLYQATKDP  306

Query  660   WYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLV  481
             WY+EVGE I +SLN YTKV GGFASVRDV+TM LEDHQHSFFL+ETCKYLYLL+DDSFLV
Sbjct  307   WYLEVGESITDSLNLYTKVDGGFASVRDVSTMVLEDHQHSFFLSETCKYLYLLYDDSFLV  366

Query  480   NRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHE  301
             ++NY+FTTEGHPLPVLS W DRL E Y  +N+T  +     +RASAMS +ICPA T S  
Sbjct  367   DQNYVFTTEGHPLPVLSAWQDRLPEVYTSANYTFIQ-----RRASAMSLQICPAMTSSTS  421

Query  300   QEY-QHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAGYCGLWLLI  148
             +E  +  ESACHI DTR DHRCLTDEDCGVD+TTCRRRSCS+AG+CGLWL +
Sbjct  422   REVDEKHESACHICDTRRDHRCLTDEDCGVDATTCRRRSCSIAGFCGLWLYL  473



>ref|XP_006476723.1| PREDICTED: probable alpha-mannosidase I MNS5-like isoform X3 
[Citrus sinensis]
Length=462

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/454 (82%), Positives = 415/454 (91%), Gaps = 4/454 (1%)
 Frame = -1

Query  1872  IMRKRVLICMLIFL---STFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHA  1702
             ++ ++V+  +L+FL    + FP+S S  D  +  +A+++ M +KV  MFYHAYENY+ HA
Sbjct  1     MLPRQVVKWILVFLVISPSLFPVSVSEADS-SYWSAKKRHMKKKVHDMFYHAYENYLTHA  59

Query  1701  FPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVL  1522
             FPHDELKPL+K++TDSLSELGNLKLEHLPQ Y+GSALTLIES+SSLVI+GN+TEFE+AVL
Sbjct  60    FPHDELKPLSKSFTDSLSELGNLKLEHLPQHYNGSALTLIESMSSLVIMGNNTEFERAVL  119

Query  1521  WLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRR  1342
             WLS NL+FDVDARINLFECNIRVLGGLVSAHILATDS NRLVQG+YKNQLL LAEDLGRR
Sbjct  120   WLSENLNFDVDARINLFECNIRVLGGLVSAHILATDSANRLVQGSYKNQLLTLAEDLGRR  179

Query  1341  FLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALR  1162
             FLPAFDTPTGLPYAWINLK GVM+NETTETSTSGCGSLILEMGALSRLTGDPI+E AALR
Sbjct  180   FLPAFDTPTGLPYAWINLKYGVMENETTETSTSGCGSLILEMGALSRLTGDPIYESAALR  239

Query  1161  ALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMF  982
             ALR+LWSMRSSLNLLGTTLDV TGEWIE+S+GIGAGVDSFYEYL KA+ILFG ++FW+MF
Sbjct  240   ALRRLWSMRSSLNLLGTTLDVTTGEWIEYSSGIGAGVDSFYEYLFKAHILFGKEDFWRMF  299

Query  981   QSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFF  802
              SAYLAVQKYFRHGPWYH+ADMR GKATYWQLTSLQAFWPG+QVLVGD+ AANSSHREF 
Sbjct  300   HSAYLAVQKYFRHGPWYHEADMRNGKATYWQLTSLQAFWPGLQVLVGDIAAANSSHREFV  359

Query  801   HVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSL  622
             HVWKKFGVLPERYLLDH MLHPTEKYYPLRPE AESTFYLYQATKDPWY+EVGE I+NSL
Sbjct  360   HVWKKFGVLPERYLLDHLMLHPTEKYYPLRPELAESTFYLYQATKDPWYLEVGESIVNSL  419

Query  621   NQYTKVQGGFASVRDVTTMELEDHQHSFFLAETC  520
             N YTKV GGFAS+RDVTTM+LEDHQHSFFLAET 
Sbjct  420   NSYTKVDGGFASIRDVTTMQLEDHQHSFFLAETS  453



>ref|XP_009419878.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X4 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419879.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=485

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/427 (85%), Positives = 394/427 (92%), Gaps = 2/427 (0%)
 Frame = -1

Query  1779  AARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSG  1600
             +A++  M +KVRKMFYHAYENYM+HAFPHDELKPLTKT+TDSLSELGNLKLE LPQ Y+G
Sbjct  33    SAKKVYMREKVRKMFYHAYENYMVHAFPHDELKPLTKTFTDSLSELGNLKLERLPQNYNG  92

Query  1599  SALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILA  1420
             SALTL+ESLSSLV+LGN+TEFE+ VLWLS NL+FDVDAR+NLFECNIRVLGGLVSAHILA
Sbjct  93    SALTLVESLSSLVVLGNYTEFERGVLWLSDNLTFDVDARVNLFECNIRVLGGLVSAHILA  152

Query  1419  TDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSG  1240
             TDS +RL  G YKNQLLDLA DLG+RFLPAF+TPTGLPYAWINLK GVM++ETTETSTSG
Sbjct  153   TDSKSRLEHGLYKNQLLDLARDLGQRFLPAFETPTGLPYAWINLKYGVMEDETTETSTSG  212

Query  1239  C--GSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTG  1066
             C  GSLILEMGALSRLTGDP F+ AALRALRKLWSMRS LNLLGTTLDV TG+WIE+S+G
Sbjct  213   CASGSLILEMGALSRLTGDPRFQAAALRALRKLWSMRSPLNLLGTTLDVVTGDWIEYSSG  272

Query  1065  IGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQL  886
             +GAGVDSFYEYL+KAYILFG DEFW MF S+YLAVQKYFRHGPWYH+ADMRTGKATYWQL
Sbjct  273   VGAGVDSFYEYLIKAYILFGNDEFWDMFHSSYLAVQKYFRHGPWYHEADMRTGKATYWQL  332

Query  885   TSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPE  706
             TSLQAFWPG+Q+LVGD+ AANSSHREFF+VW KFGVLPERYLLDH MLHPTEKYYPLRPE
Sbjct  333   TSLQAFWPGLQILVGDIAAANSSHREFFYVWDKFGVLPERYLLDHGMLHPTEKYYPLRPE  392

Query  705   FAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAE  526
              AESTFYLYQAT+DPWYMEVGE IINSLN YT+V GGFASVRDVTTMELEDHQHSFFL+E
Sbjct  393   LAESTFYLYQATRDPWYMEVGETIINSLNYYTRVDGGFASVRDVTTMELEDHQHSFFLSE  452

Query  525   TCKYLYL  505
             T   L L
Sbjct  453   TTMSLLL  459



>ref|XP_002994551.1| hypothetical protein SELMODRAFT_229806 [Selaginella moellendorffii]
 gb|EFJ04384.1| hypothetical protein SELMODRAFT_229806 [Selaginella moellendorffii]
Length=534

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/542 (65%), Positives = 420/542 (77%), Gaps = 25/542 (5%)
 Frame = -1

Query  1791  PNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQ  1612
             P P    R  + + VR MF+HAY+NYM +AFPHDELKPL+ +YTDSL ELGNLKLE L +
Sbjct  17    PIPRFEERAALKEDVRNMFHHAYDNYMKYAFPHDELKPLSLSYTDSLEELGNLKLERLSE  76

Query  1611  KYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSA  1432
              YSGSALTL+ESLSSL ++ N +EFEK VLWL+ NLSFDVD R+N+FECNIR+LGGL+SA
Sbjct  77    TYSGSALTLVESLSSLAVMKNSSEFEKGVLWLAENLSFDVDVRVNVFECNIRLLGGLISA  136

Query  1431  HILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettet  1252
             H LA DS  +L+   Y +QLL LAEDLG R LPAFDTPTG+PYAWINLK GV  NETTET
Sbjct  137   HFLAKDSRKQLMSNGYNDQLLMLAEDLGLRLLPAFDTPTGIPYAWINLKTGVHPNETTET  196

Query  1251  stSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFS  1072
             STSGCGSL+LEMGALSRLTG+P FE  ALRALRKLWSMRS LNLLGT LD+ TG W E+S
Sbjct  197   STSGCGSLVLEMGALSRLTGNPQFENLALRALRKLWSMRSELNLLGTNLDINTGRWTEYS  256

Query  1071  TGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYW  892
             +GIGAG+DSFYEYL                  AY AVQ+++R+G WYHDADMRTGKATYW
Sbjct  257   SGIGAGIDSFYEYL-----------------DAYRAVQQHYRYGSWYHDADMRTGKATYW  299

Query  891   QLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLR  712
             Q TSLQAFWPG+QVL+GD+ AAN++HREF  +W+ FG+ PERYLLD   +HPTE+YYPLR
Sbjct  300   QFTSLQAFWPGLQVLIGDIAAANATHREFLRLWEMFGIFPERYLLDAGKVHPTERYYPLR  359

Query  711   PEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFL  532
             PE AESTF+LYQATKDPWY++VG+ I+NS+N +++V GGFASVRDV TM+LEDHQHSFFL
Sbjct  360   PELAESTFFLYQATKDPWYLDVGKKIMNSINVFSRVPGGFASVRDVMTMKLEDHQHSFFL  419

Query  531   AETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKR  352
             +ETCKYLYLLFDDSFL   N++F+TEGH  PV  +W  +     L S    F  +K    
Sbjct  420   SETCKYLYLLFDDSFLDGENHVFSTEGHLFPVNQSWQQQPRPKIL-SRLRLFSRQKPID-  477

Query  351   ASAMSQRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAG  172
              SA++ + CP  +         +ESACHIPDTR DHRC++  DCGVD+TTC +RSCS AG
Sbjct  478   TSALTSKTCPRLSRG------SVESACHIPDTRADHRCVSRSDCGVDATTCAKRSCSFAG  531

Query  171   YC  166
             YC
Sbjct  532   YC  533



>ref|XP_002975540.1| hypothetical protein SELMODRAFT_228348 [Selaginella moellendorffii]
 gb|EFJ23169.1| hypothetical protein SELMODRAFT_228348 [Selaginella moellendorffii]
Length=534

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/542 (65%), Positives = 420/542 (77%), Gaps = 25/542 (5%)
 Frame = -1

Query  1791  PNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQ  1612
             P P    R  + + VR MF+HAY+NYM +AFPHDELKPL+ +YTDSL ELGNLKLE L +
Sbjct  17    PIPRFEERAALKEDVRNMFHHAYDNYMKYAFPHDELKPLSLSYTDSLEELGNLKLERLSE  76

Query  1611  KYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSA  1432
              YSGSALTL+ESLSSL ++ N +EFEK VLWL+ NLSFDVD R+N+FECNIR+LGGL+SA
Sbjct  77    TYSGSALTLVESLSSLAVMKNSSEFEKGVLWLAENLSFDVDVRVNVFECNIRLLGGLISA  136

Query  1431  HILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettet  1252
             H LA DS  +L+   Y +QLL LAEDLG R LPAFDTPTG+PYAWINLK GV  NETTET
Sbjct  137   HFLAKDSRKQLMSNGYNDQLLMLAEDLGLRLLPAFDTPTGIPYAWINLKTGVHPNETTET  196

Query  1251  stSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFS  1072
             STSGCGSL+LEMGALSRLTG+P FE  ALRALRKLWSMRS LNLLGT LD+ TG W E+S
Sbjct  197   STSGCGSLVLEMGALSRLTGNPQFENLALRALRKLWSMRSELNLLGTNLDINTGRWTEYS  256

Query  1071  TGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYW  892
             +GIGAG+DSFYEYL                  AY AVQ+++R+G WYHDADMRTGKATYW
Sbjct  257   SGIGAGIDSFYEYL-----------------DAYRAVQQHYRYGSWYHDADMRTGKATYW  299

Query  891   QLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLR  712
             Q TSLQAFWPG+QVL+GD+ AAN++HREF  +W+ FG+ PERYLLD   +HPTE+YYPLR
Sbjct  300   QFTSLQAFWPGLQVLIGDIAAANATHREFLRLWEMFGIFPERYLLDAGKVHPTERYYPLR  359

Query  711   PEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFL  532
             PE AESTF+LYQATKDPWY++VG+ I+NS+N +++V GGFASVRDV TM+LEDHQHSFFL
Sbjct  360   PELAESTFFLYQATKDPWYLDVGKKIMNSINVFSRVPGGFASVRDVMTMKLEDHQHSFFL  419

Query  531   AETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKR  352
             +ETCKYLYLLFDDSFL   N++F+TEGH  PV  +W  +     L S    F  +K    
Sbjct  420   SETCKYLYLLFDDSFLDGENHVFSTEGHLFPVNQSWQQQPRPKIL-SRLRLFSRQKPID-  477

Query  351   ASAMSQRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAG  172
              SA++ + CP  +         +ESACHIPDTR DHRC++  DCGVD+TTC +RSCS AG
Sbjct  478   TSALASKTCPRLSRG------SVESACHIPDTRADHRCVSRSDCGVDATTCAKRSCSFAG  531

Query  171   YC  166
             YC
Sbjct  532   YC  533



>ref|XP_002973508.1| hypothetical protein SELMODRAFT_228194 [Selaginella moellendorffii]
 gb|EFJ25168.1| hypothetical protein SELMODRAFT_228194 [Selaginella moellendorffii]
Length=534

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/542 (65%), Positives = 419/542 (77%), Gaps = 25/542 (5%)
 Frame = -1

Query  1791  PNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQ  1612
             P P    R  + + VR MF+HAY+NYM +AFPHDELKPL+ +YTDSL ELGNLKLE L +
Sbjct  17    PIPRFEERAALKEDVRNMFHHAYDNYMKYAFPHDELKPLSLSYTDSLEELGNLKLERLSE  76

Query  1611  KYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSA  1432
              YSGSALTL+ESLSSL ++ N +EFEK VLWL+ NLSFDVD R+N+FECNIR+LGGL+SA
Sbjct  77    TYSGSALTLVESLSSLAVMKNSSEFEKGVLWLAENLSFDVDVRVNVFECNIRLLGGLISA  136

Query  1431  HILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettet  1252
             H LA DS  +L+   Y +QLL LAEDLG R LPAFDTPTG+PYAWINLK GV  NETTET
Sbjct  137   HFLAKDSRKQLMSNGYNDQLLMLAEDLGLRLLPAFDTPTGIPYAWINLKTGVHPNETTET  196

Query  1251  stSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFS  1072
             STSGCGSL+LEMGALSRLTG+P FE  ALRALRKLWSMRS LNLLGT LD+ TG W E+S
Sbjct  197   STSGCGSLVLEMGALSRLTGNPQFENLALRALRKLWSMRSELNLLGTNLDINTGRWTEYS  256

Query  1071  TGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYW  892
             +GIGAG+DSFYEYL                  AY AVQ+++R+G WYHDADMRTGKATYW
Sbjct  257   SGIGAGIDSFYEYL-----------------DAYRAVQQHYRYGSWYHDADMRTGKATYW  299

Query  891   QLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLR  712
             Q TSLQAFWPG+QVL+GD+ AAN++HREF  +W+ FG+ PERYLLD   +HPTE+YYPLR
Sbjct  300   QFTSLQAFWPGLQVLIGDIAAANATHREFLRLWEMFGIFPERYLLDAGKVHPTERYYPLR  359

Query  711   PEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFL  532
             PE AESTF+LYQATKDPWY++VG+ I+NS+N +++V GGFASVRDV TM+LEDH HSFFL
Sbjct  360   PELAESTFFLYQATKDPWYLDVGKKIMNSINVFSRVPGGFASVRDVMTMKLEDHHHSFFL  419

Query  531   AETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKR  352
             +ETCKYLYLLFDDSFL   N++F+TEGH  PV  +W  +     L S    F  +K    
Sbjct  420   SETCKYLYLLFDDSFLDGENHVFSTEGHLFPVNQSWQQQPRPKIL-SRLRLFSRQKPID-  477

Query  351   ASAMSQRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSMAG  172
              SA++ + CP  +         +ESACHIPDTR DHRC++  DCGVD+TTC +RSCS AG
Sbjct  478   TSALTSKTCPRLSRG------SVESACHIPDTRADHRCVSRSDCGVDATTCAKRSCSFAG  531

Query  171   YC  166
             YC
Sbjct  532   YC  533



>ref|XP_009113758.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X2 [Brassica 
rapa]
Length=495

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/462 (75%), Positives = 402/462 (87%), Gaps = 7/462 (2%)
 Frame = -1

Query  1908  LLPFSIDPKSFRIMRKRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYH  1729
              + FS     FR   K V IC LI  + F   S    D       ++++M +KVR+MFYH
Sbjct  7     FISFSCSLAMFR--PKHVFICFLISFAFFIDPSSQHVDD-----VKKQQMREKVREMFYH  59

Query  1728  AYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGN  1549
             AY+NYM +AFPHDELKP+TK++TDSLSELGNLKLEHLP  Y+GSA+TL+ESLSSL ILGN
Sbjct  60    AYDNYMTYAFPHDELKPITKSFTDSLSELGNLKLEHLPTDYNGSAVTLVESLSSLAILGN  119

Query  1548  HTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLL  1369
              TEFEK VLWLS NL+FDVD R+NLFECNIR+LGGL+SAH+LA D TNRL+QG+Y N+LL
Sbjct  120   KTEFEKGVLWLSENLTFDVDVRVNLFECNIRLLGGLISAHLLAIDPTNRLIQGSYNNELL  179

Query  1368  DLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGD  1189
              LAEDLG+RFLPAF+TPT +PYAWIN K+GVM+NETTETSTSGCGSLILEMGALSRLTGD
Sbjct  180   RLAEDLGKRFLPAFETPTRIPYAWINFKKGVMENETTETSTSGCGSLILEMGALSRLTGD  239

Query  1188  PIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILF  1009
             P FE AALRALR+LW MRSSL+LLGTTLDV TGEW+E+S+GIGAGVDSFYEYL+KAYILF
Sbjct  240   PRFESAALRALRQLWRMRSSLDLLGTTLDVVTGEWLEYSSGIGAGVDSFYEYLMKAYILF  299

Query  1008  GGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDA  829
             G +++W+MF+SAYLA QKYFR+GPWYH+A+M +GK TYWQLTSLQAFWPG+QVLVGDV A
Sbjct  300   GKEDYWRMFRSAYLASQKYFRYGPWYHEANMWSGKPTYWQLTSLQAFWPGLQVLVGDVAA  359

Query  828   ANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYME  649
             ANSSH EFFH W+KFGV+PERYLLDHQM+HPTE+YYPLRPE AESTFYLYQATKDPWY++
Sbjct  360   ANSSHWEFFHAWEKFGVIPERYLLDHQMIHPTERYYPLRPELAESTFYLYQATKDPWYLD  419

Query  648   VGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAET  523
             VGE ++ SLN+YTKV GGFASVRDVTTM+LEDHQHSFFLAET
Sbjct  420   VGEAMVKSLNRYTKVAGGFASVRDVTTMQLEDHQHSFFLAET  461



>ref|XP_009764736.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X3 [Nicotiana 
sylvestris]
Length=416

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/405 (85%), Positives = 373/405 (92%), Gaps = 3/405 (1%)
 Frame = -1

Query  1872  IMRKRVLICMLIFL---STFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHA  1702
             + R  V I +L++L    + F +  S   P N MAA+RKRMS +VR+MFYHAY+NYMM+A
Sbjct  1     MFRSAVAIWILLYLVISPSIFIICLSEQHPTNLMAAKRKRMSDRVREMFYHAYDNYMMYA  60

Query  1701  FPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVL  1522
             FPHDELKPL+K YTDSLSELGNLKLEHLPQ+Y+GSALTLIESLSSL ILGN+TEFEKA+L
Sbjct  61    FPHDELKPLSKAYTDSLSELGNLKLEHLPQQYNGSALTLIESLSSLAILGNYTEFEKAIL  120

Query  1521  WLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRR  1342
             WLS NLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLG+R
Sbjct  121   WLSENLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGQR  180

Query  1341  FLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALR  1162
             FLPAFDTPTGLPYAWINLK GVM +ETTETSTSGCGSLILEMG LSRLTGDP FE AALR
Sbjct  181   FLPAFDTPTGLPYAWINLKHGVMADETTETSTSGCGSLILEMGTLSRLTGDPRFETAALR  240

Query  1161  ALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMF  982
             ALRKLWSMRSSLNLLGTTLDVATG WIE+S+GIGAGVDSFYEYL+KAY+LFG DEFWKMF
Sbjct  241   ALRKLWSMRSSLNLLGTTLDVATGNWIEYSSGIGAGVDSFYEYLMKAYVLFGRDEFWKMF  300

Query  981   QSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFF  802
             QSAY+AVQKYFRHGPWYH+ADMRTGKATYWQLTSLQAFWPG+QV VGD+DAANSSHREFF
Sbjct  301   QSAYIAVQKYFRHGPWYHEADMRTGKATYWQLTSLQAFWPGLQVQVGDIDAANSSHREFF  360

Query  801   HVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATK  667
              VWK++GVLPERYLLDHQMLHPTEKYYPLRPE AESTFYLYQATK
Sbjct  361   KVWKQYGVLPERYLLDHQMLHPTEKYYPLRPELAESTFYLYQATK  405



>gb|EMS63302.1| putative alpha-mannosidase I MNS5 [Triticum urartu]
Length=478

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/413 (78%), Positives = 365/413 (88%), Gaps = 16/413 (4%)
 Frame = -1

Query  1713  MMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFE  1534
             M +AFPHDELKPLTK +TDSLSELGNL LEHLPQ Y+GSALTL+ESLSSLV+LGN TEF+
Sbjct  1     MAYAFPHDELKPLTKGFTDSLSELGNLNLEHLPQDYNGSALTLVESLSSLVVLGNLTEFD  60

Query  1533  KAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAED  1354
             + V WLS NL+FDVDAR+NLFECNIR+LGGL+SAHILA D +++   G Y+NQLL LAE+
Sbjct  61    RGVSWLSENLTFDVDARVNLFECNIRLLGGLISAHILAKDYSSQNKDGVYQNQLLRLAEN  120

Query  1353  LGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEI  1174
             LG RFLPAF+TPTGLPYAWINLK GVM+NETTETSTSGCGSLILEMGALSRLTGDP +E 
Sbjct  121   LGSRFLPAFETPTGLPYAWINLKYGVMENETTETSTSGCGSLILEMGALSRLTGDPRYEA  180

Query  1173  AALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEF  994
             AALRALRKLWSMRSSLNL+G+TLDV +G WIE+S+GIGAGVDSFYEYL+KAY+LFG DE+
Sbjct  181   AALRALRKLWSMRSSLNLVGSTLDVLSGNWIEYSSGIGAGVDSFYEYLIKAYVLFGSDEY  240

Query  993   WKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSH  814
             W MF SAYLAVQKYFRHGPWYH+AD+RTG+AT+WQLTSLQAFWPGVQ L+GDV AAN SH
Sbjct  241   WDMFHSAYLAVQKYFRHGPWYHEADIRTGEATHWQLTSLQAFWPGVQTLLGDVAAANLSH  300

Query  813   REFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATK-----------  667
             REF++VW++FGVLPERYLLD+ +LHPTEKYYPLRPEFAESTFYLYQATK           
Sbjct  301   REFYNVWQRFGVLPERYLLDYGILHPTEKYYPLRPEFAESTFYLYQATKDKDNMMSRSLT  360

Query  666   -----DPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAET  523
                  DPWY+EVGE II SLN YTKV+GGFAS+RDV+TM LEDHQHSFFL+ET
Sbjct  361   PLISIDPWYLEVGEAIIGSLNYYTKVEGGFASIRDVSTMNLEDHQHSFFLSET  413



>ref|XP_002318019.2| hypothetical protein POPTR_0012s07810g [Populus trichocarpa]
 gb|EEE96239.2| hypothetical protein POPTR_0012s07810g [Populus trichocarpa]
Length=375

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/376 (83%), Positives = 344/376 (91%), Gaps = 1/376 (0%)
 Frame = -1

Query  1275  MQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVA  1096
             M+NETTETSTSGCGSLILEMGALSRLTGDP +E A+LRALRKLWSMRSSLNLLGTTLDV 
Sbjct  1     MKNETTETSTSGCGSLILEMGALSRLTGDPKYESASLRALRKLWSMRSSLNLLGTTLDVE  60

Query  1095  TGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADM  916
             TGEWIE S+GIGAGVDSFYEYL KA+ILFG ++FW+MF SAYLAVQKYFRHGPWYH+ADM
Sbjct  61    TGEWIEHSSGIGAGVDSFYEYLFKAHILFGKEDFWRMFHSAYLAVQKYFRHGPWYHEADM  120

Query  915   RTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHP  736
             RTGKATYWQLTSLQAFWPG+QVLVGD++AANSSHREF HVWKKFGVLPERYLLDHQMLHP
Sbjct  121   RTGKATYWQLTSLQAFWPGLQVLVGDIEAANSSHREFVHVWKKFGVLPERYLLDHQMLHP  180

Query  735   TEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELE  556
             TEKYYPLRPE AESTFYLYQATKDPWY+EVGE I++SLN YTKV+GGFAS+RDVTTM+ E
Sbjct  181   TEKYYPLRPELAESTFYLYQATKDPWYIEVGEAIVDSLNLYTKVEGGFASIRDVTTMQTE  240

Query  555   DHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSF  376
             DHQHSFFLAETCKYLYLLFDDSFLV+RNYIFTTEGHPLPVLS WH+RL E Y+PSNWT  
Sbjct  241   DHQHSFFLAETCKYLYLLFDDSFLVDRNYIFTTEGHPLPVLSAWHERLPEIYIPSNWTYV  300

Query  375   KHEKHRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCR  196
             K EK  KRASAMS ++CPA +L+     Q +ESACHIPD R DH+C +DE+CGVDST+CR
Sbjct  301   KKEK-PKRASAMSLQVCPALSLNSRHGEQLVESACHIPDARNDHKCFSDEECGVDSTSCR  359

Query  195   RRSCSMAGYCGLWLLI  148
             RRSCS+ GYCGLWL+I
Sbjct  360   RRSCSLGGYCGLWLII  375



>ref|XP_009764735.1| PREDICTED: probable alpha-mannosidase I MNS5 isoform X2 [Nicotiana 
sylvestris]
Length=420

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/377 (83%), Positives = 344/377 (91%), Gaps = 3/377 (1%)
 Frame = -1

Query  1872  IMRKRVLICMLIFL---STFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHA  1702
             + R  V I +L++L    + F +  S   P N MAA+RKRMS +VR+MFYHAY+NYMM+A
Sbjct  1     MFRSAVAIWILLYLVISPSIFIICLSEQHPTNLMAAKRKRMSDRVREMFYHAYDNYMMYA  60

Query  1701  FPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVL  1522
             FPHDELKPL+K YTDSLSELGNLKLEHLPQ+Y+GSALTLIESLSSL ILGN+TEFEKA+L
Sbjct  61    FPHDELKPLSKAYTDSLSELGNLKLEHLPQQYNGSALTLIESLSSLAILGNYTEFEKAIL  120

Query  1521  WLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRR  1342
             WLS NLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLG+R
Sbjct  121   WLSENLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGQR  180

Query  1341  FLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALR  1162
             FLPAFDTPTGLPYAWINLK GVM +ETTETSTSGCGSLILEMG LSRLTGDP FE AALR
Sbjct  181   FLPAFDTPTGLPYAWINLKHGVMADETTETSTSGCGSLILEMGTLSRLTGDPRFETAALR  240

Query  1161  ALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMF  982
             ALRKLWSMRSSLNLLGTTLDVATG WIE+S+GIGAGVDSFYEYL+KAY+LFG DEFWKMF
Sbjct  241   ALRKLWSMRSSLNLLGTTLDVATGNWIEYSSGIGAGVDSFYEYLMKAYVLFGRDEFWKMF  300

Query  981   QSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFF  802
             QSAY+AVQKYFRHGPWYH+ADMRTGKATYWQLTSLQAFWPG+QV VGD+DAANSSHREFF
Sbjct  301   QSAYIAVQKYFRHGPWYHEADMRTGKATYWQLTSLQAFWPGLQVQVGDIDAANSSHREFF  360

Query  801   HVWKKFGVLPERYLLDH  751
              VWK++GVLPER L ++
Sbjct  361   KVWKQYGVLPERNLFNN  377


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 3/40 (8%)
 Frame = -2

Query  767  GIYWTIRCCIPRRSTILYVLNLRNLHFTYTKQPK---IHG  657
            GI WTIRCCI  ++TILY LN ++ HFTYTKQPK   +HG
Sbjct  379  GICWTIRCCILLKNTILYALNWQSPHFTYTKQPKVSMVHG  418



>ref|XP_010462925.1| PREDICTED: LOW QUALITY PROTEIN: probable alpha-mannosidase I 
MNS5 [Camelina sativa]
Length=493

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/410 (75%), Positives = 359/410 (88%), Gaps = 4/410 (1%)
 Frame = -1

Query  1866  RKRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDE  1687
             +KR+ +C+L+ L+ F  +  +       + A++K M +KVR+MFYHAY+NYM +AFPHDE
Sbjct  10    KKRLFLCLLVSLAFFLVVVDT--SSQQHLEAKKKLMREKVRQMFYHAYDNYMTYAFPHDE  67

Query  1686  LKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVN  1507
             LKPLTK++TDSLSELGNLKLEHLP  Y+GSA+TL+ESLSSL ILGN +EFEK V WLS N
Sbjct  68    LKPLTKSFTDSLSELGNLKLEHLPTDYNGSAVTLVESLSSLAILGNSSEFEKGVHWLSDN  127

Query  1506  LSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAF  1327
             L+FD+DAR+NLFECNIRVLGGL+SAH+LA D TNRL+QG+Y NQLL LAEDLG+RFLPAF
Sbjct  128   LTFDIDARVNLFECNIRVLGGLISAHLLAIDPTNRLIQGSYNNQLLRLAEDLGKRFLPAF  187

Query  1326  DTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKL  1147
             +TPTGLPYAWINLK GV++NETTETSTSGCGSLILEMGALSRLTGDP FE AALRALR+L
Sbjct  188   ETPTGLPYAWINLKNGVIENETTETSTSGCGSLILEMGALSRLTGDPRFESAALRALRQL  247

Query  1146  WSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYL  967
             W MRSSL+LLGTTLDV TGEW+E+S+ IGAGVDSFYEYL+KAYILFG +++W+MF S   
Sbjct  248   WRMRSSLDLLGTTLDVVTGEWLEYSSSIGAGVDSFYEYLLKAYILFGKEDYWQMFSSX--  305

Query  966   AVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKK  787
             A QKYF  G WYH+A+M +GK TYWQLTSLQAFWPG+QVL GD+ AANS+HREFFHVW+K
Sbjct  306   ASQKYFIQGLWYHEANMWSGKPTYWQLTSLQAFWPGLQVLAGDIAAANSTHREFFHVWEK  365

Query  786   FGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGEL  637
              GVLPERYLLDHQM+HPT KYYPLRPE AESTFYLYQATKDPWY++VGE+
Sbjct  366   VGVLPERYLLDHQMIHPTMKYYPLRPELAESTFYLYQATKDPWYLDVGEI  415


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 57/96 (59%), Gaps = 5/96 (5%)
 Frame = -1

Query  534  LAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRK  355
            LAE+  YLY    D + ++   I   EGHP+ V+S+WH+++ ++Y   NWT  K      
Sbjct  393  LAESTFYLYQATKDPWYLDVGEI---EGHPIQVVSSWHEKVPKSYFSGNWTLSKRGAWES  449

Query  354  RASAMSQRICPATTLSHEQEYQHLESAC--HIPDTR  253
             ASA+S ++CP+  L+  +  QH ESAC  H+PD +
Sbjct  450  GASALSLQVCPSKALNSRRPEQHRESACHVHVPDEQ  485



>ref|XP_009588288.1| PREDICTED: probable alpha-mannosidase I MNS5, partial [Nicotiana 
tomentosiformis]
Length=373

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/344 (83%), Positives = 313/344 (91%), Gaps = 3/344 (1%)
 Frame = -1

Query  1872  IMRKRVLICMLIFL---STFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHA  1702
             + R  V I +L++L    + F +  S     N MA +RKRMS +VR+MFYHAY+NYMM+A
Sbjct  1     MFRPAVAIWILLYLVISPSIFIICLSQQHSTNLMADKRKRMSDRVREMFYHAYDNYMMYA  60

Query  1701  FPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVL  1522
             FPHDELKPLT TYTDSLSELGNLKLEHLPQ+Y+GSALTLIESLSSL ILGN+TEFEKA+L
Sbjct  61    FPHDELKPLTNTYTDSLSELGNLKLEHLPQQYNGSALTLIESLSSLAILGNYTEFEKAIL  120

Query  1521  WLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRR  1342
             WLS NLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLG+R
Sbjct  121   WLSENLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGQR  180

Query  1341  FLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALR  1162
             FLPAF+TPTGLPYAWINLK GVM +ETTETSTSGCGSLILEMG LSRLTGDP FE+AALR
Sbjct  181   FLPAFNTPTGLPYAWINLKHGVMADETTETSTSGCGSLILEMGTLSRLTGDPRFEMAALR  240

Query  1161  ALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMF  982
             ALRKLWSMRSSLNLLGTTLDV TG WIE+S+GIGAGVDSFYEYL+KAY+LFG DEFWKMF
Sbjct  241   ALRKLWSMRSSLNLLGTTLDVETGNWIEYSSGIGAGVDSFYEYLMKAYVLFGRDEFWKMF  300

Query  981   QSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQV  850
             QSAY+AVQKYFRHGPWYH+ADMRTGKATYWQLTSLQAFWPG+QV
Sbjct  301   QSAYIAVQKYFRHGPWYHEADMRTGKATYWQLTSLQAFWPGLQV  344



>ref|XP_002504119.1| glycoside hydrolase family 47 protein [Micromonas sp. RCC299]
 gb|ACO65377.1| glycoside hydrolase family 47 protein [Micromonas sp. RCC299]
Length=571

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/544 (52%), Positives = 366/544 (67%), Gaps = 30/544 (6%)
 Frame = -1

Query  1740  MFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLV  1561
             MF+HAY+NYM HAFPHDELKPL++T+TDSL ELGNL ++HLP+ Y G ALTLI++ S+L 
Sbjct  35    MFHHAYDNYMTHAFPHDELKPLSRTWTDSLGELGNLDMKHLPEDYEGVALTLIDATSTLA  94

Query  1560  ILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYK  1381
             +LGN TEF + V W+  NL FD+D R+N FECNIRVL GL+SAH++A     R  +G  +
Sbjct  95    VLGNRTEFARNVRWMERNLDFDIDVRVNAFECNIRVLAGLLSAHVIALGDGGRAGEGAAR  154

Query  1380  NQ---------------LLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetst  1246
              +                 D A DLG R L AFDT TG+PYAW+NL+ GV   ET ET+ 
Sbjct  155   KRPSWFGKGRGSGPSAPSFD-ALDLGERLLKAFDTKTGMPYAWVNLRHGVRPGETNETNV  213

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTG  1066
             +  GS ILE G LSRLTGD  FE AA  A+R +WS+R   +LLG TLDV  G W+  S G
Sbjct  214   AAVGSFILEFGLLSRLTGDGRFERAARGAIRSMWSIRGDRDLLGNTLDVQRGTWVVRSGG  273

Query  1065  IGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQL  886
             IGAG DSF+EYL+KAY++FG DE+++MF  AY+AV +Y+    WYH+A + TG AT+ Q 
Sbjct  274   IGAGCDSFFEYLIKAYVMFGDDEYYRMFSDAYVAVMRYYHDDGWYHEAHLNTGVATHVQA  333

Query  885   TSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPE  706
             TSLQAFWPG+Q L+GD++AA ++H  F  VW K+GV PER++   Q LHPTEK+YPLRPE
Sbjct  334   TSLQAFWPGMQTLIGDLEAARATHARFGSVWDKYGVFPERFMYREQHLHPTEKHYPLRPE  393

Query  705   FAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAE  526
              AEST  LY AT+D  +  VG  +   + ++T+V GG ASVRDV+T  LEDHQHSFFLAE
Sbjct  394   HAESTAMLYMATRDDSFRTVGARLHADITRHTRVPGGHASVRDVSTKALEDHQHSFFLAE  453

Query  525   TCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRL----SEAYLPSNWTSFKHEKHR  358
             TCKYLYLLFDDSF+  RN +F+TEGHPLPVL+ W ++     S     S+W S    ++ 
Sbjct  454   TCKYLYLLFDDSFMDGRNLVFSTEGHPLPVLA-WQNQEDKEDSGDASKSSWVSDGKSRYN  512

Query  357   KRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSCSM  178
                             + E++    +S CH+ D +  HRC+ D DCGVD+ TC  R CS 
Sbjct  513   GGGEVFD---------AEEEDVIGKDSDCHVLDLKESHRCVDDGDCGVDAQTCSPRKCSE  563

Query  177   AGYC  166
               +C
Sbjct  564   HKFC  567



>ref|XP_003059643.1| glycoside hydrolase family 47 protein [Micromonas pusilla CCMP1545]
 gb|EEH56775.1| glycoside hydrolase family 47 protein [Micromonas pusilla CCMP1545]
Length=555

 Score =   525 bits (1351),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 272/542 (50%), Positives = 348/542 (64%), Gaps = 23/542 (4%)
 Frame = -1

Query  1740  MFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLV  1561
             MF H Y+NY+ HAFPHDEL+P+++TYTDSL ELGNLK EHL + Y+G ALTLI++ S+L 
Sbjct  16    MFQHGYDNYLEHAFPHDELRPISRTYTDSLGELGNLKREHLSETYAGVALTLIDATSTLA  75

Query  1560  ILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQG---  1390
             +LGN TEF + V W+  NL+FD D R+N FECNIR LGGL+SAH++A      L      
Sbjct  76    VLGNVTEFTRNVRWMERNLNFDADVRVNAFECNIRALGGLLSAHVIAGGDIGMLEAAFMP  135

Query  1389  TYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGA  1210
             +YK  LL +A DLG+R L AFDT TG+PYAW+NL+RGV + E    +    GS  LE GA
Sbjct  136   SYKGGLLPIAHDLGKRLLRAFDTRTGMPYAWVNLRRGVREGEGANVA--AVGSFSLEFGA  193

Query  1209  LSRLTGDPIFEIAALRALRKLWSMRS-SLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEY  1033
             LSRLTGD  FE+AA RA + LWS+R+ + NLLG TLDV TG W++ S G+GAG DSF+EY
Sbjct  194   LSRLTGDDAFELAATRATKALWSLRNRATNLLGNTLDVQTGRWVDRSGGVGAGCDSFFEY  253

Query  1032  LVKAYILFGGDEFWKM-----------FQSAYLAVQKYFRHGP-WYHDADMRTGKATYWQ  889
             L+K ++ FG +    +           F  AY+A  K++R    WYH+++M TG  T+ Q
Sbjct  254   LLKKHVAFGDEARSPIHTGPHATAADAFSDAYVAATKHYRTPEGWYHESNMDTGAPTHLQ  313

Query  888   LTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRP  709
              TSLQAFWPG+QVL GDV AA  +H   + VW+K+ + PERY      LH +E+YYPLRP
Sbjct  314   ATSLQAFWPGLQVLNGDVRAAKKTHARLWSVWRKYEMFPERYQYVDGTLHASERYYPLRP  373

Query  708   EFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLA  529
             E AEST  L+ AT+D  Y  +GE II  +N++ +V GGFASV+DV    LEDH HSFFLA
Sbjct  374   ELAESTAILFHATRDDSYRFIGEEIIRDINRHARVPGGFASVKDVQFKTLEDHMHSFFLA  433

Query  528   ETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKHEKHRKRA  349
             ETC YLYLLFDDSFL  RN IF TEGHPLP+     D +  A   +     + E+  +  
Sbjct  434   ETCTYLYLLFDDSFLSTRNVIFNTEGHPLPL----RDAMRAAKARAEEEEEEEEEEEEYD  489

Query  348   SAMSQRICPATTLSHEQEYQHLESACHIPDT-RGDHRCLTDEDCGVDSTTCRRRSCSMAG  172
                  +     ++            CH+ D  R  H C  D DCGVD+ TC +R CS   
Sbjct  490   EEARAKADADASVGGSPVGARDGPRCHVLDADRDAHTCRDDSDCGVDADTCAKRKCSEHR  549

Query  171   YC  166
             YC
Sbjct  550   YC  551



>ref|XP_005643868.1| seven-hairpin glycosidase [Coccomyxa subellipsoidea C-169]
 gb|EIE19324.1| seven-hairpin glycosidase [Coccomyxa subellipsoidea C-169]
Length=585

 Score =   515 bits (1326),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 279/546 (51%), Positives = 352/546 (64%), Gaps = 46/546 (8%)
 Frame = -1

Query  1794  PPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLP  1615
             P   +  +R  M   VR+M  HAY NYM  AFPHDELKP+ KTYTDSL ELGN+K     
Sbjct  5     PGAGVEEQRNLMENSVREMIDHAYSNYMDVAFPHDELKPIAKTYTDSLGELGNVKGLAGN  64

Query  1614  QKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVS  1435
             + YSG ALTLI++LS+L ++ +   F +AV WL+ NLSFDVD R+N+FE NIR+LGGL+S
Sbjct  65    KGYSGVALTLIDALSTLAVIEDAARFHEAVSWLTKNLSFDVDVRVNVFEANIRLLGGLLS  124

Query  1434  AHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNette  1255
             AH+LA D  +                  G + +P      GL         GV QNET  
Sbjct  125   AHLLAADPVH------------------GPKLMPEGAYSGGL--------HGVFQNETEV  158

Query  1254  -tstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIE  1078
              T+T+ CGS  +EMG LSRLTG P FE  A R+L+ LWSMR+ L L GT LD+    W++
Sbjct  159   ETNTAACGSFTIEMGVLSRLTGLPQFEYHAKRSLQVLWSMRTPLGLFGTALDMQRAVWLD  218

Query  1077  FSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKAT  898
              + GIGA  DSFYEYL+KAYILFG  E+W+MFQ+AY A  +++R G WY  AD+  G  T
Sbjct  219   PNGGIGASADSFYEYLLKAYILFGEMEYWEMFQAAYTAAIRHYRDGTWYPQADIWMGAHT  278

Query  897   YWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLL-DHQMLHPTEKYY  721
             + Q TSLQAFWPG+QVL GDV AA  S   FF VW++FG+LPERYL   +  LH TE+YY
Sbjct  279   HLQFTSLQAFWPGMQVLAGDVKAAAESFAAFFGVWQRFGLLPERYLYGGNGALHSTEQYY  338

Query  720   PLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHS  541
             PLRPE  ES FYL+QAT D  YM+ G+ ++ SLN++ +V GG+ASVR V +ME EDH HS
Sbjct  339   PLRPELMESAFYLHQATGDVAYMQAGQHMLESLNRHARVDGGYASVRSVGSMEKEDHMHS  398

Query  540   FFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLP-VLSTWHDRLSEAYLPSNWTSFKHEK  364
             FFLAETCKYL+LL +DSF    NY+FTTEGHP+P V   +H       +P  W +     
Sbjct  399   FFLAETCKYLFLLANDSFWKGGNYVFTTEGHPIPGVRRVYH-------VPLEWGTL----  447

Query  363   HRKRASAMSQRICPATTLSHEQEYQHLESACHIPDTRGDHRCLTDEDCGVDSTTCRRRSC  184
                 ASA+   +CP  T     +   +ES CHI D  GD  C  +EDCGVD ++CR+RSC
Sbjct  448   -HANASALDALVCPDFT-----QVSTVESTCHIRDRNGDGSCGANEDCGVDGSSCRQRSC  501

Query  183   SMAGYC  166
             S  G+C
Sbjct  502   SEHGFC  507



>gb|EPS60831.1| hypothetical protein M569_13969, partial [Genlisea aurea]
Length=337

 Score =   501 bits (1289),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 249/308 (81%), Positives = 283/308 (92%), Gaps = 0/308 (0%)
 Frame = -1

Query  1773  RRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSA  1594
             ++KRMS+ VR+MFYHAY NYM +AFPHDELKPLTK+YTDSL ELGNL LE+L Q+Y+G+A
Sbjct  30    QKKRMSENVREMFYHAYNNYMKYAFPHDELKPLTKSYTDSLGELGNLNLENLSQEYNGTA  89

Query  1593  LTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATD  1414
             L+LIESLSSL ILG++ EFEKAV WLS NLSFDVD R+NLFECNIRVLGGLVSAHILATD
Sbjct  90    LSLIESLSSLAILGDYAEFEKAVFWLSENLSFDVDVRVNLFECNIRVLGGLVSAHILATD  149

Query  1413  STNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCG  1234
             S +R   G+Y+NQLL LAEDLGRRFLPAF+TP+GLPYAWINLK GVM NETTET+TSGCG
Sbjct  150   SASRFSSGSYENQLLFLAEDLGRRFLPAFNTPSGLPYAWINLKYGVMANETTETTTSGCG  209

Query  1233  SLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAG  1054
             SLILEMGALSRLTGD  FE+AA+RA+RKLWSMRSSLNLLGTTLD+ T EWIE+S+GIGAG
Sbjct  210   SLILEMGALSRLTGDSRFELAAIRAIRKLWSMRSSLNLLGTTLDIGTSEWIEYSSGIGAG  269

Query  1053  VDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQ  874
             VDSFYEYL+KA++LFG +E W+MFQSAYLAVQ YFRHGPWYH+ADMRTG+ATYWQLTSLQ
Sbjct  270   VDSFYEYLLKAHLLFGSEEMWRMFQSAYLAVQSYFRHGPWYHEADMRTGRATYWQLTSLQ  329

Query  873   AFWPGVQV  850
             AFWPG+QV
Sbjct  330   AFWPGLQV  337



>ref|XP_007146348.1| hypothetical protein PHAVU_006G033000g [Phaseolus vulgaris]
 gb|ESW18342.1| hypothetical protein PHAVU_006G033000g [Phaseolus vulgaris]
Length=302

 Score =   457 bits (1176),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 206/260 (79%), Positives = 237/260 (91%), Gaps = 0/260 (0%)
 Frame = -1

Query  1152  KLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSA  973
             KLWSM+SSL L GTT DVATG+WIE+S+GIGAGVDSFYEYL+KA+ILFG ++FWKMF SA
Sbjct  4     KLWSMQSSLKLFGTTPDVATGQWIEYSSGIGAGVDSFYEYLLKAHILFGKEDFWKMFHSA  63

Query  972   YLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVW  793
             Y+AVQKYFRHG WYH+AD+RTG+ATYWQLTSLQAFWPG+QVL+GD+ AANSSHREFFHVW
Sbjct  64    YVAVQKYFRHGSWYHEADIRTGRATYWQLTSLQAFWPGLQVLIGDLSAANSSHREFFHVW  123

Query  792   KKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQY  613
             K++GVL ERYLLDHQM+HPTEKYYPLRPE  ESTFYL Q TKDPWY+EVGE I+NS+N Y
Sbjct  124   KRYGVLLERYLLDHQMIHPTEKYYPLRPELVESTFYLCQTTKDPWYIEVGESIVNSINLY  183

Query  612   TKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRNYIFTTEGHPLPVL  433
             TKV+GGFAS++DVTTM+LEDHQHSFFLAETCKYLYLLFDDSF+   NY+FTTEGHP PVL
Sbjct  184   TKVEGGFASIKDVTTMQLEDHQHSFFLAETCKYLYLLFDDSFVHENNYVFTTEGHPFPVL  243

Query  432   STWHDRLSEAYLPSNWTSFK  373
             S WH+ L +AY+P+NWT  K
Sbjct  244   SNWHEELPQAYVPTNWTFVK  263



>dbj|BAJ94418.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=269

 Score =   437 bits (1125),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 211/264 (80%), Positives = 241/264 (91%), Gaps = 0/264 (0%)
 Frame = -1

Query  1554  GNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQ  1375
             GN TEF++ V WLS NL+FDVDAR+NLFECNIR+LGGL+SAHILA D +++   G Y+NQ
Sbjct  6     GNLTEFDRGVSWLSENLTFDVDARVNLFECNIRLLGGLISAHILAKDYSSQNKDGVYQNQ  65

Query  1374  LLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLT  1195
             LL LAE+LGRRFLPAF+TPTGLPYAWINLK GVM+NETTETSTSGCGSLILEMGALSRLT
Sbjct  66    LLHLAENLGRRFLPAFETPTGLPYAWINLKYGVMENETTETSTSGCGSLILEMGALSRLT  125

Query  1194  GDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYI  1015
             GD  +E AALRALRKLWSMRSSLNL+G+TLDV +G WIE+S+GIGAGVDSFYEYL+KAYI
Sbjct  126   GDSRYEAAALRALRKLWSMRSSLNLVGSTLDVLSGNWIEYSSGIGAGVDSFYEYLIKAYI  185

Query  1014  LFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDV  835
             LFG DE+W MF SAYLAVQKYFRHGPWYH+AD+RTG+AT+WQLTSLQAFWPGVQ L+GDV
Sbjct  186   LFGSDEYWDMFHSAYLAVQKYFRHGPWYHEADIRTGEATHWQLTSLQAFWPGVQTLLGDV  245

Query  834   DAANSSHREFFHVWKKFGVLPERY  763
              AAN SHREF++VW++FGVLPERY
Sbjct  246   AAANLSHREFYNVWQRFGVLPERY  269



>ref|XP_007034948.1| Glycosyl hydrolase family 47 protein isoform 1 [Theobroma cacao]
 ref|XP_007034949.1| Glycosyl hydrolase family 47 protein isoform 1 [Theobroma cacao]
 gb|EOY05874.1| Glycosyl hydrolase family 47 protein isoform 1 [Theobroma cacao]
 gb|EOY05875.1| Glycosyl hydrolase family 47 protein isoform 1 [Theobroma cacao]
Length=615

 Score =   437 bits (1123),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 234/489 (48%), Positives = 310/489 (63%), Gaps = 25/489 (5%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K++  +VR+MFYHA++ YM HAFP DEL+PL+    D+L                G ALT
Sbjct  33    KQLRDEVREMFYHAFDGYMDHAFPLDELRPLSCEGEDTLG---------------GYALT  77

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL +L +LG+   F  +V W+  NL FD++  +++FE +IRVLGGL+SAH++A+D  
Sbjct  78    LIDSLDTLALLGDRERFTASVEWIGKNLQFDINKTVSIFETSIRVLGGLLSAHLIASDYA  137

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +   +Y NQLLDLAEDL RR LPAFDTPTG+P+  +NLK GV ++E+  TST+G G+L
Sbjct  138   TGMGIPSYDNQLLDLAEDLARRLLPAFDTPTGIPFGSVNLKYGVDEHESKITSTAGGGTL  197

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRLT DPIFE     A+R LW+ RS LNL+G  ++V TGEW +   GIG  +D
Sbjct  198   TLEFGVLSRLTNDPIFERVTKNAVRGLWARRSKLNLVGAHINVFTGEWTQKDAGIGTSID  257

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAY+LFG +E+  +FQ AY A   Y  + PWY + +M +G   +    SLQAF
Sbjct  258   SFYEYLLKAYLLFGDEEYLFIFQEAYSAAMHYLYNDPWYVEVNMDSGAIVWPLFNSLQAF  317

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GDVD A  +H  FF VWK++G  PE + L    +   +K YPLRPE  EST+
Sbjct  318   WPGLQVLAGDVDPAIRTHTAFFSVWKRYGFTPEGFNLATLSVQHGQKSYPLRPELIESTY  377

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT+DP Y++ G  ++ SL    +   G+  + DV   + EDH  SFFLAET KYL+
Sbjct  378   WLYKATRDPRYLDAGRDMVASLQYGARCPCGYCHISDVEFHKSEDHMESFFLAETVKYLW  437

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV---LSTWHDRLSEAYLPSNWTSFKHEKHR  358
             LLFD     D+ + N    YIFTTEGH LP    +S   +  S      N   FKHE H 
Sbjct  438   LLFDLAVGPDNLVENGPYKYIFTTEGHLLPATPQISLVQEHCSYFGAYCNHGDFKHEPHA  497

Query  357   KRASAMSQR  331
                SA SQ 
Sbjct  498   SDMSADSQE  506



>ref|XP_004134427.1| PREDICTED: probable alpha-mannosidase I MNS4-like [Cucumis sativus]
 ref|XP_004164495.1| PREDICTED: probable alpha-mannosidase I MNS4-like [Cucumis sativus]
 gb|KGN56918.1| hypothetical protein Csa_3G143590 [Cucumis sativus]
Length=615

 Score =   433 bits (1113),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 222/451 (49%), Positives = 298/451 (66%), Gaps = 22/451 (5%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K++  +VR+MFYHA+  YM HAFP DEL+PL+    DSL                G ALT
Sbjct  39    KQLRDEVREMFYHAFNGYMKHAFPLDELRPLSCEGEDSLG---------------GYALT  83

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL +L +LG+  +F  +V W+  NL FD++  ++LFE NIRVLGGL+SAH++A+D T
Sbjct  84    LIDSLDTLALLGDREQFAASVEWIGKNLRFDINKTVSLFETNIRVLGGLLSAHLIASDHT  143

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +   +Y+NQLLDLAEDLGRR LPAFDTPTG+P+  +NL  GV ++E+  TST+G G+L
Sbjct  144   TGMKIASYENQLLDLAEDLGRRLLPAFDTPTGIPFGSVNLLYGVDEHESKITSTAGGGTL  203

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRLT DPIFE     A+R LW+ RS LNL+G  ++V TGEW +   GIG  +D
Sbjct  204   TLEFGVLSRLTNDPIFERVTKNAVRGLWACRSKLNLVGAHINVFTGEWTQKDAGIGTSID  263

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAY+LFG +E+  +FQ AY AV  Y  + PWY + +M +G   +    SLQAF
Sbjct  264   SFYEYLLKAYLLFGDEEYLFIFQEAYGAVMHYLFNDPWYVEVNMDSGALVWPLFNSLQAF  323

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GD+D A  +H  F  VWK++G  PE + L    +   +K YPLRPE  EST+
Sbjct  324   WPGLQVLAGDIDPAIRTHTAFLSVWKRYGFTPEGFNLATLSVQHGQKSYPLRPELIESTY  383

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT++P Y++ G  ++ SL    +   G+  + DV   + EDH  SFFLAET KYL+
Sbjct  384   WLYKATRNPRYLDAGRDMVTSLQYGARCPCGYCHISDVEFHKQEDHMESFFLAETVKYLW  443

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             LLFD     D+ + N    Y+F+TEGH LP 
Sbjct  444   LLFDLAAGPDNLVENGPYKYVFSTEGHLLPA  474



>ref|XP_006838875.1| hypothetical protein AMTR_s00002p00267140 [Amborella trichopoda]
 gb|ERN01444.1| hypothetical protein AMTR_s00002p00267140 [Amborella trichopoda]
Length=632

 Score =   433 bits (1113),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 221/480 (46%), Positives = 309/480 (64%), Gaps = 27/480 (6%)
 Frame = -1

Query  1854  LICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL  1675
             LIC+LI  + F P    G  P        K++  +V++MFYHA++ YM HAFP DEL+PL
Sbjct  4     LICILILSTVFRPSDAEGVSP-----LEAKQLRDEVQQMFYHAFDGYMEHAFPLDELRPL  58

Query  1674  TKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFD  1495
             T +  DSL                  ALTLI+SL +L +LG+ + F  AV W+  NLSFD
Sbjct  59    TCSGEDSLGSY---------------ALTLIDSLDTLALLGDSSRFTAAVEWIGQNLSFD  103

Query  1494  VDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPT  1315
             ++  ++LFE  IRVLGGL+SAH++A+D    +   +Y +QLL +AEDLG+R LPAF+TPT
Sbjct  104   INKTVSLFETTIRVLGGLLSAHLIASDYATGMKVDSYDDQLLHVAEDLGQRLLPAFETPT  163

Query  1314  GLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMR  1135
             G+P+  +NL  GV ++E+  TST+G G+L +E G LSRLTG+P+FE     A+R +W  R
Sbjct  164   GIPFGSVNLLYGVDEHESKITSTAGGGTLTIEFGVLSRLTGNPVFEKVTKNAVRGIWVRR  223

Query  1134  SSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQK  955
             S ++L+G  ++V TGEW +   GIG  +DSFYEYL+KAY+LFG +E+  MFQ AY AV  
Sbjct  224   SEIDLVGAHINVFTGEWTQKDAGIGTSIDSFYEYLLKAYLLFGDEEYLYMFQEAYRAVMH  283

Query  954   YFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVL  775
             Y  + PWY + +M +    +    SLQAFWPG+QVL GDV+ A  +H+ FF VWK++G  
Sbjct  284   YLHNDPWYVEVNMNSAAVVWPLFNSLQAFWPGLQVLAGDVEPAARTHKAFFSVWKRYGFT  343

Query  774   PERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGG  595
             PE + L    +   +K YPLRPE  EST++L++AT+DP Y++ G  ++ SL    +   G
Sbjct  344   PEGFNLATFSVQNGQKSYPLRPELIESTYWLFKATRDPMYLDAGRDMVASLQYGARCPCG  403

Query  594   FASVRDVTTMELEDHQHSFFLAETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             +  + DV + + EDH  SFFLAET KYL+LLFD     D+ + N    YIF+TEGH  P+
Sbjct  404   YCHITDVESHKQEDHMESFFLAETVKYLWLLFDLAVSADNMVENGPYRYIFSTEGHLFPI  463



>ref|XP_002985136.1| hypothetical protein SELMODRAFT_121761 [Selaginella moellendorffii]
 gb|EFJ13630.1| hypothetical protein SELMODRAFT_121761 [Selaginella moellendorffii]
Length=506

 Score =   427 bits (1099),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 224/521 (43%), Positives = 313/521 (60%), Gaps = 31/521 (6%)
 Frame = -1

Query  1833  LSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDS  1654
             ++ F  +   G    +  AA   ++  +V++MFYHAY  YM HAFP DEL+P++    DS
Sbjct  1     MAAFLILISDGASAASVTAAEALQLRDEVKEMFYHAYNGYMAHAFPLDELRPMSCAGEDS  60

Query  1653  LSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINL  1474
             L                G ALTL++SL  L +LG+  +F  AV W+  +L FD +  +++
Sbjct  61    LG---------------GYALTLVDSLDMLAVLGDREKFFDAVNWIGKHLRFDKNKTVSV  105

Query  1473  FECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWI  1294
             FE  IRVLGGL+SAH+L +D    +V   Y ++LL+LAEDLGRR LPAFDTPTG+PY  +
Sbjct  106   FETTIRVLGGLLSAHMLVSDQATGMVMYDYNDELLNLAEDLGRRLLPAFDTPTGIPYGSV  165

Query  1293  NLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLG  1114
             NL  GV ++E+  TST+G G+L +E G LSRLTGDP+FE  +  A+R LW+ RS + L+G
Sbjct  166   NLLYGVSEDESQVTSTAGGGTLTMEFGVLSRLTGDPVFEEVSRNAVRGLWAQRSHIGLVG  225

Query  1113  TTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPW  934
               ++V +GEW    +GIG  +DSFYEYL+KAY+LFG DE+  MF+ +Y AV +Y    PW
Sbjct  226   AHINVLSGEWTHKDSGIGTSIDSFYEYLLKAYLLFGEDEYLHMFKESYKAVMRYLFKDPW  285

Query  933   YHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLD  754
             Y + +M +    +    SLQAFWPG+QVL GDV+ A  +H  FF VWKKFG  PE + L 
Sbjct  286   YMEVNMNSAVVVWPLFNSLQAFWPGLQVLAGDVEPATQTHTAFFSVWKKFGFTPEGFNLA  345

Query  753   HQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDV  574
                + P ++ YPLRPE  EST++LY+AT+DP Y++ G  I+ S+    +   G+  + DV
Sbjct  346   SMSIQPGQRSYPLRPELIESTYWLYKATRDPIYLDAGRDILASIQYGCRCPCGYCHIADV  405

Query  573   TTMELEDHQHSFFLAETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV-------  436
              T + +DH  SFFL+ET KYLYLLFD     D+ + N    Y+F+TEGH  P+       
Sbjct  406   ETHQQDDHMESFFLSETVKYLYLLFDLAAGGDNIVENGPYPYLFSTEGHLFPLTPQISLP  465

Query  435   --LSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPA  319
                 T+          SNW       H    S +   + P+
Sbjct  466   KECCTYSGSFCPDSSKSNWMLHNATNHVDAGSPLKVFLLPS  506



>ref|XP_002969801.1| hypothetical protein SELMODRAFT_92622 [Selaginella moellendorffii]
 gb|EFJ28925.1| hypothetical protein SELMODRAFT_92622 [Selaginella moellendorffii]
Length=507

 Score =   426 bits (1095),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 224/520 (43%), Positives = 312/520 (60%), Gaps = 31/520 (6%)
 Frame = -1

Query  1833  LSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDS  1654
             ++ F  +   G    +  AA   ++  +V++MFYHAY  YM HAFP DEL+P++    DS
Sbjct  1     MAAFLILISDGASAASVTAAEALQLRDEVKEMFYHAYNGYMDHAFPLDELRPMSCVGEDS  60

Query  1653  LSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINL  1474
             L                G ALTL++SL  L +LG+  +F  AV W+  +L FD +  +++
Sbjct  61    LG---------------GYALTLVDSLDMLAVLGDREKFFDAVNWIGKHLRFDKNKTVSV  105

Query  1473  FECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWI  1294
             FE  IRVLGGL+SAH+L +D    +V   Y ++LL+LAEDLGRR LPAFDTPTG+PY  +
Sbjct  106   FETTIRVLGGLLSAHMLVSDQATGMVMYDYNDELLNLAEDLGRRLLPAFDTPTGIPYGSV  165

Query  1293  NLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLG  1114
             NL  GV ++E+  TST+G G+L +E G LSRLTGDP+FE  +  A+R LW+ RS + L+G
Sbjct  166   NLLYGVSEDESQVTSTAGGGTLTMEFGVLSRLTGDPVFEEVSRNAVRGLWAQRSHIGLVG  225

Query  1113  TTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPW  934
               ++V +GEW    +GIG  +DSFYEYL+KAY+LFG DE+  MF+ +Y AV +Y    PW
Sbjct  226   AHINVLSGEWTHKDSGIGTSIDSFYEYLLKAYLLFGEDEYLHMFKESYKAVMRYLFKDPW  285

Query  933   YHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLD  754
             Y + +M +    +    SLQAFWPG+QVL GDV+ A  +H  FF VWKKFG  PE + L 
Sbjct  286   YMEVNMNSAVVVWPLFNSLQAFWPGLQVLAGDVEPATQTHTAFFSVWKKFGFTPEGFNLA  345

Query  753   HQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDV  574
                + P ++ YPLRPE  EST++LY+AT+DP Y++ G  I+ S+    +   G+  + DV
Sbjct  346   SMSIQPGQRSYPLRPELIESTYWLYKATRDPIYLDAGRDILASIQYGCRCPCGYCHIADV  405

Query  573   TTMELEDHQHSFFLAETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV-------  436
              T + +DH  SFFL+ET KYLYLLFD     D+ + N    Y+F+TEGH  P+       
Sbjct  406   ETHQQDDHMESFFLSETVKYLYLLFDLALGGDNIVENGPYPYLFSTEGHLFPLTPQISLP  465

Query  435   --LSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICP  322
                 T+          SNW       H    S +   + P
Sbjct  466   KECCTYSGSFCPDSSKSNWMLHNATNHVDAGSPLKVFLLP  505



>ref|XP_009398566.1| PREDICTED: probable alpha-mannosidase I MNS4 [Musa acuminata 
subsp. malaccensis]
Length=625

 Score =   428 bits (1100),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 228/481 (47%), Positives = 305/481 (63%), Gaps = 29/481 (6%)
 Frame = -1

Query  1839  IFLSTFFPMSFSGFDPPNPMA-----ARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL  1675
             +FL     M FS   PP   A     A  K +  +VR MFYHA++ Y+ HAFP DEL+PL
Sbjct  6     LFLWVLQLMVFSAIFPPGVSADGVTPAEAKELRDEVRDMFYHAFDGYIKHAFPLDELRPL  65

Query  1674  TKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFD  1495
             T    DSL                G ALTLI+SL +L +LG+   F  AV W+S N+ FD
Sbjct  66    TCKGEDSLG---------------GYALTLIDSLDTLALLGDRERFNAAVDWVSENVRFD  110

Query  1494  VDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPT  1315
             +D  +++FE  IR+LGGL+SAH++A+D    +   +Y +QLL L+ DL +R LPAFDTPT
Sbjct  111   IDKTVSVFETTIRILGGLLSAHLIASDYATGMKIQSYDDQLLHLSVDLAQRLLPAFDTPT  170

Query  1314  GLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMR  1135
             G+P+  +NL  GV +NE+  TST+G G+L LE G LSRLT + +FE     A+R +W+ R
Sbjct  171   GIPFGSVNLLHGVDENESKITSTAGGGTLTLEFGVLSRLTNNAVFEQVTKNAVRGIWARR  230

Query  1134  SSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQK  955
             S +NL+G  +++ TGEW +   GIG  +DSFYEYL+KAY+LFG +E+  MFQ AY A  +
Sbjct  231   SKINLVGAHINIFTGEWTQKDAGIGTSIDSFYEYLLKAYLLFGDEEYLFMFQEAYKAAMR  290

Query  954   YFRHGPWYHDADMRTGKATYWQL-TSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGV  778
             Y  H PWY + +M +  AT W L  SLQAFWPG+QVL GDVD A  +H  FF VWKK+G 
Sbjct  291   YLHHDPWYVEVNMNSA-ATVWPLFNSLQAFWPGLQVLAGDVDPAIRTHAAFFSVWKKYGF  349

Query  777   LPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQG  598
              PE + L    +   +K YPLRPE  EST++L++AT+DP Y++VG  I+ SL    +   
Sbjct  350   TPEGFNLATMSVQHGQKSYPLRPELIESTYWLFKATRDPRYLDVGRDIVASLQYGARCPC  409

Query  597   GFASVRDVTTMELEDHQHSFFLAETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLP  439
             G+  + DV + E +DH  SFFLAET KYL+LLFD     D+ + N    YIF+TEGH LP
Sbjct  410   GYCHIADVESHEQDDHMESFFLAETVKYLWLLFDLSVGPDNIVENGPYKYIFSTEGHFLP  469

Query  438   V  436
              
Sbjct  470   A  470



>ref|XP_004289466.1| PREDICTED: probable alpha-mannosidase I MNS4-like [Fragaria vesca 
subsp. vesca]
Length=615

 Score =   427 bits (1098),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 219/451 (49%), Positives = 296/451 (66%), Gaps = 22/451 (5%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K++  +VR+MFYHA+  YM HAFP DELKP +    DSL                G ALT
Sbjct  39    KQLRDEVREMFYHAFNGYMDHAFPLDELKPQSCGGEDSLG---------------GYALT  83

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI++L +L +LG+   F  +V W+S NL FD++  +++FE  IRVLGGL+SAH++A+D  
Sbjct  84    LIDALDTLALLGDRDRFSASVEWISKNLQFDINKTVSVFETTIRVLGGLLSAHLIASDYA  143

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +   TY NQLL+LAEDLGRR LPAFDTP+G+P+  +NL+ GV ++E+  TST+G G+L
Sbjct  144   TGMRIPTYDNQLLNLAEDLGRRLLPAFDTPSGIPFGSVNLRHGVDEHESKITSTAGGGTL  203

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRLT D IFE A   A+R LW+ RS LNL+G  ++V TGEW +   GIG  +D
Sbjct  204   TLEFGVLSRLTNDSIFEQATKNAVRGLWAQRSKLNLVGAHINVFTGEWTQKDAGIGTSID  263

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAY+LFG +E+  +FQ AY A  +Y  + PWY + +M +    +    SLQAF
Sbjct  264   SFYEYLLKAYLLFGDEEYLYIFQEAYAAAMQYLYNDPWYVEVNMDSAAVVWPLFNSLQAF  323

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GD+D A  +H  FF VWKK+G  PE + L    +   ++ YPLRPE  EST+
Sbjct  324   WPGLQVLAGDIDPAIRTHTAFFSVWKKYGFTPEGFNLATFSVQHGQRSYPLRPELMESTY  383

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT+DP Y++ G  ++ SL    +   G+  + DV + + EDH  SFFLAET KYL+
Sbjct  384   WLYKATRDPKYLDAGRDMVASLQYSARCACGYCHIADVESHKQEDHMESFFLAETVKYLW  443

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             LLFD     D+ + N    YIF+TEGH LP 
Sbjct  444   LLFDLAVGPDNLVDNGPYKYIFSTEGHLLPA  474



>ref|XP_006403205.1| hypothetical protein EUTSA_v10003168mg [Eutrema salsugineum]
 gb|ESQ44658.1| hypothetical protein EUTSA_v10003168mg [Eutrema salsugineum]
Length=622

 Score =   426 bits (1095),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 232/515 (45%), Positives = 317/515 (62%), Gaps = 40/515 (8%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K++  +VR+MFYHA++ YM +AFP DELKPL+    D+L                G ALT
Sbjct  38    KQLRDEVREMFYHAFDGYMNNAFPLDELKPLSCQGEDTLG---------------GYALT  82

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL +L +LG+   F  +V W+  NL F+++  +++FE  IRVLGGL+SAH++A+D  
Sbjct  83    LIDSLDTLALLGDRERFTSSVEWIGKNLQFNINKTVSVFETTIRVLGGLLSAHLIASDYA  142

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +   +Y N+LL LAEDL RR LPAFDTPTG+PY  +NL  GV ++E+  TST+G G+L
Sbjct  143   TGMRIPSYDNELLVLAEDLTRRMLPAFDTPTGIPYGSVNLMYGVDKHESKITSTAGGGTL  202

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRLT DP+FE  A  A+R LW+ RSSL+L+G  ++V TGEW +   GIG  +D
Sbjct  203   SLEFGVLSRLTNDPVFEQVAKNAVRGLWARRSSLDLVGAHINVFTGEWTQKDAGIGTSID  262

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAYILFG +E+  +FQ AY +  +Y    PWY + +M +G   +    SLQAF
Sbjct  263   SFYEYLLKAYILFGDEEYLYIFQEAYGSAMQYLHKDPWYVEVNMDSGAIVWPVFNSLQAF  322

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GDVD A  +H  FF VWK++G  PE + L    +   +K YPLRPE  EST+
Sbjct  323   WPGLQVLAGDVDPAIRTHTAFFSVWKRYGFTPEGFNLATLSVQYGQKSYPLRPELIESTY  382

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT+DP Y++ G   + SL    K   G+  + DV   + EDH  SFFLAET KYL+
Sbjct  383   WLYKATRDPRYLDAGRDFVASLQYGAKCPCGYCHITDVEQHKQEDHLESFFLAETVKYLW  442

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV-----LSTWHDRLSEAYLPSNWTSFKHEK  364
             LLFD     D+ + N    YIF+TEGH LP+     L+  H      Y P N T  + E+
Sbjct  443   LLFDLAVNSDNLVDNGPYKYIFSTEGHLLPLTPQISLAREHCSYFGGYCPRNATKPEQEQ  502

Query  363   HRK-----------RASAMSQRICPATTLSHEQEY  292
                             + + + +CP   L+H Q+Y
Sbjct  503   ESTLSNVYPYHESFSVTGLIKGLCPG--LTHAQKY  535



>ref|XP_008438590.1| PREDICTED: probable alpha-mannosidase I MNS4 [Cucumis melo]
Length=614

 Score =   425 bits (1093),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 223/461 (48%), Positives = 298/461 (65%), Gaps = 24/461 (5%)
 Frame = -1

Query  1797  DPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHL  1618
             D   P  A + R   +VR+MFYHA+  YM HAFP DEL+PL+    DSL           
Sbjct  31    DGVTPQEANQLR--DEVREMFYHAFNGYMRHAFPLDELRPLSCEGEDSLG----------  78

Query  1617  PQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLV  1438
                  G ALTLI+SL +L +LG+  +F  +V W+  NL FD++  ++LFE NIRVLGGL+
Sbjct  79    -----GYALTLIDSLDTLALLGDREQFAASVEWIGKNLRFDINKTVSLFETNIRVLGGLL  133

Query  1437  SAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNett  1258
             SAH++A+D T  +   +Y+NQLL LAEDL RR LPAFDTPTG+P+  +NL  GV ++E+ 
Sbjct  134   SAHLIASDHTTGMKIASYENQLLHLAEDLARRLLPAFDTPTGIPFGSVNLLYGVDEHESK  193

Query  1257  etstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIE  1078
              TST+G G+L LE G LSRLT DPIFE     A+R LW+ RS LNL+G  ++V TGEW +
Sbjct  194   ITSTAGGGTLTLEFGVLSRLTNDPIFEQVTKNAVRGLWACRSKLNLVGAHINVFTGEWTQ  253

Query  1077  FSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKAT  898
                GIG  +DSFYEYL+KAY+LFG +E+  +FQ AY AV  Y  + PWY + +M +G   
Sbjct  254   KDAGIGTSIDSFYEYLLKAYLLFGDEEYLFIFQEAYGAVMHYLFNDPWYVEVNMDSGALV  313

Query  897   YWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYP  718
             +    SLQAFWPG+QVL GD+D A  +H  F  VWK++G  PE + L    +   +K YP
Sbjct  314   WPLFNSLQAFWPGLQVLAGDIDPAIRTHTAFLSVWKRYGFTPEGFNLATLSVQHGQKSYP  373

Query  717   LRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSF  538
             LRPE  EST++LY+AT++P Y++ G  ++ SL    +   G+  + DV   + EDH  SF
Sbjct  374   LRPELIESTYWLYKATRNPRYLDAGRDMVASLQYGARCPCGYCHISDVEFHKQEDHMESF  433

Query  537   FLAETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             FLAET KYL+LLFD     D+ + N    Y+F+TEGH LP 
Sbjct  434   FLAETVKYLWLLFDLAAGPDNLVENGPYKYVFSTEGHLLPA  474



>ref|XP_006350659.1| PREDICTED: probable alpha-mannosidase I MNS4-like isoform X2 
[Solanum tuberosum]
Length=613

 Score =   423 bits (1088),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 216/451 (48%), Positives = 292/451 (65%), Gaps = 22/451 (5%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K +  +VR+MFYHA+  YM HAFP DEL+PL+    D+L                G ALT
Sbjct  33    KELRDEVREMFYHAFNGYMNHAFPRDELRPLSCGGEDTLG---------------GYALT  77

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL +L +LG+   F  +V W+  NL FD++  +++FE  IR+LGGL+SAH++A+D  
Sbjct  78    LIDSLDTLALLGDRERFTASVEWIGKNLRFDINKTVSIFETTIRILGGLISAHLIASDHN  137

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +   +Y ++LL LAEDL RR LPAFDTPTG+P+  +NL  GV +NE+  TST+G G+L
Sbjct  138   TGMRIPSYDDELLHLAEDLARRMLPAFDTPTGIPFGSVNLLHGVDENESKITSTAGGGTL  197

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRLT DPIFE  A  A+R LW+ RS +NL+G  +DV +GEW +   GIG  +D
Sbjct  198   TLEFGILSRLTNDPIFEQVAKNAVRGLWARRSKINLVGAHIDVFSGEWTQKDAGIGTSID  257

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAY+LFG +E+  +FQ AY AV KY    PWY + +M +    +    SLQAF
Sbjct  258   SFYEYLLKAYLLFGDEEYLFIFQEAYKAVMKYLFSDPWYVEVNMNSAALVWPLFNSLQAF  317

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GD++ A  +H  FF VW+++G  PE + L    +   +K YPLRPE  EST+
Sbjct  318   WPGLQVLAGDIEPAIRTHAAFFSVWRRYGFTPEGFNLATLSVQQGQKSYPLRPELIESTY  377

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT+DP Y++ G  I+ SL    +   G+  + DV   + EDH  SFFLAET KYL+
Sbjct  378   WLYKATRDPRYLDAGREILASLQYGARCTCGYCHISDVEFHKQEDHMESFFLAETVKYLW  437

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             LLFD     D+ + N    YIF+TEGH LP 
Sbjct  438   LLFDLAAGPDNLVENGPYKYIFSTEGHLLPA  468



>ref|XP_010936128.1| PREDICTED: probable alpha-mannosidase I MNS4 isoform X1 [Elaeis 
guineensis]
Length=626

 Score =   423 bits (1088),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 222/479 (46%), Positives = 304/479 (63%), Gaps = 29/479 (6%)
 Frame = -1

Query  1833  LSTFFPMSFSGFDPPNPMA-----ARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTK  1669
             ++ +F ++F+   P   +A     +  K++  +VR+MFYHA++ YM HAFP DEL+PL+ 
Sbjct  5     VAVYFLIAFAAVCPLGALADGVSPSEAKQLRDEVREMFYHAFDGYMHHAFPLDELRPLSC  64

Query  1668  TYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVD  1489
                D+L                G ALTLI+SL +L +LG+   F  AV W+  N+ FD+D
Sbjct  65    KGEDTLG---------------GYALTLIDSLDTLALLGDRERFSAAVEWVGKNVRFDID  109

Query  1488  ARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGL  1309
               +++FE  IRVLGGL+SAH++A+D    L   +Y +QLL LA DL  R LPAFDTPTG+
Sbjct  110   KTVSVFETTIRVLGGLLSAHLMASDYATGLKIQSYDDQLLHLAVDLATRLLPAFDTPTGI  169

Query  1308  PYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS  1129
             P+  +NL RGV +NE+  TST+G G+L LE G LS LT +PIFE     A+R +W+ RS 
Sbjct  170   PFGSVNLVRGVDENESKITSTAGGGTLTLEFGVLSHLTNNPIFEQVTKNAVRGIWARRSK  229

Query  1128  LNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYF  949
             +NL+G  ++V TGEW +   GIG  +DSFYEYL+KAY+LFG +E+  MFQ AY A   Y 
Sbjct  230   INLVGAHINVFTGEWTQKDAGIGTSIDSFYEYLLKAYLLFGDEEYLFMFQEAYKAAMHYL  289

Query  948   RHGPWYHDADMRTGKATYWQL-TSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLP  772
              H PWY + +M +  AT W L  SLQAFWPG+QVL GD+D A  +H  FF VWKK+G  P
Sbjct  290   HHDPWYVEVNMNSA-ATVWPLFNSLQAFWPGLQVLAGDIDPAVRTHAAFFSVWKKYGFTP  348

Query  771   ERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGF  592
             E + L        +K YPLRPE  EST++L++AT+DP Y++ G   + S+    +   G+
Sbjct  349   EGFNLATLNAQSGQKSYPLRPELMESTYWLFKATRDPRYLDAGRDFVTSIQYGARCPCGY  408

Query  591   ASVRDVTTMELEDHQHSFFLAETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
               + DV + + +DH  SFFLAET KYL+LLFD     D+ + N    YIF+TEGH LP 
Sbjct  409   CHIADVESHKQDDHMESFFLAETVKYLWLLFDLAVGPDNIVENGPYKYIFSTEGHLLPA  467



>ref|XP_006350658.1| PREDICTED: probable alpha-mannosidase I MNS4-like isoform X1 
[Solanum tuberosum]
Length=618

 Score =   422 bits (1086),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 216/451 (48%), Positives = 292/451 (65%), Gaps = 22/451 (5%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K +  +VR+MFYHA+  YM HAFP DEL+PL+    D+L                G ALT
Sbjct  33    KELRDEVREMFYHAFNGYMNHAFPRDELRPLSCGGEDTLG---------------GYALT  77

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL +L +LG+   F  +V W+  NL FD++  +++FE  IR+LGGL+SAH++A+D  
Sbjct  78    LIDSLDTLALLGDRERFTASVEWIGKNLRFDINKTVSIFETTIRILGGLISAHLIASDHN  137

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +   +Y ++LL LAEDL RR LPAFDTPTG+P+  +NL  GV +NE+  TST+G G+L
Sbjct  138   TGMRIPSYDDELLHLAEDLARRMLPAFDTPTGIPFGSVNLLHGVDENESKITSTAGGGTL  197

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRLT DPIFE  A  A+R LW+ RS +NL+G  +DV +GEW +   GIG  +D
Sbjct  198   TLEFGILSRLTNDPIFEQVAKNAVRGLWARRSKINLVGAHIDVFSGEWTQKDAGIGTSID  257

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAY+LFG +E+  +FQ AY AV KY    PWY + +M +    +    SLQAF
Sbjct  258   SFYEYLLKAYLLFGDEEYLFIFQEAYKAVMKYLFSDPWYVEVNMNSAALVWPLFNSLQAF  317

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GD++ A  +H  FF VW+++G  PE + L    +   +K YPLRPE  EST+
Sbjct  318   WPGLQVLAGDIEPAIRTHAAFFSVWRRYGFTPEGFNLATLSVQQGQKSYPLRPELIESTY  377

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT+DP Y++ G  I+ SL    +   G+  + DV   + EDH  SFFLAET KYL+
Sbjct  378   WLYKATRDPRYLDAGREILASLQYGARCTCGYCHISDVEFHKQEDHMESFFLAETVKYLW  437

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             LLFD     D+ + N    YIF+TEGH LP 
Sbjct  438   LLFDLAAGPDNLVENGPYKYIFSTEGHLLPA  468



>ref|XP_004970143.1| PREDICTED: probable alpha-mannosidase I MNS4-like isoform X8 
[Setaria italica]
Length=672

 Score =   424 bits (1089),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 223/458 (49%), Positives = 301/458 (66%), Gaps = 26/458 (6%)
 Frame = -1

Query  1785  PMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKY  1606
             P  ARR R   +V+ MFYHA++ YM +AFP DEL+PL+    DSL               
Sbjct  38    PSEARRLR--DEVKDMFYHAFDGYMKYAFPLDELRPLSCQGEDSLG--------------  81

Query  1605  SGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHI  1426
              G ALTLI+SL +L +LG+  +F  AV W+  N+ FD++  +++FE NIR+LGGL+SAH+
Sbjct  82    -GYALTLIDSLDTLALLGDKEKFGAAVEWVGKNVRFDINKTVSVFETNIRILGGLLSAHL  140

Query  1425  LATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetst  1246
             +A+D    +   +Y +QLL+LA DL +R LPAFDTPTG+P+  +NLK GV +NE+  TST
Sbjct  141   IASDYATGMRIQSYDDQLLNLAADLAQRLLPAFDTPTGIPFGSVNLKYGVDENESKITST  200

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTG  1066
             +G G+L LE G LSRLT + +FE     ++R +WS RS LNL+G  ++V TGEW +   G
Sbjct  201   AGGGTLTLEFGILSRLTNNTVFERVTKNSVRGIWSRRSKLNLVGAHINVFTGEWTQKDAG  260

Query  1065  IGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQL  886
             IG  +DSFYEYL+KAY+LFG +E+  +FQ AY A   Y  H PWY + +M +G AT W L
Sbjct  261   IGTSIDSFYEYLLKAYLLFGDEEYLYIFQEAYKAAMHYLHHDPWYVEVNMNSG-ATVWPL  319

Query  885   -TSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRP  709
               SLQAFWPG+QVL GDVD A  +H  FF VWKK+G  PE + L    +   ++ YPLRP
Sbjct  320   FNSLQAFWPGLQVLAGDVDPAIRTHAAFFSVWKKYGFTPEGFNLATSTVQNGQRSYPLRP  379

Query  708   EFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLA  529
             E  EST++L++AT+D  Y++VG  I+ SL    +   G+  + DV T + +DH  SFFLA
Sbjct  380   ELIESTYWLFKATRDYRYLDVGRDILASLQYGARCPCGYCHISDVETHKQDDHMESFFLA  439

Query  528   ETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             ET KYL+LLFD     D+ + N    YIF+TEGH LPV
Sbjct  440   ETVKYLWLLFDLAAGPDNIVENGPYKYIFSTEGHLLPV  477



>ref|XP_008224188.1| PREDICTED: probable alpha-mannosidase I MNS4 [Prunus mume]
Length=599

 Score =   421 bits (1082),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 222/489 (45%), Positives = 305/489 (62%), Gaps = 25/489 (5%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K++  +VR+MFYHA+  YM HAFP DEL+P +    DSL                G ALT
Sbjct  39    KQLRDEVREMFYHAFNGYMEHAFPLDELRPQSCGGEDSLG---------------GYALT  83

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL +L +LG+   F  +V W+  NL FD++  +++FE  IRVLGGL+SAH++A+D  
Sbjct  84    LIDSLDTLALLGDRDRFAASVEWIGKNLQFDINKTVSVFETTIRVLGGLLSAHLIASDYA  143

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +   TY N+LL+LAEDL RR LPAFDTP+G+P+  +NL  GV ++E+  TST+G G+L
Sbjct  144   TGMKIPTYNNELLNLAEDLARRLLPAFDTPSGIPFGSVNLMHGVDEHESKITSTAGGGTL  203

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRLT DPIFE   + A+R LW+ RS LNL+G  ++V TGEW +   GIG  +D
Sbjct  204   TLEFGVLSRLTKDPIFEQVTMNAVRGLWARRSRLNLVGAHINVFTGEWTQKDAGIGTSID  263

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAY+LFG +E+  +FQ AY A   Y  + PWY + +M +    +    SLQAF
Sbjct  264   SFYEYLLKAYLLFGDEEYLFIFQEAYAAAMHYLYNDPWYVEVNMDSAAVVWPLFNSLQAF  323

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GD+D A  +H  FF VWK++G  PE + L    +   ++ YPLRPE  EST+
Sbjct  324   WPGLQVLAGDIDPAIRTHTAFFSVWKRYGFTPEGFNLATLSVQHGQRSYPLRPELMESTY  383

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT+DP Y++ G  ++ SL    +   GF  + DV   + EDH  SFFLAET KYL+
Sbjct  384   WLYKATRDPKYLDAGRDMVASLQYSARCPCGFCHIADVEFHKQEDHMESFFLAETVKYLW  443

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV---LSTWHDRLSEAYLPSNWTSFKHEKHR  358
             LLFD     D+ + N    YIF+TEGH LP    +S   +  S      N  + ++E H 
Sbjct  444   LLFDLAVGPDNLVENGPYKYIFSTEGHILPATPEISLVQEHCSYFGAYCNTGNMRNESHA  503

Query  357   KRASAMSQR  331
                ++  Q 
Sbjct  504   SDVASNPQE  512



>ref|XP_007222006.1| hypothetical protein PRUPE_ppa002909mg [Prunus persica]
 gb|EMJ23205.1| hypothetical protein PRUPE_ppa002909mg [Prunus persica]
Length=622

 Score =   421 bits (1083),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 216/451 (48%), Positives = 292/451 (65%), Gaps = 22/451 (5%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K++  +VR+MFYHA+  YM HAFP DEL+P +    DSL                G ALT
Sbjct  39    KQLRDEVREMFYHAFNGYMEHAFPLDELRPQSCGGEDSLG---------------GYALT  83

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL +L +LG+   F  +V W+  NL FD++  +++FE  IRVLGGL+SAH++A+D  
Sbjct  84    LIDSLDTLALLGDRDRFAASVEWIGKNLQFDINKTVSVFETTIRVLGGLLSAHLIASDYA  143

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +   TY N+LL+LAEDL RR LPAFDTP+G+P+  +NL  GV ++E+  TST+G G+L
Sbjct  144   TGMKIPTYNNELLNLAEDLARRLLPAFDTPSGIPFGSVNLMHGVDEHESKITSTAGGGTL  203

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRLT DPIFE   + A+R LW+ RS LNL+G  ++V TGEW +   GIG  +D
Sbjct  204   TLEFGVLSRLTKDPIFEQVTMNAVRGLWARRSRLNLVGAHINVFTGEWTQKDAGIGTSID  263

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAY+LFG +E+  +FQ AY A   Y  + PWY + +M +    +    SLQAF
Sbjct  264   SFYEYLLKAYLLFGDEEYLFIFQEAYAAAMHYLYNDPWYVEVNMDSAAVVWPLFNSLQAF  323

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GD+D A  +H  FF VWK++G  PE + L    +   ++ YPLRPE  EST+
Sbjct  324   WPGLQVLAGDIDPAIRTHTAFFSVWKRYGFTPEGFNLATLSVQHGQRSYPLRPELMESTY  383

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT+DP Y++ G  ++ SL    +   GF  + DV   + EDH  SFFLAET KYL+
Sbjct  384   WLYKATRDPQYLDAGRDMVASLQYSARCPCGFCHISDVEFHKQEDHMESFFLAETVKYLW  443

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             LLFD     D+ + N    YIF+TEGH LP 
Sbjct  444   LLFDLAVGPDNLVENGPYKYIFSTEGHLLPA  474



>gb|KHN30561.1| Putative alpha-mannosidase I MNS4 [Glycine soja]
Length=619

 Score =   421 bits (1083),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 217/451 (48%), Positives = 290/451 (64%), Gaps = 22/451 (5%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K +  +V+ MFYHA+  YM HAFP DEL+PL+    D+L                G ALT
Sbjct  35    KELRDEVKDMFYHAFNGYMDHAFPLDELRPLSCAGHDTLG---------------GYALT  79

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL +L +LG+   F  +V W+  NL FD++  ++LFE  IRVLGGL+SAH++ATD  
Sbjct  80    LIDSLDTLALLGDRQRFSASVEWIGKNLRFDINKTVSLFETTIRVLGGLLSAHLIATDYA  139

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
             + +    Y NQLL+LAEDL RR LPAFDTPTG+P+  +NL  GV ++E+  TST+G G+L
Sbjct  140   SGMRVPLYDNQLLNLAEDLARRLLPAFDTPTGIPFGSVNLLHGVDKHESKITSTAGGGTL  199

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRLT DPIFE     A+R LW+ RS LNL+G  ++V TGEW +   GIG  +D
Sbjct  200   TLEFGVLSRLTNDPIFEQVTKNAVRGLWARRSKLNLVGAHINVFTGEWTQKDAGIGTSID  259

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAY+LFG +E+  +FQ AY A   Y  H PWY + +M +    +    SLQAF
Sbjct  260   SFYEYLLKAYLLFGDEEYLYIFQEAYAAAMHYLYHDPWYVEVNMDSAAIVWPLFNSLQAF  319

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GD++ A  +H  F  VW+++G  PE + L    +   +K YPLRPE  EST+
Sbjct  320   WPGLQVLAGDINPAIRTHAAFLSVWRRYGFTPEGFNLASLSVQHGQKSYPLRPELIESTY  379

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT+DP Y++ G  ++ SL   T+   G+  + DV   + EDH  SFFLAET KYL+
Sbjct  380   WLYKATRDPRYLDAGRDMVASLQYGTRCPCGYCHISDVENHQQEDHMESFFLAETVKYLW  439

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             LLFD     D+ + N    YIF+TEGH LP 
Sbjct  440   LLFDLAVGPDNLVENGPYKYIFSTEGHLLPA  470



>ref|NP_199184.1| putative alpha-mannosidase I MNS4 [Arabidopsis thaliana]
 sp|Q9FG93.1|MNS4_ARATH RecName: Full=Probable alpha-mannosidase I MNS4 [Arabidopsis 
thaliana]
 gb|AAK43943.1|AF370128_1 unknown protein [Arabidopsis thaliana]
 dbj|BAB11298.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK64102.1| unknown protein [Arabidopsis thaliana]
 gb|AED94999.1| putative alpha-mannosidase I MNS4 [Arabidopsis thaliana]
Length=624

 Score =   421 bits (1082),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 234/551 (42%), Positives = 328/551 (60%), Gaps = 52/551 (9%)
 Frame = -1

Query  1839  IFLSTFFPMSFSGFDPPNPMAARR------KRMSQKVRKMFYHAYENYMMHAFPHDELKP  1678
             +  +    ++FSGF   + + A        K++  +VR MFYHA++ YM +AFP DEL+P
Sbjct  8     LLFAILISLTFSGFVLHHGVLAESVKPDEAKQLRDEVRGMFYHAFDGYMNNAFPLDELRP  67

Query  1677  LTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSF  1498
             L+    D+L                G ALTLI+SL +L +LG+   F  +V W+  NL F
Sbjct  68    LSCQGEDTLG---------------GYALTLIDSLDTLALLGDRERFTSSVEWIGKNLQF  112

Query  1497  DVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTP  1318
             +++  +++FE  IRVLGGL+SAH++A+D    +   +Y N+LL LAE+L RR LPAFDTP
Sbjct  113   NINKTVSVFETTIRVLGGLLSAHLIASDYATGMRIPSYNNELLVLAENLARRMLPAFDTP  172

Query  1317  TGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSM  1138
             TG+P+  +NL  GV ++E+  TST+G G+L LE G LSRLT DP+FE  A  A+R LW+ 
Sbjct  173   TGIPFGSVNLMYGVDKHESKITSTAGGGTLSLEFGVLSRLTNDPVFEQVAKNAVRGLWAR  232

Query  1137  RSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQ  958
             RS+L+L+G  ++V TGEW +   GIG  +DSFYEYL+KAYILFG +E+  +FQ AY +  
Sbjct  233   RSNLDLVGAHINVFTGEWTQKDAGIGTSIDSFYEYLLKAYILFGDEEYLYIFQEAYRSAM  292

Query  957   KYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGV  778
             +Y    PWY + +M +    +    SLQAFWPG+QVL GDVD A  +H  FF VWK++G 
Sbjct  293   QYLHKDPWYVEVNMDSAAIVWPVFNSLQAFWPGLQVLAGDVDPAIRTHTAFFSVWKRYGF  352

Query  777   LPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQG  598
              PE + L    +   +K YPLRPE  EST++LY+AT+DP Y++ G   + SL    K   
Sbjct  353   TPEGFNLATLSVQYGQKSYPLRPELIESTYWLYKATRDPRYLDAGRDFVASLQYGAKCPC  412

Query  597   GFASVRDVTTMELEDHQHSFFLAETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLP  439
             G+  + DV   + EDH  SFFLAET KYL+LLFD     D+ + N    YIF+TEGH LP
Sbjct  413   GYCHITDVELHKQEDHMESFFLAETVKYLWLLFDLAVDSDNLVDNGPYKYIFSTEGHLLP  472

Query  438   V-----LSTWHDRLSEAYLPSNWTSFKHEKHRKRAS-----------------AMSQRIC  325
             +     L+  H      Y PSN T  + E   + +S                  + + +C
Sbjct  473   ITPQISLAREHCSYFGGYCPSNSTKLEQEVLGEDSSNDDHSNDYPYHESFPVTGLIKGLC  532

Query  324   PATTLSHEQEY  292
             P   L+H Q+Y
Sbjct  533   PG--LTHAQKY  541



>ref|XP_002863644.1| glycoside hydrolase family 47 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39903.1| glycoside hydrolase family 47 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=624

 Score =   421 bits (1082),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 230/521 (44%), Positives = 319/521 (61%), Gaps = 46/521 (9%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K++  +VR MFYHA++ YM +AFP DEL+PL+    D+L                G ALT
Sbjct  38    KQLRDEVRGMFYHAFDGYMNNAFPLDELRPLSCQGEDTLG---------------GYALT  82

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL +L +LG+   F  +V W+  NL F+++  +++FE  IRVLGGL+SAH++A+D  
Sbjct  83    LIDSLDTLALLGDRERFTSSVEWIGKNLQFNINKTVSVFETTIRVLGGLLSAHLIASDYA  142

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +   +Y N+LL LAEDL RR LPAFDTPTG+P+  +NL  GV ++E+  TST+G G+L
Sbjct  143   TGMRIPSYNNELLVLAEDLTRRMLPAFDTPTGIPFGSVNLMYGVDKHESKITSTAGGGTL  202

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRLT DP+FE  A  A+R LW+ RS+L+L+G  ++V TGEW +   GIG  +D
Sbjct  203   SLEFGVLSRLTNDPVFEQVAKNAVRGLWARRSNLDLVGAHINVFTGEWTQKDAGIGTSID  262

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAYILFG +E+  +FQ AY +  +Y    PWY + +M +    +    SLQAF
Sbjct  263   SFYEYLLKAYILFGDEEYLYIFQEAYRSAMQYLHKDPWYVEVNMDSAAIVWPVFNSLQAF  322

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GDVD A  +H  FF VWK++G  PE + L    +   +K YPLRPE  EST+
Sbjct  323   WPGLQVLAGDVDPAIRTHTAFFSVWKRYGFTPEGFNLATLSVQYGQKSYPLRPELIESTY  382

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT+DP Y++ G   + SL    K   G+  + DV   + EDH  SFFLAET KYL+
Sbjct  383   WLYKATRDPRYLDAGRDFVASLQYGAKCPCGYCHITDVELHKQEDHMESFFLAETVKYLW  442

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV---LSTWHDRLS--EAYLPSNWTSFKHEK  364
             LLFD     D+ + N    YIF+TEGH LP+   +S   +R S    Y PSN T  + E 
Sbjct  443   LLFDLAVDSDNLVDNGPYKYIFSTEGHLLPLTPQISLARERCSYFGGYCPSNSTKLEQEV  502

Query  363   HRKRA-----------------SAMSQRICPATTLSHEQEY  292
               + +                 + + + +CP   L+H Q+Y
Sbjct  503   LEEESNNDDRSNIYPYHESFPITGLIKGLCPG--LTHAQKY  541



>ref|XP_003536208.1| PREDICTED: probable alpha-mannosidase I MNS4-like [Glycine max]
Length=619

 Score =   421 bits (1081),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 217/451 (48%), Positives = 289/451 (64%), Gaps = 22/451 (5%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K +  +V+ MFYHA+  YM HAFP DEL+PL+    D+L                G ALT
Sbjct  35    KELRDEVKDMFYHAFNGYMDHAFPLDELRPLSCAGHDTLG---------------GYALT  79

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL +L +LG+   F  +V W+  NL FD++  ++LFE  IRVLGGL+SAH++ATD  
Sbjct  80    LIDSLDTLALLGDRQRFSASVEWIGKNLRFDINKTVSLFETTIRVLGGLLSAHLIATDYA  139

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +    Y NQLL+LAEDL RR LPAFDTPTG+P+  +NL  GV ++E+  TST+G G+L
Sbjct  140   TGMRVPLYDNQLLNLAEDLARRLLPAFDTPTGIPFGSVNLLHGVDKHESKITSTAGGGTL  199

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRLT DPIFE     A+R LW+ RS LNL+G  ++V TGEW +   GIG  +D
Sbjct  200   TLEFGVLSRLTNDPIFEQVTKNAVRGLWARRSKLNLVGAHINVFTGEWTQKDAGIGTSID  259

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAY+LFG +E+  +FQ AY A   Y  H PWY + +M +    +    SLQAF
Sbjct  260   SFYEYLLKAYLLFGDEEYLYIFQEAYAAAMHYLYHDPWYVEVNMDSAAIVWPLFNSLQAF  319

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GD++ A  +H  F  VW+++G  PE + L    +   +K YPLRPE  EST+
Sbjct  320   WPGLQVLAGDINPAIRTHAAFLSVWRRYGFTPEGFNLASLSVQHGQKSYPLRPELIESTY  379

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT+DP Y++ G  ++ SL   T+   G+  + DV   + EDH  SFFLAET KYL+
Sbjct  380   WLYKATRDPRYLDAGRDMVASLQYGTRCPCGYCHISDVENHQQEDHMESFFLAETVKYLW  439

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             LLFD     D+ + N    YIF+TEGH LP 
Sbjct  440   LLFDLAVGPDNLVENGPYKYIFSTEGHLLPA  470



>gb|EYU33010.1| hypothetical protein MIMGU_mgv1a002884mg [Erythranthe guttata]
Length=628

 Score =   421 bits (1081),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 218/483 (45%), Positives = 305/483 (63%), Gaps = 25/483 (5%)
 Frame = -1

Query  1863  KRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDEL  1684
             K+ L+ +++ LS FF    S            K++  +VR+MFYHA++ YM HAFP DEL
Sbjct  5     KKPLLLIMLILSDFF---VSEILAEGVTKEEAKQLRDEVREMFYHAFDGYMKHAFPRDEL  61

Query  1683  KPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNL  1504
             KPL+    D+L                G ALTLI+SL +L +LG+  +F  +V W+  N+
Sbjct  62    KPLSCGGEDTLG---------------GYALTLIDSLDTLALLGDREQFTTSVEWIGKNI  106

Query  1503  SFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFD  1324
              FD++  +++FE  IR+LGGL+SAH++A+D    +   +Y ++LL LAEDL RR LPAFD
Sbjct  107   RFDINKTVSIFETTIRILGGLLSAHLIASDYNTGMRIPSYDDELLHLAEDLARRMLPAFD  166

Query  1323  TPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLW  1144
             TPTG+P+  +NL  GV +NE+  TST+G G+L LE G LSRLT DPIFE     A+R LW
Sbjct  167   TPTGIPFGSVNLMHGVDENESKITSTAGGGTLTLEFGVLSRLTNDPIFEQVTKNAVRGLW  226

Query  1143  SMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLA  964
             + RS +NL+G  +DV +GEW +   GIG  +DSFYEYL+KAY+LFG +E+  +FQ AY A
Sbjct  227   ARRSRINLVGAHIDVFSGEWTQKDAGIGTSIDSFYEYLLKAYLLFGDEEYLFIFQEAYRA  286

Query  963   VQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKF  784
                Y  + PWY + +M +    +    SLQAFWPG+QVL GD++ A  +H  FF VWK++
Sbjct  287   AMVYLYNDPWYVEVNMNSAALVWPLFNSLQAFWPGLQVLAGDIEPAIRTHAAFFSVWKRY  346

Query  783   GVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKV  604
             G  PE + L    +   +K YPLRPE  EST++LY+AT++P Y++ G  ++ SL    + 
Sbjct  347   GFTPEGFNLATFNVQQGQKSYPLRPELIESTYWLYKATRNPSYLDAGRDMLASLQYAARC  406

Query  603   QGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFD-----DSFLVNR--NYIFTTEGHP  445
               G+  + DV   + EDH  SFFLAET KYL+LLFD     D+ + N    YIF+TEGH 
Sbjct  407   TCGYCHISDVEFHQQEDHMESFFLAETVKYLWLLFDLAAGPDNLVENGPYKYIFSTEGHL  466

Query  444   LPV  436
             +P 
Sbjct  467   IPT  469



>ref|XP_002311656.2| glycoside hydrolase family 47 family protein [Populus trichocarpa]
 gb|EEE89023.2| glycoside hydrolase family 47 family protein [Populus trichocarpa]
Length=613

 Score =   420 bits (1080),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 220/449 (49%), Positives = 289/449 (64%), Gaps = 22/449 (5%)
 Frame = -1

Query  1761  MSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLI  1582
             +  +VR+MFYHA+  YM HAFP DELKPL+    DSL                G ALTLI
Sbjct  47    LRDEVREMFYHAFNGYMEHAFPLDELKPLSCEGEDSLG---------------GYALTLI  91

Query  1581  ESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNR  1402
             +SL  L +LG+   F  +V W+  NL FD++  +++FE  IRVLGGL+SAH++A+D    
Sbjct  92    DSLDMLALLGDRERFTSSVDWIGKNLRFDINKTVSVFETTIRVLGGLLSAHLIASDYATG  151

Query  1401  LVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLIL  1222
             +   +Y NQLLDLAEDL RR LPAFDTPTG+P+  +NL  GV + E+  TST+G G+L L
Sbjct  152   MRIPSYDNQLLDLAEDLARRMLPAFDTPTGIPFGSVNLLYGVDEQESRITSTAGGGTLTL  211

Query  1221  EMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSF  1042
             E G LSRLT DPIFE     A+R LW+ RS LNL+G  ++V TGEW +   GIG  +DSF
Sbjct  212   EFGMLSRLTNDPIFEQVTKNAVRGLWARRSKLNLVGAHINVFTGEWTQKDAGIGTSIDSF  271

Query  1041  YEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWP  862
             YEYL+KAY+LFG +E+  +FQ AY A   Y  + PWY + +M +    +    SLQAFWP
Sbjct  272   YEYLLKAYLLFGDEEYLFIFQEAYAAAMHYLYNDPWYVEVNMDSAAIVWPLFNSLQAFWP  331

Query  861   GVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYL  682
             G+QVL GD+D A  +H  FF VWK++G  PE + L    +   +K YPLRPE  EST++L
Sbjct  332   GLQVLAGDIDPAIRTHAAFFSVWKRYGFTPEGFNLATLTVQHGQKSYPLRPELIESTYWL  391

Query  681   YQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLL  502
             Y+AT+DP Y++VG  ++ SL    +   G+  + DV   + EDH  SFFLAET KYL+LL
Sbjct  392   YKATRDPRYLDVGRDMVVSLQYGARCPCGYCHIVDVEFHKKEDHMESFFLAETVKYLWLL  451

Query  501   FD-----DSFLVNR--NYIFTTEGHPLPV  436
             FD     D+ + N    YIF+TEGH LP 
Sbjct  452   FDLASGPDNLVENGPYKYIFSTEGHLLPA  480



>ref|XP_006282375.1| hypothetical protein CARUB_v10028673mg [Capsella rubella]
 gb|EOA15273.1| hypothetical protein CARUB_v10028673mg [Capsella rubella]
Length=624

 Score =   420 bits (1080),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 237/551 (43%), Positives = 330/551 (60%), Gaps = 46/551 (8%)
 Frame = -1

Query  1857  VLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKP  1678
             +LI +LI L+    +   G    +      K++  +VR MFYHA++ YM +AFP DEL+P
Sbjct  8     LLISILISLTFSSLVLHHGVLAESVKPEEAKQLRDEVRGMFYHAFDGYMNNAFPLDELRP  67

Query  1677  LTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSF  1498
             L+    D+L                G ALTLI+SL +L +LG+   F  +V W+  NL F
Sbjct  68    LSCQGEDTLG---------------GYALTLIDSLDTLALLGDRERFTSSVEWIGKNLQF  112

Query  1497  DVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTP  1318
             +++  +++FE  IRVLGGL+SAH++A+D    +   +Y N+LL LAEDL RR LPAFDTP
Sbjct  113   NINKTVSVFETTIRVLGGLLSAHLIASDYATGMRIPSYDNELLVLAEDLTRRMLPAFDTP  172

Query  1317  TGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSM  1138
             TG+P+  +NL  GV ++E+  TST+G G+L LE G LSRLT DP+FE  A  A+R LW+ 
Sbjct  173   TGIPFGSVNLMYGVDKHESKITSTAGGGTLSLEFGVLSRLTNDPVFEQVAKNAVRGLWAR  232

Query  1137  RSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQ  958
             RS+L+L+G  ++V TGEW +   GIG  +DSFYEYL+KAYILFG +E+  +FQ AY +  
Sbjct  233   RSNLDLVGAHINVFTGEWTQKDAGIGTSIDSFYEYLLKAYILFGDEEYLYIFQEAYRSAM  292

Query  957   KYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGV  778
             +Y    PWY + +M +    +    SLQAFWPG+QVL GDVD A  +H  FF VWK++G 
Sbjct  293   QYLHKDPWYVEVNMDSAAIVWPVFNSLQAFWPGLQVLAGDVDPAIRTHTAFFSVWKRYGF  352

Query  777   LPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQG  598
              PE + L    +   +K YPLRPE  EST++LY+ATKDP Y++ G   + SL    K   
Sbjct  353   TPEGFNLATLSVQYGQKSYPLRPELIESTYWLYKATKDPRYLDAGRDFVASLQYGAKCPC  412

Query  597   GFASVRDVTTMELEDHQHSFFLAETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLP  439
             G+  + DV   + EDH  SFFLAET KYL+LLFD     D+ + N    YIF+TEGH LP
Sbjct  413   GYCHITDVELHKQEDHMESFFLAETVKYLWLLFDLAVDSDNLVDNGPYKYIFSTEGHLLP  472

Query  438   V-----LSTWHDRLSEAYLPSNWTSFKHE------KHRKRA-----------SAMSQRIC  325
             +     L+  H      Y  SN+T  + E       H +R+           + + + +C
Sbjct  473   LTPQISLAREHCSYLGGYCLSNFTKPEQEVLEEESNHNERSNIYPYHESFPVTGLIKGLC  532

Query  324   PATTLSHEQEY  292
             P   L+H Q+Y
Sbjct  533   PG--LTHAQKY  541



>ref|XP_008788133.1| PREDICTED: probable alpha-mannosidase I MNS4 [Phoenix dactylifera]
 ref|XP_008788134.1| PREDICTED: probable alpha-mannosidase I MNS4 [Phoenix dactylifera]
Length=630

 Score =   420 bits (1080),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 226/489 (46%), Positives = 307/489 (63%), Gaps = 27/489 (6%)
 Frame = -1

Query  1878  FRIMRKRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAF  1699
             +R     V +  LI  +  FP+     D  +P  A  K++  +VR+MFYHA++ YM HAF
Sbjct  2     YRREMGAVAVYHLIAFAAVFPLGALA-DGVSPSEA--KQLRDEVREMFYHAFDGYMHHAF  58

Query  1698  PHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLW  1519
             P DEL+PLT    D+L                G ALTLI+SL +L +LG+   F  AV W
Sbjct  59    PLDELRPLTCKGEDTLG---------------GYALTLIDSLDTLALLGDRERFSAAVEW  103

Query  1518  LSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRF  1339
             +  N+ FD+D  +++FE  IRVLGGL+SAH++A+D    +   +Y +QLL LA DL  R 
Sbjct  104   VGKNVWFDIDKTVSVFETTIRVLGGLLSAHLIASDYATGMKIQSYDDQLLHLAVDLATRL  163

Query  1338  LPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRA  1159
             LPAFDTPTG+P+  +NL  GV +NE+  TST+G G+L LE G LSRLT +PI+E     A
Sbjct  164   LPAFDTPTGIPFGSVNLVHGVDENESKITSTAGGGTLTLEFGVLSRLTNNPIYEHVTKNA  223

Query  1158  LRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQ  979
             +R +W+ RS +NL+G  ++V TGEW +   GIG  +DSFYEYL+KAY+LFG +E+  MFQ
Sbjct  224   VRGIWARRSKINLVGAHINVFTGEWTQKDAGIGTSIDSFYEYLLKAYLLFGDEEYLFMFQ  283

Query  978   SAYLAVQKYFRHGPWYHDADMRTGKATYWQL-TSLQAFWPGVQVLVGDVDAANSSHREFF  802
              AY A   Y  H PWY + +M +  AT W L  SLQAFWPG+QVL GD+D A  +H  F 
Sbjct  284   EAYKAAMHYLHHDPWYVEVNMNSA-ATVWPLFNSLQAFWPGLQVLAGDIDPAVRTHAAFL  342

Query  801   HVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSL  622
              VWKK+G  PE + L    +   +K YPLRPE  EST++L++AT+DP Y++ G   + SL
Sbjct  343   SVWKKYGFTPEGFNLATLNVQSGQKGYPLRPELMESTYWLFKATRDPRYLDAGRDFVTSL  402

Query  621   NQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFD-----DSFLVNR--NYIF  463
                ++   G+  + DV + + +DH  SFFLAET KYL+LLFD     D+ + N    YIF
Sbjct  403   QYGSRCPCGYCHIADVESHKQDDHMESFFLAETVKYLWLLFDLAVGPDNIVENGPYKYIF  462

Query  462   TTEGHPLPV  436
             +TEGH LP 
Sbjct  463   STEGHLLPA  471



>dbj|BAD52943.1| putative aspartyl(D) tRNA Synthetase (89.0 kD)(drs-2C) [Oryza 
sativa Japonica Group]
Length=676

 Score =   421 bits (1083),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 222/462 (48%), Positives = 299/462 (65%), Gaps = 26/462 (6%)
 Frame = -1

Query  1797  DPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHL  1618
             D   P  ARR R   +V+ MFYHA++ YM HAFP DEL+PL+    DSL           
Sbjct  38    DGVTPSEARRLR--DEVKDMFYHAFDGYMQHAFPLDELRPLSCQGEDSLG----------  85

Query  1617  PQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLV  1438
                  G ALTLI+SL +L +LG+   F+ AV W+  N+ FD++  +++FE NIR+LGGL+
Sbjct  86    -----GYALTLIDSLDTLALLGDKERFDAAVEWVGKNVRFDINKTVSVFETNIRILGGLL  140

Query  1437  SAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNett  1258
             SAH++A+D    +   +Y +QLL LA DL +R LPAFDTPTG+P+  +NL  GV +NE+ 
Sbjct  141   SAHLIASDYATGMRIQSYDDQLLHLAADLAQRLLPAFDTPTGIPFGSVNLLYGVDENESK  200

Query  1257  etstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIE  1078
              TST+G G+L LE G LSRLT D ++E     ++R +W+ RS L+L+G  ++V TGEW +
Sbjct  201   ITSTAGGGTLTLEFGVLSRLTNDSVYERVTKNSVRGIWARRSKLDLVGAHINVFTGEWTQ  260

Query  1077  FSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKAT  898
                GIG  +DSFYEYL+KAY+LFG +E+  +FQ AY A   Y  H PWY + +M +G AT
Sbjct  261   KDAGIGTSIDSFYEYLLKAYLLFGDEEYLYIFQEAYKAAMHYLHHDPWYVEVNMNSG-AT  319

Query  897   YWQL-TSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYY  721
              W L  SLQAFWPG+QVL GDVD A  +H  FF VWKK+G  PE + L    +   ++ Y
Sbjct  320   VWPLFNSLQAFWPGLQVLAGDVDPAIRTHAAFFSVWKKYGFTPEGFNLATSTVQNGQRSY  379

Query  720   PLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHS  541
             PLRPE  EST++L++AT+D  Y++VG  I+ SL    K   G+  + DV T + +DH  S
Sbjct  380   PLRPELIESTYWLFKATRDYRYLDVGRDILASLQYGAKCPCGYCHISDVETHQQDDHMES  439

Query  540   FFLAETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             FFLAET KYL+LLFD     D+ + N    YIF+TEGH LP 
Sbjct  440   FFLAETVKYLWLLFDLAAGPDNIVENGPYKYIFSTEGHLLPA  481



>ref|XP_006420090.1| hypothetical protein CICLE_v10004553mg [Citrus clementina]
 gb|ESR33330.1| hypothetical protein CICLE_v10004553mg [Citrus clementina]
Length=624

 Score =   420 bits (1079),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 224/481 (47%), Positives = 304/481 (63%), Gaps = 24/481 (5%)
 Frame = -1

Query  1857  VLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKP  1678
             +L  + I LS  F +  S  D      AR+ R   +VR+MFYHA++ YM HAFP DEL+P
Sbjct  10    LLFLVSILLSGNFFICRSLADGVTAEEARQLR--DEVREMFYHAFDGYMEHAFPLDELRP  67

Query  1677  LTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSF  1498
             L+    DSL                G ALTL++SL +L +LG+   F  +V W+  NL F
Sbjct  68    LSCEGEDSLG---------------GYALTLVDSLDTLALLGDRERFTTSVEWIGKNLQF  112

Query  1497  DVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTP  1318
             D++  +++FE  IRVLGGL+SAH++A+D    +   +Y NQLL+LAEDL RR LPAFDTP
Sbjct  113   DINKTVSVFETTIRVLGGLLSAHLIASDYATGMKIPSYDNQLLNLAEDLARRLLPAFDTP  172

Query  1317  TGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSM  1138
             TG+P+  +NL  GV ++E+  TST+G G+L LE G LSRLT DPIFE    +A+  +W+ 
Sbjct  173   TGIPFGSVNLLHGVDEHESKITSTAGGGTLTLEFGVLSRLTNDPIFEQVTKKAVLGIWAR  232

Query  1137  RSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQ  958
             RS LNL+G  ++V TGEW +   GIG  +DSFYEYL+KAY+LFG +E+  +FQ +Y A  
Sbjct  233   RSKLNLVGAHINVFTGEWTQKDAGIGTSIDSFYEYLLKAYLLFGDEEYLYIFQESYQAAM  292

Query  957   KYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGV  778
              Y  + PWY + +M +    +    SLQAFWPG+QVL GD+D A  +H  FF VWK++G 
Sbjct  293   HYLFNDPWYVEVNMDSAAIVWLLFNSLQAFWPGLQVLAGDIDPAVRTHAAFFSVWKRYGF  352

Query  777   LPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQG  598
              PE + L    +   +K YPLRPE  EST+ LY+AT+DP Y++ G  ++ SL   T+   
Sbjct  353   TPEGFNLATLTIQQGQKSYPLRPELIESTYLLYKATRDPRYLDAGRDMVASLQYGTRCPC  412

Query  597   GFASVRDVTTMELEDHQHSFFLAETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLP  439
             G+  + DV   + EDH  SFFLAET KYL+LLFD     D+ + N    YIF+TEGH LP
Sbjct  413   GYCHISDVEFHKKEDHMESFFLAETVKYLWLLFDLAVGPDNLVENGPYKYIFSTEGHLLP  472

Query  438   V  436
              
Sbjct  473   A  473



>ref|NP_001044401.1| Os01g0773600 [Oryza sativa Japonica Group]
 dbj|BAF06315.1| Os01g0773600 [Oryza sativa Japonica Group]
Length=684

 Score =   421 bits (1083),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 222/462 (48%), Positives = 299/462 (65%), Gaps = 26/462 (6%)
 Frame = -1

Query  1797  DPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHL  1618
             D   P  ARR R   +V+ MFYHA++ YM HAFP DEL+PL+    DSL           
Sbjct  46    DGVTPSEARRLR--DEVKDMFYHAFDGYMQHAFPLDELRPLSCQGEDSLG----------  93

Query  1617  PQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLV  1438
                  G ALTLI+SL +L +LG+   F+ AV W+  N+ FD++  +++FE NIR+LGGL+
Sbjct  94    -----GYALTLIDSLDTLALLGDKERFDAAVEWVGKNVRFDINKTVSVFETNIRILGGLL  148

Query  1437  SAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNett  1258
             SAH++A+D    +   +Y +QLL LA DL +R LPAFDTPTG+P+  +NL  GV +NE+ 
Sbjct  149   SAHLIASDYATGMRIQSYDDQLLHLAADLAQRLLPAFDTPTGIPFGSVNLLYGVDENESK  208

Query  1257  etstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIE  1078
              TST+G G+L LE G LSRLT D ++E     ++R +W+ RS L+L+G  ++V TGEW +
Sbjct  209   ITSTAGGGTLTLEFGVLSRLTNDSVYERVTKNSVRGIWARRSKLDLVGAHINVFTGEWTQ  268

Query  1077  FSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKAT  898
                GIG  +DSFYEYL+KAY+LFG +E+  +FQ AY A   Y  H PWY + +M +G AT
Sbjct  269   KDAGIGTSIDSFYEYLLKAYLLFGDEEYLYIFQEAYKAAMHYLHHDPWYVEVNMNSG-AT  327

Query  897   YWQL-TSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYY  721
              W L  SLQAFWPG+QVL GDVD A  +H  FF VWKK+G  PE + L    +   ++ Y
Sbjct  328   VWPLFNSLQAFWPGLQVLAGDVDPAIRTHAAFFSVWKKYGFTPEGFNLATSTVQNGQRSY  387

Query  720   PLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHS  541
             PLRPE  EST++L++AT+D  Y++VG  I+ SL    K   G+  + DV T + +DH  S
Sbjct  388   PLRPELIESTYWLFKATRDYRYLDVGRDILASLQYGAKCPCGYCHISDVETHQQDDHMES  447

Query  540   FFLAETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             FFLAET KYL+LLFD     D+ + N    YIF+TEGH LP 
Sbjct  448   FFLAETVKYLWLLFDLAAGPDNIVENGPYKYIFSTEGHLLPA  489



>ref|XP_006489501.1| PREDICTED: probable alpha-mannosidase I MNS4-like [Citrus sinensis]
Length=624

 Score =   419 bits (1078),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 215/455 (47%), Positives = 294/455 (65%), Gaps = 22/455 (5%)
 Frame = -1

Query  1779  AARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSG  1600
             A   +++  +VR+MFYHA++ YM HAFP DEL+PL+    DSL                G
Sbjct  34    AEEARQLRDEVREMFYHAFDGYMEHAFPLDELRPLSCEGEDSLG---------------G  78

Query  1599  SALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILA  1420
              ALTL++SL +L +LG+   F  +V W+  NL FD++  +++FE  IRVLGGL+SAH++A
Sbjct  79    YALTLVDSLDTLALLGDRERFTTSVEWIGKNLQFDINKTVSVFETTIRVLGGLLSAHLIA  138

Query  1419  TDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSG  1240
             +D    +   +Y NQLL+LAEDL RR LPAFDTPTG+P+  +NL  GV ++E+  TST+G
Sbjct  139   SDYATGMKIPSYDNQLLNLAEDLARRLLPAFDTPTGIPFGSVNLLHGVDEHESKITSTAG  198

Query  1239  CGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIG  1060
              G+L LE G LSRLT DPIFE    +A+  +W+ RS LNL+G  ++V TGEW +   GIG
Sbjct  199   GGTLTLEFGVLSRLTNDPIFEQVTKKAVLGIWARRSKLNLVGAHINVFTGEWTQKDAGIG  258

Query  1059  AGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTS  880
               +DSFYEYL+KAY+LFG +E+  +FQ +Y A   Y  + PWY + +M +    +    S
Sbjct  259   TSIDSFYEYLLKAYLLFGDEEYLYIFQESYQAAMHYLFNDPWYVEVNMDSAAIVWPLFNS  318

Query  879   LQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFA  700
             LQAFWPG+QVL GD+D A  +H  FF VWK++G  PE + L    +   +K YPLRPE  
Sbjct  319   LQAFWPGLQVLAGDIDPAVRTHAAFFSVWKRYGFTPEGFNLATLTIQQGQKSYPLRPELI  378

Query  699   ESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETC  520
             EST+ LY+AT+DP Y++ G  ++ SL   T+   G+  + DV   + EDH  SFFLAET 
Sbjct  379   ESTYLLYKATRDPRYLDAGRDMVASLQYGTRCPCGYCHISDVEFHKKEDHMESFFLAETV  438

Query  519   KYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             KYL+LLFD     D+ + N    YIF+TEGH LP 
Sbjct  439   KYLWLLFDLAVGPDNLVENGPYKYIFSTEGHLLPA  473



>ref|XP_010542914.1| PREDICTED: probable alpha-mannosidase I MNS4 isoform X1 [Tarenaya 
hassleriana]
Length=657

 Score =   421 bits (1081),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 217/451 (48%), Positives = 295/451 (65%), Gaps = 22/451 (5%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K +  +VR+MFYH+++ YM HAFP DELKPL+    D+L                G ALT
Sbjct  53    KLLRDEVREMFYHSFDGYMKHAFPLDELKPLSCEGEDTLG---------------GYALT  97

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL +L +LG+   F  +V W+  NL F+++  +++FE +IRVLGGL+SAH++A+D  
Sbjct  98    LIDSLDTLALLGDRANFTSSVEWIGKNLQFNINKTVSVFETSIRVLGGLLSAHLIASDYA  157

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +   +Y N+LL LAEDL RR LPAFDTPTG+P+  +NL  GV ++E+  TST+G G+L
Sbjct  158   TGMRIPSYDNELLVLAEDLARRMLPAFDTPTGIPFGSVNLMHGVDKHESKITSTAGGGTL  217

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRLT DP+FE  A  A+R LW+ RS+L+L+G  ++V TGEW +   GIG  +D
Sbjct  218   TLEFGVLSRLTNDPVFEQVAKNAVRGLWARRSNLDLVGAHINVFTGEWTQKDAGIGTSID  277

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAYILFG +E+  MFQ AY AV +Y    PWY + +M +    +    SLQAF
Sbjct  278   SFYEYLLKAYILFGDEEYLYMFQEAYGAVMQYLHKDPWYVEVNMDSAAIVWPLFNSLQAF  337

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GD+D A  +H  FF VW+++G  PE + L    +   +K YPLRPE  EST+
Sbjct  338   WPGLQVLAGDIDPAIRTHTAFFSVWRRYGFTPEGFNLATLSVQHGQKSYPLRPELIESTY  397

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT+DP Y++ G   + SL    +   G+  + DV   + EDH  SFFLAET KYL+
Sbjct  398   WLYKATRDPRYLDAGRDFVTSLQYGARCPCGYCHITDVEFHKQEDHMESFFLAETVKYLW  457

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             LLFD     D+ + N    YIFTTEGH LP+
Sbjct  458   LLFDLAVGPDNRVENGPYQYIFTTEGHLLPM  488



>ref|XP_011027514.1| PREDICTED: probable alpha-mannosidase I MNS4 [Populus euphratica]
 ref|XP_011027519.1| PREDICTED: probable alpha-mannosidase I MNS4 [Populus euphratica]
 ref|XP_011029893.1| PREDICTED: probable alpha-mannosidase I MNS4 [Populus euphratica]
 ref|XP_011029894.1| PREDICTED: probable alpha-mannosidase I MNS4 [Populus euphratica]
Length=621

 Score =   419 bits (1077),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 220/449 (49%), Positives = 289/449 (64%), Gaps = 22/449 (5%)
 Frame = -1

Query  1761  MSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLI  1582
             +  +VR+MFYHA+  YM HAFP DELKPL+    DSL                G ALTLI
Sbjct  48    LRDEVREMFYHAFNGYMEHAFPLDELKPLSCEGEDSLG---------------GYALTLI  92

Query  1581  ESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNR  1402
             +SL  L +LG+  +F  +V W+  NL FD++  +++FE  IRVLGGL+SAH++A+D    
Sbjct  93    DSLDMLALLGDREQFTSSVDWIGKNLRFDINKTVSVFETTIRVLGGLLSAHLIASDYATG  152

Query  1401  LVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLIL  1222
             +   +Y NQLLDLAEDL RR LPAFDTPTG+P+  +NL  GV + E+  TST+G G+L L
Sbjct  153   MRIPSYDNQLLDLAEDLARRMLPAFDTPTGIPFGSVNLLYGVDEQESRITSTAGGGTLTL  212

Query  1221  EMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSF  1042
             E G LSRLT DPIFE     A+R LW+ RS LNL+G  ++V TGEW +   GIG  +DSF
Sbjct  213   EFGMLSRLTNDPIFEQVTKNAVRGLWARRSKLNLVGAHINVFTGEWTQKDAGIGTSIDSF  272

Query  1041  YEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWP  862
             YEYL+KAY+LFG +E+  +FQ AY A   Y  + PWY + +M +    +    SLQAFWP
Sbjct  273   YEYLLKAYLLFGDEEYLFIFQEAYAAAMHYLYNDPWYVEVNMDSAAIVWPLFNSLQAFWP  332

Query  861   GVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYL  682
             G+QVL GD+D A  +H  FF VWK++G  PE + L    +   +K YPLRPE  EST++L
Sbjct  333   GLQVLAGDIDPAIRTHAAFFSVWKRYGFTPEGFNLATLTVQHGQKSYPLRPELIESTYWL  392

Query  681   YQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLL  502
             Y+AT+DP Y +VG  ++ SL    +   G+  + DV   + EDH  SFFLAET KYL+LL
Sbjct  393   YKATRDPRYPDVGRDMVVSLQYGARCPCGYCHIVDVEFHKKEDHMESFFLAETVKYLWLL  452

Query  501   FD-----DSFLVNR--NYIFTTEGHPLPV  436
             FD     D+ + N    YIF+TEGH LP 
Sbjct  453   FDLASGPDNLVENGPYKYIFSTEGHLLPA  481



>ref|XP_010441994.1| PREDICTED: probable alpha-mannosidase I MNS4 [Camelina sativa]
Length=625

 Score =   419 bits (1077),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 230/521 (44%), Positives = 317/521 (61%), Gaps = 46/521 (9%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K++  +VR MFYHA++ YM +AFP DEL+PL+    D+L                G ALT
Sbjct  38    KQLRDEVRGMFYHAFDGYMNNAFPLDELRPLSCQGEDTLG---------------GYALT  82

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL +L +LG+   F  +VLW+  NL F+++  +++FE  IRVLGGL+SAH++A+D  
Sbjct  83    LIDSLDTLALLGDRESFTSSVLWIGKNLQFNINKTVSVFETTIRVLGGLLSAHLIASDYA  142

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +   +Y N+LL LAEDL RR LPAFDTPTG+P+  +NL  GV ++E+  TST+G G+L
Sbjct  143   TGMRIPSYNNELLVLAEDLTRRMLPAFDTPTGIPFGSVNLMYGVDKHESKITSTAGGGTL  202

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRLT DP+FE  A  A+R LW+ RS+L+L+G  ++V TGEW +   GIG  +D
Sbjct  203   SLEFGVLSRLTNDPVFEQVAKNAVRGLWARRSNLDLVGAHINVFTGEWTQKDAGIGTSID  262

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAYILFG +E+  +FQ AY +  ++    PWY + +M +    +    SLQAF
Sbjct  263   SFYEYLLKAYILFGDEEYLYIFQEAYRSAMQHLHKDPWYVEVNMDSAAIVWPVFNSLQAF  322

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GDVD A  +H  FF VWK++G  PE + L    +   +K YPLRPE  EST+
Sbjct  323   WPGLQVLAGDVDPAIRTHTAFFSVWKRYGFTPEGFNLATLSVQYGQKSYPLRPELIESTY  382

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT+DP Y++ G   + SL    K   G+  + DV   + EDH  SFFLAET KYL+
Sbjct  383   WLYKATRDPRYLDAGRDFVASLQYGAKCPCGYCHITDVELHKQEDHMESFFLAETVKYLW  442

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV-----LSTWHDRLSEAYLPSNWTSFKHEK  364
             LLFD     D+ + N    YIF+TEGH LP+     L+  H      Y  SN T  + E 
Sbjct  443   LLFDLAVDSDNLVDNGPYKYIFSTEGHLLPLTPQISLAREHCSYLGGYCSSNSTKREQEV  502

Query  363   HRKRAS-----------------AMSQRICPATTLSHEQEY  292
               + +S                  + + ICP   L+H Q+Y
Sbjct  503   LEEESSNDARSNIYPYHESFPVTGLIKGICPG--LTHAQKY  541



>ref|XP_009123899.1| PREDICTED: probable alpha-mannosidase I MNS4 [Brassica rapa]
Length=632

 Score =   419 bits (1077),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 232/531 (44%), Positives = 319/531 (60%), Gaps = 51/531 (10%)
 Frame = -1

Query  1788  NPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQK  1609
             NP  A  K++  +VR+MFYHA++ YM +AFP DEL+PL+    D+L              
Sbjct  38    NPHEA--KQLRDEVREMFYHAFDGYMNNAFPLDELRPLSCQGEDTLG-------------  82

Query  1608  YSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAH  1429
               G ALTLI+SL +L +LG+   F  +V W+  +L F+++  +++FE  IRVLGGL+SAH
Sbjct  83    --GYALTLIDSLDTLALLGDRERFTSSVQWIGKSLQFNINKTVSVFETTIRVLGGLLSAH  140

Query  1428  ILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettets  1249
             ++A+D    +   +Y N+LL LAEDL RR LPAFDTPTG+PY  +NL  GV ++E+  TS
Sbjct  141   LIASDYATGMRIPSYDNELLVLAEDLARRMLPAFDTPTGIPYGSVNLMYGVDEHESKITS  200

Query  1248  tSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFST  1069
             T+G G+L LE G LSRLT DP+FE  A  A+R LW+ RS+L+L+G  ++V TGEW +   
Sbjct  201   TAGGGTLTLEFGVLSRLTNDPVFEQVAKNAVRGLWARRSTLDLVGAHINVFTGEWTQKDA  260

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQ  889
             GIG  +DSFYEYL+KAYILFG +E+  +FQ AY +   +    PWY + +M +G   +  
Sbjct  261   GIGTSIDSFYEYLLKAYILFGDEEYLYIFQEAYGSAMHHLHKDPWYVEVNMDSGAIVWPV  320

Query  888   LTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRP  709
               SLQAFWPG+QVL GDVD A  +H  FF VWK++G  PE + L    +   +K YPLRP
Sbjct  321   FNSLQAFWPGLQVLAGDVDPAIRTHTAFFSVWKRYGFTPEGFNLATLSVQYGQKSYPLRP  380

Query  708   EFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLA  529
             E  EST++LY+AT+DP Y++ G   + SL    K   G+  + DV   + EDH  SFFLA
Sbjct  381   ELIESTYWLYKATRDPRYLDAGRDFVASLQYGAKCPCGYCHITDVELHKQEDHMESFFLA  440

Query  528   ETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV-----LSTWHDRLSEAYLPSNW  385
             ET KYL+LLFD     D+ + N    YIF+TEGH LP+     L+  H      Y P N 
Sbjct  441   ETVKYLWLLFDLAVDSDNLVDNGPYKYIFSTEGHLLPLTPQISLAREHCSYFGGYCPRNA  500

Query  384   TSFKHEKHRKR--------------------ASAMSQRICPATTLSHEQEY  292
             T F+      +                     + + + +CP   LSH Q+Y
Sbjct  501   TKFEQSNDDHQVPEIELGHHSNIYPYHESFPVTGLIKGLCP--RLSHAQKY  549



>ref|XP_004241034.1| PREDICTED: probable alpha-mannosidase I MNS4 isoform X2 [Solanum 
lycopersicum]
Length=613

 Score =   418 bits (1075),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 213/451 (47%), Positives = 290/451 (64%), Gaps = 22/451 (5%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K +  +VR+MFYHA+  YM HAFP DEL+PL+    D+L                G ALT
Sbjct  33    KELRDEVREMFYHAFNGYMNHAFPRDELRPLSCGGEDTLG---------------GYALT  77

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL +L +LG+   F  +V W+  NL FD++  +++FE  IR+LGGL+SAH++A+D  
Sbjct  78    LIDSLDTLALLGDRERFTASVEWIGKNLRFDINKTVSIFETTIRILGGLISAHLIASDHN  137

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +   +Y ++LL LAEDL RR LPAFDTPTG+P+  +NL  GV +NE+  TST+G G+L
Sbjct  138   TGMKIPSYDDELLHLAEDLARRMLPAFDTPTGIPFGSVNLLHGVDENESKITSTAGGGTL  197

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRL  DPIFE  +  A+R LW+ RS +NL+G  +DV +GEW +   GIG  +D
Sbjct  198   TLEFGILSRLINDPIFEQVSKNAVRGLWARRSKINLVGAHIDVFSGEWTQKDAGIGTSID  257

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAY+LFG +E+  +FQ AY A   Y    PWY + +M +    +    SLQAF
Sbjct  258   SFYEYLLKAYLLFGDEEYLFIFQEAYKAAMNYLFSDPWYVEVNMNSAALVWPLFNSLQAF  317

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GD++ A  +H  FF VWK++G  PE + L    +   +K YPLRPE  EST+
Sbjct  318   WPGLQVLAGDIEPAIRTHAAFFSVWKRYGFTPEGFNLATLSVQQGQKSYPLRPELIESTY  377

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT+DP Y++ G  I+ SL    +   G+  + DV   + EDH  SFFLAET KYL+
Sbjct  378   WLYKATRDPRYLDAGREILASLQYGARCTCGYCHISDVEFHKQEDHMESFFLAETVKYLW  437

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             LLFD     D+ + N    Y+F+TEGH LPV
Sbjct  438   LLFDLAAGPDNLVENGPYKYVFSTEGHLLPV  468



>gb|KDP40271.1| hypothetical protein JCGZ_02269 [Jatropha curcas]
Length=608

 Score =   418 bits (1074),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 216/449 (48%), Positives = 292/449 (65%), Gaps = 22/449 (5%)
 Frame = -1

Query  1761  MSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLI  1582
             +  +VR+MFYHA++ YM HAFP DEL+PL+    D+L                G ALTLI
Sbjct  43    LRDEVREMFYHAFDGYMEHAFPRDELRPLSCEGEDTLG---------------GYALTLI  87

Query  1581  ESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNR  1402
             +SL +L +LG+   F  +V W++ NL FD++  +++FE +IRVLGGL+SAH+LA+D    
Sbjct  88    DSLDTLALLGDRERFTSSVEWIAKNLRFDINKTVSVFETSIRVLGGLLSAHLLASDYATG  147

Query  1401  LVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLIL  1222
             +   +Y NQLLDLAEDL RR LPAFDTPTG+P+  +NL  GV ++E+  TST+G G+L L
Sbjct  148   MRIPSYDNQLLDLAEDLARRMLPAFDTPTGIPFGSVNLLHGVDEHESKITSTAGGGTLTL  207

Query  1221  EMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSF  1042
             E G LSRLT +PIFE     A+R LW+ RS LNL+G  ++V TGEW +   GIG  +DSF
Sbjct  208   EFGVLSRLTNNPIFEQVTKNAVRGLWARRSRLNLVGAHINVFTGEWTQKDAGIGTSIDSF  267

Query  1041  YEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWP  862
             YEYL+KAY+LFG +E+  +FQ AY A   Y  + PWY + +M +    +    SLQAFWP
Sbjct  268   YEYLLKAYLLFGDEEYLFIFQEAYAAAMHYLFNDPWYVEVNMDSAAIVWPLFNSLQAFWP  327

Query  861   GVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYL  682
             G+QVL GD+D A  +H  FF VWK++G  PE + L    +   +K YPLRPE  EST++L
Sbjct  328   GLQVLAGDIDPAIRTHAAFFSVWKRYGFTPEGFNLATLSVQNGQKSYPLRPELIESTYWL  387

Query  681   YQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLL  502
             Y+AT+D  Y++ G  ++ SL    +   G+  + DV   + EDH  SFFLAET KYL+LL
Sbjct  388   YKATRDARYLDAGREMVASLQYGARCPCGYCHITDVEFHKQEDHMESFFLAETVKYLWLL  447

Query  501   FD-----DSFLVNR--NYIFTTEGHPLPV  436
             FD     D+ + N    YIF+TEGH LP 
Sbjct  448   FDLASGPDNLVENGPYKYIFSTEGHLLPA  476



>ref|XP_010274205.1| PREDICTED: probable alpha-mannosidase I MNS4 [Nelumbo nucifera]
Length=615

 Score =   418 bits (1074),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 216/490 (44%), Positives = 308/490 (63%), Gaps = 24/490 (5%)
 Frame = -1

Query  1884  KSFRIMRKRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMH  1705
             K+ ++++   ++C+ + + +   +  +  +   P  A++ R   +VR+MFYHA++ YM H
Sbjct  3     KAVKMLKPSSILCVFVLIFSAISVDRAVAEGVTPDEAKQLR--DEVREMFYHAFDGYMEH  60

Query  1704  AFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAV  1525
             AFP DEL+PLT T  D+L                G ALTLI+SL +L + G+   F  +V
Sbjct  61    AFPLDELRPLTCTGEDTLG---------------GYALTLIDSLDTLALFGDRERFAASV  105

Query  1524  LWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGR  1345
              W+  NL FD++  +++FE  IR+LGGL+SAH++A+D    +   +Y NQLL LAEDL  
Sbjct  106   EWIGKNLHFDINKTVSVFETTIRILGGLLSAHLIASDYATGMGIPSYDNQLLHLAEDLAH  165

Query  1344  RFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAAL  1165
             R LPAFDTPTG+P+  +NL  GV +NE+  TST+G G+L LE G LS LT +P+F+    
Sbjct  166   RLLPAFDTPTGIPFGSVNLLHGVDENESKITSTAGGGTLTLEFGILSILTNNPVFQQVTK  225

Query  1164  RALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKM  985
              A+R +W+ RS LNL+G  ++V TGEW +   GIG  +DSFYEYL+KAY+LFG +E+  +
Sbjct  226   NAVRGIWARRSKLNLVGAHINVFTGEWTQKDAGIGTSIDSFYEYLLKAYLLFGDEEYLFI  285

Query  984   FQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREF  805
             FQ AY A   Y  + PWY + +M +    +    SLQAFWPG+QVL GD+D A  +H  F
Sbjct  286   FQEAYKAAMHYLYNDPWYVEVNMNSAVIVWPLFNSLQAFWPGLQVLAGDIDPAIRTHAAF  345

Query  804   FHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINS  625
             F VWKK+G  PE + L    +   +K YPLRPE  EST++LY+AT+D  Y++ G  ++ S
Sbjct  346   FSVWKKYGFTPEGFNLATLSVQHGQKSYPLRPELMESTYWLYKATRDTRYLDAGREMVAS  405

Query  624   LNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFD-----DSFLVNR--NYI  466
             L    +   G+  + DV + + EDH  SFFLAET KYL+LLFD     D+ + N    YI
Sbjct  406   LQYGARCPCGYCHISDVVSHKQEDHMESFFLAETVKYLWLLFDLAAGSDNLVENGPYKYI  465

Query  465   FTTEGHPLPV  436
             F+TEGH LP 
Sbjct  466   FSTEGHLLPA  475



>ref|NP_001132501.1| uncharacterized protein LOC100193961 precursor [Zea mays]
 gb|ACG24143.1| ER degradation-enhancing alpha-mannosidase-like 1 [Zea mays]
 gb|AFW84927.1| ER degradation-enhancing alpha-mannosidase-like 1 [Zea mays]
Length=651

 Score =   419 bits (1077),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 222/458 (48%), Positives = 300/458 (66%), Gaps = 26/458 (6%)
 Frame = -1

Query  1785  PMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKY  1606
             P  ARR R   +V+ MFYHA++ YM +AFP DEL+PL+    DSL               
Sbjct  38    PSEARRLR--DEVKDMFYHAFDGYMKYAFPLDELRPLSCQGEDSLG--------------  81

Query  1605  SGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHI  1426
              G ALTLI+SL +L +LG+  +F  AV W+  N+ FD++  +++FE NIR+LGGL+SAH+
Sbjct  82    -GYALTLIDSLDTLALLGDKEKFGAAVEWVGKNVHFDINKTVSVFETNIRILGGLLSAHL  140

Query  1425  LATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetst  1246
             +A+D    +   +Y +QLL LA DL +R LPAFDTPTG+P+  +NL  GV +NE+  TST
Sbjct  141   IASDYATGMRIQSYDDQLLHLAADLAQRLLPAFDTPTGIPFGSVNLLYGVDENESKITST  200

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTG  1066
             +G G+L LE G LSRLT + +FE    +++R +WS RS LNL+G  ++V TGEW +   G
Sbjct  201   AGGGTLTLEFGILSRLTNNTVFERVTKKSVRGIWSRRSKLNLVGAHINVFTGEWTQKDAG  260

Query  1065  IGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQL  886
             IG  +DSFYEYL+KAY+LFG +E+  +FQ AY A   Y  H PWY + +M +G AT W L
Sbjct  261   IGTSIDSFYEYLLKAYLLFGDEEYLYIFQEAYKAAMHYLHHDPWYVEVNMNSG-ATVWPL  319

Query  885   -TSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRP  709
               SLQAFWPG+QVL GDVD A  +H  FF VWKK+G  PE + L    +   ++ YPLRP
Sbjct  320   FNSLQAFWPGLQVLAGDVDPAIRTHAAFFSVWKKYGFTPEGFNLATSTVQNGQRSYPLRP  379

Query  708   EFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLA  529
             E  EST++L++AT+D  Y++VG  I+ SL    +   G+  + DV T + +DH  SFFLA
Sbjct  380   ELIESTYWLFKATRDYRYLDVGRDILASLQYGARCPCGYCHISDVETHKQDDHMESFFLA  439

Query  528   ETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             ET KYL+LLFD     D+ + N    YIF+TEGH LPV
Sbjct  440   ETVKYLWLLFDLAAGPDNIVENGPYKYIFSTEGHLLPV  477



>ref|XP_008341094.1| PREDICTED: probable alpha-mannosidase I MNS4 [Malus domestica]
Length=594

 Score =   417 bits (1071),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 217/454 (48%), Positives = 291/454 (64%), Gaps = 22/454 (5%)
 Frame = -1

Query  1776  ARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGS  1597
             A  K++  +VR+MFYHA+  YM HAFP DEL+P +    DSL                G 
Sbjct  36    AEAKQLRDEVREMFYHAFNGYMEHAFPLDELRPHSCAGEDSLG---------------GY  80

Query  1596  ALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILAT  1417
             ALTLI+SL +L +LG+   F  +V W+   L FD++  +++FE  IRVLGGL+SAH++A+
Sbjct  81    ALTLIDSLDTLALLGDREHFAASVEWIGKTLRFDINKTVSVFETTIRVLGGLLSAHLIAS  140

Query  1416  DSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGC  1237
             D +  +   TY NQLL LAEDL RR LPAFDTP+G+P+  +NL  GV ++E+  TST+G 
Sbjct  141   DYSTGMKIPTYDNQLLTLAEDLARRLLPAFDTPSGIPFGSVNLMHGVDEHESKITSTAGG  200

Query  1236  GSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGA  1057
             G+L LE G LSRLT DPIFE     A+R LW+ RS LNL+G  ++V TGEW +   GIG 
Sbjct  201   GTLTLEFGVLSRLTKDPIFEQVTKNAVRGLWARRSRLNLVGAHVNVFTGEWTQKDAGIGT  260

Query  1056  GVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSL  877
              +DSFYEYL+KAY+LFG +E+  +FQ AY A   +  + PWY + +M +    +    SL
Sbjct  261   SIDSFYEYLLKAYLLFGDEEYLFIFQEAYAAAMHHLYNDPWYVEVNMDSAAVVWPLFNSL  320

Query  876   QAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAE  697
             QAFWPG+QVL GD+D A  +H  FF VWK++G  PE + L    +   ++ YPLRPE  E
Sbjct  321   QAFWPGLQVLAGDIDPAIRTHAAFFSVWKRYGFTPEGFNLATLSVQHGQRSYPLRPELME  380

Query  696   STFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCK  517
             ST++LY+AT+DP Y++ G  +I SL    +   GF  + DV   + EDH  SFFLAET K
Sbjct  381   STYWLYKATRDPKYLDAGRDMIASLQHSARCPCGFCHISDVEFHKQEDHMESFFLAETVK  440

Query  516   YLYLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             YL+LLFD     D+ + N    YIF+TEGH LP 
Sbjct  441   YLWLLFDLAVGPDNLVENGPYKYIFSTEGHLLPA  474



>gb|KFK31701.1| hypothetical protein AALP_AA6G147900 [Arabis alpina]
Length=629

 Score =   418 bits (1074),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 228/528 (43%), Positives = 316/528 (60%), Gaps = 53/528 (10%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K++  +VR+MFYHA++ YM +AFP DELKP++    D+L                G ALT
Sbjct  44    KQLRDEVREMFYHAFDGYMNNAFPLDELKPMSCQGEDTLG---------------GYALT  88

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL +L +LG+   F  +V W+  NL F+++  +++FE  IRVLGGL+SAH++A+D  
Sbjct  89    LIDSLDTLALLGDRERFTSSVEWIGKNLQFNINKTVSVFETTIRVLGGLLSAHLIASDYA  148

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +   +Y N+LL LAEDL RR LPAFDTPTG+P+  +NL  GV ++E+  TST+G G+L
Sbjct  149   TGMRIPSYNNELLVLAEDLTRRMLPAFDTPTGIPFGSVNLMHGVDKHESKITSTAGGGTL  208

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRLT DP+FE  A  A+R LW+ RS+L+L+G  ++V TGEW +   GIG  +D
Sbjct  209   TLEFGVLSRLTNDPVFEQVAKNAVRGLWARRSTLDLVGAHINVFTGEWTQKDAGIGTSID  268

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAYILFG +E+  +FQ AY +V  Y    PWY + +M +    +    SLQAF
Sbjct  269   SFYEYLLKAYILFGDEEYLYIFQEAYGSVMHYLHKDPWYVEVNMDSAAIVWPVFNSLQAF  328

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GDV+ A  +H  FF VWK++G  PE + L    +   +K YPLRPE  EST+
Sbjct  329   WPGLQVLAGDVEPAIRTHTAFFSVWKRYGFTPEGFNLATLSVQYGQKSYPLRPELIESTY  388

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT+DP Y++ G   + SL    K   G+  + DV   + EDH  SFFLAET KYL+
Sbjct  389   WLYKATRDPRYLDAGRDFVASLQYGAKCHCGYCHITDVELHKQEDHMESFFLAETVKYLW  448

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV-----LSTWHDRLSEAYLPSNWTSFKHEK  364
             LLFD     D+ + N    Y+F+TEGH LP+     L+  H      Y P N T  + E+
Sbjct  449   LLFDLAVGSDNLVDNGPYKYVFSTEGHLLPLTPQISLAREHCSYLGGYCPRNATKPRQEE  508

Query  363   HRKR------------------------ASAMSQRICPATTLSHEQEY  292
                                          + + + ICP   L+H Q+Y
Sbjct  509   ESNNDQVPGIELETHSSSNIYPYHESFPVTGLIKGICPG--LTHAQKY  554



>ref|XP_010322255.1| PREDICTED: probable alpha-mannosidase I MNS4 isoform X1 [Solanum 
lycopersicum]
Length=618

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 213/451 (47%), Positives = 290/451 (64%), Gaps = 22/451 (5%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K +  +VR+MFYHA+  YM HAFP DEL+PL+    D+L                G ALT
Sbjct  33    KELRDEVREMFYHAFNGYMNHAFPRDELRPLSCGGEDTLG---------------GYALT  77

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL +L +LG+   F  +V W+  NL FD++  +++FE  IR+LGGL+SAH++A+D  
Sbjct  78    LIDSLDTLALLGDRERFTASVEWIGKNLRFDINKTVSIFETTIRILGGLISAHLIASDHN  137

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +   +Y ++LL LAEDL RR LPAFDTPTG+P+  +NL  GV +NE+  TST+G G+L
Sbjct  138   TGMKIPSYDDELLHLAEDLARRMLPAFDTPTGIPFGSVNLLHGVDENESKITSTAGGGTL  197

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRL  DPIFE  +  A+R LW+ RS +NL+G  +DV +GEW +   GIG  +D
Sbjct  198   TLEFGILSRLINDPIFEQVSKNAVRGLWARRSKINLVGAHIDVFSGEWTQKDAGIGTSID  257

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAY+LFG +E+  +FQ AY A   Y    PWY + +M +    +    SLQAF
Sbjct  258   SFYEYLLKAYLLFGDEEYLFIFQEAYKAAMNYLFSDPWYVEVNMNSAALVWPLFNSLQAF  317

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GD++ A  +H  FF VWK++G  PE + L    +   +K YPLRPE  EST+
Sbjct  318   WPGLQVLAGDIEPAIRTHAAFFSVWKRYGFTPEGFNLATLSVQQGQKSYPLRPELIESTY  377

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT+DP Y++ G  I+ SL    +   G+  + DV   + EDH  SFFLAET KYL+
Sbjct  378   WLYKATRDPRYLDAGREILASLQYGARCTCGYCHISDVEFHKQEDHMESFFLAETVKYLW  437

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             LLFD     D+ + N    Y+F+TEGH LPV
Sbjct  438   LLFDLAAGPDNLVENGPYKYVFSTEGHLLPV  468



>ref|XP_007143880.1| hypothetical protein PHAVU_007G109800g [Phaseolus vulgaris]
 gb|ESW15874.1| hypothetical protein PHAVU_007G109800g [Phaseolus vulgaris]
Length=613

 Score =   417 bits (1072),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 216/451 (48%), Positives = 291/451 (65%), Gaps = 22/451 (5%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K + ++ R+MFYHA+  YM +AFP DEL+PL+    D+L                G ALT
Sbjct  33    KELREEAREMFYHAFNGYMDNAFPLDELRPLSCAGEDTLG---------------GYALT  77

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL +L +LG+   F  +V WL  NL FD++  +++FE  IRVLGGL+SAH++A+D  
Sbjct  78    LIDSLDTLALLGDRQRFATSVEWLGKNLRFDINKTVSVFETTIRVLGGLLSAHLIASDYA  137

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +   +Y NQLL+LAEDL RR LPAFDTPTG+P+  +NL  GV ++E+  TST+G G+L
Sbjct  138   TGMRVPSYDNQLLNLAEDLARRLLPAFDTPTGIPFGSVNLLHGVDKHESKITSTAGGGTL  197

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRLT DPIFE     A+R LW+ RS LNL+G  ++V TGEW +   GIG  +D
Sbjct  198   TLEFGVLSRLTNDPIFEQVTKHAVRGLWARRSKLNLVGAHINVFTGEWTQKDAGIGTSID  257

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAY+LFG +E+  +FQ AY A   Y  H PWY + +M +    +    SLQAF
Sbjct  258   SFYEYLLKAYLLFGDEEYLYIFQEAYAAAMHYLYHDPWYVEVNMDSAAIVWPLFNSLQAF  317

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GD++ A  +H  F  VW+++G  PE + L    +   +K YPLRPE  EST+
Sbjct  318   WPGLQVLAGDINPAIRTHAAFLSVWRRYGFTPEGFNLASLSVQHGQKSYPLRPELIESTY  377

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT+DP Y++ G  +I SL   T+   G+  + DV   + EDH  SFFLAET KYL+
Sbjct  378   WLYKATRDPRYLDAGRDMIASLQYGTRCPCGYCHISDVEQHKQEDHMESFFLAETVKYLW  437

Query  507   LLFDDSF----LVNRN---YIFTTEGHPLPV  436
             LLFD +     LV +    YIF+TEGH LP 
Sbjct  438   LLFDLAVGPDNLVEKGPYKYIFSTEGHLLPA  468



>ref|XP_002456427.1| hypothetical protein SORBIDRAFT_03g036080 [Sorghum bicolor]
 gb|EES01547.1| hypothetical protein SORBIDRAFT_03g036080 [Sorghum bicolor]
Length=583

 Score =   416 bits (1069),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 221/458 (48%), Positives = 300/458 (66%), Gaps = 26/458 (6%)
 Frame = -1

Query  1785  PMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKY  1606
             P  ARR R   +V+ MFYHA++ YM +AFP DEL+PL+    DSL               
Sbjct  38    PSEARRLR--DEVKDMFYHAFDGYMKYAFPLDELRPLSCQGEDSLG--------------  81

Query  1605  SGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHI  1426
              G ALTLI+SL +L +LG+  +F  AV W+  N+ FD++  +++FE NIR+LGGL+SAH+
Sbjct  82    -GYALTLIDSLDTLALLGDKEKFGAAVEWVGKNVRFDINKTVSVFETNIRILGGLLSAHL  140

Query  1425  LATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetst  1246
             +A+D    +   +Y +QLL LA DL +R LPAFDTPTG+P+  +NL  GV +NE+  TST
Sbjct  141   IASDYATGMRIQSYDDQLLHLAADLAQRLLPAFDTPTGIPFGSVNLMYGVDENESKITST  200

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTG  1066
             +G G+L LE G LSRLT + +FE    +++R +WS RS LNL+G  ++V TGEW +   G
Sbjct  201   AGGGTLTLEFGILSRLTNNTVFERVTKKSVRGIWSRRSKLNLVGAHINVFTGEWTQKDAG  260

Query  1065  IGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQL  886
             IG  +DSFYEYL+KAY+LFG +E+  +FQ AY A   Y  H PWY + +M +G AT W L
Sbjct  261   IGTSIDSFYEYLLKAYLLFGDEEYLYIFQEAYKAAMHYLHHDPWYVEVNMNSG-ATVWPL  319

Query  885   -TSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRP  709
               SLQAFWPG+QVL GDVD A  +H  FF VWKK+G  PE + L    +   ++ YPLRP
Sbjct  320   FNSLQAFWPGLQVLAGDVDPAIRTHAAFFSVWKKYGFTPEGFNLATSTVQNGQRSYPLRP  379

Query  708   EFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLA  529
             E  EST++L++AT+D  Y++VG  I+ SL    +   G+  + DV T + +DH  SFFLA
Sbjct  380   ELIESTYWLFKATRDHRYLDVGRDILASLQYGARCPCGYCHIADVETHKQDDHMESFFLA  439

Query  528   ETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             ET KYL+LLFD     D+ + +    YIF+TEGH LPV
Sbjct  440   ETVKYLWLLFDLAAGPDNIVESGPYKYIFSTEGHLLPV  477



>ref|XP_010481835.1| PREDICTED: probable alpha-mannosidase I MNS4 [Camelina sativa]
Length=625

 Score =   416 bits (1069),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 228/521 (44%), Positives = 317/521 (61%), Gaps = 46/521 (9%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K++  +VR MFYHA++ YM +AFP DEL+PL+    D+L                G ALT
Sbjct  38    KQLRDEVRGMFYHAFDGYMNNAFPLDELRPLSCQGEDTLG---------------GYALT  82

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL +L +LG+   F  +VLW+  NL F+++  +++FE  IRVLGGL+SAH++A+D  
Sbjct  83    LIDSLDTLALLGDRERFTSSVLWIGKNLQFNINKTVSVFETTIRVLGGLLSAHLIASDYA  142

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +   +Y N+LL LAEDL RR LPAFDTPTG+P+  +NL  GV ++E+  TST+G G+L
Sbjct  143   TGMRIPSYNNELLFLAEDLTRRMLPAFDTPTGIPFGSVNLMYGVDKHESKITSTAGGGTL  202

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRLT DP+FE  A  A+R LW+ RS+L+L+G  ++V TGEW +   GIG  +D
Sbjct  203   SLEFGVLSRLTNDPVFEQVAKNAVRGLWARRSNLDLVGAHINVFTGEWTQKDAGIGTSID  262

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAYILFG +E+  +FQ AY +  ++    PWY + +M +    +    SLQAF
Sbjct  263   SFYEYLLKAYILFGDEEYLYIFQEAYRSAMQHLHKDPWYVEVNMDSAAIVWPVFNSLQAF  322

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GDVD A  +H  FF VWK++G  PE + L    +   +K YPLRPE  EST+
Sbjct  323   WPGLQVLAGDVDPAIRTHTAFFSVWKRYGFTPEGFNLATLSVQYGQKSYPLRPELIESTY  382

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT+DP Y++ G   + SL    K   G+  + DV   + EDH  SFFLAET KYL+
Sbjct  383   WLYKATRDPRYLDAGRDFVASLQYGAKCPCGYCHITDVELHKQEDHMESFFLAETVKYLW  442

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV-----LSTWHDRLSEAYLPSNWTSFKHEK  364
             LLFD     D+ + N    YIF+TEGH LP+     L+  H      Y  SN T  + E 
Sbjct  443   LLFDLAVDSDNLVDNGPYKYIFSTEGHLLPLTPQISLAREHCSYLGGYCSSNSTKREQEV  502

Query  363   HRKRA-----------------SAMSQRICPATTLSHEQEY  292
               + +                 + + + +CP   L+H Q+Y
Sbjct  503   LEEESNNDDRSNIYPYHESFPVTGLIKGLCPG--LTHAQKY  541



>ref|XP_011091103.1| PREDICTED: probable alpha-mannosidase I MNS4 [Sesamum indicum]
 ref|XP_011091104.1| PREDICTED: probable alpha-mannosidase I MNS4 [Sesamum indicum]
Length=626

 Score =   414 bits (1065),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 213/451 (47%), Positives = 291/451 (65%), Gaps = 22/451 (5%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K++  +VR+MFYHA++ YM HAFP DELKPL+    D+L                G ALT
Sbjct  34    KQLRDEVREMFYHAFDGYMKHAFPRDELKPLSCGGEDTLG---------------GYALT  78

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL +L +LG+   F  +V W+  NL FD++  +++FE  IRVLGGL+SAH++A+D  
Sbjct  79    LIDSLDTLALLGDRERFTVSVEWIGKNLRFDINKTVSVFETTIRVLGGLLSAHLIASDYN  138

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +   +Y ++LL LAEDL RR LPAFDTPTG+P+  +NL  GV +NE+  TST+G G+L
Sbjct  139   TGMRIPSYDDELLHLAEDLARRMLPAFDTPTGIPFGSVNLMHGVDENESKITSTAGGGTL  198

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRLT DPIFE     A+R LW+ RS +NL+G  +DV TGEW +   GIG  +D
Sbjct  199   TLEFGVLSRLTNDPIFEQVTKNAVRGLWARRSRINLVGAHIDVFTGEWTQKDAGIGTSID  258

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAY+LFG +E+  +FQ AY A   Y  + PWY + +M +    +    SLQAF
Sbjct  259   SFYEYLLKAYLLFGDEEYLFIFQEAYRAAMLYLYNDPWYVEVNMNSAALVWPLFNSLQAF  318

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GD++ A  +H  FF VWK++G  PE + L    +   +K YPLRPE  EST+
Sbjct  319   WPGLQVLAGDIEPAIRTHAAFFSVWKRYGFTPEGFNLATFNVQQGQKSYPLRPELIESTY  378

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT++P +++ G  ++ SL    +   G+  + DV   + EDH  SFFLAET KYL+
Sbjct  379   WLYKATRNPRFLDAGRDMLASLQYGARCTCGYCHISDVEFHQQEDHMESFFLAETVKYLW  438

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             LLFD     D+ + N    Y F+TEGH LP 
Sbjct  439   LLFDLAAGPDNLVENGPYKYTFSTEGHLLPA  469



>ref|XP_004495394.1| PREDICTED: probable alpha-mannosidase I MNS4-like isoform X1 
[Cicer arietinum]
Length=617

 Score =   412 bits (1060),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 215/452 (48%), Positives = 289/452 (64%), Gaps = 23/452 (5%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K++  +V +MFYHA+  YM +AFP DELKPL+    D+L                G ALT
Sbjct  38    KQLRDEVGEMFYHAFNGYMDNAFPLDELKPLSCAGEDTLG---------------GYALT  82

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFD-VDARINLFECNIRVLGGLVSAHILATDS  1411
             LI+SL +L +LG+   F  +V W+  NL FD ++  +++FE  IRVLGGL+SAH++A+D 
Sbjct  83    LIDSLDTLALLGDRERFAASVEWIGKNLRFDMINKTVSVFETTIRVLGGLLSAHLIASDY  142

Query  1410  TNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGS  1231
                +   +Y NQLL+LAEDL RR LPAFDTPTG+PY  +NL  GV + E+  TST+G G+
Sbjct  143   ATGMRVPSYDNQLLNLAEDLARRLLPAFDTPTGIPYGSVNLLHGVDKQESKITSTAGGGT  202

Query  1230  LILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGV  1051
             L LE G LSRLT DPIFE     A+  LW+ RS LNL+G  ++V TGEW +   GIG  +
Sbjct  203   LTLEFGVLSRLTNDPIFEQVTKNAVLALWARRSKLNLVGAHINVFTGEWTQKDAGIGTSI  262

Query  1050  DSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQA  871
             DSFYEYL+KAYILFG +E+  +FQ AY A   Y  H PWY + +M +    +    SLQA
Sbjct  263   DSFYEYLLKAYILFGDEEYLYIFQEAYSAAMHYLYHDPWYVEVNMDSAAIVWPLFNSLQA  322

Query  870   FWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAEST  691
             FWPG+QVL GD++ A  +H  F  VW+++G  PE + L    +   +K YPLRPE  EST
Sbjct  323   FWPGLQVLAGDINPAIRTHAAFLSVWRRYGFTPEGFNLASLSVQHGQKSYPLRPELIEST  382

Query  690   FYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYL  511
             ++LY+AT+DP Y++ G  ++ SL   T+   G+  + DV   + EDH  SFFLAET KYL
Sbjct  383   YWLYKATRDPRYLDAGRDMVASLQYGTRCACGYCHISDVENHKQEDHMESFFLAETVKYL  442

Query  510   YLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             +LLFD     D+ + N    Y+F+TEGH LP 
Sbjct  443   WLLFDLAVGPDNLVENGPYKYVFSTEGHLLPA  474



>ref|XP_003569932.1| PREDICTED: probable alpha-mannosidase I MNS4 isoform X1 [Brachypodium 
distachyon]
Length=674

 Score =   414 bits (1064),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 218/461 (47%), Positives = 293/461 (64%), Gaps = 24/461 (5%)
 Frame = -1

Query  1797  DPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHL  1618
             D   P  ARR R   +V+ MFYHA++ YM HAFP DEL+PL+    DSL           
Sbjct  30    DGVTPSEARRLR--DEVKDMFYHAFDGYMQHAFPLDELRPLSCKGEDSLG----------  77

Query  1617  PQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLV  1438
                  G ALTLI+SL +L +LG+  +F   V W+  N+ FD++  +++FE NIR+LGGL+
Sbjct  78    -----GYALTLIDSLDTLALLGDKEKFGAGVEWVGKNVRFDINKTVSVFETNIRILGGLL  132

Query  1437  SAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNett  1258
             SAH++A+D    +   +Y +QLL LA DL +R LPAFDTPTG+P+  +NL  GV  +E+ 
Sbjct  133   SAHLIASDYATGMRIQSYDDQLLHLAVDLAQRLLPAFDTPTGIPFGSVNLLYGVDDDESK  192

Query  1257  etstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIE  1078
              TST+G G+L LE G LSRLT + +FE     A+R +WS RS LNL+G  ++V TGEW +
Sbjct  193   ITSTAGGGTLALEFGILSRLTNNTVFEEVTKNAVRGIWSRRSKLNLVGAHINVFTGEWTQ  252

Query  1077  FSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKAT  898
                GIG  +DSFYEYL+KAY+LFG +E+  +FQ AY A   Y    PWY + +M TG   
Sbjct  253   KDAGIGTSIDSFYEYLLKAYLLFGDEEYLYIFQEAYKAAMHYLHLDPWYVEVNMNTGVTV  312

Query  897   YWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYP  718
             +    SLQAFWPG+QVL GDVD A  +H  FF VWKK+G  PE + L    +   ++ YP
Sbjct  313   WPLFNSLQAFWPGLQVLAGDVDPAIRTHAAFFSVWKKYGFTPEGFNLATSTVQNGQRSYP  372

Query  717   LRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSF  538
             LRPE  EST++L++AT+D  Y++VG  I+ SL    +   G+  + DV T + +DH  SF
Sbjct  373   LRPELIESTYWLFKATRDYKYLDVGRDILASLQYGARCPCGYCHISDVETHKQDDHMESF  432

Query  537   FLAETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             FLAET KYL+LLFD     D+ + N    YIF+TEGH LP 
Sbjct  433   FLAETVKYLWLLFDLAVGPDNIVENGPYKYIFSTEGHLLPA  473



>emb|CDM84177.1| unnamed protein product [Triticum aestivum]
 emb|CDM84423.1| unnamed protein product [Triticum aestivum]
Length=669

 Score =   413 bits (1062),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 219/462 (47%), Positives = 296/462 (64%), Gaps = 26/462 (6%)
 Frame = -1

Query  1797  DPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHL  1618
             D   P  AR  R   +V+ MFYHA++ YM HAFP DEL+PL+    DSL           
Sbjct  34    DGVTPSEARLLR--DEVKDMFYHAFDGYMQHAFPLDELRPLSCQGEDSLG----------  81

Query  1617  PQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLV  1438
                  G ALTLI+SL +L +LG+   F   V W+  N+ FD++  +++FE NIR+LGGL+
Sbjct  82    -----GYALTLIDSLDTLALLGDKERFAAGVEWVGKNVRFDINKTVSVFETNIRILGGLL  136

Query  1437  SAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNett  1258
             SAH++A+D    +   +Y +QLL L+ DL +R LPAFDTPTG+P+  +NL  GV  +E+ 
Sbjct  137   SAHLIASDYATGMKIESYDDQLLHLSVDLAQRLLPAFDTPTGIPFGSVNLLYGVDDDESK  196

Query  1257  etstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIE  1078
              TST+G G+L LE G LSRLT + +FE  A  ++R +W+ RS LNL+G  ++V TGEW +
Sbjct  197   ITSTAGGGTLALEFGVLSRLTNNTVFEQVAKNSVRGIWARRSKLNLVGAHINVFTGEWTQ  256

Query  1077  FSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKAT  898
                GIG  +DSFYEY++KAY+LFG +E+  +FQ AY A   Y  H PWY + +M +G AT
Sbjct  257   KDAGIGTSIDSFYEYVLKAYLLFGDEEYLYVFQEAYKAAMHYLHHDPWYIEVNMNSG-AT  315

Query  897   YWQL-TSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYY  721
              W L  SLQAFWPG+QVL GDVD A  +H  FF VWKK+G  PE + L    +   ++ Y
Sbjct  316   VWPLFNSLQAFWPGLQVLAGDVDPAIRTHAAFFSVWKKYGFTPEGFNLATSTVQNGQRSY  375

Query  720   PLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHS  541
             PLRPE  EST++L++AT+D  Y++VG  I+ SL    K   G+  + DV T + +DH  S
Sbjct  376   PLRPELIESTYWLFKATRDYRYLDVGRDILASLQYAAKCPCGYCHISDVETHKQDDHMES  435

Query  540   FFLAETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             FFLAET KYL+LLFD     D+ + N    YIF+TEGH LP 
Sbjct  436   FFLAETVKYLWLLFDLAVGPDNIVENGPYKYIFSTEGHLLPA  477



>ref|XP_010693817.1| PREDICTED: probable alpha-mannosidase I MNS4 [Beta vulgaris subsp. 
vulgaris]
Length=616

 Score =   411 bits (1057),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 216/457 (47%), Positives = 293/457 (64%), Gaps = 24/457 (5%)
 Frame = -1

Query  1785  PMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKY  1606
             P  ARR R   +V +MF+HA+  YM HAFP DELKPL+    D+L               
Sbjct  33    PDEARRLR--DEVEEMFFHAFNGYMDHAFPRDELKPLSCDGEDTLG--------------  76

Query  1605  SGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHI  1426
              G ALTL++SL +L +LG+   F  +V W+  NL FD++  +++FE  IRVLGGL+SAH+
Sbjct  77    -GYALTLVDSLDTLALLGDKERFASSVEWIGKNLRFDINKTVSVFETTIRVLGGLLSAHL  135

Query  1425  LATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetst  1246
             +A+D    +   +Y NQLL LAEDLG R LPAFDTPTG+P+  +NL  GV +NE+  TST
Sbjct  136   IASDYATGMRVPSYDNQLLHLAEDLGYRLLPAFDTPTGIPFGSVNLLDGVDENESKITST  195

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTG  1066
             +G G+L LE G LSRLT +P+F+     A+  LW+ RS LNL+G  ++V TGEW +   G
Sbjct  196   AGGGTLTLEFGILSRLTNNPVFQQVTKNAVHGLWACRSKLNLVGAHINVFTGEWTQKDAG  255

Query  1065  IGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQL  886
             IG  +DSFYEYL+KA++LFG +E+  MFQ AY A   Y  + PWY + +M +    +   
Sbjct  256   IGTSIDSFYEYLLKAFLLFGDEEYLFMFQEAYGAAMHYLFNDPWYVEVNMDSAAIVWPLF  315

Query  885   TSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPE  706
              SLQAFWPG+QVL GDVD A  +H  F+ VWK++G  PE + L    +   +K YPLRPE
Sbjct  316   NSLQAFWPGLQVLAGDVDPAIRTHAAFYSVWKRYGFTPEGFNLATLSVQQGQKSYPLRPE  375

Query  705   FAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAE  526
              AEST++LY+AT+D  Y++VG  I++SL    +   G+  + DV   + EDH  SFFL+E
Sbjct  376   LAESTYWLYKATRDTRYLDVGRDIVSSLQYGARCPCGYCHITDVEDHKQEDHMESFFLSE  435

Query  525   TCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             T KYL+LLFD     D+ + +    YIF+TEGH LP 
Sbjct  436   TVKYLWLLFDLAVGPDNLVESGPYEYIFSTEGHLLPA  472



>dbj|BAJ85126.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=695

 Score =   413 bits (1062),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 215/451 (48%), Positives = 292/451 (65%), Gaps = 24/451 (5%)
 Frame = -1

Query  1764  RMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTL  1585
             R+  +V+ MFYHA++ YM HAFP DEL+PL+    DSL                G ALTL
Sbjct  65    RLRDEVKDMFYHAFDGYMQHAFPLDELRPLSCQGEDSLG---------------GYALTL  109

Query  1584  IESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTN  1405
             I+SL +L +LG+   F   V W+  N+ FD++  +++FE NIR+LGGL+SAH++A+D   
Sbjct  110   IDSLDTLALLGDKERFAAGVEWVGKNVRFDINKTVSVFETNIRILGGLLSAHLIASDYAT  169

Query  1404  RLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLI  1225
              +   +Y +QLL LA DL +R LPAFDTPTG+P+  +NL  GV  +E+  TST+G G+L 
Sbjct  170   GMKIESYDDQLLHLAADLAQRLLPAFDTPTGIPFGSVNLLYGVDDDESKITSTAGGGTLT  229

Query  1224  LEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDS  1045
             LE G LSRLT + +FE     ++R +W+ RS LNL+G  ++V TGEW +   GIG  +DS
Sbjct  230   LEFGVLSRLTNNTVFEQVTKNSVRGIWARRSKLNLVGAHINVFTGEWTQKDAGIGTSIDS  289

Query  1044  FYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQL-TSLQAF  868
             FYEYL+KAY+LFG +E+  +F+ AY A   Y  H PWY + +M +G AT W L  SLQAF
Sbjct  290   FYEYLLKAYLLFGDEEYLYVFEEAYKAAMHYLHHDPWYIEVNMNSG-ATVWPLFNSLQAF  348

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GDVD A  +H  FF VWKK+G  PE + L    +   ++ YPLRPE  EST+
Sbjct  349   WPGLQVLAGDVDPAIRTHAAFFSVWKKYGFTPEGFNLATSTVQNGQRSYPLRPELIESTY  408

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +L++AT+D  Y++VG  I+ SL    K   G+  + DV T + +DH  SFFLAET KYL+
Sbjct  409   WLFKATRDFRYLDVGRDILASLQYAAKCPCGYCHISDVETHKQDDHMESFFLAETVKYLW  468

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             LLFD     D+ + N    YIF+TEGH LP 
Sbjct  469   LLFDLAVGPDNIVENGPYKYIFSTEGHLLPA  499



>ref|XP_002517026.1| Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA, putative [Ricinus 
communis]
 gb|EEF45189.1| Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA, putative [Ricinus 
communis]
Length=655

 Score =   411 bits (1057),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 230/525 (44%), Positives = 317/525 (60%), Gaps = 33/525 (6%)
 Frame = -1

Query  1854  LICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL  1675
             ++   I  +TFF  + +  D   P+ A+  R   +VR+MFYHA+  YM +AFP DEL+PL
Sbjct  13    VLLSFITSTTFFHRALA--DGVTPLEAKVLR--DEVREMFYHAFNGYMENAFPLDELRPL  68

Query  1674  TKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFD  1495
             +    DSL                G ALTLI+SL +L +LG+   F  ++ W+  NL FD
Sbjct  69    SCEGEDSLG---------------GYALTLIDSLDTLALLGDRDRFTSSIDWIDKNLRFD  113

Query  1494  VDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPT  1315
             ++  +++FE  IRVLGGL+SAH++A+D +  +   +Y+NQLL LAEDL  R LPAFDTPT
Sbjct  114   INKTVSIFETTIRVLGGLLSAHLIASDYSTGMGIPSYENQLLHLAEDLAWRLLPAFDTPT  173

Query  1314  GLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMR  1135
             G+P+  +NL  GV ++E+  TST+G G+L LE G LSRLT +PIFE     A+R LW+ R
Sbjct  174   GIPFGSVNLLHGVDEHESKITSTAGGGTLTLEFGVLSRLTNNPIFEQVTKNAVRGLWARR  233

Query  1134  SSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQK  955
             S LNL+G  ++V TGEW +   GIG  +DSFYEYL+KAY+LFG +E+  +FQ AY A  +
Sbjct  234   SRLNLVGAHINVFTGEWTQKDAGIGTSIDSFYEYLLKAYLLFGDEEYLFIFQEAYAAAMQ  293

Query  954   YFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVL  775
             Y    PWY + +M +G   +    SLQAFWPG+QVL GD+D A  +H  F  VW+K+G  
Sbjct  294   YLFSDPWYVEVNMDSGAIVWPLFNSLQAFWPGLQVLAGDIDPAIRTHAAFLSVWRKYGFT  353

Query  774   PERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGG  595
             PE + L    +   +K YPLRPE  EST++LY+AT+D  Y++ G  ++ SL    +   G
Sbjct  354   PEGFNLATLSVQHGQKSYPLRPELIESTYWLYKATRDSRYLDAGRDMVASLQYGARCPCG  413

Query  594   FASVRDVTTMELEDHQHSFFLAETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             +  + DV   + EDH  SFFLAET KYL+LLFD     D+ + N    YIF+TEGH LP 
Sbjct  414   YCHITDVEFHKKEDHMESFFLAETVKYLWLLFDLASGPDNLVENGPYKYIFSTEGHLLPA  473

Query  435   LSTW-----HDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPAT  316
             +        H     AY  S+    K E  +   S  S  I  +T
Sbjct  474   MPQISLLGEHCSYFGAYCESD--DIKQESPKSSISVNSHEINAST  516



>ref|XP_010069175.1| PREDICTED: probable alpha-mannosidase I MNS4 [Eucalyptus grandis]
 gb|KCW57437.1| hypothetical protein EUGRSUZ_H00217 [Eucalyptus grandis]
Length=661

 Score =   411 bits (1057),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 211/451 (47%), Positives = 291/451 (65%), Gaps = 22/451 (5%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K++  +VR+MFYHA++ YM HAFP DEL+PL+    D++   GN             ALT
Sbjct  37    KQLRDEVREMFYHAFDGYMEHAFPKDELRPLSCQGEDTI---GNY------------ALT  81

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL  L +LG+   F  +V W+  NL FD++  +++FE  IR+LGGL+SAH++A+D  
Sbjct  82    LIDSLDMLALLGDRERFTSSVEWIGKNLRFDINKTVSVFETTIRILGGLLSAHLIASDYA  141

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +   +Y++QLL LAEDL RR LPAFDTPTG+P+  +NL  GV + E+  TST+G G+L
Sbjct  142   TGMRIPSYEDQLLHLAEDLARRLLPAFDTPTGIPFGSVNLMHGVDEQESKITSTAGGGTL  201

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRL  +PI+E     A+R LW+ RS LNL+G  ++V TGEW +   GIG  +D
Sbjct  202   TLEFGVLSRLANNPIYEEVTKNAVRGLWARRSKLNLVGAHINVFTGEWTQKDAGIGTSID  261

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAY+LFG DE+  +FQ AY A   Y  + PWY + +M +    +    SLQAF
Sbjct  262   SFYEYLLKAYLLFGEDEYLYIFQEAYGAAMHYLHNDPWYVEVNMDSAAIVWPLFNSLQAF  321

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GD+D A  +H  FF VWK++G  PE + L    +   +K YPLRPE  EST+
Sbjct  322   WPGLQVLAGDIDPAIRTHAAFFSVWKRYGFTPEGFNLATLNVQQGQKSYPLRPELMESTY  381

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +L++AT+DP Y++ G  ++ SL    +   G+  + DV   + EDH  SFFLAET KYL+
Sbjct  382   WLFKATRDPRYLDAGRDMVASLQYGARCPCGYCHISDVEFHKQEDHMESFFLAETVKYLW  441

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             LLFD     D+ + N    Y+F+TEGH LP 
Sbjct  442   LLFDLAAGPDNLVENGPYKYVFSTEGHLLPA  472



>gb|KEH42782.1| glycosyl hydrolase family 47 protein [Medicago truncatula]
Length=552

 Score =   408 bits (1048),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 219/486 (45%), Positives = 302/486 (62%), Gaps = 25/486 (5%)
 Frame = -1

Query  1869  MRKRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHD  1690
             +R  +LI  L  +S+   ++ S  D      A  K++  +V +MFYHA+  YM +AFP D
Sbjct  13    IRSSILILTLACISSCCFLTLSFADSVTKEEA--KQLRNEVGEMFYHAFNGYMDNAFPLD  70

Query  1689  ELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSV  1510
             ELKPL+    D+L                G ALTLI+SL +L +LG+   F  +V W+  
Sbjct  71    ELKPLSCKGEDTLG---------------GYALTLIDSLDTLALLGDRERFAASVEWIGK  115

Query  1509  NLSFD-VDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLP  1333
             NL FD ++  +++FE  IRVLGGL+SAH +A+D    +   +Y NQLL+LAEDL RR LP
Sbjct  116   NLRFDMINKTVSVFETTIRVLGGLISAHQIASDYATGMRVPSYDNQLLNLAEDLARRLLP  175

Query  1332  AFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALR  1153
             AFDTPTG+P+  +NL  GV ++E+  TST+G G+L LE G LSRLT DPIFE     A+ 
Sbjct  176   AFDTPTGIPFGSVNLLHGVDKHESKITSTAGGGTLTLEFGVLSRLTNDPIFEQVTKNAVL  235

Query  1152  KLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSA  973
              +W+ RS LNL+G  ++V TGEW +   GIG  +DSFYEYL+KAY+LFG +E+  +F+ A
Sbjct  236   AIWARRSKLNLVGAHINVFTGEWTQKDAGIGTSIDSFYEYLLKAYLLFGDEEYLYIFKEA  295

Query  972   YLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVW  793
             Y A   Y  H PWY + +M +    +    SLQAFWPG+QVL GD++ A  +H  F  VW
Sbjct  296   YAAAMHYLYHDPWYVEVNMDSAAIVWPLFNSLQAFWPGLQVLAGDINPAIRTHAAFLSVW  355

Query  792   KKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQY  613
             +++G  PE + L    +   +K YPLRPE  EST++LY+AT+DP Y++ G  ++ SL   
Sbjct  356   RRYGFTPEGFNLASLSVQHGQKSYPLRPELIESTYWLYKATRDPRYLDAGRDMLASLQYG  415

Query  612   TKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFD-----DSFLVNR--NYIFTTE  454
             T+   G+  + DV     EDH  SFFLAET KYL+LLFD     D+ + N    Y+F+TE
Sbjct  416   TRCPCGYCHISDVEDHRQEDHMESFFLAETVKYLWLLFDLAVGPDNLVENGPYKYVFSTE  475

Query  453   GHPLPV  436
             GH LP 
Sbjct  476   GHLLPA  481



>emb|CDX96894.1| BnaC02g30320D [Brassica napus]
Length=616

 Score =   409 bits (1052),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 229/531 (43%), Positives = 310/531 (58%), Gaps = 64/531 (12%)
 Frame = -1

Query  1788  NPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQK  1609
             NP  A  K++  +VR+MFYHA++ YM +AFP DELKPL+    D+L              
Sbjct  35    NPHEA--KQLRDEVREMFYHAFDGYMNNAFPLDELKPLSCQGEDTLG-------------  79

Query  1608  YSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAH  1429
               G ALTLI+SL +L +LG+   F  +V W+  NL F+++  +++FE  IRVLGGL+SAH
Sbjct  80    --GYALTLIDSLDTLALLGDRESFTSSVQWIGKNLQFNINKTVSVFETTIRVLGGLLSAH  137

Query  1428  ILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettets  1249
             ++A+D    +   +Y N+LL LAEDL RR LPAFDTPTG+PY  I              S
Sbjct  138   LIASDCATGMRIPSYDNELLVLAEDLARRMLPAFDTPTGIPYGSIT-------------S  184

Query  1248  tSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFST  1069
             T+G G+L LE G LSRLT DP+FE  A  A+R LW+ RS+L+L+G  ++V TGEW +   
Sbjct  185   TAGGGTLTLEFGVLSRLTNDPVFEQVAKNAVRGLWARRSTLDLVGAHINVFTGEWTQKDA  244

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQ  889
             GIG  +DSFYEYL+KAYILFG +E+  +FQ AY +   +    PWY + +M +G   +  
Sbjct  245   GIGTSIDSFYEYLLKAYILFGDEEYLYIFQEAYGSAMHHLHKDPWYVEVNMDSGAIVWPV  304

Query  888   LTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRP  709
               SLQAFWPG+QVL GDVD A  +H  FF VWK++G  PE + L    +   +K YPLRP
Sbjct  305   FNSLQAFWPGLQVLAGDVDPAIRTHTAFFSVWKRYGFTPEGFNLATLSVQYGQKSYPLRP  364

Query  708   EFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLA  529
             E  EST++LY+AT+DP Y++ G   + SL    K   G+  + DV   + EDH  SFFLA
Sbjct  365   ELIESTYWLYKATRDPRYLDAGRDFVASLQYGAKCPCGYCHITDVELHKQEDHMESFFLA  424

Query  528   ETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV-----LSTWHDRLSEAYLPSNW  385
             ET KYL+LLFD     D+ + N    YIF+TEGH LP+     L+  H      Y P N 
Sbjct  425   ETVKYLWLLFDLAVDSDNLVDNGPYKYIFSTEGHLLPLTPQISLAREHCSYFGGYCPRNA  484

Query  384   TSFKHEKHRKR--------------------ASAMSQRICPATTLSHEQEY  292
             T F+      +                     + + + +CP   LSH Q+Y
Sbjct  485   TKFEQSNDDHQVPEIELDHHSNIYPYHESFPVTGLIKGLCP--RLSHAQKY  533



>ref|XP_010542915.1| PREDICTED: probable alpha-mannosidase I MNS4 isoform X2 [Tarenaya 
hassleriana]
Length=626

 Score =   409 bits (1051),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 220/508 (43%), Positives = 310/508 (61%), Gaps = 33/508 (6%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K +  +VR+MFYH+++ YM HAFP DELKPL+    D+L                G ALT
Sbjct  53    KLLRDEVREMFYHSFDGYMKHAFPLDELKPLSCEGEDTLG---------------GYALT  97

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL +L +LG+   F  +V W+  NL F+++  +++FE +IRVLGGL+SAH++A+D  
Sbjct  98    LIDSLDTLALLGDRANFTSSVEWIGKNLQFNINKTVSVFETSIRVLGGLLSAHLIASDYA  157

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +   +Y N+LL LAEDL RR LPAFDTPTG+P+  +NL  GV ++E+  TST+G G+L
Sbjct  158   TGMRIPSYDNELLVLAEDLARRMLPAFDTPTGIPFGSVNLMHGVDKHESKITSTAGGGTL  217

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRLT DP+FE  A  A+R LW+ RS+L+L+G  ++V TGEW +   GIG  +D
Sbjct  218   TLEFGVLSRLTNDPVFEQVAKNAVRGLWARRSNLDLVGAHINVFTGEWTQKDAGIGTSID  277

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAYILFG +E+  MFQ AY AV +Y    PWY + +M +    +    SLQAF
Sbjct  278   SFYEYLLKAYILFGDEEYLYMFQEAYGAVMQYLHKDPWYVEVNMDSAAIVWPLFNSLQAF  337

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GD+D A  +H  FF VW+++G  PE + L    +   +K YPLRPE  EST+
Sbjct  338   WPGLQVLAGDIDPAIRTHTAFFSVWRRYGFTPEGFNLATLSVQHGQKSYPLRPELIESTY  397

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT+DP Y++ G   + SL    +   G+  + DV   + EDH  SFFLAET KYL+
Sbjct  398   WLYKATRDPRYLDAGRDFVTSLQYGARCPCGYCHITDVEFHKQEDHMESFFLAETVKYLW  457

Query  507   LLFD-----DSFLVNRNYIFTTEG----HPLPVLSTWHDRLSEAYLPSNWTSFKHE----  367
             LLFD     D+ + N  Y     G    +P   +S+   + S      +   F +     
Sbjct  458   LLFDLAVGPDNRVENGPYQSNAAGKEEQYPAANISSASTQDSNDSSKISGNGFGNSIPLQ  517

Query  366   ---KHRKRASAMSQRICPATTLSHEQEY  292
                +     + + + +CPA  L+H Q+Y
Sbjct  518   YPYQEPSPITGLIKGVCPA--LTHAQKY  543



>ref|XP_007132819.1| hypothetical protein PHAVU_011G1272001g, partial [Phaseolus vulgaris]
 gb|ESW04813.1| hypothetical protein PHAVU_011G1272001g, partial [Phaseolus vulgaris]
Length=241

 Score =   395 bits (1014),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 206/228 (90%), Gaps = 1/228 (0%)
 Frame = -1

Query  1053  VDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADM-RTGKATYWQLTSL  877
             VDSFYEYL+KA+ILFG ++FWKMF S Y+AVQKYFRHG WYH+AD+ RTG+AT+WQLTSL
Sbjct  1     VDSFYEYLLKAHILFGKEDFWKMFHSPYVAVQKYFRHGSWYHEADIIRTGRATHWQLTSL  60

Query  876   QAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAE  697
             QAFWPG+QVL+GD   ANSSHREFFHVWK++GVLPERYLLDHQM+HPTEKYYPLRPE  E
Sbjct  61    QAFWPGLQVLIGDFSDANSSHREFFHVWKRYGVLPERYLLDHQMIHPTEKYYPLRPELVE  120

Query  696   STFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCK  517
             STFYL QATKDPWY+EVGE I+NS+N YTKV+GGFAS++DVTTM+LEDHQHSFFLAETCK
Sbjct  121   STFYLCQATKDPWYIEVGESIVNSINLYTKVEGGFASIKDVTTMQLEDHQHSFFLAETCK  180

Query  516   YLYLLFDDSFLVNRNYIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFK  373
             YLYLLFDDSF+   NY+FTTEGHP PVLS WH+ L +AY+P+NWT  K
Sbjct  181   YLYLLFDDSFVHENNYVFTTEGHPFPVLSNWHEELPQAYVPTNWTFVK  228



>gb|KEH42783.1| glycosyl hydrolase family 47 protein [Medicago truncatula]
Length=624

 Score =   408 bits (1049),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 219/486 (45%), Positives = 302/486 (62%), Gaps = 25/486 (5%)
 Frame = -1

Query  1869  MRKRVLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHD  1690
             +R  +LI  L  +S+   ++ S  D      A  K++  +V +MFYHA+  YM +AFP D
Sbjct  13    IRSSILILTLACISSCCFLTLSFADSVTKEEA--KQLRNEVGEMFYHAFNGYMDNAFPLD  70

Query  1689  ELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSV  1510
             ELKPL+    D+L                G ALTLI+SL +L +LG+   F  +V W+  
Sbjct  71    ELKPLSCKGEDTLG---------------GYALTLIDSLDTLALLGDRERFAASVEWIGK  115

Query  1509  NLSFD-VDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLP  1333
             NL FD ++  +++FE  IRVLGGL+SAH +A+D    +   +Y NQLL+LAEDL RR LP
Sbjct  116   NLRFDMINKTVSVFETTIRVLGGLISAHQIASDYATGMRVPSYDNQLLNLAEDLARRLLP  175

Query  1332  AFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALR  1153
             AFDTPTG+P+  +NL  GV ++E+  TST+G G+L LE G LSRLT DPIFE     A+ 
Sbjct  176   AFDTPTGIPFGSVNLLHGVDKHESKITSTAGGGTLTLEFGVLSRLTNDPIFEQVTKNAVL  235

Query  1152  KLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSA  973
              +W+ RS LNL+G  ++V TGEW +   GIG  +DSFYEYL+KAY+LFG +E+  +F+ A
Sbjct  236   AIWARRSKLNLVGAHINVFTGEWTQKDAGIGTSIDSFYEYLLKAYLLFGDEEYLYIFKEA  295

Query  972   YLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVW  793
             Y A   Y  H PWY + +M +    +    SLQAFWPG+QVL GD++ A  +H  F  VW
Sbjct  296   YAAAMHYLYHDPWYVEVNMDSAAIVWPLFNSLQAFWPGLQVLAGDINPAIRTHAAFLSVW  355

Query  792   KKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQY  613
             +++G  PE + L    +   +K YPLRPE  EST++LY+AT+DP Y++ G  ++ SL   
Sbjct  356   RRYGFTPEGFNLASLSVQHGQKSYPLRPELIESTYWLYKATRDPRYLDAGRDMLASLQYG  415

Query  612   TKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFD-----DSFLVNR--NYIFTTE  454
             T+   G+  + DV     EDH  SFFLAET KYL+LLFD     D+ + N    Y+F+TE
Sbjct  416   TRCPCGYCHISDVEDHRQEDHMESFFLAETVKYLWLLFDLAVGPDNLVENGPYKYVFSTE  475

Query  453   GHPLPV  436
             GH LP 
Sbjct  476   GHLLPA  481



>ref|XP_002280131.1| PREDICTED: probable alpha-mannosidase I MNS4 [Vitis vinifera]
Length=649

 Score =   409 bits (1050),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 212/451 (47%), Positives = 287/451 (64%), Gaps = 22/451 (5%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K +  +VR MFYHA++ YM +AFP DEL+PLT    D+L                G ALT
Sbjct  36    KLLRDEVRGMFYHAFDGYMENAFPLDELRPLTCEGEDTLG---------------GYALT  80

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST  1408
             LI+SL +L +LG+   F  +V W+  NL FD++  +++FE  IR+LGGL+S H++A+D  
Sbjct  81    LIDSLDTLALLGDRERFATSVEWIGKNLRFDINKTVSVFETTIRILGGLLSGHLIASDYA  140

Query  1407  NRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSL  1228
               +   +Y NQLL L EDL RR LPAFDTPTG+P+  +NL  GV ++E+  TST+G G+L
Sbjct  141   TGMKIPSYDNQLLHLCEDLARRLLPAFDTPTGIPFGSVNLLHGVDEHESKITSTAGGGTL  200

Query  1227  ILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVD  1048
              LE G LSRLT DPIFE     A+  LW+ RS LNL+G  ++V TGEW +   GIG  +D
Sbjct  201   TLEFGVLSRLTNDPIFEQVTKNAVHGLWARRSKLNLVGAHINVFTGEWTQKDAGIGTSID  260

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAF  868
             SFYEYL+KAY+LFG +E+  +FQ AY A   Y  + PWY + +M +    +    SLQAF
Sbjct  261   SFYEYLLKAYLLFGDEEYLFIFQEAYGAAMYYLYNDPWYVEVNMDSAAIVWPLFNSLQAF  320

Query  867   WPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTF  688
             WPG+QVL GD+D A  +H  FF VWK++G  PE + L    +   +K YPLRPE  EST+
Sbjct  321   WPGLQVLAGDIDPAIRTHTAFFSVWKRYGFTPEGFNLATLSVQHGQKSYPLRPELMESTY  380

Query  687   YLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLY  508
             +LY+AT++P Y++ G  ++ SL    +   G+  + DV   + EDH  SFFLAET KYL+
Sbjct  381   WLYKATRNPRYLDAGRDMVTSLQYGARCPCGYCHISDVEFHKQEDHMESFFLAETVKYLW  440

Query  507   LLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             LLFD     D+ + N    YIF+TEGH LP 
Sbjct  441   LLFDLAAGSDNLVENGPYKYIFSTEGHLLPA  471



>ref|XP_004495395.1| PREDICTED: probable alpha-mannosidase I MNS4-like isoform X2 
[Cicer arietinum]
Length=613

 Score =   404 bits (1039),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 214/452 (47%), Positives = 288/452 (64%), Gaps = 27/452 (6%)
 Frame = -1

Query  1767  KRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALT  1588
             K++  +V +MFYHA+  YM +AFP DELKPL+    D+L                G ALT
Sbjct  38    KQLRDEVGEMFYHAFNGYMDNAFPLDELKPLSCAGEDTLG---------------GYALT  82

Query  1587  LIESLSSLVILGNHTEFEKAVLWLSVNLSFD-VDARINLFECNIRVLGGLVSAHILATDS  1411
             LI+SL +L +LG+   F  +V W+  NL FD ++  +++FE  IRVLGGL+SAH++A+D 
Sbjct  83    LIDSLDTLALLGDRERFAASVEWIGKNLRFDMINKTVSVFETTIRVLGGLLSAHLIASDY  142

Query  1410  TNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGS  1231
                +   +Y NQLL+LAEDL RR LPAFDTPTG+PY  +NL  GV + E+  TST+G G+
Sbjct  143   ATGMRVPSYDNQLLNLAEDLARRLLPAFDTPTGIPYGSVNLLHGVDKQESKITSTAGGGT  202

Query  1230  LILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGV  1051
             L LE G LSRLT DPI + A L     LW+ RS LNL+G  ++V TGEW +   GIG  +
Sbjct  203   LTLEFGVLSRLTNDPITKNAVL----ALWARRSKLNLVGAHINVFTGEWTQKDAGIGTSI  258

Query  1050  DSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQA  871
             DSFYEYL+KAYILFG +E+  +FQ AY A   Y  H PWY + +M +    +    SLQA
Sbjct  259   DSFYEYLLKAYILFGDEEYLYIFQEAYSAAMHYLYHDPWYVEVNMDSAAIVWPLFNSLQA  318

Query  870   FWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAEST  691
             FWPG+QVL GD++ A  +H  F  VW+++G  PE + L    +   +K YPLRPE  EST
Sbjct  319   FWPGLQVLAGDINPAIRTHAAFLSVWRRYGFTPEGFNLASLSVQHGQKSYPLRPELIEST  378

Query  690   FYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYL  511
             ++LY+AT+DP Y++ G  ++ SL   T+   G+  + DV   + EDH  SFFLAET KYL
Sbjct  379   YWLYKATRDPRYLDAGRDMVASLQYGTRCACGYCHISDVENHKQEDHMESFFLAETVKYL  438

Query  510   YLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             +LLFD     D+ + N    Y+F+TEGH LP 
Sbjct  439   WLLFDLAVGPDNLVENGPYKYVFSTEGHLLPA  470



>dbj|GAM25915.1| hypothetical protein SAMD00019534_090900 [Acytostelium subglobosum 
LB1]
Length=491

 Score =   399 bits (1024),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 206/451 (46%), Positives = 288/451 (64%), Gaps = 21/451 (5%)
 Frame = -1

Query  1785  PMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKY  1606
             P    ++ +   V++MFYH Y++YM H+FP DELKP++   +D+              KY
Sbjct  38    PSNELKRLLRDDVKRMFYHGYDSYMKHSFPMDELKPISCKGSDTFG------------KY  85

Query  1605  SGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHI  1426
                ALT I+SL +L+ILGN TEFEK V W   N+ F+ D  +++FE NIRVLGGL+SAH+
Sbjct  86    ---ALTYIDSLDALLILGNTTEFEKGVQWTIDNIQFNKDVNVSVFETNIRVLGGLLSAHL  142

Query  1425  LATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetst  1246
             LA +  +     TY   LL LA DLG R L AFDTPTG+PY  +NL RGV+  E++ T T
Sbjct  143   LAEEHMS-----TYTGGLLPLALDLGERILVAFDTPTGIPYGAVNLARGVLPGESSVTCT  197

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTG  1066
             +G G+  LE G LS+LT  P FE AA RA R LW  RS ++LLG  LD+ TG W    +G
Sbjct  198   AGAGTFALEFGILSKLTQRPEFERAAKRAARSLWRYRSEIDLLGNHLDLITGAWTITESG  257

Query  1065  IGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQL  886
             IG G+DS++EYL+KA I F   ++  +F+ AY A+ ++ +   WY +  M      +   
Sbjct  258   IGTGIDSYFEYLLKAAIFFDDQDYLDIFEKAYRAIIRHVKKEHWYVEVQMSKANIVWPIY  317

Query  885   TSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPE  706
              SLQ+FWPG+Q L G  + A  + + F  VW+++G LPE Y L    +HP ++ YPLRPE
Sbjct  318   NSLQSFWPGLQALAGQFEDAFGTVKAFHTVWRRYGFLPEGYNLLSGGVHPGQRSYPLRPE  377

Query  705   FAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAE  526
              AES + +YQ  KDP+++++G  ++ +L+  T+ + G A++ DV T ELED   SFFL+E
Sbjct  378   LAESLYTMYQNNKDPYFIKMGRDMVWTLSNQTRCECGHANIADVETHELEDKMESFFLSE  437

Query  525   TCKYLYLLFDDS-FLVNRNYIFTTEGHPLPV  436
             TCKYLYLLFDDS   +N++Y+F TEGH  P+
Sbjct  438   TCKYLYLLFDDSNMFINQSYVFNTEGHIFPM  468



>ref|XP_007901596.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Callorhinchus milii]
Length=646

 Score =   403 bits (1036),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 223/505 (44%), Positives = 315/505 (62%), Gaps = 28/505 (6%)
 Frame = -1

Query  1791  PNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLP  1615
             P P   +R+RM +    MFY  YENYM HAFP DEL P+  +          N+ +  + 
Sbjct  119   PEP---QRRRMREAALDMFYFGYENYMRHAFPQDELNPIDCQGRGPDRDNPSNININDVL  175

Query  1614  QKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVS  1435
               YS   LTLI++L +L +LGN +EF++AV  +   +SFD D+ + +FE  IR+LG L+S
Sbjct  176   GNYS---LTLIDALDTLAVLGNASEFKRAVNLVIATVSFDKDSTVQVFEATIRILGSLLS  232

Query  1434  AHILATDSTN---RLVQGTYKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQN  1267
             AH++ TD       +V   Y N+LL LA DL  R LPAF+ T TG+P+  +NLK+GV  N
Sbjct  233   AHMIITDPVQPFGNMVPEGYDNELLHLAHDLAVRLLPAFENTKTGIPHPRVNLKKGVPSN  292

Query  1266  ettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATG  1090
                ET T+G GSL++E G LS L GD  FE  A RA+R LW++RS+   LLG  +++ TG
Sbjct  293   CVNETCTAGAGSLLVEFGILSHLIGDSTFEWVARRAVRALWNLRSNETGLLGNVVNIQTG  352

Query  1089  EWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----------  940
             +W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF + Y ++Q + R G          
Sbjct  353   DWVGKQSGLGAGMDSFYEYLLKSYILFGDSEDLEMFNAVYESIQNHLRRGREACNEGEGD  412

Query  939   -PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERY  763
              P Y + +M  G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK+FG LPERY
Sbjct  413   PPLYVNVNMFNGEIMNTWIDSLQAFFPGLQVLMGDVEDAICLHAFYYAIWKRFGALPERY  472

Query  762   LLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASV  583
               + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++
Sbjct  473   --NWQLQAPDVMFYPLRPELVESTYLLYQATKNPFYLHVGMDILESLEKYTKVRCGYATL  530

Query  582   RDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLSTWHDRL  412
               V     ED   SFFL+ETCKYLYLLFD+   ++R+   YIFTTEGH LPV+  + ++ 
Sbjct  531   HHVIEKSKEDRMESFFLSETCKYLYLLFDEDNPLHRSGSKYIFTTEGHILPVIKLFREKP  590

Query  411   SEAYLPSNWTSFKHEKHRKRASAMS  337
              +   P    +F + +   R +  S
Sbjct  591   WQDVFPKEEDTFANSEVDYRPANSS  615



>gb|KFM79018.1| ER degradation-enhancing alpha-mannosidase-like 1, partial [Stegodyphus 
mimosarum]
Length=526

 Score =   398 bits (1023),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 217/469 (46%), Positives = 300/469 (64%), Gaps = 27/469 (6%)
 Frame = -1

Query  1761  MSQKVRKMFYHAYENYMMHAFPHDELKPLTKT-YTDSLSELGNLKLEHLPQKYSGSALTL  1585
             M ++ RKMF   Y+NY+ +AFP DEL P+  T          N+ +  +   YS   LTL
Sbjct  1     MKEEARKMFQFGYDNYLKYAFPKDELNPIFCTGRGPDYENPSNININDVLGDYS---LTL  57

Query  1584  IESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTN  1405
             I++L +L ++GN TEF+KAV  +  ++SFD D  + +FE NIR+LG L+SAH+L  D+  
Sbjct  58    IDALDTLAVMGNTTEFKKAVKLIIEHVSFDTDNTVQVFEANIRILGSLLSAHLLINDAKQ  117

Query  1404  ---RLVQGTYKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetstSGC  1237
                 LV   Y N+LL LA +L  R LPAF+ T TGLPY  +NL+ GV +  +T T T+G 
Sbjct  118   PFGNLVPKDYNNELLHLAHELASRLLPAFENTKTGLPYPRVNLRHGVPEGVSTHTCTAGA  177

Query  1236  GSLILEMGALSRLTGDPIFEIAALRALRKLWSMRS-SLNLLGTTLDVATGEWIEFSTGIG  1060
             GS++LE G LSRL  DP++E  A RA+R LW +RS +  LLG  +DV +GEWI   +GIG
Sbjct  178   GSMLLEFGMLSRLLQDPVYEGVARRAVRALWKLRSKNTGLLGNVVDVQSGEWIGQMSGIG  237

Query  1059  AGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDADMR  913
             AG+DSF+EYL+K+YILFG  E + +F   Y  +++Y R G           P Y + +M 
Sbjct  238   AGLDSFFEYLLKSYILFGEKEDFSLFNETYHTIKRYMRKGRPHCNHGYGEHPLYVNVNMI  297

Query  912   TGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPT  733
              G      + SLQA + GVQVL GD++ A  SH  ++ +W++FG LPER+  + Q + P 
Sbjct  298   DGSTLTLWIDSLQAAFAGVQVLTGDIEEAICSHALYYSIWRRFGALPERF--NWQRVSPD  355

Query  732   EKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELED  553
               +YPLRPE  EST+ LYQATK+P+Y+ VG+ II SLN+Y+K + G+A++ +V    LED
Sbjct  356   LAFYPLRPELIESTYLLYQATKNPFYLHVGQEIIESLNKYSKAKCGYATIHNVQDKTLED  415

Query  552   HQHSFFLAETCKYLYLLFDDSFLVNR---NYIFTTEGHPLPVLSTWHDR  415
                SFFL+ETCKYLYLLFD    VN+   +Y+FTTEGH  P+L  W  R
Sbjct  416   RMESFFLSETCKYLYLLFDVDNPVNKMASHYVFTTEGHIFPLL--WQSR  462



>ref|XP_008317896.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Cynoglossus semilaevis]
Length=635

 Score =   402 bits (1032),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 228/521 (44%), Positives = 323/521 (62%), Gaps = 30/521 (6%)
 Frame = -1

Query  1770  RKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSA  1594
             R +M    ++MFY  Y+NYM +AFP DEL P+  +     +S   N+ +  +   YS   
Sbjct  113   RVKMKDMAKEMFYFGYDNYMKYAFPEDELNPIDCEGRGPDVSNPSNININDVLGNYS---  169

Query  1593  LTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATD  1414
             LTLI++L +L++LGN TEF +AV  +   +SFD D+ + +FE NIR+LGGL+SAHIL TD
Sbjct  170   LTLIDTLDTLLVLGNVTEFHRAVKLVIDTVSFDKDSTVQVFEANIRILGGLISAHILLTD  229

Query  1413  STN---RLVQGTYKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLKRGVMQNettetst  1246
               +   ++    Y N+LL LA DL  R LPAF +T TG+PY  +NLK GV  +   ET T
Sbjct  230   PKHPFGKVGFEGYDNELLHLAHDLAVRLLPAFENTTTGIPYPRVNLKTGVPPDSINETCT  289

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFST  1069
             +G GSL++E G LSRL GD  FE  A RA+R LW++RS+   LLG  +++ TG+W+   +
Sbjct  290   AGAGSLLVEFGILSRLIGDSTFEWVARRAVRALWNLRSNETGLLGNVVNIQTGQWVSKQS  349

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDA  922
             G+GAG+DSFYEYL+K+Y+LFG  E ++MFQSAY ++Q + R G           P Y + 
Sbjct  350   GLGAGMDSFYEYLLKSYLLFGEKEDYRMFQSAYESIQNHLRRGRESCNEGEGDPPLYVNV  409

Query  921   DMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQML  742
             +M +G+     + SLQAF+PG+QVL GDVD A   H  ++ +WK+FG LPERY  + Q+ 
Sbjct  410   NMFSGEIMNTWIDSLQAFFPGLQVLNGDVDNAICLHAFYYAIWKRFGALPERY--NWQLQ  467

Query  741   HPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTME  562
              P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +  KV+ G+A++  V    
Sbjct  468   APDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKNAKVRCGYATLHHVVDKS  527

Query  561   LEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLSTWHDRLSEAYLPS  391
              ED   SFFL+ETCKYLYLLFD+   ++++   YIFTTEGH +PV   + D+  +   P 
Sbjct  528   KEDRMESFFLSETCKYLYLLFDEDNPLHKSDNKYIFTTEGHVVPVDQRFRDKQWDDPFPC  587

Query  390   NWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQ-HLESAC  271
                +  +   R   +  S        +  E+ Y   L+S C
Sbjct  588   TEGALTNPYTRPAPTNTSN----CNRIPEERRYTLPLKSVC  624



>ref|XP_006646379.1| PREDICTED: uncharacterized protein LOC102706250 [Oryza brachyantha]
Length=1348

 Score =   419 bits (1076),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 218/462 (47%), Positives = 297/462 (64%), Gaps = 26/462 (6%)
 Frame = -1

Query  1797  DPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHL  1618
             D   P  ARR R   +V+ MFYHA++ YM HAFP DEL+PL+    DSL           
Sbjct  711   DGVTPSEARRLR--DEVKDMFYHAFDGYMQHAFPLDELRPLSCQGEDSLG----------  758

Query  1617  PQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLV  1438
                  G ALTLI+SL +L +LG+   F+ AV W+  N+ FD++  +++FE NIR+LGGL+
Sbjct  759   -----GYALTLIDSLDTLALLGDKDRFDAAVEWVGKNVRFDINKTVSVFETNIRILGGLL  813

Query  1437  SAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNett  1258
             SAH++A+D    +   +Y +QLL LA DL +R LPAFDTPTG+P+  +NL  GV +NE+ 
Sbjct  814   SAHLIASDYATGMKIQSYDDQLLHLAVDLAQRLLPAFDTPTGIPFGSVNLLYGVDENESK  873

Query  1257  etstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIE  1078
              TST+G G+L LE G LSRLT + ++E     ++R +W+ RS L+L+G  ++V TGEW +
Sbjct  874   ITSTAGGGTLTLEFGVLSRLTNNSVYEQVTKNSVRGIWARRSKLDLVGAHINVFTGEWTQ  933

Query  1077  FSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKAT  898
                GIG  +DSFYEYL+KAY+LFG +E+  +FQ AY A   Y  H PWY + +M +G AT
Sbjct  934   KDAGIGTSIDSFYEYLLKAYLLFGDEEYLYIFQEAYKAAMHYLHHDPWYVEVNMNSG-AT  992

Query  897   YWQL-TSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYY  721
              W L  SLQAFWPG+QVL GDVD A  +H  F  VWKK+G  PE + L    +   ++ Y
Sbjct  993   VWPLFNSLQAFWPGLQVLAGDVDPAIRTHAAFLSVWKKYGFTPEGFNLATSTVQNGQRSY  1052

Query  720   PLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHS  541
             PLRPE  EST++L++AT+D  Y++ G  I+ SL    K   G+  + DV + + +DH  S
Sbjct  1053  PLRPELIESTYWLFKATRDHRYLDAGRDILASLQYSAKCPCGYCHISDVESHQQDDHMES  1112

Query  540   FFLAETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             FFLAET KYL+LLFD     D+ + N    YIF+TEGH LP 
Sbjct  1113  FFLAETVKYLWLLFDLAAGPDNIVENGPYKYIFSTEGHLLPA  1154



>ref|XP_003973373.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like 1-like 
[Takifugu rubripes]
Length=638

 Score =   401 bits (1031),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 226/516 (44%), Positives = 322/516 (62%), Gaps = 36/516 (7%)
 Frame = -1

Query  1791  PNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLP  1615
             P+ + A+ K M+   ++MFY  Y+NYM HAFP DEL P+        +    N+ +  + 
Sbjct  110   PDALKAKMKDMA---KEMFYFGYDNYMRHAFPADELNPIECNGRGPDVLNPSNININDVL  166

Query  1614  QKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVS  1435
               YS   LTLI++L +L++LGN TEF++AV  +  N+SFD D+ + +FE NIR+LGGL+S
Sbjct  167   GNYS---LTLIDTLDTLLVLGNVTEFQRAVKLVIDNVSFDKDSTVQVFEANIRILGGLIS  223

Query  1434  AHILATDSTN---RLVQGTYKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLKRGVMQN  1267
              HIL TD+ +   ++    Y N+LL LA DL  R LPAF +T TG+PY  +NLK GV  +
Sbjct  224   THILLTDTKHPFGKVGFEGYDNELLHLAHDLAVRLLPAFENTSTGIPYPRVNLKTGVPPD  283

Query  1266  ettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATG  1090
                ET T+G GSL++E G LSRL GD  FE  A RA++ LWS+R++   LLG  +++ TG
Sbjct  284   SINETCTAGAGSLLVEFGILSRLIGDSTFEWVARRAVKALWSLRNNETGLLGNVVNIQTG  343

Query  1089  EWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----------  940
             +W+   +G+GAG+DSFYEYL+K+YILFG  E  KMFQ+AY ++Q + R G          
Sbjct  344   QWVGKQSGLGAGMDSFYEYLLKSYILFGEKEDHKMFQTAYESIQNHMRRGRESCNAGQGD  403

Query  939   -PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERY  763
              P Y + +M +G+     + SLQAF+PG+QVL GDVD A   H  ++ +WK+FG LPERY
Sbjct  404   PPLYVNVNMCSGEIINTWIDSLQAFFPGLQVLYGDVDNAICLHAFYYAIWKRFGALPERY  463

Query  762   LLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASV  583
               + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +  KV+ G+A++
Sbjct  464   --NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKNAKVRCGYATL  521

Query  582   RDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLSTWHDRL  412
               V     ED   SFFL+ETCKYLYLLFD+   ++R+   YIFTTEGH +P+   + ++ 
Sbjct  522   HHVVEKSKEDRMESFFLSETCKYLYLLFDEDNPLHRSDNKYIFTTEGHVVPIDKRFREK-  580

Query  411   SEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSH  304
                     W      ++         R  PA+ +S+
Sbjct  581   -------EWNKLFSYENGVLPEGTQSRSPPASNISN  609



>ref|XP_004084433.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like 1-like 
[Oryzias latipes]
Length=643

 Score =   400 bits (1029),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 220/481 (46%), Positives = 310/481 (64%), Gaps = 25/481 (5%)
 Frame = -1

Query  1776  ARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSG  1600
             A + +M +  R+MFY  Y+NYM +AFP DEL P+  K          N+ +  +   YS 
Sbjct  117   ALKSQMKEMAREMFYFGYDNYMKYAFPEDELNPIDCKGRGPDALNPSNININDVLGNYS-  175

Query  1599  SALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILA  1420
               LTLI++L +L++LGN +EF++AV  +   +SFD D+ + +FE NIR+LG L+SAHIL 
Sbjct  176   --LTLIDTLDTLLVLGNVSEFQRAVKLVIETVSFDKDSTVQVFEANIRILGSLISAHILL  233

Query  1419  TDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettet  1252
             TD      +     Y+N+LL LA DL  R LPAF+ T TG+PY  +NLK GV  +   ET
Sbjct  234   TDPKQPFGKVNFEGYENELLHLAHDLAVRLLPAFEHTDTGIPYPRVNLKTGVPLDSINET  293

Query  1251  stSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEF  1075
              T+G GSL++E G LSRL GD  FE  A RA+R LW +RS+   LLG  +++ TG+W+  
Sbjct  294   CTAGAGSLLVEFGILSRLIGDSTFEWVARRAVRALWRLRSNETGLLGNVINIQTGQWVGK  353

Query  1074  STGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYH  928
              +G+GAG+DSFYEYL+K+YILFG +E  +MFQ+AY ++Q + R G           P Y 
Sbjct  354   QSGLGAGMDSFYEYLLKSYILFGEEEDNQMFQAAYESIQNHLRRGRDLCNEGEGDPPLYV  413

Query  927   DADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQ  748
             + +M +G+     + SLQAF+PG+QVL GDVD A   H  ++ +WK+FG LPERY  + Q
Sbjct  414   NVNMNSGEIINTWIDSLQAFFPGLQVLNGDVDNAICLHAFYYAIWKRFGALPERY--NWQ  471

Query  747   MLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTT  568
             +  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL Q TKV+ G+A++  V  
Sbjct  472   LQAPDVHFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEQTTKVRCGYATLHHVVE  531

Query  567   MELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLSTWHDRLSEAYL  397
                ED   SFFL+ETCKYLYLLFD++  ++++   YIFTTEGH +P+   + ++  +   
Sbjct  532   KSKEDRMESFFLSETCKYLYLLFDENNPLHKSGHKYIFTTEGHIVPIDKRFREKQWDDLF  591

Query  396   P  394
             P
Sbjct  592   P  592



>ref|XP_008155548.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Eptesicus fuscus]
Length=555

 Score =   397 bits (1021),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 241/541 (45%), Positives = 324/541 (60%), Gaps = 45/541 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+          +  NL
Sbjct  17    YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIDCGGRGPDRGDPSNL  72

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  73    NINDVLGNYS---LTLVDALDTLAIMGNASEFQKAVKLVINTVSFDKDSTVQVFEATIRV  129

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  130   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLK  189

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LWS+RSS   LLG  
Sbjct  190   TGVPPDSNNETCTAGAGSLLVEFGMLSRLLGDSTFEWVARRAVKALWSLRSSGTGLLGNV  249

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+KAYILFG  E   MF +AY ++Q Y R G    
Sbjct  250   VNIQTGHWVGKQSGLGAGLDSFYEYLLKAYILFGEKEDLDMFNAAYHSIQSYLRRGREAC  309

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + DM +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  310   NEGEGDPPLYVNVDMFSGRLMNTWMDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  369

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  370   ALPERY--NWQLQAPDVFFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  427

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNR---NYIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V++    Y+FTTEGH + V  
Sbjct  428   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKAGTRYMFTTEGHVVSV--  485

Query  429   TWHDR-LSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDT  256
                DR L EA     W  F  ++H + A     R  PA   +   E  +  S C+ +PD 
Sbjct  486   ---DRHLREA----PWKEFFPDEHGRAAGTALHR--PA---APRLEVFNSSSNCNRVPDE  533

Query  255   R  253
             R
Sbjct  534   R  534



>ref|XP_005987996.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 isoform X1 [Latimeria chalumnae]
Length=651

 Score =   400 bits (1028),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 222/490 (45%), Positives = 315/490 (64%), Gaps = 27/490 (6%)
 Frame = -1

Query  1770  RKRMSQKVRKMFYHAYENYMMHAFPHDELKPL--TKTYTDSLSELGNLKLEHLPQKYSGS  1597
             R++M +  R+MFY  YENYM HAFP DEL P+       D L+   N+ +  +   YS  
Sbjct  127   RRQMREMAREMFYFGYENYMKHAFPEDELNPIDCMGRGPDVLNP-SNININDVLGNYS--  183

Query  1596  ALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILAT  1417
              LTLI+++ +L ++GN +EF++AV  +   +SFD D+ + +FE  IR+LG L+SAH++ T
Sbjct  184   -LTLIDAMDTLAVMGNISEFQRAVKLVIDTVSFDKDSTVQVFEATIRILGSLLSAHVILT  242

Query  1416  DSTNRLVQGTYK---NQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettets  1249
             D        T+K   N+LL +A DL  R LPAF+ T TG+PY  +NLK+GV  + T ET 
Sbjct  243   DPKQPFGDVTFKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKKGVPLDGTNETC  302

Query  1248  tSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFS  1072
             T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  +++ TG+W+   
Sbjct  303   TAGAGSLLVEFGILSRLIGDSTFEWVARRAVKALWNLRSNETGLLGNVVNIHTGQWVGKQ  362

Query  1071  TGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHD  925
             +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y +
Sbjct  363   SGLGAGMDSFYEYLLKSYILFGEKEDLEMFNAAYGSIQNYLRRGREACNEGEGDPPLYVN  422

Query  924   ADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQM  745
              +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK+FG LPERY  + Q+
Sbjct  423   VNMFSGQIMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRFGALPERY--NWQL  480

Query  744   LHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTM  565
               P   +YPLRPE  EST+ LYQATK+P+Y+ VG  II SL +YTKV+ G+A++  V   
Sbjct  481   QAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDIIQSLEKYTKVRCGYATLHHVVEK  540

Query  564   ELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLSTWHDRLSEAYLP  394
               ED   SFFL+ETCKYLYLLFD+   ++++   YIFTTEGH +PV     ++L +   P
Sbjct  541   SKEDRMESFFLSETCKYLYLLFDEDNPLHKSGNKYIFTTEGHLVPVDKHLREKLWQDLFP  600

Query  393   SNWTSFKHEK  364
                 S +  K
Sbjct  601   REEESVEEPK  610



>gb|AJA37905.1| EDEM-like protein 1 [Littorina littorea]
Length=566

 Score =   397 bits (1019),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 220/516 (43%), Positives = 314/516 (61%), Gaps = 38/516 (7%)
 Frame = -1

Query  1869  MRKRVLICMLIFLSTFFPMSFS------GFDPP--NPMA----ARRKRMSQKVRKMFYHA  1726
             MR+  L+C++I     FP+  S      G D P  N         R  M ++ +KMFY  
Sbjct  1     MRQEQLVCLIILC---FPLYDSRLHWLRGDDDPYLNKYGHFSDRERLEMLEEAKKMFYFG  57

Query  1725  YENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNH  1546
             Y+NYM +AFP DEL P+  T      E  N    ++     G +LTL+E+L +L ++GN 
Sbjct  58    YDNYMKYAFPQDELDPIHCTGRGPDRE--NPSNININDVLGGYSLTLVEALDTLAVMGNA  115

Query  1545  TEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTN---RLVQGTYKNQ  1375
             +EF+KAV  +  N+SFD D  + +FE  IRVLG L+SAH++ TD       +    Y ++
Sbjct  116   SEFQKAVQLVIDNVSFDTDNVVQVFEATIRVLGSLLSAHLIITDPQQPFGDMAPPDYDDE  175

Query  1374  LLDLAEDLGRRFLPAF-DTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRL  1198
             LL++A DL  R LPAF +T TG+P+  +NL  GV       T T+G G+L+LE G LSRL
Sbjct  176   LLEMAHDLATRLLPAFENTATGIPFPRVNLSTGVHPECINHTCTAGAGTLLLEFGVLSRL  235

Query  1197  TGDPIFEIAALRALRKLWSMRSSL-NLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKA  1021
               DP+++  A +A+  LW  RS++  LLG  +++ TGEW+   +G+GAG+DSFYEYL KA
Sbjct  236   LADPVYDFYAHQAVAGLWKYRSNVTGLLGNVINIQTGEWVGKMSGLGAGLDSFYEYLFKA  295

Query  1020  YILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDADMRTGKATYWQLTSLQ  874
             YILFG + + +MF  +Y  ++ + R G           P Y + +M TG+     + +LQ
Sbjct  296   YILFGDERYMRMFNESYETIKFHMRKGRERCNFGEGNSPMYVNVNMMTGEVINTWIDALQ  355

Query  873   AFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAES  694
             A WPGVQVL GD++ A  SH  ++ +W+K+  LPERY  + Q+  P   +YPLRPE  ES
Sbjct  356   AAWPGVQVLAGDIEEAICSHAFYYSIWRKYDALPERY--NWQLKAPDVSFYPLRPELVES  413

Query  693   TFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKY  514
             T++LY+AT++P+Y+ VG  I++SL+ +TK + G+ +V DV T ELED   SFFL+ETCKY
Sbjct  414   TYFLYRATRNPFYLHVGREILSSLSTHTKAKCGYGTVHDVETKELEDRMESFFLSETCKY  473

Query  513   LYLLFDDSFLVN---RNYIFTTEGHPLPVLSTWHDR  415
             LYLLFD    VN     Y+FTTEGH LP+   W  +
Sbjct  474   LYLLFDKDNHVNTALSRYLFTTEGHILPIDRRWRTK  509



>gb|EPB83370.1| ER degradation enhancer, mannosidase alpha-like 1 [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=794

 Score =   404 bits (1037),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 224/455 (49%), Positives = 297/455 (65%), Gaps = 17/455 (4%)
 Frame = -1

Query  1740  MFYHAYENYMMHAFPHDELKPLTKTYTDSLS-ELGNLKLEHLPQKYSGSALTLIESLSSL  1564
             MF H + NYM HA+P DEL P   T   S   +  N+ +  +   YS   LTL+++L +L
Sbjct  1     MFDHGWNNYMQHAYPEDELNPFKCTGRGSDKYDPNNININDVLGDYS---LTLVDTLDTL  57

Query  1563  VILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATD-STNRLVQGT  1387
              ILG   +FE+AV  +   +SF  D ++ +FE NIR LGGL+SAH+LATD S N  +QG 
Sbjct  58    AILGTQEQFEQAVDRVIKTVSFSQDNKVQVFEVNIRALGGLLSAHMLATDPSLNHTIQG-  116

Query  1386  YKNQLLDLAEDLGRRFLPAFDTP-TGLPYAWINLKRGVMQNettetstSGCGSLILEMGA  1210
             Y ++LL +A+DL  R +PAF T  TG+P+  +NLKRGV  +ETTET T+G GSLILE G 
Sbjct  117   YNDELLHMAQDLADRLMPAFQTSKTGIPFPRVNLKRGVPPSETTETCTAGAGSLILEFGV  176

Query  1209  LSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYL  1030
             LSRLTGDP +E AA +ALR +WS RS LNLLG  +D+ TG WI  ++  GAG+DS +EY+
Sbjct  177   LSRLTGDPTYEQAAKKALRAVWSRRSHLNLLGNVIDIQTGRWIHTASSTGAGIDSVFEYM  236

Query  1029  VKAYILFGGDEFWKMFQSAYLAVQKYFR--HGPWYHDADMRTGKATYWQLTSLQAFWPGV  856
             +KAY+LFG  E+  MF  AY A+  Y R   G  Y +  M TG    + + SL AF+PG+
Sbjct  237   LKAYVLFGEQEYKDMFDQAYKALLLYVRDQSGYLYRNVHMSTGSLMSYWIDSLSAFFPGL  296

Query  855   QVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQ  676
             QVL GD+D+A   H  F+++W+++  LPER+  D         YYPLRPEF EST++LY 
Sbjct  297   QVLQGDLDSAIKHHLVFYNIWRRYHALPERF--DFYQKTVDLPYYPLRPEFIESTYHLYM  354

Query  675   ATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFD  496
             ATKDP+Y+EVGE+++  LN  T+V  GFAS+ DV +  LED   SF L+ET KYLYLLFD
Sbjct  355   ATKDPFYLEVGEMVVEDLNNRTRVPCGFASIGDVRSGRLEDRMESFMLSETLKYLYLLFD  414

Query  495   DSFLVN---RNYIFTTEGHPLPVLSTW---HDRLS  409
                 +N    NY+FTTEGH L +   +   HD  S
Sbjct  415   VDNSINTMDNNYVFTTEGHVLGLPKKYLYHHDNTS  449



>ref|XP_005796976.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1-like [Xiphophorus maculatus]
Length=638

 Score =   398 bits (1023),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 216/465 (46%), Positives = 305/465 (66%), Gaps = 25/465 (5%)
 Frame = -1

Query  1770  RKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSA  1594
             R +M    ++MFY  YENYM +AFP DEL P+  +     +    N+ +  +   YS   
Sbjct  114   RVKMKDMAKEMFYFGYENYMKYAFPEDELNPIDCEGRGPDVMNPSNININDVLGNYS---  170

Query  1593  LTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATD  1414
             LTLI++L +L++LGN TEF++AV  +   +SFD ++ + +FE NIR+LG L+SAHIL TD
Sbjct  171   LTLIDTLDTLLVLGNVTEFQRAVKLVIDTVSFDKNSTVQVFEANIRILGSLISAHILLTD  230

Query  1413  STNRLVQ---GTYKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLKRGVMQNettetst  1246
             S +   +     Y N+LL LA DL  R LPAF +T TG+PY  +NLK GV Q+   ET T
Sbjct  231   SKHPFGEVGFKDYDNELLHLAHDLAVRLLPAFENTSTGIPYPRVNLKTGVPQDSINETCT  290

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFST  1069
             +G GSL++E G LSRL GD  FE  A RA+R LW++RS+   LLG  +++ TG+W+   +
Sbjct  291   AGAGSLLVEFGILSRLIGDSTFEWVARRAVRALWNLRSNETGLLGNVINIQTGQWVGKQS  350

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDA  922
             G+GAG+DSFYEYL+K+YILFG  E ++MF++AY ++Q + R G           P Y + 
Sbjct  351   GLGAGMDSFYEYLLKSYILFGEKEDYQMFKAAYESIQNHLRRGRESCNEGEGDPPLYVNV  410

Query  921   DMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQML  742
             +M +G+     + SLQAF+PG+QVL GD+D A   H  ++ +WK+FG LPERY  + Q+ 
Sbjct  411   NMFSGEIMNTWIDSLQAFFPGLQVLNGDIDDAICLHAFYYAIWKRFGALPERY--NWQLK  468

Query  741   HPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTME  562
              P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +  KV+ G+A++  V    
Sbjct  469   APDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKNAKVRCGYATLHHVVDKS  528

Query  561   LEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV  436
              ED   SFFL+ETCKYLYLLFD+   ++++   YIFTTEGH +P+
Sbjct  529   KEDRMESFFLSETCKYLYLLFDEDNPLHKSDNKYIFTTEGHVVPI  573



>ref|XP_005383976.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1-like, partial [Chinchilla lanigera]
Length=564

 Score =   396 bits (1017),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 234/545 (43%), Positives = 322/545 (59%), Gaps = 52/545 (10%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  25    YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  80

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  81    NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  137

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  138   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLK  197

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GDP FE  A RA++ LW++RS+   LLG  
Sbjct  198   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDPTFEWVARRAVKALWNLRSNDTGLLGNV  257

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  258   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREAC  317

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  318   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  377

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  378   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVR  435

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV--  436
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  436   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISVDK  495

Query  435   ---LSTWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-  268
                 S W +  SE         F H                    SHE +  +  S C+ 
Sbjct  496   HLRESPWKEFFSEDEGQEQQGKFVHRPK-----------------SHELKVINSSSNCNR  538

Query  267   IPDTR  253
             +PD R
Sbjct  539   VPDER  543



>ref|XP_004339384.1| glycosyl hydrolase family 47 protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR17371.1| glycosyl hydrolase family 47 protein [Acanthamoeba castellanii 
str. Neff]
Length=838

 Score =   404 bits (1037),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 221/447 (49%), Positives = 283/447 (63%), Gaps = 29/447 (6%)
 Frame = -1

Query  1740  MFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLV  1561
             MFYHAY++YM+HAFP DEL PL+   +++L              YS   LTL++SL +L+
Sbjct  1     MFYHAYDSYMLHAFPKDELLPLSCNGSETLG------------SYS---LTLVDSLDALL  45

Query  1560  ILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYK  1381
             ILGNH+EFEKA+ W+  NL FD+DA +++FE NIRVLGGL+SAH+LA D+        Y 
Sbjct  46    ILGNHSEFEKAITWVGDNLDFDLDANVSVFETNIRVLGGLLSAHLLAADAPELFPD--YD  103

Query  1380  NQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSR  1201
              +LL+LA DL  R LPAF T T +PY  +NL+ GV + ETT  S +G G+LILE G LSR
Sbjct  104   GRLLELAVDLASRLLPAFQTNTRIPYGTVNLRHGVPEGETTVASLAGAGTLILEFGLLSR  163

Query  1200  LTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKA  1021
             +TG+P FE AA  AL  LW  RS + L G  +D   G W + S+GIGAG DSF+EYL+K 
Sbjct  164   ITGNPAFEDAAHAALVGLWERRSPIGLYGGHIDTRDGTWTDASSGIGAGADSFFEYLLKG  223

Query  1020  YILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGV-----  856
              ILF   +++ MF+ AY A+  Y  H  WY   +M +GK       +L AFWPG+     
Sbjct  224   AILFDEADYYAMFEEAYEAILAYVLHDGWYFVVEMNSGKMVLPYFDALSAFWPGLQAVVT  283

Query  855   -QVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLY  679
              QVL+GDV  A  S   F  VW  FG  PE+  L +  L   +K YPLRPE  ES +YL+
Sbjct  284   AQVLLGDVSGAIESVTGFAKVWAFFGFTPEKANLINGALLQGQKSYPLRPELVESLYYLH  343

Query  678   QATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLF  499
             QAT DP ++  G+ I+++L   T+V  G+A V DV T ELEDH +SFFLAET KYLYLLF
Sbjct  344   QATGDPIWLHFGKGILSALQNRTRVACGYAGVVDVETGELEDHMNSFFLAETLKYLYLLF  403

Query  498   DD------SFLVNRNYIFTTEGHPLPV  436
             DD      S    R Y+F TEGH LPV
Sbjct  404   DDGSNFVHSGARGRRYVFNTEGHVLPV  430



>ref|XP_010624478.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1, partial [Fukomys damarensis]
Length=534

 Score =   394 bits (1012),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 223/492 (45%), Positives = 305/492 (62%), Gaps = 30/492 (6%)
 Frame = -1

Query  1770  RKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSA  1594
             R +M    R MF   Y+NYM HAFP DEL P+  +     L +  NL +  +   YS   
Sbjct  4     RAQMRDLARGMFVFGYDNYMAHAFPQDELNPIYCRGRGPDLGDPSNLNINDVLGNYS---  60

Query  1593  LTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATD  1414
             LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TD
Sbjct  61    LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITD  120

Query  1413  STNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetst  1246
             S       T   Y N+LL LA DL  R LPAF+ T TG+PY  +NLK GV  +   ET T
Sbjct  121   SKQPFGDMTIKDYDNELLHLAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCT  180

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFST  1069
             +G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  +++ TG W+   +
Sbjct  181   AGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWVGKQS  240

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDA  922
             G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y + 
Sbjct  241   GLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLYVNV  300

Query  921   DMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQML  742
             +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+ 
Sbjct  301   NMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQ  358

Query  741   HPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTME  562
              P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++  V    
Sbjct  359   APDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKS  418

Query  561   LEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV-----LSTWHDRLSE  406
              ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V      S W +  SE
Sbjct  419   KEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISVDKHLRESPWKEFFSE  478

Query  405   AYLPSNWTSFKH  370
                      F H
Sbjct  479   DEEQEQQGKFVH  490



>emb|CDH52163.1| er degradation-enhancing alpha-mannosidase-like1-like [Lichtheimia 
corymbifera JMRC:FSU:9682]
Length=788

 Score =   401 bits (1031),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 224/496 (45%), Positives = 312/496 (63%), Gaps = 21/496 (4%)
 Frame = -1

Query  1857  VLICMLIFLSTFFPMSFSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKP  1678
             V I  L+ L     M F+  +       RR  +    ++MF+H ++NY+  A+P DEL P
Sbjct  31    VFIISLVLLDCCVGMEFTMSE------KRRLELKDTAKEMFFHGWDNYIRFAYPEDELNP  84

Query  1677  L--TKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNL  1504
             +      +D L    N+ +  +   YS   LTL+++L +L ++G   EFEKAV  +   +
Sbjct  85    MLCNGRGSDKLKP-DNININDILGDYS---LTLVDTLDTLAVMGEQKEFEKAVRRVIDQV  140

Query  1503  SFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFD  1324
             SF  D ++ +FE NIR LGGL+SAHILA++ +       YK +LL LA+DL  R +PAF 
Sbjct  141   SFHQDNKVQIFELNIRALGGLLSAHILASEPSLGHTIPGYKGELLALAQDLADRLMPAFQ  200

Query  1323  -TPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKL  1147
              T TG+P+  +NLK GV + ET ET T+G GSL+LE G LSRLTG+P +E  A RAL  L
Sbjct  201   YTKTGIPFPRVNLKYGVPKTETVETCTAGAGSLLLEFGVLSRLTGNPHYEQVAKRALHAL  260

Query  1146  WSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYL  967
             W+ RS LNLLG  +++ TG+WI  ++  GAG+DS++EYL+KAY+LFG  E+ +MF+ +Y 
Sbjct  261   WNRRSDLNLLGNVINIQTGQWIHTASSTGAGIDSYFEYLLKAYVLFGDPEYLEMFEESYE  320

Query  966   AVQKYFRH--GPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVW  793
             A+ ++ R   G  Y +  M TG      + SL AFWPGVQVL GD+DAA   H  F+++W
Sbjct  321   AIMQHVRDPGGYLYRNVHMSTGALMATWIDSLSAFWPGVQVLYGDLDAAVKGHLVFYNIW  380

Query  792   KKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQY  613
             +K+  LPER+    + +     +YPLRPEF EST+YLY+AT+DP+Y+ VGE++I  LN  
Sbjct  381   RKYHALPERFDFYRKTVDI--GFYPLRPEFIESTYYLYRATRDPFYLHVGEMVIEDLNNR  438

Query  612   TKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVN---RNYIFTTEGHPL  442
             T++  GFAS+ DV T  LED   SF L+ET KYLYLLFD     N    N++FTTEGH L
Sbjct  439   TRLPCGFASIGDVRTGRLEDRMESFLLSETLKYLYLLFDTDNEFNAMDSNFVFTTEGHFL  498

Query  441   PVLSTWHDRLSEAYLP  394
             P L+T H   S +  P
Sbjct  499   P-LATHHLTTSNSSYP  513



>ref|XP_008406920.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 isoform X1 [Poecilia reticulata]
Length=638

 Score =   397 bits (1019),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 215/465 (46%), Positives = 304/465 (65%), Gaps = 25/465 (5%)
 Frame = -1

Query  1770  RKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSA  1594
             R +M    ++MFY  YENYM +AFP DEL P+  +     +    N+ +  +   YS   
Sbjct  114   RVKMKDMAKEMFYFGYENYMKYAFPEDELNPIDCEGRGPDVLNPSNININDVLGNYS---  170

Query  1593  LTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATD  1414
             LTLI++L +L++LGN TEF++AV  +   +SFD D+ + +FE NIR+LG L+SAHIL TD
Sbjct  171   LTLIDTLDTLLVLGNVTEFQRAVKLVIDTVSFDKDSTVQVFEANIRILGSLISAHILLTD  230

Query  1413  STNRLVQ---GTYKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetst  1246
               +   +     Y N+LL LA DL  R LPAF+ T TG+P+  +NLK GV Q+   ET T
Sbjct  231   PKHPFGEVGFKDYDNELLHLAHDLAVRLLPAFENTSTGIPFPRVNLKTGVPQDGINETCT  290

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFST  1069
             +G GSL++E G LSRL GD  FE  A RA+R LW++RS+   LLG  +++ TG+W++  +
Sbjct  291   AGAGSLLVEFGILSRLIGDSTFEWVARRAVRALWNLRSNETGLLGNVINIQTGQWVDKQS  350

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDA  922
             G+GAG+DSFYEYL+K+YILFG  E ++MF++AY ++Q + R G           P Y + 
Sbjct  351   GLGAGMDSFYEYLLKSYILFGEKEDYRMFKAAYESIQNHLRRGRESCNEGEGDPPLYVNV  410

Query  921   DMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQML  742
             +M +G+     + SLQAF+PG+QVL GD+D A   H  ++ +WK+FG LPERY  + Q+ 
Sbjct  411   NMFSGEIMNTWIDSLQAFFPGLQVLNGDIDDAICLHAFYYAIWKRFGALPERY--NWQLK  468

Query  741   HPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTME  562
              P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL    KV+ G+A++  V    
Sbjct  469   APDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLETNAKVRCGYATLHHVVDKS  528

Query  561   LEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV  436
              ED   SFFL+ETCKYLYLLFD+   ++++   YIFTTEGH +P+
Sbjct  529   KEDRMESFFLSETCKYLYLLFDEDNPLHKSDNKYIFTTEGHVVPI  573



>ref|XP_010731080.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Larimichthys crocea]
Length=638

 Score =   396 bits (1018),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 219/472 (46%), Positives = 309/472 (65%), Gaps = 28/472 (6%)
 Frame = -1

Query  1791  PNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLP  1615
             P+ + A+ K M+   ++MFY  Y+NYM +AFP DEL P+  +     +    N+ +  + 
Sbjct  110   PDTLKAKMKGMA---KEMFYFGYDNYMKYAFPEDELNPIDCEGRGPDVLNPSNININDVL  166

Query  1614  QKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVS  1435
               YS   LTLI++L +L++LGN TEF++AV  +   +SFD D+ + +FE NIR+LG L+S
Sbjct  167   GNYS---LTLIDTLDTLLVLGNVTEFQRAVKLVIDTVSFDKDSTVQVFEANIRILGSLIS  223

Query  1434  AHILATDSTN---RLVQGTYKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLKRGVMQN  1267
             +HIL TD  +   ++    Y N+LL LA DL  R LPAF +T TG+PY  +NLK GV  +
Sbjct  224   SHILLTDPKHPFGKVGFEGYDNELLHLAHDLAVRLLPAFENTSTGIPYPRVNLKTGVPPD  283

Query  1266  ettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATG  1090
                ET T+G GSL++E G LSRL GD  FE  A RA+R LWS+RS+   LLG  +++ TG
Sbjct  284   SINETCTAGAGSLLVEFGILSRLIGDSTFEWVARRAVRALWSLRSNETGLLGNVVNIQTG  343

Query  1089  EWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----------  940
             +W+   +G+GAG+DSFYEYL+K+YILFG  E ++MFQ+AY ++Q + R G          
Sbjct  344   QWVGKQSGLGAGMDSFYEYLLKSYILFGEKEDYRMFQAAYESIQNHMRRGRESCNEGEGD  403

Query  939   -PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERY  763
              P Y + +M +G+     + SLQAF+PG+QVL GDVD A   H  ++ +WK+FG LPERY
Sbjct  404   PPLYVNVNMFSGEIMNTWIDSLQAFFPGLQVLNGDVDNAICLHAFYYAIWKRFGALPERY  463

Query  762   LLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASV  583
               + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +  KV+ G+A++
Sbjct  464   --NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKNAKVRCGYATL  521

Query  582   RDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV  436
               V     ED   SFFL+ETCKYLYLLFD+   ++R+   YIFTTEGH +P+
Sbjct  522   HHVVDKSKEDRMESFFLSETCKYLYLLFDEDNPLHRSDNKYIFTTEGHVVPI  573



>gb|ELR56083.1| ER degradation-enhancing alpha-mannosidase-like 1, partial [Bos 
mutus]
Length=548

 Score =   393 bits (1009),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 223/492 (45%), Positives = 304/492 (62%), Gaps = 30/492 (6%)
 Frame = -1

Query  1770  RKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSA  1594
             R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL +  +   YS   
Sbjct  18    RAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRRDPSNLNINDVLGNYS---  74

Query  1593  LTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATD  1414
             LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TD
Sbjct  75    LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDRDSTVQVFEATIRVLGSLLSAHRIITD  134

Query  1413  STNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetst  1246
             S       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK GV  +   ET T
Sbjct  135   SKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCT  194

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFST  1069
             +G GSL++E G LSRL GD  FE  A RA++ LWS+RSS   LLG  +++ TG W+   +
Sbjct  195   AGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWSLRSSDTGLLGNVVNIQTGHWVGKQS  254

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDA  922
             G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y + 
Sbjct  255   GLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLYVNV  314

Query  921   DMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQML  742
             +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+ 
Sbjct  315   NMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQ  372

Query  741   HPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTME  562
              P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++  V    
Sbjct  373   APDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKS  432

Query  561   LEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV-----LSTWHDRLSE  406
              ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V      S W +  SE
Sbjct  433   KEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISVDEHLRESPWKEFFSE  492

Query  405   AYLPSNWTSFKH  370
                P       H
Sbjct  493   EGGPDQVGKSGH  504



>emb|CDS05465.1| hypothetical protein LRAMOSA07993 [Absidia idahoensis var. thermophila]
Length=575

 Score =   394 bits (1011),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 216/457 (47%), Positives = 296/457 (65%), Gaps = 15/457 (3%)
 Frame = -1

Query  1740  MFYHAYENYMMHAFPHDELKPL--TKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSS  1567
             MF+H ++NY+  A+P DEL P+      +D L    N+ +  +   YS   LTL+++L +
Sbjct  1     MFFHGWDNYIRFAYPEDELNPMLCNGRGSDKLRP-DNININDILGDYS---LTLVDTLDT  56

Query  1566  LVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGT  1387
             L ++G   EFEKAV  +   +SF  D ++ +FE NIR LGGL+SAHILA+D +       
Sbjct  57    LAVMGEQKEFEKAVRRVIDQVSFHQDNKVQIFELNIRALGGLLSAHILASDPSLGHTIAG  116

Query  1386  YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGA  1210
             Y  +LL LA+DL  R +PAF  T TG+P+  +NLK GV + ET ET T+G GSL+LE G 
Sbjct  117   YNGELLSLAQDLADRLMPAFQYTKTGIPFPRVNLKYGVPKTETVETCTAGAGSLLLEFGV  176

Query  1209  LSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYL  1030
             LSRLTG+P +E  A RAL  LW+ RS LNLLG  +++ TG+WI  ++  GAG+DS++EYL
Sbjct  177   LSRLTGNPHYEEVAKRALHALWNRRSDLNLLGNVINIQTGQWIHTASSTGAGIDSYFEYL  236

Query  1029  VKAYILFGGDEFWKMFQSAYLAVQKYFR--HGPWYHDADMRTGKATYWQLTSLQAFWPGV  856
             +KAY+LFG  E+ +MF+ +Y A+ ++ R   G  Y +  M TG      + SL AFWPGV
Sbjct  237   LKAYVLFGDPEYLEMFEESYEAIMQHVRDPSGYLYRNVHMSTGALMATWIDSLSAFWPGV  296

Query  855   QVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQ  676
             QVL GD+DAA   H  F+++W+K+  LPER+    + +     +YPLRPEF EST+YLY+
Sbjct  297   QVLYGDLDAAVKGHLVFYNIWQKYHALPERFDFYRKTVDI--GFYPLRPEFIESTYYLYR  354

Query  675   ATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFD  496
             AT+DP+Y+ VGE++I  LN  T++  GFAS+ DV T  LED   SF L+ET KYLYLLFD
Sbjct  355   ATRDPFYLHVGEMVIEDLNNRTRLPCGFASIGDVRTGRLEDRMESFLLSETLKYLYLLFD  414

Query  495   DSFLVN---RNYIFTTEGHPLPVLSTWHDRLSEAYLP  394
                  N    N++FTTEGH LP L+T H   S    P
Sbjct  415   TDNEFNAMDSNFVFTTEGHFLP-LATHHLTTSNTSYP  450



>ref|XP_005881984.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1, partial [Myotis brandtii]
Length=525

 Score =   392 bits (1007),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 235/521 (45%), Positives = 318/521 (61%), Gaps = 41/521 (8%)
 Frame = -1

Query  1749  VRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSALTLIESL  1573
              R MF   Y+NYM HAFP DEL P+          +  NL +  +   YS   LTL+++L
Sbjct  3     ARGMFVFGYDNYMAHAFPQDELNPIDCGGRGPDRGDPSNLNINDVLGNYS---LTLVDAL  59

Query  1572  SSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQ  1393
              +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TDS      
Sbjct  60    DTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSKQPFGD  119

Query  1392  GT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLKRGVMQNettetstSGCGSLI  1225
              T   Y N+LL +A DL  R LPAF +T TG+PY  +NLK GV  +   ET T+G GSL+
Sbjct  120   MTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCTAGAGSLL  179

Query  1224  LEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFSTGIGAGVD  1048
             +E G LSRL GD  FE  A RA++ LWS+RSS   LLG  +++ TG W+   +G+GAG+D
Sbjct  180   VEFGMLSRLLGDSTFEWVARRAVKALWSLRSSGTGLLGNVVNIQTGHWVGKQSGLGAGLD  239

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDADMRTGKA  901
             SFYEYL+K+YILFG  E   MF +AY ++Q Y R G           P Y + DM +G+ 
Sbjct  240   SFYEYLLKSYILFGEKEDLDMFNAAYHSIQSYLRRGREACNEGEGDPPLYVNVDMFSGRL  299

Query  900   TYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYY  721
                 + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+  P   +Y
Sbjct  300   MNTWMDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQAPDVFFY  357

Query  720   PLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHS  541
             PLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++  V     ED   S
Sbjct  358   PLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKSKEDRMES  417

Query  540   FFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLSTWHDR-LSEAYLPSNWTSFK  373
             FFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V     DR L EA     W  F 
Sbjct  418   FFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHVVSV-----DRHLREA----PWKEFF  468

Query  372   HEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDTR  253
              ++ R RA+  S R   A  L    +  +  S C+ +PD R
Sbjct  469   PDE-RGRAAGSSLRRPAAPDL----KVINSSSNCNRVPDER  504



>ref|XP_008562182.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1, partial [Galeopterus variegatus]
Length=529

 Score =   392 bits (1007),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 225/511 (44%), Positives = 311/511 (61%), Gaps = 37/511 (7%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             ++G  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  19    YNGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  74

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L ++GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  75    NINDVLGNYS---LTLVDALDTLAVMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  131

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  132   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLK  191

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LWS+RS+   LLG  
Sbjct  192   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWSLRSNDTGLLGNV  251

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  252   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREAC  311

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  312   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  371

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  372   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  429

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  430   CGYATLHHVIDKSTEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIVSV--  487

Query  429   TWHDRLSEAYLPSNWTSFKHEKHRKRASAMS  337
                    E    S W  F  E+ R+     S
Sbjct  488   ------DEHLRESPWKEFFSEEGRQDREGKS  512



>ref|XP_004903313.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1-like, partial [Heterocephalus glaber]
Length=570

 Score =   393 bits (1010),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 233/541 (43%), Positives = 325/541 (60%), Gaps = 44/541 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  31    YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  86

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  87    NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  143

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  144   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLK  203

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  204   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  263

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  264   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLQMFNAAYQSIQNYLRRGREAC  323

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  324   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  383

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  384   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  441

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   ++++   Y+FTTEGH L V  
Sbjct  442   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPIHKSGTRYMFTTEGHVLSV--  499

Query  429   TWHDRLSEAYLPSNWTS-FKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDT  256
                 RL E    S W   F  ++ +++      R       S E +  +  S C+ +PD 
Sbjct  500   --DKRLRE----SPWKEFFSEDEEQEQQGKFVHR-----PKSQELKVINSSSNCNRVPDE  548

Query  255   R  253
             R
Sbjct  549   R  549



>gb|KFO32430.1| ER degradation-enhancing alpha-mannosidase-like 1 [Fukomys damarensis]
Length=528

 Score =   392 bits (1006),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 222/489 (45%), Positives = 303/489 (62%), Gaps = 30/489 (6%)
 Frame = -1

Query  1761  MSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSALTL  1585
             M    R MF   Y+NYM HAFP DEL P+  +     L +  NL +  +   YS   LTL
Sbjct  1     MRDLARGMFVFGYDNYMAHAFPQDELNPIYCRGRGPDLGDPSNLNINDVLGNYS---LTL  57

Query  1584  IESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTN  1405
             +++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TDS  
Sbjct  58    VDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSKQ  117

Query  1404  RLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetstSGC  1237
                  T   Y N+LL LA DL  R LPAF+ T TG+PY  +NLK GV  +   ET T+G 
Sbjct  118   PFGDMTIKDYDNELLHLAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCTAGA  177

Query  1236  GSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFSTGIG  1060
             GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  +++ TG W+   +G+G
Sbjct  178   GSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWVGKQSGLG  237

Query  1059  AGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDADMR  913
             AG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y + +M 
Sbjct  238   AGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLYVNVNMF  297

Query  912   TGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPT  733
             +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+  P 
Sbjct  298   SGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQAPD  355

Query  732   EKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELED  553
               +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++  V     ED
Sbjct  356   VLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKSKED  415

Query  552   HQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV-----LSTWHDRLSEAYL  397
                SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V      S W +  SE   
Sbjct  416   RMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISVDKHLRESPWKEFFSEDEE  475

Query  396   PSNWTSFKH  370
                   F H
Sbjct  476   QEQQGKFVH  484



>ref|XP_002435164.1| alpha-mannosidase, putative [Ixodes scapularis]
 gb|EEC07988.1| alpha-mannosidase, putative [Ixodes scapularis]
Length=582

 Score =   394 bits (1011),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 215/466 (46%), Positives = 296/466 (64%), Gaps = 25/466 (5%)
 Frame = -1

Query  1770  RKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKT-YTDSLSELGNLKLEHLPQKYSGSA  1594
             R  M+Q+ + MF  AY++YM +AFP DEL P+  T       +  N+ +  +   YS   
Sbjct  47    RLEMAQEAKLMFEFAYDSYMKYAFPKDELNPIYCTGRGPDYDDPSNININDVLGDYS---  103

Query  1593  LTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATD  1414
             LTL+++L +L ++ N TEF++AV  +  N+SFD D  I +FE NIR+LG L+SAH+L TD
Sbjct  104   LTLVDALDTLAVMRNVTEFKRAVQLVLDNVSFDKDNVIQVFEANIRLLGALLSAHLLITD  163

Query  1413  STN---RLVQGTYKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLKRGVMQNettetst  1246
                    L    YK+ LL L+ DL  R LPAF +T TG+PY  +NL+ GV    +T T T
Sbjct  164   EEQPFGDLRPDGYKDDLLRLSNDLATRLLPAFKNTRTGIPYPRVNLRTGVPPGVSTHTCT  223

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFST  1069
             +G GSL+LE G LSRL G+ +FE  A RA R LW +R+    LLG  +DV TGEWI   +
Sbjct  224   AGAGSLLLEFGVLSRLVGNKVFETVARRATRALWDLRAKDTGLLGNIVDVNTGEWIGKMS  283

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDA  922
             GIGAG+DSFYEYL+K YILFG  E ++MF  +Y  +++Y R G           P Y + 
Sbjct  284   GIGAGLDSFYEYLLKTYILFGDVEDFRMFNESYSLIKQYMRKGRLLCNEGRGDHPLYVNV  343

Query  921   DMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQML  742
             +M  G  +   + SLQA + G+QVL+GD++ A  SH  F+ +W++FG LPER+  + Q +
Sbjct  344   NMHDGSTSTLWIDSLQASFSGIQVLMGDIEEAICSHALFYAIWRRFGALPERF--NWQKV  401

Query  741   HPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTME  562
              P   +YPLRPE  EST+ LY+ATK+P+Y+ VG  I+ SLN +TK   G+A++ +V    
Sbjct  402   SPDLAFYPLRPELIESTYLLYRATKNPFYLHVGRDILQSLNNFTKADCGYATIHNVQDKS  461

Query  561   LEDHQHSFFLAETCKYLYLLFDDSFLVNR---NYIFTTEGHPLPVL  433
             LED   SFFL+ETCKYLYLLFD    VN+    Y+FTTEGH LP++
Sbjct  462   LEDRMESFFLSETCKYLYLLFDTDNPVNKRFAKYVFTTEGHILPII  507



>gb|ELW70358.1| ER degradation-enhancing alpha-mannosidase-like 1 [Tupaia chinensis]
Length=564

 Score =   393 bits (1009),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 221/484 (46%), Positives = 303/484 (63%), Gaps = 30/484 (6%)
 Frame = -1

Query  1770  RKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSA  1594
             R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL +  +   YS   
Sbjct  34    RAQMRDLARGMFVFGYDNYMAHAFPQDELNPIYCRGRGPDRGDPSNLNINDVLGNYS---  90

Query  1593  LTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATD  1414
             LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TD
Sbjct  91    LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDRDSTVQVFEATIRVLGSLLSAHRIITD  150

Query  1413  STNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetst  1246
             S       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK GV  +   ET T
Sbjct  151   SKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCT  210

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFST  1069
             +G GSL++E G LSRL GD  FE  A RA++ LWS+RS+   LLG  +++ TG W+   +
Sbjct  211   AGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWSLRSNDTGLLGNVVNIQTGRWVGKQS  270

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDA  922
             G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y + 
Sbjct  271   GLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLYVNV  330

Query  921   DMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQML  742
             +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+ 
Sbjct  331   NMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQ  388

Query  741   HPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTME  562
              P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++  V    
Sbjct  389   APDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKS  448

Query  561   LEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV-----LSTWHDRLSE  406
              ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V      S W +  SE
Sbjct  449   KEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIVSVDEHLRESPWKEFFSE  508

Query  405   AYLP  394
                P
Sbjct  509   EGGP  512



>ref|XP_010936136.1| PREDICTED: probable alpha-mannosidase I MNS4 isoform X2 [Elaeis 
guineensis]
Length=611

 Score =   394 bits (1013),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 213/479 (44%), Positives = 292/479 (61%), Gaps = 44/479 (9%)
 Frame = -1

Query  1833  LSTFFPMSFSGFDPPNPMA-----ARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTK  1669
             ++ +F ++F+   P   +A     +  K++  +VR+MFYHA++ YM HAFP DEL+PL+ 
Sbjct  5     VAVYFLIAFAAVCPLGALADGVSPSEAKQLRDEVREMFYHAFDGYMHHAFPLDELRPLSC  64

Query  1668  TYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVD  1489
                D+L                G ALTLI+SL +L +LG+   F  AV W+  N+ FD+D
Sbjct  65    KGEDTLG---------------GYALTLIDSLDTLALLGDRERFSAAVEWVGKNVRFDID  109

Query  1488  ARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGL  1309
               +++FE  IRVLGGL+SAH++A+D    L   +Y +QLL LA DL  R LPAFDTPTG+
Sbjct  110   KTVSVFETTIRVLGGLLSAHLMASDYATGLKIQSYDDQLLHLAVDLATRLLPAFDTPTGI  169

Query  1308  PYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS  1129
             P+  +NL RGV +NE+  TST+G G+L LE G LS LT +PIFE     A+R +W+ RS 
Sbjct  170   PFGSVNLVRGVDENESKITSTAGGGTLTLEFGVLSHLTNNPIFEQVTKNAVRGIWARRSK  229

Query  1128  LNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYF  949
             +NL+G  ++V TGEW +   GIG  +DSFYEYL+K                AY A   Y 
Sbjct  230   INLVGAHINVFTGEWTQKDAGIGTSIDSFYEYLLK---------------EAYKAAMHYL  274

Query  948   RHGPWYHDADMRTGKATYWQL-TSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLP  772
              H PWY + +M +  AT W L  SLQAFWPG+QVL GD+D A  +H  FF VWKK+G  P
Sbjct  275   HHDPWYVEVNMNSA-ATVWPLFNSLQAFWPGLQVLAGDIDPAVRTHAAFFSVWKKYGFTP  333

Query  771   ERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGF  592
             E + L        +K YPLRPE  EST++L++AT+DP Y++ G   + S+    +   G+
Sbjct  334   EGFNLATLNAQSGQKSYPLRPELMESTYWLFKATRDPRYLDAGRDFVTSIQYGARCPCGY  393

Query  591   ASVRDVTTMELEDHQHSFFLAETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
               + DV + + +DH  SFFLAET KYL+LLFD     D+ + N    YIF+TEGH LP 
Sbjct  394   CHIADVESHKQDDHMESFFLAETVKYLWLLFDLAVGPDNIVENGPYKYIFSTEGHLLPA  452



>ref|XP_005522018.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Pseudopodoces humilis]
Length=605

 Score =   394 bits (1012),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 227/515 (44%), Positives = 313/515 (61%), Gaps = 29/515 (6%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R R+    R MF   Y++YM HAFP DEL PL  +       +  NL
Sbjct  72    YSGAFPPQ----LRARLRDAARGMFVFGYDSYMEHAFPRDELDPLHCRGRGPDRRDPSNL  127

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTLI++L +L ++GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  128   NINDVLGNYS---LTLIDALDTLAVMGNSSEFQKAVKLVIDTVSFDKDSTVQVFEATIRV  184

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAHI+ TD+       T   Y N+LL LA DL  R LPAF+ T TG+PY  +NLK
Sbjct  185   LGSLLSAHIIITDTKQPFGDMTIKDYDNELLHLAHDLAVRLLPAFENTKTGIPYPRVNLK  244

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
             +GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LWS+RS+   LLG  
Sbjct  245   KGVPPDSHNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWSLRSNNTGLLGNV  304

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG DSFYEYL+K+YILFG  E  +MF +AY  +Q + R G    
Sbjct  305   VNIQTGHWVGKQSGLGAGSDSFYEYLLKSYILFGEKEDLEMFNAAYQNIQNHLRRGREAC  364

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M TG+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  365   NEGEGDPPLYVNVNMYTGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  424

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTK +
Sbjct  425   ALPERY--NWQLQAPDVPFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKAK  482

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   ++FTTEGH + V  
Sbjct  483   CGYATLHHVVEKTKEDRMESFFLSETCKYLYLLFDEENPVHKSGNKFMFTTEGHIVSVDE  542

Query  429   TWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRIC  325
              + + L E  LP    S    K  +  +A     C
Sbjct  543   RFRNSLWEDILPGQEDSAHKTKPTELKAANFSSNC  577



>dbj|BAC29890.1| unnamed protein product [Mus musculus]
 gb|EDK99416.1| ER degradation enhancer, mannosidase alpha-like 1, isoform CRA_b 
[Mus musculus]
Length=539

 Score =   392 bits (1006),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 223/518 (43%), Positives = 315/518 (61%), Gaps = 29/518 (6%)
 Frame = -1

Query  1806  SGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLK  1630
             SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL 
Sbjct  1     SGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIYCRGRGPDRGDPSNLN  56

Query  1629  LEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVL  1450
             +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVL
Sbjct  57    INDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVL  113

Query  1449  GGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKR  1282
             G L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK 
Sbjct  114   GSLLSAHRIITDSKQPFGDMTIEDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLKT  173

Query  1281  GVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTL  1105
             GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  +
Sbjct  174   GVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVV  233

Query  1104  DVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----  940
             ++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G     
Sbjct  234   NIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQSYLRRGREACN  293

Query  939   ------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGV  778
                   P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G 
Sbjct  294   EGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGA  353

Query  777   LPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQG  598
             LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ 
Sbjct  354   LPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKC  411

Query  597   GFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLST  427
             G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V   
Sbjct  412   GYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISVDKR  471

Query  426   WHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATT  313
               +   + +   +    + EK   R  +   R+  +++
Sbjct  472   LRELPWKEFFSEDGERDQEEKFVHRPKSQELRVINSSS  509



>ref|XP_005981151.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Pantholops hodgsonii]
Length=528

 Score =   391 bits (1005),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 222/489 (45%), Positives = 302/489 (62%), Gaps = 30/489 (6%)
 Frame = -1

Query  1761  MSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSALTL  1585
             M    R MF   Y+NYM HAFP DEL P+  +       +  NL +  +   YS   LTL
Sbjct  1     MRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYS---LTL  57

Query  1584  IESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTN  1405
             +++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TDS  
Sbjct  58    VDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSKQ  117

Query  1404  RLVQGT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLKRGVMQNettetstSGC  1237
                  T   Y N+LL +A DL  R LPAF +T TG+PY  +NLK GV  +   ET T+G 
Sbjct  118   PFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCTAGA  177

Query  1236  GSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFSTGIG  1060
             GSL++E G LSRL GD  FE  A RA++ LWS+RSS   LLG  +++ TG W+   +G+G
Sbjct  178   GSLLVEFGILSRLLGDSTFEWVARRAVKALWSLRSSDTGLLGNVVNIQTGHWVGKQSGLG  237

Query  1059  AGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDADMR  913
             AG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y + +M 
Sbjct  238   AGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGRESCNEGEGDPPLYVNVNMF  297

Query  912   TGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPT  733
             +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+  P 
Sbjct  298   SGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQAPD  355

Query  732   EKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELED  553
               +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++  V     ED
Sbjct  356   VLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKSKED  415

Query  552   HQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV-----LSTWHDRLSEAYL  397
                SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V      S W +  SE   
Sbjct  416   RMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISVDKHLRESPWKEFFSEEGG  475

Query  396   PSNWTSFKH  370
             P       H
Sbjct  476   PDQVGKSGH  484



>ref|XP_005832283.1| hypothetical protein GUITHDRAFT_157889 [Guillardia theta CCMP2712]
 gb|EKX45303.1| hypothetical protein GUITHDRAFT_157889 [Guillardia theta CCMP2712]
Length=449

 Score =   388 bits (997),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 214/443 (48%), Positives = 293/443 (66%), Gaps = 18/443 (4%)
 Frame = -1

Query  1740  MFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLV  1561
             MFYHAY+NY+MHAFPHDEL PL+ ++ D+               +   ALTL++SL  L 
Sbjct  1     MFYHAYDNYIMHAFPHDELLPLSCSFIDN---------------FGSYALTLVDSLDMLA  45

Query  1560  ILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGTYK  1381
             +LGN TEF +AV  L  +LSFD D ++++FE NIRVLGGL+S+H+LA D   +L+   Y 
Sbjct  46    VLGNRTEFARAVGLLKKHLSFDKDVQVSVFETNIRVLGGLLSSHLLARDPKLKLMD-DYD  104

Query  1380  NQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSR  1201
               LL  A +LG R LPAFDTPTG+PY  INL+ GV   ETT TS++  G+L+LE G LSR
Sbjct  105   GFLLKKALELGERLLPAFDTPTGIPYGTINLRSGVAVGETTITSSACAGTLMLEFGMLSR  164

Query  1200  LTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKA  1021
             L+G   FE  A R+L  LWS RSS+ L+G  LD+ TG+W    +G+G  +DSFYEYL+K+
Sbjct  165   LSGRGEFERVAKRSLLALWSRRSSMGLIGAHLDIMTGQWTHKDSGVGTSIDSFYEYLIKS  224

Query  1020  YILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWPGVQVLVG  841
             YIL+G DEF  +FQ AY + +      PWY D +M + +  +    SLQ+FWP ++V+ G
Sbjct  225   YILYGEDEFLFLFQQAYHSAKALLAKSPWYVDVNMESAQLVWPIYNSLQSFWPAIEVIAG  284

Query  840   DVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDP  661
             ++  A+ +H  F+ VW+++G  PE Y L    +   ++ YPLRPE  EST YLYQAT+DP
Sbjct  285   NLKDASETHSAFYGVWRRYGYTPEGYNLADGRVQQGQRSYPLRPELIESTMYLYQATRDP  344

Query  660   WYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDS-FL  484
              Y++VG  I++SL Q T+V  G A++ DV T  L+D   SFFL+ET KYLYLLF    + 
Sbjct  345   HYVQVGRDILSSLEQ-TRVPCGHAAIEDVETHLLQDKMDSFFLSETLKYLYLLFTPRHWA  403

Query  483   VNRNYIFTTEGHPLPVLSTWHDR  415
             +N +++F+TEGHPLP+     DR
Sbjct  404   LNGSFVFSTEGHPLPLQQLPGDR  426



>ref|XP_008287161.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 isoform X2 [Stegastes partitus]
Length=639

 Score =   395 bits (1014),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 218/472 (46%), Positives = 307/472 (65%), Gaps = 28/472 (6%)
 Frame = -1

Query  1791  PNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLP  1615
             P+ + A+ K M+   ++MFY  Y+NYM +AFP DEL P+  +     +    N+ +  + 
Sbjct  111   PDTLKAKMKDMA---KEMFYFGYDNYMKYAFPEDELNPIDCEGRGPDVLNPSNININDVL  167

Query  1614  QKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVS  1435
               YS   LTLI++L +L++LGN TEF +AV  +   +SFD D+ + +FE NIR+LG L+S
Sbjct  168   GNYS---LTLIDTLDTLLVLGNVTEFHRAVKLVIDTVSFDKDSTVQVFEANIRILGSLIS  224

Query  1434  AHILATDSTNRLVQ---GTYKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLKRGVMQN  1267
             AHIL TD  +   +     Y N+LL LA DL  R LPAF +T TG+PY  +NLK GV  +
Sbjct  225   AHILLTDPKHPFGEVGFDGYDNELLHLAHDLAVRLLPAFENTSTGIPYPRVNLKSGVPPD  284

Query  1266  ettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATG  1090
                ET T+G GSL++E G LSRL GD  FE  A RA+R LW++RS+   LLG  +++ TG
Sbjct  285   SINETCTAGAGSLLVEFGILSRLIGDSTFEWVARRAVRALWNLRSNETGLLGNVVNIQTG  344

Query  1089  EWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----------  940
             +W+   +G+GAG+DSFYEYL+K+YILFG  E ++MFQ+AY ++Q + R G          
Sbjct  345   QWVGKQSGLGAGMDSFYEYLLKSYILFGEKEDYRMFQAAYESIQNHLRRGRESCNEGEGD  404

Query  939   -PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERY  763
              P Y + +M +G+     + SLQAF+PG+QVL GDVD A   H  ++ +WK+FG LPERY
Sbjct  405   PPLYVNVNMFSGEIMNTWIDSLQAFFPGLQVLNGDVDNAICLHAFYYAIWKRFGALPERY  464

Query  762   LLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASV  583
               + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +  KV+ G+A++
Sbjct  465   --NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKNAKVRCGYATL  522

Query  582   RDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV  436
               V     ED   SFFL+ETCKYLYLLFD+   ++++   YIFTTEGH +P+
Sbjct  523   HHVVDKSKEDRMESFFLSETCKYLYLLFDEDNPLHKSDNKYIFTTEGHVVPI  574



>ref|XP_005053435.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1, partial [Ficedula albicollis]
Length=521

 Score =   391 bits (1004),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 221/490 (45%), Positives = 306/490 (62%), Gaps = 29/490 (6%)
 Frame = -1

Query  1749  VRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSALTLIESL  1573
              R MF   Y++YM HAFP DEL PL  +       +  NL +  +   YS   LTLI++L
Sbjct  4     ARGMFVFGYDSYMEHAFPRDELDPLHCRGRGPDRRDPSNLNINDVLGNYS---LTLIDAL  60

Query  1572  SSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQ  1393
              +L ++GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAHI+ TDS      
Sbjct  61    DTLAVMGNSSEFQKAVKLVIDTVSFDKDSTVQVFEATIRVLGSLLSAHIIITDSKQPFGD  120

Query  1392  GT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLKRGVMQNettetstSGCGSLI  1225
              T   Y N+LL LA DL  R LPAF +T TG+PY  +NLK+GV  +   ET T+G GSL+
Sbjct  121   MTIKDYDNELLHLAHDLAVRLLPAFENTKTGIPYPRVNLKKGVPPDSHNETCTAGAGSLL  180

Query  1224  LEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFSTGIGAGVD  1048
             +E G LSRL GD  FE  A RA++ LWS+RS+   LLG  +++ TG W+   +G+GAG D
Sbjct  181   VEFGILSRLLGDSTFEWVARRAVKALWSLRSNNTGLLGNVVNIQTGHWVGKQSGLGAGSD  240

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDADMRTGKA  901
             SFYEYL+K+YILFG  E  +MF +AY  +Q + R G           P Y + +M TG+ 
Sbjct  241   SFYEYLLKSYILFGEKEDLEMFNAAYQNIQNHLRRGREACNEGEGDPPLYVNVNMYTGQL  300

Query  900   TYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYY  721
                 + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+  P   +Y
Sbjct  301   MNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQAPDVPFY  358

Query  720   PLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHS  541
             PLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTK + G+A++  V     ED   S
Sbjct  359   PLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKAKCGYATLHHVVEKTKEDRMES  418

Query  540   FFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLSTWHDRLSEAYLPSNWTSFKH  370
             FFL+ETCKYLYLLFD+   V+++   ++FTTEGH + V   +   L E  LP+   S   
Sbjct  419   FFLSETCKYLYLLFDEENPVHKSGNKFMFTTEGHVVSVDERFRSSLWEDILPAEGDS---  475

Query  369   EKHRKRASAM  340
               H+ +A+ +
Sbjct  476   -SHKTKATEL  484



>ref|XP_008287153.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 isoform X1 [Stegastes partitus]
Length=648

 Score =   395 bits (1014),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 218/472 (46%), Positives = 307/472 (65%), Gaps = 28/472 (6%)
 Frame = -1

Query  1791  PNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLP  1615
             P+ + A+ K M+   ++MFY  Y+NYM +AFP DEL P+  +     +    N+ +  + 
Sbjct  111   PDTLKAKMKDMA---KEMFYFGYDNYMKYAFPEDELNPIDCEGRGPDVLNPSNININDVL  167

Query  1614  QKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVS  1435
               YS   LTLI++L +L++LGN TEF +AV  +   +SFD D+ + +FE NIR+LG L+S
Sbjct  168   GNYS---LTLIDTLDTLLVLGNVTEFHRAVKLVIDTVSFDKDSTVQVFEANIRILGSLIS  224

Query  1434  AHILATDSTNRLVQ---GTYKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLKRGVMQN  1267
             AHIL TD  +   +     Y N+LL LA DL  R LPAF +T TG+PY  +NLK GV  +
Sbjct  225   AHILLTDPKHPFGEVGFDGYDNELLHLAHDLAVRLLPAFENTSTGIPYPRVNLKSGVPPD  284

Query  1266  ettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATG  1090
                ET T+G GSL++E G LSRL GD  FE  A RA+R LW++RS+   LLG  +++ TG
Sbjct  285   SINETCTAGAGSLLVEFGILSRLIGDSTFEWVARRAVRALWNLRSNETGLLGNVVNIQTG  344

Query  1089  EWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----------  940
             +W+   +G+GAG+DSFYEYL+K+YILFG  E ++MFQ+AY ++Q + R G          
Sbjct  345   QWVGKQSGLGAGMDSFYEYLLKSYILFGEKEDYRMFQAAYESIQNHLRRGRESCNEGEGD  404

Query  939   -PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERY  763
              P Y + +M +G+     + SLQAF+PG+QVL GDVD A   H  ++ +WK+FG LPERY
Sbjct  405   PPLYVNVNMFSGEIMNTWIDSLQAFFPGLQVLNGDVDNAICLHAFYYAIWKRFGALPERY  464

Query  762   LLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASV  583
               + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +  KV+ G+A++
Sbjct  465   --NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKNAKVRCGYATL  522

Query  582   RDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV  436
               V     ED   SFFL+ETCKYLYLLFD+   ++++   YIFTTEGH +P+
Sbjct  523   HHVVDKSKEDRMESFFLSETCKYLYLLFDEDNPLHKSDNKYIFTTEGHVVPI  574



>ref|XP_006143111.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1, partial [Tupaia chinensis]
Length=560

 Score =   392 bits (1006),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 221/484 (46%), Positives = 303/484 (63%), Gaps = 30/484 (6%)
 Frame = -1

Query  1770  RKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSA  1594
             R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL +  +   YS   
Sbjct  30    RAQMRDLARGMFVFGYDNYMAHAFPQDELNPIYCRGRGPDRGDPSNLNINDVLGNYS---  86

Query  1593  LTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATD  1414
             LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TD
Sbjct  87    LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDRDSTVQVFEATIRVLGSLLSAHRIITD  146

Query  1413  STNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetst  1246
             S       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK GV  +   ET T
Sbjct  147   SKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCT  206

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFST  1069
             +G GSL++E G LSRL GD  FE  A RA++ LWS+RS+   LLG  +++ TG W+   +
Sbjct  207   AGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWSLRSNDTGLLGNVVNIQTGRWVGKQS  266

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDA  922
             G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y + 
Sbjct  267   GLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLYVNV  326

Query  921   DMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQML  742
             +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+ 
Sbjct  327   NMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQ  384

Query  741   HPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTME  562
              P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++  V    
Sbjct  385   APDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKS  444

Query  561   LEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV-----LSTWHDRLSE  406
              ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V      S W +  SE
Sbjct  445   KEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIVSVDEHLRESPWKEFFSE  504

Query  405   AYLP  394
                P
Sbjct  505   EGGP  508



>gb|EEE55466.1| hypothetical protein OsJ_03634 [Oryza sativa Japonica Group]
Length=653

 Score =   395 bits (1014),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 211/462 (46%), Positives = 282/462 (61%), Gaps = 49/462 (11%)
 Frame = -1

Query  1797  DPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHL  1618
             D   P  ARR R   +V+ MFYHA++ YM HAFP DEL+PL+    DSL           
Sbjct  38    DGVTPSEARRLR--DEVKDMFYHAFDGYMQHAFPLDELRPLSCQGEDSLG----------  85

Query  1617  PQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLV  1438
                  G ALTLI+SL +L +LG+   F+ AV W+  N+ FD++  +++FE NIR+LGGL+
Sbjct  86    -----GYALTLIDSLDTLALLGDKERFDAAVEWVGKNVRFDINKTVSVFETNIRILGGLL  140

Query  1437  SAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNett  1258
             SAH++A+D    +   +Y +QLL LA DL +R LPAFDTPT                   
Sbjct  141   SAHLIASDYATGMRIQSYDDQLLHLAADLAQRLLPAFDTPTA------------------  182

Query  1257  etstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIE  1078
                  G G+L LE G LSRLT D ++E     ++R +W+ RS L+L+G  ++V TGEW +
Sbjct  183   -----GGGTLTLEFGVLSRLTNDSVYERVTKNSVRGIWARRSKLDLVGAHINVFTGEWTQ  237

Query  1077  FSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKAT  898
                GIG  +DSFYEYL+KAY+LFG +E+  +FQ AY A   Y  H PWY + +M +G AT
Sbjct  238   KDAGIGTSIDSFYEYLLKAYLLFGDEEYLYIFQEAYKAAMHYLHHDPWYVEVNMNSG-AT  296

Query  897   YWQL-TSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYY  721
              W L  SLQAFWPG+QVL GDVD A  +H  FF VWKK+G  PE + L    +   ++ Y
Sbjct  297   VWPLFNSLQAFWPGLQVLAGDVDPAIRTHAAFFSVWKKYGFTPEGFNLATSTVQNGQRSY  356

Query  720   PLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHS  541
             PLRPE  EST++L++AT+D  Y++VG  I+ SL    K   G+  + DV T + +DH  S
Sbjct  357   PLRPELIESTYWLFKATRDYRYLDVGRDILASLQYGAKCPCGYCHISDVETHQQDDHMES  416

Query  540   FFLAETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             FFLAET KYL+LLFD     D+ + N    YIF+TEGH LP 
Sbjct  417   FFLAETVKYLWLLFDLAAGPDNIVENGPYKYIFSTEGHLLPA  458



>ref|XP_005288571.1| PREDICTED: LOW QUALITY PROTEIN: ER degradation-enhancing alpha-mannosidase-like 
protein 1 [Chrysemys picta bellii]
Length=624

 Score =   394 bits (1012),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 221/492 (45%), Positives = 308/492 (63%), Gaps = 29/492 (6%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R ++    R MF   Y+NYM HAFP DEL P+  +      ++  NL
Sbjct  90    YSGAFPPQ----LRAQLRDAARGMFVFGYDNYMRHAFPQDELNPVHCRGRGPDRADPSNL  145

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTLI++L +L ++GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  146   NINDVLGNYS---LTLIDALDTLAVMGNSSEFQKAVKLVIDTVSFDKDSTVQVFEATIRV  202

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAHI+ TD+       T   Y ++LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  203   LGSLLSAHIIITDTKQPFGDMTIKDYDDELLHMARDLAVRLLPAFENTKTGIPYPRVNLK  262

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LWS+RS+   LLG  
Sbjct  263   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWSLRSNDTGLLGNV  322

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF  AY ++Q Y R G    
Sbjct  323   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGKKEDLEMFNDAYRSIQNYLRRGREAC  382

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  383   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  442

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  443   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  500

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  501   CGYATLHHVIEKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGNKYMFTTEGHIVSVDK  560

Query  429   TWHDRLSEAYLP  394
              + D L +   P
Sbjct  561   RFRDSLWQDTFP  572



>ref|XP_004738745.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1, partial [Mustela putorius furo]
Length=565

 Score =   392 bits (1007),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 223/493 (45%), Positives = 307/493 (62%), Gaps = 34/493 (7%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  26    YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  81

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  82    NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVIDTVSFDKDSTVQVFEATIRV  138

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF +T TG+PY  +NLK
Sbjct  139   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLK  198

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  199   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  258

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  259   VNIQTGRWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYRSIQNYLRRGREAC  318

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  319   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  378

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  379   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  436

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV--  436
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  437   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTKYMFTTEGHIVSVDK  496

Query  435   ---LSTWHDRLSE  406
                 S W +  SE
Sbjct  497   HLRESPWKEFFSE  509



>ref|XP_010717069.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Meleagris gallopavo]
Length=584

 Score =   392 bits (1008),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 222/494 (45%), Positives = 304/494 (62%), Gaps = 25/494 (5%)
 Frame = -1

Query  1785  PMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQK  1609
             P    R R+    R MF   Y++YM HAFP DEL PL          +  NL +  +   
Sbjct  55    PRFPPRARLRDAARGMFAFGYDSYMQHAFPSDELDPLHCCGRGPDRDDPSNLNINDVLGN  114

Query  1608  YSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAH  1429
             YS   LTLI++L +L ++GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH
Sbjct  115   YS---LTLIDALDTLAVMGNSSEFQKAVKLVIDTVSFDKDSTVQVFEATIRVLGSLLSAH  171

Query  1428  ILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLKRGVMQNet  1261
             I+ TD+       T   Y N+LL +A DL  R LPAF +T TG+PY  +NLK+GV  N  
Sbjct  172   IIITDAKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKKGVPPNSN  231

Query  1260  tetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEW  1084
              ET T+G GSL++E G LSRL GD  FE  A RA++ LWS+RS+   LLG  +++ TG W
Sbjct  232   NETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWSLRSNNTGLLGNVVNIQTGHW  291

Query  1083  IEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------P  937
             +   +G+GAG DSFYEYL+K+YILFG  E  +MF  AY  +Q + R G           P
Sbjct  292   VGKQSGLGAGSDSFYEYLLKSYILFGEKEDLEMFIDAYQNIQNHLRRGREACNEGEGDPP  351

Query  936   WYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLL  757
              Y + +M TG+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  
Sbjct  352   LYVNVNMFTGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--  409

Query  756   DHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRD  577
             + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTK + G+A++  
Sbjct  410   NWQLQAPDVPFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKAKCGYATLHH  469

Query  576   VTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLSTWHDRLSE  406
             V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V   + + L +
Sbjct  470   VVEKTKEDRMESFFLSETCKYLYLLFDEDNPVHKSGNKYMFTTEGHIVSVDERFRNSLWQ  529

Query  405   AYLPSNWTSFKHEK  364
               LP    S +  K
Sbjct  530   DILPGEEDSTEKVK  543



>gb|EEC71566.1| hypothetical protein OsI_03924 [Oryza sativa Indica Group]
Length=640

 Score =   394 bits (1013),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 211/462 (46%), Positives = 282/462 (61%), Gaps = 49/462 (11%)
 Frame = -1

Query  1797  DPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHL  1618
             D   P  ARR R   +V+ MFYHA++ YM HAFP DEL+PL+    DSL           
Sbjct  38    DGVTPSEARRLR--DEVKDMFYHAFDGYMQHAFPLDELRPLSCQGEDSLG----------  85

Query  1617  PQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLV  1438
                  G ALTLI+SL +L +LG+   F+ AV W+  N+ FD++  +++FE NIR+LGGL+
Sbjct  86    -----GYALTLIDSLDTLALLGDKERFDAAVEWVGKNVRFDINKTVSVFETNIRILGGLL  140

Query  1437  SAHILATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNett  1258
             SAH++A+D    +   +Y +QLL LA DL +R LPAFDTPT                   
Sbjct  141   SAHLIASDYATGMRIQSYDDQLLHLAADLAQRLLPAFDTPTA------------------  182

Query  1257  etstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIE  1078
                  G G+L LE G LSRLT D ++E     ++R +W+ RS L+L+G  ++V TGEW +
Sbjct  183   -----GGGTLTLEFGVLSRLTNDSVYERVTKNSVRGIWARRSKLDLVGAHINVFTGEWTQ  237

Query  1077  FSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKAT  898
                GIG  +DSFYEYL+KAY+LFG +E+  +FQ AY A   Y  H PWY + +M +G AT
Sbjct  238   KDAGIGTSIDSFYEYLLKAYLLFGDEEYLYIFQEAYKAAMHYLHHDPWYVEVNMNSG-AT  296

Query  897   YWQL-TSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYY  721
              W L  SLQAFWPG+QVL GDVD A  +H  FF VWKK+G  PE + L    +   ++ Y
Sbjct  297   VWPLFNSLQAFWPGLQVLAGDVDPAIRTHAAFFSVWKKYGFTPEGFNLATSTVQNGQRSY  356

Query  720   PLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHS  541
             PLRPE  EST++L++AT+D  Y++VG  I+ SL    K   G+  + DV T + +DH  S
Sbjct  357   PLRPELIESTYWLFKATRDYRYLDVGRDILASLQYGAKCPCGYCHISDVETHQQDDHMES  416

Query  540   FFLAETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             FFLAET KYL+LLFD     D+ + N    YIF+TEGH LP 
Sbjct  417   FFLAETVKYLWLLFDLAAGPDNIVENGPYKYIFSTEGHLLPA  458



>ref|XP_008573947.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Galeopterus variegatus]
Length=657

 Score =   395 bits (1014),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 233/540 (43%), Positives = 323/540 (60%), Gaps = 42/540 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             ++G  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  118   YNGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  173

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L ++GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  174   NINDVLGNYS---LTLVDALDTLAVMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  230

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  231   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLK  290

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LWS+RS+   LLG  
Sbjct  291   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWSLRSNDTGLLGNV  350

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  351   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREAC  410

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  411   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  470

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  471   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  528

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  529   CGYATLHHVIDKSTEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIVSV--  586

Query  429   TWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDTR  253
                    E    S W  F  E+ R+     S         SHE +  +  S C+ +PD R
Sbjct  587   ------DEHLRESPWKEFFSEEGRQDREGKSVH----RPKSHELKVINSSSNCNRVPDER  636



>ref|XP_003927217.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1, partial [Saimiri boliviensis boliviensis]
Length=580

 Score =   392 bits (1007),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 235/541 (43%), Positives = 327/541 (60%), Gaps = 44/541 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  41    YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  96

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  97    NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  153

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF +T TG+PY  +NLK
Sbjct  154   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLK  213

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  214   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  273

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSF+EYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  274   VNIQTGHWVGKQSGLGAGLDSFFEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREAC  333

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  334   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  393

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  394   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  451

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  452   CGYATLHHVIDKSTEDRMESFFLSETCKYLYLLFDEDNPVHKSGTRYMFTTEGHIISV--  509

Query  429   TWHDRLSEAYLPSNWTSFKHEKHRKRASAMS-QRICPATTLSHEQEYQHLESACH-IPDT  256
                + L E  LP  W  F  E+  +     S  R+ P     HE +  +  S C+ +PD 
Sbjct  510   --DEHLRE--LP--WKEFFSEEGGQDQEGKSVHRLKP-----HELKVINSSSNCNRVPDE  558

Query  255   R  253
             R
Sbjct  559   R  559



>ref|XP_010571461.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1, partial [Haliaeetus leucocephalus]
Length=566

 Score =   392 bits (1006),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 231/540 (43%), Positives = 322/540 (60%), Gaps = 48/540 (9%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R R+    R MF   Y++YM HAFP DEL PL  +       +  NL
Sbjct  33    YSGAFPPQ----LRARLRDAARGMFVFGYDSYMRHAFPRDELDPLHCRGRGPDRHDPSNL  88

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTLI++L +L ++GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  89    NINDVLGNYS---LTLIDALDTLAVMGNSSEFQKAVKLVIDTVSFDKDSTVQVFEATIRV  145

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLK  1285
             LG L+SAHI+ TD+       T   Y N+LL +A DL  R LPAF +T TG+PY  +NLK
Sbjct  146   LGSLLSAHIIITDTKQPFGDMTIKDYDNELLHMARDLAVRLLPAFENTKTGIPYPRVNLK  205

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LWS+RS+   LLG  
Sbjct  206   NGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWSLRSNNTGLLGNV  265

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG DSFYEYL+K+YILFG  E  +MF  AY  +Q + R G    
Sbjct  266   VNIQTGHWVGKQSGLGAGSDSFYEYLLKSYILFGEKEDLEMFNDAYRNIQNHLRRGREAC  325

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M TG+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  326   NEGEGDPPLYVNVNMFTGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  385

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTK +
Sbjct  386   ALPERY--NWQLQAPDVPFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKAK  443

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  444   CGYATLHHVVEKTKEDRMESFFLSETCKYLYLLFDEENPVHKSGNKYMFTTEGHIVSVDE  503

Query  429   TWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDTR  253
              + + L +  LP    S             +++I P     +E +  +  S C+ +PD R
Sbjct  504   RFRNSLWQDILPGEEDS-------------AEKIKP-----NELKAVNFSSNCNRVPDER  545



>ref|XP_004629594.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Octodon degus]
Length=528

 Score =   390 bits (1002),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 229/529 (43%), Positives = 314/529 (59%), Gaps = 48/529 (9%)
 Frame = -1

Query  1761  MSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSALTL  1585
             M    R MF   Y+NYM HAFP DEL P+  +       +  NL +  +   YS   LTL
Sbjct  1     MRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYS---LTL  57

Query  1584  IESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTN  1405
             +++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH +  DS  
Sbjct  58    VDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIIIDSKQ  117

Query  1404  RLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetstSGC  1237
                  T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK GV  +   ET T+G 
Sbjct  118   PFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCTAGA  177

Query  1236  GSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFSTGIG  1060
             GSL++E G LSRL GDP FE  A RA++ LW++RS+   LLG  +++ TG WI   +G+G
Sbjct  178   GSLLVEFGILSRLLGDPTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWIGKQSGLG  237

Query  1059  AGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDADMR  913
             AG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y + +M 
Sbjct  238   AGLDSFYEYLLKSYILFGEREDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLYVNVNMF  297

Query  912   TGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPT  733
             +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+  P 
Sbjct  298   SGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQAPD  355

Query  732   EKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELED  553
               +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++  V     ED
Sbjct  356   VLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKSKED  415

Query  552   HQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV-----LSTWHDRLSEAYL  397
                SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V      S W +  SE   
Sbjct  416   RMESFFLSETCKYLYLLFDEENPVHQSGTRYMFTTEGHIISVDKHLRESPWKEFFSEDEG  475

Query  396   PSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDTR  253
                   F H                    SHE +  +  S C+ +PD R
Sbjct  476   QDQQGKFVHRPK-----------------SHELKVINSSSNCNRVPDER  507



>ref|XP_006630750.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1-like [Lepisosteus oculatus]
Length=637

 Score =   394 bits (1011),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 221/490 (45%), Positives = 310/490 (63%), Gaps = 28/490 (6%)
 Frame = -1

Query  1791  PNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLP  1615
             P  + A+ K M+   ++MFY  YENYM +AFP DEL P+  +     +    N+ +  + 
Sbjct  110   PETLKAKMKGMA---KEMFYFGYENYMKYAFPKDELNPIDCQGRGPDVLNPSNININDVL  166

Query  1614  QKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVS  1435
               YS   LTLI++L +L++LGN +EF +AV  +   +SFD D+ + +FE NIR+LG L+S
Sbjct  167   GNYS---LTLIDTLDTLLVLGNVSEFHRAVKLVIDTVSFDKDSTVQVFEANIRILGSLIS  223

Query  1434  AHILATDSTN---RLVQGTYKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLKRGVMQN  1267
             AHIL TDS      +    Y N+LL LA DL  R LPAF +T TG+PY  +NLK GV  N
Sbjct  224   AHILLTDSKQPFGNIGLVDYDNELLHLARDLAVRLLPAFENTSTGIPYPRVNLKNGVPPN  283

Query  1266  ettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATG  1090
                ET T+G GSL++E G LSRL GD  FE  A RA++ LW+ RS+   LLG  +++ TG
Sbjct  284   SINETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNFRSNETGLLGNVINIQTG  343

Query  1089  EWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----------  940
             +W+   +G+GAG+DSFYEYL+K+YILFG  E +KMF +AY ++Q + R G          
Sbjct  344   QWVGKQSGLGAGMDSFYEYLLKSYILFGEKEDYKMFHAAYESIQSHMRRGRESCNEGEGD  403

Query  939   -PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERY  763
              P Y + +M  G+     + SLQAF+PG+QVL GDV+ A   H  ++ +WK+FG LPERY
Sbjct  404   PPLYVNVNMFNGQIMNTWIDSLQAFFPGLQVLNGDVENAICLHAFYYAIWKRFGALPERY  463

Query  762   LLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASV  583
               + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL + TKV+ G+A++
Sbjct  464   --NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKNTKVRCGYATL  521

Query  582   RDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLSTWHDRL  412
               V     ED   SFFL+ETCKYLYLLFD+   ++++   YIFTTEGH +P+   + ++ 
Sbjct  522   HHVVDKSKEDRMESFFLSETCKYLYLLFDEDNPLHKSENKYIFTTEGHVVPIDERFREKA  581

Query  411   SEAYLPSNWT  382
                  P + T
Sbjct  582   WRDLFPGDET  591



>ref|XP_003762443.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like 1 
[Sarcophilus harrisii]
Length=595

 Score =   392 bits (1008),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 223/518 (43%), Positives = 315/518 (61%), Gaps = 29/518 (6%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  56    YSGAFPPQ----LRAQMRDLARGMFAFGYDNYMAHAFPEDELNPIHCRGRGPDRGDPSNL  111

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  112   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  168

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  169   LGSLLSAHRIITDSKQPFGNMTIKDYDNELLHMARDLALRLLPAFENTKTGIPYPRVNLK  228

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  229   SGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  288

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG D+  +MF +AY ++Q Y R G    
Sbjct  289   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEDDDLEMFNAAYRSIQSYLRRGREAC  348

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  349   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  408

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  409   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  466

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  467   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHQSGNRYMFTTEGHIVSVDK  526

Query  429   TWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPAT  316
                +   +          + EKH  R   +  ++  ++
Sbjct  527   HLRNAPWKKSFSEEGGEHQEEKHVPRPKPLDLKVINSS  564



>ref|XP_005896234.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Bos mutus]
Length=582

 Score =   392 bits (1007),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 223/492 (45%), Positives = 304/492 (62%), Gaps = 30/492 (6%)
 Frame = -1

Query  1770  RKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSA  1594
             R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL +  +   YS   
Sbjct  52    RAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRRDPSNLNINDVLGNYS---  108

Query  1593  LTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATD  1414
             LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TD
Sbjct  109   LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDRDSTVQVFEATIRVLGSLLSAHRIITD  168

Query  1413  STNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetst  1246
             S       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK GV  +   ET T
Sbjct  169   SKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCT  228

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFST  1069
             +G GSL++E G LSRL GD  FE  A RA++ LWS+RSS   LLG  +++ TG W+   +
Sbjct  229   AGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWSLRSSDTGLLGNVVNIQTGHWVGKQS  288

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDA  922
             G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y + 
Sbjct  289   GLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLYVNV  348

Query  921   DMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQML  742
             +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+ 
Sbjct  349   NMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQ  406

Query  741   HPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTME  562
              P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++  V    
Sbjct  407   APDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKS  466

Query  561   LEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV-----LSTWHDRLSE  406
              ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V      S W +  SE
Sbjct  467   KEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISVDEHLRESPWKEFFSE  526

Query  405   AYLPSNWTSFKH  370
                P       H
Sbjct  527   EGGPDQVGKSGH  538



>gb|EFB13180.1| hypothetical protein PANDA_008714 [Ailuropoda melanoleuca]
Length=555

 Score =   391 bits (1004),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 222/493 (45%), Positives = 307/493 (62%), Gaps = 34/493 (7%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  16    YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  71

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  72    NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVIDTVSFDKDSTVQVFEATIRV  128

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  129   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLK  188

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  189   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  248

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  249   VNIQTGRWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYRSIQNYLRRGREAC  308

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  309   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  368

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YT+V+
Sbjct  369   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTRVK  426

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV--  436
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  427   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTKYMFTTEGHIVSVDK  486

Query  435   ---LSTWHDRLSE  406
                 S W +  SE
Sbjct  487   HLRESPWKEFFSE  499



>gb|EPQ17462.1| ER degradation-enhancing alpha-mannosidase-like 1 [Myotis brandtii]
Length=520

 Score =   390 bits (1001),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 234/518 (45%), Positives = 317/518 (61%), Gaps = 41/518 (8%)
 Frame = -1

Query  1740  MFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSL  1564
             MF   Y+NYM HAFP DEL P+          +  NL +  +   YS   LTL+++L +L
Sbjct  1     MFVFGYDNYMAHAFPQDELNPIDCGGRGPDRGDPSNLNINDVLGNYS---LTLVDALDTL  57

Query  1563  VILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGT-  1387
              I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TDS       T 
Sbjct  58    AIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSKQPFGDMTI  117

Query  1386  --YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetstSGCGSLILEM  1216
               Y N+LL +A DL  R LPAF+ T TG+PY  +NLK GV  +   ET T+G GSL++E 
Sbjct  118   KDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCTAGAGSLLVEF  177

Query  1215  GALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFSTGIGAGVDSFY  1039
             G LSRL GD  FE  A RA++ LWS+RSS   LLG  +++ TG W+   +G+GAG+DSFY
Sbjct  178   GMLSRLLGDSTFEWVARRAVKALWSLRSSGTGLLGNVVNIQTGHWVGKQSGLGAGLDSFY  237

Query  1038  EYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDADMRTGKATYW  892
             EYL+K+YILFG  E   MF +AY ++Q Y R G           P Y + DM +G+    
Sbjct  238   EYLLKSYILFGEKEDLDMFNAAYHSIQSYLRRGREACNEGEGDPPLYVNVDMFSGRLMNT  297

Query  891   QLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLR  712
              + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+  P   +YPLR
Sbjct  298   WMDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQAPDVFFYPLR  355

Query  711   PEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFL  532
             PE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++  V     ED   SFFL
Sbjct  356   PELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKSKEDRMESFFL  415

Query  531   AETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLSTWHDR-LSEAYLPSNWTSFKHEK  364
             +ETCKYLYLLFD+   V+++   Y+FTTEGH + V     DR L EA     W  F  ++
Sbjct  416   SETCKYLYLLFDEENPVHKSGTRYMFTTEGHVVSV-----DRHLREA----PWKEFFPDE  466

Query  363   HRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDTR  253
              R RA+  S R   A  L    +  +  S C+ +PD R
Sbjct  467   -RGRAAGSSLRRPAAPDL----KVINSSSNCNRVPDER  499



>gb|EHB14659.1| ER degradation-enhancing alpha-mannosidase-like 1 [Heterocephalus 
glaber]
Length=528

 Score =   390 bits (1001),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 228/525 (43%), Positives = 318/525 (61%), Gaps = 40/525 (8%)
 Frame = -1

Query  1761  MSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSALTL  1585
             M    R MF   Y+NYM HAFP DEL P+  +       +  NL +  +   YS   LTL
Sbjct  1     MRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYS---LTL  57

Query  1584  IESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTN  1405
             +++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TDS  
Sbjct  58    VDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSKQ  117

Query  1404  RLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetstSGC  1237
                  T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK GV  +   ET T+G 
Sbjct  118   PFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCTAGA  177

Query  1236  GSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFSTGIG  1060
             GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  +++ TG W+   +G+G
Sbjct  178   GSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWVGKQSGLG  237

Query  1059  AGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDADMR  913
             AG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y + +M 
Sbjct  238   AGLDSFYEYLLKSYILFGEKEDLQMFNAAYQSIQNYLRRGREACNEGEGDPPLYVNVNMF  297

Query  912   TGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPT  733
             +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+  P 
Sbjct  298   SGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQAPD  355

Query  732   EKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELED  553
               +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++  V     ED
Sbjct  356   VLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKSKED  415

Query  552   HQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLSTWHDRLSEAYLPSNWT  382
                SFFL+ETCKYLYLLFD+   ++++   Y+FTTEGH L V      RL E    S W 
Sbjct  416   RMESFFLSETCKYLYLLFDEENPIHKSGTRYMFTTEGHVLSV----DKRLRE----SPWK  467

Query  381   S-FKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDTR  253
               F  ++ +++      R       S E +  +  S C+ +PD R
Sbjct  468   EFFSEDEEQEQQGKFVHR-----PKSQELKVINSSSNCNRVPDER  507



>ref|XP_010787046.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 isoform X1 [Notothenia coriiceps]
Length=639

 Score =   394 bits (1011),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 222/506 (44%), Positives = 316/506 (62%), Gaps = 28/506 (6%)
 Frame = -1

Query  1791  PNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLP  1615
             P+ + A+ K M+   ++MFY  Y+NYM +AFP DEL P+  +     +    N+ +  + 
Sbjct  110   PDTLKAKMKDMA---KEMFYFGYDNYMKYAFPEDELNPIDCEGRGPDVLNPSNININDVL  166

Query  1614  QKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVS  1435
               YS   LTLI++L +L++LGN TEF+KAV  +   +SFD D+ + +FE NIR+LG L+S
Sbjct  167   GNYS---LTLIDTLDTLLVLGNVTEFQKAVKLVIDTVSFDKDSTVQVFEANIRILGSLIS  223

Query  1434  AHILATDSTN---RLVQGTYKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQN  1267
             +HIL TD  +   ++    Y N+LL LA DL  R LPAF+ T TG+PY  +NLK GV  +
Sbjct  224   SHILLTDPKHPFGKVDYEGYDNELLHLAHDLAVRLLPAFENTLTGIPYPRVNLKTGVPPD  283

Query  1266  ettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATG  1090
                ET T+G GSL++E G LSRL GD  FE  A RA+R LWS+RS+   LLG  +++ TG
Sbjct  284   SINETCTAGAGSLLVEFGILSRLIGDSTFEWVARRAVRALWSLRSNETGLLGNVVNIQTG  343

Query  1089  EWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----------  940
             +W+   +G+GAG+DSFYEYL+K+YILFG  E  +MFQ +Y ++Q + R G          
Sbjct  344   QWVGKQSGLGAGMDSFYEYLLKSYILFGEKEDHRMFQDSYESIQNHMRRGRESCNEGEGD  403

Query  939   -PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERY  763
              P Y + +M +G+     + SLQAF+PG+QVL GDVD A   H  ++ +WK+FG LPERY
Sbjct  404   PPLYVNVNMFSGEIMNTWIDSLQAFFPGLQVLNGDVDNAICLHAFYYAIWKRFGALPERY  463

Query  762   LLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASV  583
               + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +  KV+ G+A++
Sbjct  464   --NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKNAKVKCGYATL  521

Query  582   RDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLSTWHDRL  412
               V     ED   SFFL+ETCKYLYLLFD+   ++++   YIFTTEGH +P+   + ++ 
Sbjct  522   HHVVDKSKEDRMESFFLSETCKYLYLLFDEDNPLHKSDNKYIFTTEGHIVPIDKRFREKQ  581

Query  411   SEAYLPSNWTSFKHEKHRKRASAMSQ  334
              +   P        +K   R    S 
Sbjct  582   WDDEFPCEEAVLAEQKPINRKPPPSN  607



>ref|XP_010960689.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Camelus bactrianus]
Length=586

 Score =   392 bits (1006),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 232/541 (43%), Positives = 321/541 (59%), Gaps = 44/541 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  47    YSGAFPPK----LRAQMRDLARGMFVFGYDNYMAHAFPEDELNPIHCRGRGPDRGDPSNL  102

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  103   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVIDTVSFDKDSTVQVFEATIRV  159

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  160   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLK  219

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  220   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  279

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  280   VNIQTGRWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREAC  339

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  340   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  399

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPER+  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  400   ALPERF--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  457

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  458   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIVSV--  515

Query  429   TWHDRLSEAYLPSNWTS-FKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDT  256
                    E    S W   F  E  + +      R  P     HE    +  S C+ +PD 
Sbjct  516   ------DEHLRESPWKEFFSEEGGQDQVGKSEHRPKP-----HELRVINSSSNCNRVPDE  564

Query  255   R  253
             R
Sbjct  565   R  565



>ref|XP_004442265.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1, partial [Ceratotherium simum simum]
Length=569

 Score =   391 bits (1004),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 223/494 (45%), Positives = 307/494 (62%), Gaps = 34/494 (7%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  30    YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  85

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  86    NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDRDSTVQVFEATIRV  142

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  143   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLK  202

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  203   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  262

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  263   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREAC  322

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  323   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  382

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  383   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  440

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV--  436
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  441   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIVSVDK  500

Query  435   ---LSTWHDRLSEA  403
                 S W +  SE 
Sbjct  501   HLRESPWKEFFSEV  514



>ref|XP_006783208.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1-like [Neolamprologus brichardi]
Length=636

 Score =   392 bits (1008),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 218/473 (46%), Positives = 308/473 (65%), Gaps = 30/473 (6%)
 Frame = -1

Query  1791  PNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLP  1615
             P+ + A+ K M+   ++MFY  Y+NYM +AFP DEL P+  +     +    N+ +  + 
Sbjct  108   PDTLKAKMKDMA---KEMFYFGYDNYMKYAFPEDELNPIDCEGRGPDVQNPSNININDVL  164

Query  1614  QKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVS  1435
               YS   LTLI++L +L++LGN +EF++AV  +   +SFD D+ + +FE NIR+LG L+S
Sbjct  165   GNYS---LTLIDTLDTLLVLGNVSEFQRAVKLVIDTVSFDKDSTVQVFEANIRILGSLIS  221

Query  1434  AHILATDST----NRLVQGTYKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQ  1270
             AHIL TD      N   +G Y N+LL LA DL  R LPAF+ T TG+PY  +NLK GV  
Sbjct  222   AHILLTDPKHPFGNVGFEG-YDNELLHLAHDLAVRLLPAFENTSTGIPYPRVNLKNGVPP  280

Query  1269  NettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVAT  1093
             +   ET T+G GSL++E G LSRL GD  FE  A RA+R LW++RS+   LLG  +++ T
Sbjct  281   DSVNETCTAGAGSLLVEFGILSRLIGDSTFEWVARRAVRALWNLRSNETGLLGNVVNIQT  340

Query  1092  GEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG---------  940
             G+W+   +G+GAG+DSFYEYL+K+YILFG  E ++MF +AY ++Q + R G         
Sbjct  341   GQWVGKQSGLGAGMDSFYEYLLKSYILFGEKEDYRMFTAAYESIQNHMRRGRESCNEGEG  400

Query  939   --PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPER  766
               P Y + +M +G+     + SLQAF+PG+QVL GDVD A   H  ++ +WK+FG LPER
Sbjct  401   DPPLYVNVNMFSGEIMNTWIDSLQAFFPGLQVLNGDVDDAICLHAFYYAIWKRFGALPER  460

Query  765   YLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFAS  586
             Y  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +  KV+ G+A+
Sbjct  461   Y--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKNAKVRCGYAT  518

Query  585   VRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV  436
             +  V     ED   SFFL+ETCKYLYLLFD+   ++++   YIFTTEGH +P+
Sbjct  519   LHHVVDKSKEDRMESFFLSETCKYLYLLFDEDNPLHKSDNKYIFTTEGHVVPI  571



>ref|XP_004548751.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1-like [Maylandia zebra]
 ref|XP_005724586.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1-like [Pundamilia nyererei]
 ref|XP_005927522.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1-like [Haplochromis burtoni]
Length=636

 Score =   392 bits (1008),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 218/473 (46%), Positives = 308/473 (65%), Gaps = 30/473 (6%)
 Frame = -1

Query  1791  PNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLP  1615
             P+ + A+ K M+   ++MFY  Y+NYM +AFP DEL P+  +     +    N+ +  + 
Sbjct  108   PDTLKAKMKDMA---KEMFYFGYDNYMKYAFPEDELNPIDCEGRGPDVQNPSNININDVL  164

Query  1614  QKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVS  1435
               YS   LTLI++L +L++LGN +EF++AV  +   +SFD D+ + +FE NIR+LG L+S
Sbjct  165   GNYS---LTLIDTLDTLLVLGNVSEFQRAVKLVIDTVSFDKDSTVQVFEANIRILGSLIS  221

Query  1434  AHILATDST----NRLVQGTYKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQ  1270
             AHIL TD      N   +G Y N+LL LA DL  R LPAF+ T TG+PY  +NLK GV  
Sbjct  222   AHILLTDPKHPFGNVGFEG-YDNELLHLAHDLAVRLLPAFENTSTGIPYPRVNLKNGVPP  280

Query  1269  NettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVAT  1093
             +   ET T+G GSL++E G LSRL GD  FE  A RA+R LW++RS+   LLG  +++ T
Sbjct  281   DSVNETCTAGAGSLLVEFGILSRLIGDSTFEWVARRAVRALWNLRSNETGLLGNVVNIQT  340

Query  1092  GEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG---------  940
             G+W+   +G+GAG+DSFYEYL+K+YILFG  E ++MF +AY ++Q + R G         
Sbjct  341   GQWVGKQSGLGAGMDSFYEYLLKSYILFGEKEDYRMFTAAYESIQNHMRRGRESCNEGEG  400

Query  939   --PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPER  766
               P Y + +M +G+     + SLQAF+PG+QVL GDVD A   H  ++ +WK+FG LPER
Sbjct  401   DPPLYVNVNMFSGEIMNTWIDSLQAFFPGLQVLNGDVDDAICLHAFYYAIWKRFGALPER  460

Query  765   YLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFAS  586
             Y  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +  KV+ G+A+
Sbjct  461   Y--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKNAKVRCGYAT  518

Query  585   VRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV  436
             +  V     ED   SFFL+ETCKYLYLLFD+   ++++   YIFTTEGH +P+
Sbjct  519   LHHVVDKSKEDRMESFFLSETCKYLYLLFDEDNPLHKSDNKYIFTTEGHVVPI  571



>gb|EHH51168.1| ER degradation-enhancing alpha-mannosidase-like 1, partial [Macaca 
fascicularis]
Length=588

 Score =   391 bits (1004),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 234/541 (43%), Positives = 325/541 (60%), Gaps = 44/541 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  49    YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  104

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L ++GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  105   NINDVLGNYS---LTLVDALDTLAVMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  161

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  162   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLK  221

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  222   TGVPPDTNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  281

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  282   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREAC  341

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  342   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  401

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  402   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  459

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  460   CGYATLHHVIDKSTEDRMESFFLSETCKYLYLLFDEDNPVHKSGTRYMFTTEGHIVSV--  517

Query  429   TWHDRLSEAYLPSNWTS-FKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDT  256
                + L E  LP  W   F  E  + +      R  P     HE +  +  S C+ +PD 
Sbjct  518   --DEHLRE--LP--WKEFFSEEGGQDQGGKSVHRPKP-----HELKVINSSSNCNRVPDE  566

Query  255   R  253
             R
Sbjct  567   R  567



>ref|XP_008954887.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1, partial [Pan paniscus]
Length=599

 Score =   391 bits (1005),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 235/541 (43%), Positives = 325/541 (60%), Gaps = 44/541 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  60    YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  115

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  116   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  172

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF +T TG+PY  +NLK
Sbjct  173   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLK  232

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  233   TGVPPDTNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  292

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  293   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREAC  352

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  353   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  412

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  413   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  470

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  471   CGYATLHHVIDKSTEDRMESFFLSETCKYLYLLFDEDNPVHKSGTRYMFTTEGHIVSV--  528

Query  429   TWHDRLSEAYLPSNWTS-FKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDT  256
                + L E  LP  W   F  E  + +      R  P     HE +  +  S C+ +PD 
Sbjct  529   --DEHLRE--LP--WKEFFSEEGGQDQGGKSVHRPKP-----HELKVINSSSNCNRVPDE  577

Query  255   R  253
             R
Sbjct  578   R  578



>ref|XP_008654408.1| PREDICTED: uncharacterized protein LOC100193961 isoform X1 [Zea 
mays]
Length=636

 Score =   392 bits (1007),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 214/458 (47%), Positives = 288/458 (63%), Gaps = 41/458 (9%)
 Frame = -1

Query  1785  PMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKY  1606
             P  ARR R   +V+ MFYHA++ YM +AFP DEL+PL+    DSL               
Sbjct  38    PSEARRLR--DEVKDMFYHAFDGYMKYAFPLDELRPLSCQGEDSLG--------------  81

Query  1605  SGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHI  1426
              G ALTLI+SL +L +LG+  +F  AV W+  N+ FD++  +++FE NIR+LGGL+SAH+
Sbjct  82    -GYALTLIDSLDTLALLGDKEKFGAAVEWVGKNVHFDINKTVSVFETNIRILGGLLSAHL  140

Query  1425  LATDSTNRLVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetst  1246
             +A+D    +   +Y +QLL LA DL +R LPAFDTPTG+P+  +NL  GV +NE+  TST
Sbjct  141   IASDYATGMRIQSYDDQLLHLAADLAQRLLPAFDTPTGIPFGSVNLLYGVDENESKITST  200

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTG  1066
             +G G+L LE G LSRLT + +FE    +++R +WS RS LNL+G  ++V TGEW +   G
Sbjct  201   AGGGTLTLEFGILSRLTNNTVFERVTKKSVRGIWSRRSKLNLVGAHINVFTGEWTQKDAG  260

Query  1065  IGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQL  886
             IG  +DSFYEYL+K                AY A   Y  H PWY + +M +G AT W L
Sbjct  261   IGTSIDSFYEYLLK---------------EAYKAAMHYLHHDPWYVEVNMNSG-ATVWPL  304

Query  885   -TSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRP  709
               SLQAFWPG+QVL GDVD A  +H  FF VWKK+G  PE + L    +   ++ YPLRP
Sbjct  305   FNSLQAFWPGLQVLAGDVDPAIRTHAAFFSVWKKYGFTPEGFNLATSTVQNGQRSYPLRP  364

Query  708   EFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLA  529
             E  EST++L++AT+D  Y++VG  I+ SL    +   G+  + DV T + +DH  SFFLA
Sbjct  365   ELIESTYWLFKATRDYRYLDVGRDILASLQYGARCPCGYCHISDVETHKQDDHMESFFLA  424

Query  528   ETCKYLYLLFD-----DSFLVNR--NYIFTTEGHPLPV  436
             ET KYL+LLFD     D+ + N    YIF+TEGH LPV
Sbjct  425   ETVKYLWLLFDLAAGPDNIVENGPYKYIFSTEGHLLPV  462



>ref|XP_001420019.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO98312.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=436

 Score =   385 bits (990),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 208/449 (46%), Positives = 288/449 (64%), Gaps = 20/449 (4%)
 Frame = -1

Query  1761  MSQKVRKMFYHAYENYMMHAFPHDELKPLTKTYTDSLSELGNLKLEHLPQKYSGSALTLI  1582
             +  +V++MF    E+Y +HA+P DELKP++    + ++  G+          SG A+TLI
Sbjct  1     LRDEVKEMFTDTLESYNVHAYPADELKPMS---CEGVNTFGS---------ESGFAVTLI  48

Query  1581  ESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNR  1402
             ++L ++V++GN T FE+ V  +  N  FDVDA ++LFE NIRVLGGL+SAH+LA+D    
Sbjct  49    DALDAMVVMGNKTAFERGVRAVIDNTRFDVDAHVSLFEMNIRVLGGLLSAHLLASDEATG  108

Query  1401  LVQGTYKNQLLDLAEDLGRRFLPAFDTPTGLPYAWINLKRGVMQNettetstSGCGSLIL  1222
                  Y+++LL+LA DLG  FLPAF+T TG+PY  +NLK GV  NETT TST+  GSLIL
Sbjct  109   FGIEWYEDELLELANDLGEAFLPAFETKTGIPYGAVNLKYGVEVNETTITSTAAGGSLIL  168

Query  1221  EMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIGAGVDSF  1042
             E G LS LTGDP F   A  AL  LW  RS + L+G  +D+ TG+W +    +GAG+DSF
Sbjct  169   EFGTLSALTGDPRFRRVAEAALEALWDHRSDIGLVGAHIDIETGQWTQAEASVGAGIDSF  228

Query  1041  YEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHGPWYHDADMRTGKATYWQLTSLQAFWP  862
             YEY++K+YILFG +   ++F+ AY AV+ + R  PWY +A M TG+    +  SL +FWP
Sbjct  229   YEYMLKSYILFGNERHLEIFEEAYAAVEAHVRLAPWYVEAGMMTGQLISSRYDSLMSFWP  288

Query  861   GVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYL  682
             G+Q L GD++ A ++H  FF VWK +G  PE + +      P +K YPLRPE  EST+ L
Sbjct  289   GLQALYGDIETATTTHDAFFQVWKHYGFTPEGFDVRTGAAIPGQKPYPLRPELIESTYLL  348

Query  681   YQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLL  502
             Y+AT D  Y+  G   + SL +  K   G+A + DV+T +L D   SFFL+ET KYLYLL
Sbjct  349   YKATGDVTYIACGRDFLASL-RLLKTNCGYAHMADVSTQKLVDKMESFFLSETLKYLYLL  407

Query  501   FDDSF----LVNRN---YIFTTEGHPLPV  436
             FD +     +V+     Y+FTTE H LP+
Sbjct  408   FDAALDRENIVDGGPYPYLFTTEAHILPL  436



>ref|XP_006220578.1| PREDICTED: LOW QUALITY PROTEIN: ER degradation enhancer, mannosidase 
alpha-like 1 [Vicugna pacos]
 ref|XP_010983290.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Camelus dromedarius]
Length=528

 Score =   389 bits (998),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 227/525 (43%), Positives = 314/525 (60%), Gaps = 40/525 (8%)
 Frame = -1

Query  1761  MSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSALTL  1585
             M    R MF   Y+NYM HAFP DEL P+  +       +  NL +  +   YS   LTL
Sbjct  1     MRDLARGMFVFGYDNYMAHAFPEDELNPIHCRGRGPDRGDPSNLNINDVLGNYS---LTL  57

Query  1584  IESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTN  1405
             +++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TDS  
Sbjct  58    VDALDTLAIMGNSSEFQKAVKLVIDTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSKQ  117

Query  1404  RLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetstSGC  1237
                  T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK GV  +   ET T+G 
Sbjct  118   PFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCTAGA  177

Query  1236  GSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFSTGIG  1060
             GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  +++ TG W+   +G+G
Sbjct  178   GSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGRWVGKQSGLG  237

Query  1059  AGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDADMR  913
             AG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y + +M 
Sbjct  238   AGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLYVNVNMF  297

Query  912   TGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPT  733
             +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPER+  + Q+  P 
Sbjct  298   SGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERF--NWQLQAPD  355

Query  732   EKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELED  553
               +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++  V     ED
Sbjct  356   VLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKSKED  415

Query  552   HQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLSTWHDRLSEAYLPSNWT  382
                SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V         E    S W 
Sbjct  416   RMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIVSV--------DEHLRESPWK  467

Query  381   S-FKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDTR  253
               F  E  + +      R  P     HE    +  S C+ +PD R
Sbjct  468   EFFSEEGGQDQVGKSEHRPKP-----HELRVINSSSNCNRVPDER  507



>ref|XP_002920037.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like 1-like 
[Ailuropoda melanoleuca]
Length=585

 Score =   390 bits (1002),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 222/493 (45%), Positives = 307/493 (62%), Gaps = 34/493 (7%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  46    YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  101

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  102   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVIDTVSFDKDSTVQVFEATIRV  158

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  159   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLK  218

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  219   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  278

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  279   VNIQTGRWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYRSIQNYLRRGREAC  338

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  339   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  398

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YT+V+
Sbjct  399   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTRVK  456

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV--  436
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  457   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTKYMFTTEGHIVSVDK  516

Query  435   ---LSTWHDRLSE  406
                 S W +  SE
Sbjct  517   HLRESPWKEFFSE  529



>ref|XP_238366.4| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Rattus norvegicus]
 ref|XP_001075943.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Rattus norvegicus]
Length=650

 Score =   392 bits (1007),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 224/519 (43%), Positives = 317/519 (61%), Gaps = 29/519 (6%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +     L +  NL
Sbjct  111   YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIYCRGRGPDLGDPSNL  166

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  167   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  223

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  224   LGSLLSAHRIITDSKQPFGDMTIEDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLK  283

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  284   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  343

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  344   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQSYLRRGREAC  403

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  404   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  463

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  464   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  521

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  522   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISVDK  581

Query  429   TWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATT  313
                +   + +   +    + EK   R  +   R+  +++
Sbjct  582   RLRELPWKEFFSEDGERDQEEKFVHRPKSQELRVINSSS  620



>ref|NP_001006143.1| ER degradation-enhancing alpha-mannosidase-like 1 [Gallus gallus]
 emb|CAG31867.1| hypothetical protein RCJMB04_12l23 [Gallus gallus]
Length=616

 Score =   391 bits (1004),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 222/498 (45%), Positives = 307/498 (62%), Gaps = 25/498 (5%)
 Frame = -1

Query  1770  RKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSA  1594
             R R+    R MF   Y++YM HAFP DEL PL          +  NL +  +   YS   
Sbjct  93    RARLRDAARGMFAFGYDSYMQHAFPSDELDPLHCCGRGPDRDDPSNLNINDVLGNYS---  149

Query  1593  LTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATD  1414
             LTLI++L +L ++GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAHI+ TD
Sbjct  150   LTLIDALDTLAVMGNSSEFQKAVKLVIDTVSFDKDSTVQVFEATIRVLGSLLSAHIIITD  209

Query  1413  STNRLVQGT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLKRGVMQNettetst  1246
             +       T   Y N+LL +A DL  R LPAF +T TG+PY  +NLK+GV  N   ET T
Sbjct  210   AKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKKGVPPNSNNETCT  269

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFST  1069
             +G GSL++E G LSRL GD  FE  A RA++ LWS+RS+   LLG  +++ TG W+   +
Sbjct  270   AGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWSLRSNNTGLLGNVVNIQTGHWVGKQS  329

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDA  922
             G+GAG DSFYEYL+K+YILFG  E  +MF  AY  +Q + R G           P Y + 
Sbjct  330   GLGAGSDSFYEYLLKSYILFGEKEDLEMFIDAYQNIQNHLRRGREACNEGEGDPPLYVNV  389

Query  921   DMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQML  742
             +M TG+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+ 
Sbjct  390   NMFTGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQ  447

Query  741   HPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTME  562
              P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTK + G+A++  V    
Sbjct  448   APDVPFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKAKCGYATLHHVVEKT  507

Query  561   LEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLSTWHDRLSEAYLPS  391
              ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V   + + L +  LP 
Sbjct  508   KEDRMESFFLSETCKYLYLLFDEDNPVHKSGNKYMFTTEGHIVSVDERFRNSLWQDILPG  567

Query  390   NWTSFKHEKHRKRASAMS  337
                + K + +  +A   S
Sbjct  568   EEGTEKVKPNELKAVNFS  585



>ref|XP_005166083.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 isoform X1 [Danio rerio]
Length=628

 Score =   391 bits (1005),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 218/482 (45%), Positives = 304/482 (63%), Gaps = 25/482 (5%)
 Frame = -1

Query  1776  ARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPLT-KTYTDSLSELGNLKLEHLPQKYSG  1600
             A + +M    R MFY  Y+NYM  AFP DEL P+  +     +    N+ +  +   YS 
Sbjct  110   ALKVKMRAMARDMFYFGYDNYMKFAFPEDELNPIACEGRGPDVLNPSNININDVLGNYS-  168

Query  1599  SALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILA  1420
               LTLI++L +L++LGN TEF +AV  +   +SFD D+ + +FE NIR+LG L+SAHIL 
Sbjct  169   --LTLIDTLDTLLVLGNVTEFHRAVKLVIDTVSFDKDSTVQVFEANIRILGSLISAHILL  226

Query  1419  TDSTNRLVQ---GTYKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLKRGVMQNettet  1252
             TD  +         Y N+LL LA DL  R LPAF +T TG+PY  +NLK GV  +   ET
Sbjct  227   TDPRHPFGDVGLKDYDNELLHLAHDLAVRLLPAFENTSTGIPYPRVNLKNGVPPDSINET  286

Query  1251  stSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEF  1075
              T+G GSL++E G LSRL GD  FE  A RA++ LW +RS+   LLG  +++ TG+W+  
Sbjct  287   CTAGAGSLLVEFGILSRLIGDSTFEWVARRAVKALWKLRSNETGLLGNVVNIQTGQWVGK  346

Query  1074  STGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYH  928
              +G+GAG+DSFYEYL+K+YILFG  E ++MF +AY ++Q + R G           P Y 
Sbjct  347   QSGLGAGMDSFYEYLLKSYILFGEKEDFRMFTAAYESIQSHLRRGREACNEGEGDPPLYV  406

Query  927   DADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQ  748
             + +M  G+     + SLQAF+PG+QVL GDV+ A   H  ++ +WK+FG LPERY  + Q
Sbjct  407   NVNMFNGQIMNTWIDSLQAFFPGLQVLNGDVENAICLHAFYYAIWKRFGALPERY--NWQ  464

Query  747   MLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTT  568
             +  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL + TKV+ G+A++  V  
Sbjct  465   LQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILESLEKNTKVRCGYATLHHVVD  524

Query  567   MELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLSTWHDRLSEAYL  397
                ED   SFFL+ETCKYLYLLFD+   ++++   YIFTTEGH +P+   + +R  E   
Sbjct  525   KSKEDRMESFFLSETCKYLYLLFDEDNPLHKSENKYIFTTEGHVVPIDQRFRERSWEEQF  584

Query  396   PS  391
             P+
Sbjct  585   PN  586



>ref|XP_003448374.1| PREDICTED: ER degradation enhancer, mannosidase alpha-like 1 
[Oreochromis niloticus]
Length=636

 Score =   392 bits (1006),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 218/473 (46%), Positives = 307/473 (65%), Gaps = 30/473 (6%)
 Frame = -1

Query  1791  PNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLP  1615
             P+ + A+ K M+   ++MFY  Y+NYM +AFP DEL P+  +     +    N+ +  + 
Sbjct  108   PDTLKAKMKDMA---KEMFYFGYDNYMKYAFPEDELNPIDCEGRGPDVQNPSNININDVL  164

Query  1614  QKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVS  1435
               YS   LTLI++L +L++LGN +EF++AV  +   +SFD D+ + +FE NIR+LG L+S
Sbjct  165   GNYS---LTLIDTLDTLLVLGNVSEFQRAVKLVIDTVSFDKDSTVQVFEANIRILGSLIS  221

Query  1434  AHILATDST----NRLVQGTYKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQ  1270
             AHIL TD      N   +G Y N+LL LA DL  R LPAF+ T TG+PY  +NLK GV  
Sbjct  222   AHILLTDPKHPFGNVGFEG-YDNELLHLAHDLAVRLLPAFENTSTGIPYPRVNLKNGVPL  280

Query  1269  NettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVAT  1093
             +   ET T+G GSL++E G LSRL GD  FE  A RA+R LW++RS+   LLG  +++ T
Sbjct  281   DSVNETCTAGAGSLLVEFGILSRLIGDSTFEWVARRAVRALWNLRSNETGLLGNVVNIQT  340

Query  1092  GEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG---------  940
             G+W+   +G+GAG+DSFYEYL K+YILFG  E ++MF +AY ++Q + R G         
Sbjct  341   GQWVGKQSGLGAGMDSFYEYLFKSYILFGEKEDYRMFTAAYESIQNHMRRGRESCNEGEG  400

Query  939   --PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPER  766
               P Y + +M +G+     + SLQAF+PG+QVL GDVD A   H  ++ +WK+FG LPER
Sbjct  401   DPPLYVNVNMFSGEIMNTWIDSLQAFFPGLQVLNGDVDDAICLHAFYYAIWKRFGALPER  460

Query  765   YLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFAS  586
             Y  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +  KV+ G+A+
Sbjct  461   Y--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKNAKVRCGYAT  518

Query  585   VRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV  436
             +  V     ED   SFFL+ETCKYLYLLFD+   ++++   YIFTTEGH +P+
Sbjct  519   LHHVVDKSKEDRMESFFLSETCKYLYLLFDEDNPLHKSDNKYIFTTEGHVVPI  571



>ref|XP_006074665.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 isoform X1 [Bubalus bubalis]
Length=658

 Score =   392 bits (1007),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 224/503 (45%), Positives = 309/503 (61%), Gaps = 33/503 (7%)
 Frame = -1

Query  1770  RKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSA  1594
             R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL +  +   YS   
Sbjct  128   RAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYS---  184

Query  1593  LTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATD  1414
             LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TD
Sbjct  185   LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITD  244

Query  1413  STNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetst  1246
             S       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK GV  +   ET T
Sbjct  245   SKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCT  304

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFST  1069
             +G GSL++E G LSRL GD  FE  A RA++ LWS+RSS   LLG  +++ TG W+   +
Sbjct  305   AGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWSLRSSDTGLLGNVVNIQTGHWVGKQS  364

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDA  922
             G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y + 
Sbjct  365   GLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLYVNV  424

Query  921   DMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQML  742
             +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+ 
Sbjct  425   NMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQ  482

Query  741   HPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTME  562
              P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++  V    
Sbjct  483   APDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKS  542

Query  561   LEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV-----LSTWHDRLSE  406
              ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V      S W +  SE
Sbjct  543   KEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISVDEHLRESPWKEFFSE  602

Query  405   AYLPSNWTSFKHEKHRKRASAMS  337
                P      +   HR +   ++
Sbjct  603   EGGPDQ---VEKSGHRPKPQELN  622



>ref|XP_004854301.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1-like [Heterocephalus glaber]
Length=657

 Score =   392 bits (1007),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 233/541 (43%), Positives = 325/541 (60%), Gaps = 44/541 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  118   YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  173

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  174   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  230

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  231   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLK  290

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  291   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  350

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  351   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLQMFNAAYQSIQNYLRRGREAC  410

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  411   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  470

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  471   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  528

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   ++++   Y+FTTEGH L V  
Sbjct  529   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPIHKSGTRYMFTTEGHVLSV--  586

Query  429   TWHDRLSEAYLPSNWTS-FKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDT  256
                 RL E    S W   F  ++ +++      R       S E +  +  S C+ +PD 
Sbjct  587   --DKRLRE----SPWKEFFSEDEEQEQQGKFVHR-----PKSQELKVINSSSNCNRVPDE  635

Query  255   R  253
             R
Sbjct  636   R  636



>ref|XP_004793540.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Mustela putorius furo]
Length=608

 Score =   390 bits (1003),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 223/493 (45%), Positives = 307/493 (62%), Gaps = 34/493 (7%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  69    YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  124

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  125   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVIDTVSFDKDSTVQVFEATIRV  181

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  182   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLK  241

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  242   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  301

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  302   VNIQTGRWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYRSIQNYLRRGREAC  361

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  362   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  421

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  422   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  479

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV--  436
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  480   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTKYMFTTEGHIVSVDK  539

Query  435   ---LSTWHDRLSE  406
                 S W +  SE
Sbjct  540   HLRESPWKEFFSE  552



>ref|NP_001096562.1| ER degradation-enhancing alpha-mannosidase-like protein 1 [Bos 
taurus]
 gb|AAI51306.1| EDEM1 protein [Bos taurus]
 gb|AAI53844.1| ER degradation enhancer, mannosidase alpha-like 1 [Bos taurus]
Length=658

 Score =   392 bits (1007),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 223/492 (45%), Positives = 304/492 (62%), Gaps = 30/492 (6%)
 Frame = -1

Query  1770  RKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSA  1594
             R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL +  +   YS   
Sbjct  128   RAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYS---  184

Query  1593  LTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATD  1414
             LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TD
Sbjct  185   LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITD  244

Query  1413  STNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetst  1246
             S       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK GV  +   ET T
Sbjct  245   SKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCT  304

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFST  1069
             +G GSL++E G LSRL GD  FE  A RA++ LWS+RSS   LLG  +++ TG W+   +
Sbjct  305   AGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWSLRSSDTGLLGNVVNIQTGHWVGKQS  364

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDA  922
             G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y + 
Sbjct  365   GLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLYVNV  424

Query  921   DMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQML  742
             +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+ 
Sbjct  425   NMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQ  482

Query  741   HPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTME  562
              P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++  V    
Sbjct  483   APDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKS  542

Query  561   LEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV-----LSTWHDRLSE  406
              ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V      S W +  SE
Sbjct  543   KEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISVDEHLRESPWKEFFSE  602

Query  405   AYLPSNWTSFKH  370
                P       H
Sbjct  603   EGGPDQVGKSGH  614



>ref|XP_003383033.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like 1 
[Amphimedon queenslandica]
Length=548

 Score =   388 bits (997),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 214/479 (45%), Positives = 299/479 (62%), Gaps = 30/479 (6%)
 Frame = -1

Query  1776  ARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSG  1600
             + R RM  + R MFYH Y NYM HAFPHDEL P+         ++  N+ +      YS 
Sbjct  12    SERLRMINETRAMFYHGYNNYMRHAFPHDELDPIHCSGRGHDWNDPSNININDALGDYS-  70

Query  1599  SALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILA  1420
               LTLI++LS+LV++G+   F +AV ++S N++FD    + +FE NIRV+G L+S+H++ 
Sbjct  71    --LTLIDALSTLVVMGDSERFMEAVEYISHNITFDHCPTVQVFEANIRVIGSLLSSHLII  128

Query  1419  TDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLKRGVMQNettet  1252
             T++  RL       Y ++LL +A DL  R LPAF +T TGLP+  +NL  GV      ET
Sbjct  129   TEADKRLGDFRPLHYSDELLHVAHDLAERLLPAFENTATGLPHPRVNLCHGVPSGGVPET  188

Query  1251  stSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMR-SSLNLLGTTLDVATGEWIEF  1075
              T+G GSLILE   LSRL GDPI+E  A RA+R LW +R     L+G  +++ +G+WI  
Sbjct  189   CTAGAGSLILEFSILSRLVGDPIYENLARRAVRTLWDLRHPRTGLVGNVVNIHSGDWIGP  248

Query  1074  STGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG---------------  940
              +GIGAGVDSFYEYL+K++ILFG  E  +MF   Y  + KY R G               
Sbjct  249   MSGIGAGVDSFYEYLLKSFILFGEREDLEMFTEFYKNIMKYMRKGCCSCLDIIINDKWLQ  308

Query  939   -PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERY  763
              P Y + +  +GK   +   SL A + G+QVL GD+D A  +H  ++ +W+K+  LPERY
Sbjct  309   SPLYVNVNYNSGKLYNFWFDSLSASFAGLQVLAGDLDEAICTHALYYTLWRKYESLPERY  368

Query  762   LLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASV  583
               D +   P+  +YPLRPE AEST+ LYQAT +P+Y+ VG  I+NS+N++ K + G+A++
Sbjct  369   --DWKAKSPSVSFYPLRPELAESTYLLYQATHNPFYLHVGTDILNSINKHMKAKCGYATL  426

Query  582   RDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNR---NYIFTTEGHPLPVLSTWHDR  415
              DV T E ED   SFFL+E CKYLYLLFD   ++N+   NY+FTTEGH +P+ ST H +
Sbjct  427   HDVITKEKEDRMESFFLSEMCKYLYLLFDTDHVINKHSANYLFTTEGHVIPISSTLHRK  485



>ref|XP_003982524.1| PREDICTED: ER degradation enhancer, mannosidase alpha-like 1, 
partial [Felis catus]
Length=524

 Score =   387 bits (995),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 217/473 (46%), Positives = 299/473 (63%), Gaps = 30/473 (6%)
 Frame = -1

Query  1749  VRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSALTLIESL  1573
              R MF   Y+NYM HAFP DEL P+  +       +  NL +  +   YS   LTL+++L
Sbjct  1     ARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYS---LTLVDAL  57

Query  1572  SSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQ  1393
              +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TDS      
Sbjct  58    DTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSKQPFGD  117

Query  1392  GT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLKRGVMQNettetstSGCGSLI  1225
              T   Y N+LL +A DL  R LPAF +T TG+PY  +NLK GV  +   ET T+G GSL+
Sbjct  118   MTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCTAGAGSLL  177

Query  1224  LEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFSTGIGAGVD  1048
             +E G LSRL GD  FE  A RA++ LW++RS+   LLG  +++ TG W+   +G+GAG+D
Sbjct  178   VEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWVGKQSGLGAGLD  237

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDADMRTGKA  901
             SFYEYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y + +M +G+ 
Sbjct  238   SFYEYLLKSYILFGEKEDLEMFNAAYRSIQNYLRRGREACNEGEGDPPLYVNVNMFSGQL  297

Query  900   TYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYY  721
                 + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+  P   +Y
Sbjct  298   MNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQAPDVLFY  355

Query  720   PLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHS  541
             PLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++  V     ED   S
Sbjct  356   PLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKSKEDRMES  415

Query  540   FFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV-----LSTWHDRLSE  406
             FFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V      S W +  SE
Sbjct  416   FFLSETCKYLYLLFDEENPVHKSGTKYMFTTEGHIVSVDKHLRESPWKEFFSE  468



>emb|CEG65919.1| Putative ER degradation enhancer, mannosidase alpha-like 1 [Rhizopus 
microsporus]
Length=589

 Score =   390 bits (1001),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 211/449 (47%), Positives = 292/449 (65%), Gaps = 12/449 (3%)
 Frame = -1

Query  1773  RRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGS  1597
             RR ++    ++MF H + +Y+ HAFP DEL P   +      +   N+ +  +   YS  
Sbjct  7     RRLQLKDLSKEMFEHGWSSYIEHAFPDDELNPFECRGRGSDKANPDNINVNDVLGDYS--  64

Query  1596  ALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILAT  1417
              LTL+++L +L I+G   +FE+AV  +   +SF  + ++ +FE NIR LGGL+S H+L T
Sbjct  65    -LTLVDTLDTLAIIGTRKQFEEAVKQVIETVSFHQNNKVQVFELNIRALGGLLSTHMLIT  123

Query  1416  DSTNRLVQGTYKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetstSG  1240
             D         YK++LL LA DL  R +PAF+ T TG+PY  +NL++GV   ETTET T+G
Sbjct  124   DPELDYSIEGYKDELLHLAVDLANRLMPAFNSTKTGIPYPRVNLQKGVPPTETTETCTAG  183

Query  1239  CGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSSLNLLGTTLDVATGEWIEFSTGIG  1060
              GSLILE G LSRLTGDP +E AA RAL+ +W+ RS L+L+G  +D+ TG WI  ++  G
Sbjct  184   AGSLILEFGLLSRLTGDPAYEEAAKRALKSVWNRRSHLSLMGNVIDIQTGNWIHTASSTG  243

Query  1059  AGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFR--HGPWYHDADMRTGKATYWQL  886
             AG+DS +EY++KAYILFG DE+  MF+ AY A+  Y R   G  Y +  M TG    + +
Sbjct  244   AGIDSVFEYMLKAYILFGEDEYLDMFEEAYRALMIYVRDSSGYIYRNVHMSTGSLMSYWI  303

Query  885   TSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPE  706
              SL AF+PG+QVL GD+ AA  +H  F+++W+++  LPER+  D         YYPLRPE
Sbjct  304   DSLSAFFPGLQVLYGDIHAAIKNHLVFYNIWRRYHALPERF--DFYQKRVNLPYYPLRPE  361

Query  705   FAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAE  526
             F EST+YLYQATKDP+Y++VGE++I  LN  T++  GFAS+ DV + +LED   SF L+E
Sbjct  362   FIESTYYLYQATKDPFYLDVGEMVIQDLNNRTRLACGFASIGDVESGKLEDRMESFMLSE  421

Query  525   TCKYLYLLFDDSFLVNR---NYIFTTEGH  448
             T KYLYLLFD     N+   N +FTTEGH
Sbjct  422   TLKYLYLLFDTEHPFNKRDSNAVFTTEGH  450



>ref|XP_008067717.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Tarsius syrichta]
Length=521

 Score =   387 bits (994),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 217/470 (46%), Positives = 298/470 (63%), Gaps = 30/470 (6%)
 Frame = -1

Query  1740  MFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSL  1564
             MF   Y+NYM HAFP DEL P+  +       +  NL +  +   YS   LTL+++L +L
Sbjct  1     MFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYS---LTLVDALDTL  57

Query  1563  VILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGT-  1387
              I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TDS       T 
Sbjct  58    AIMGNSSEFQKAVKLVINTVSFDRDSTVQVFEATIRVLGSLLSAHRIITDSKQPFGDMTI  117

Query  1386  --YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLKRGVMQNettetstSGCGSLILEM  1216
               Y N+LL +A DL  R LPAF +T TG+PY  +NLK GV  +   ET T+G GSL++E 
Sbjct  118   KDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCTAGAGSLLVEF  177

Query  1215  GALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFSTGIGAGVDSFY  1039
             G LSRL GD  FE  A RA++ LW++RS+   LLG  +++ TG W+   +G+GAG+DSFY
Sbjct  178   GILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWVGKQSGLGAGLDSFY  237

Query  1038  EYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDADMRTGKATYW  892
             EYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y + +M +G+    
Sbjct  238   EYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLYVNVNMFSGQLMNT  297

Query  891   QLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLR  712
              + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+  P   +YPLR
Sbjct  298   WIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQAPDVLFYPLR  355

Query  711   PEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFL  532
             PE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++  V     ED   SFFL
Sbjct  356   PELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKSTEDRMESFFL  415

Query  531   AETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV-----LSTWHDRLSE  406
             +ETCKYLYLLFD+   V+++   Y+FTTEGH + V      S W D  SE
Sbjct  416   SETCKYLYLLFDEENPVHKSGNRYMFTTEGHIVSVDKHLRESPWKDFFSE  465



>ref|XP_007952256.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Orycteropus afer afer]
Length=590

 Score =   389 bits (1000),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 225/507 (44%), Positives = 311/507 (61%), Gaps = 44/507 (9%)
 Frame = -1

Query  1821  FPMSFSGFD----------PPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-  1675
             FP+SF   D          PP      R +M    R MF+  Y+NYM HAFP DEL P+ 
Sbjct  37    FPLSFGFQDEYEKRYSSAFPPQ----LRAQMRDLARGMFFFGYDNYMAHAFPQDELNPIH  92

Query  1674  TKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFD  1495
              +       +  NL +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD
Sbjct  93    CRGRGPDRGDPSNLNINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFD  149

Query  1494  VDARINLFECNIRVLGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD  1324
              D+ + +FE  IRVLG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+
Sbjct  150   KDSTVQVFEATIRVLGSLLSAHRIITDSRQPFGDMTIKDYDNELLHMAHDLAVRLLPAFE  209

Query  1323  -TPTGLPYAWINLKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKL  1147
              T TG+PY  +NLK GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ L
Sbjct  210   NTKTGIPYPRVNLKTGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKAL  269

Query  1146  WSMRSS-LNLLGTTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAY  970
             W++RS+   LLG  +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY
Sbjct  270   WNLRSNDTGLLGNVVNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAY  329

Query  969   LAVQKYFRHG-----------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAAN  823
              ++Q Y R G           P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A 
Sbjct  330   QSIQNYLRRGREACNEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAI  389

Query  822   SSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVG  643
               H  ++ +WK++G LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG
Sbjct  390   CLHAFYYAIWKRYGALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVG  447

Query  642   ELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---  472
               I+ SL ++TKV+ G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   
Sbjct  448   MDILQSLEKHTKVKCGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTR  507

Query  471   YIFTTEGHPLPV-----LSTWHDRLSE  406
             Y+FTTEGH + V      S W +  SE
Sbjct  508   YMFTTEGHIVSVDKHLRESPWKEFFSE  534



>ref|XP_010363980.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Rhinopithecus roxellana]
Length=657

 Score =   391 bits (1005),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 235/541 (43%), Positives = 325/541 (60%), Gaps = 44/541 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  118   YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  173

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L ++GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  174   NINDVLGNYS---LTLVDALDTLAVMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  230

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF +T TG+PY  +NLK
Sbjct  231   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLK  290

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  291   TGVPPDTNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  350

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  351   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREAC  410

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  411   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  470

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  471   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  528

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  529   CGYATLHHVIDKSTEDRMESFFLSETCKYLYLLFDEDNPVHKSGTRYMFTTEGHIVSV--  586

Query  429   TWHDRLSEAYLPSNWTS-FKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDT  256
                + L E  LP  W   F  E  + R      R  P     HE +  +  S C+ +PD 
Sbjct  587   --DEHLRE--LP--WKEFFSEEGGQDRGGKSVHRPKP-----HELKVINSSSNCNRVPDE  635

Query  255   R  253
             R
Sbjct  636   R  636



>ref|XP_004018659.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like 1 
[Ovis aries]
Length=625

 Score =   390 bits (1003),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 223/492 (45%), Positives = 303/492 (62%), Gaps = 30/492 (6%)
 Frame = -1

Query  1770  RKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSA  1594
             R +M    R MF   Y+NYM HAFP DEL P+  +          NL +  +   YS   
Sbjct  95    RAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRPGGSNLNINDVLGNYS---  151

Query  1593  LTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATD  1414
             LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TD
Sbjct  152   LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITD  211

Query  1413  STNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetst  1246
             S       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK GV  +   ET T
Sbjct  212   SKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCT  271

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFST  1069
             +G GSL++E G LSRL GD  FE  A RA++ LWS+RSS   LLG  +++ TG W+   +
Sbjct  272   AGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWSLRSSDTGLLGNVVNIQTGHWVGKQS  331

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDA  922
             G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y + 
Sbjct  332   GLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLYVNV  391

Query  921   DMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQML  742
             +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+ 
Sbjct  392   NMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQ  449

Query  741   HPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTME  562
              P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++  V    
Sbjct  450   APDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKS  509

Query  561   LEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV-----LSTWHDRLSE  406
              ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V      S W +  SE
Sbjct  510   KEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISVDEHLRESPWKEFFSE  569

Query  405   AYLPSNWTSFKH  370
                P       H
Sbjct  570   EGGPDQVGKSGH  581



>ref|XP_005331023.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Ictidomys tridecemlineatus]
Length=660

 Score =   391 bits (1005),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 232/541 (43%), Positives = 325/541 (60%), Gaps = 44/541 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  121   YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  176

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  177   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  233

Query  1452  LGGLVSAHILATDST---NRLVQGTYKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLK  1285
             LG L+SAH + TDS      +    Y N+LL +A DL  R LPAF +T TG+PY  +NLK
Sbjct  234   LGSLLSAHRIITDSKQPFGDMAIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLK  293

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  294   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  353

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG+W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  354   VNIQTGDWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREAC  413

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  414   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  473

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  474   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  531

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  532   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGSKYMFTTEGHIVSV--  589

Query  429   TWHDRLSEAYLPSNWTS-FKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDT  256
                  L E    S W   F  ++ + +      R  P     HE +  +  S C+ +PD 
Sbjct  590   --DKHLRE----SPWKEFFSEDRGKDQEGKFVHRPKP-----HELKVLNSSSNCNRVPDE  638

Query  255   R  253
             R
Sbjct  639   R  639



>ref|XP_008852801.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Nannospalax galili]
Length=654

 Score =   391 bits (1005),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 220/506 (43%), Positives = 311/506 (61%), Gaps = 25/506 (5%)
 Frame = -1

Query  1770  RKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSA  1594
             R RM    R MF   Y+NYM HAFP DEL P+  +       +  NL +  +   YS   
Sbjct  124   RARMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYS---  180

Query  1593  LTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATD  1414
             LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TD
Sbjct  181   LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITD  240

Query  1413  STNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetst  1246
             S       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK GV  +   ET T
Sbjct  241   SKQPFGDMTIEDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCT  300

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFST  1069
             +G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  +++ TG W+   +
Sbjct  301   AGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWVGKQS  360

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDA  922
             G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y + 
Sbjct  361   GLGAGLDSFYEYLLKSYILFGDKEDLEMFNAAYQSIQSYLRRGREACNEGEGDPPLYVNV  420

Query  921   DMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQML  742
             +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+ 
Sbjct  421   NMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQ  478

Query  741   HPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTME  562
              P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++  V    
Sbjct  479   APDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKS  538

Query  561   LEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLSTWHDRLSEAYLPS  391
              ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V     +   + +   
Sbjct  539   KEDRMESFFLSETCKYLYLLFDEENPVHKSGTKYMFTTEGHIISVDKRLRELPWKEFFSE  598

Query  390   NWTSFKHEKHRKRASAMSQRICPATT  313
             +    + EK   R  +   R+  +++
Sbjct  599   DGERDQEEKFVHRPKSQEFRVVNSSS  624



>ref|XP_006909253.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1, partial [Pteropus alecto]
Length=517

 Score =   387 bits (993),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 213/458 (47%), Positives = 295/458 (64%), Gaps = 25/458 (5%)
 Frame = -1

Query  1749  VRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSALTLIESL  1573
              R MF   Y+NYM HAFP DEL P+  +       +  NL +  +   YS   LTL+++L
Sbjct  2     ARAMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYS---LTLVDAL  58

Query  1572  SSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQ  1393
              +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TDS      
Sbjct  59    DTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSKQPFGD  118

Query  1392  GT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetstSGCGSLI  1225
              T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK GV  +   ET T+G GSL+
Sbjct  119   MTIEDYDNELLHMAHDLAVRLLPAFENTRTGIPYPRVNLKTGVPPDSNNETCTAGAGSLL  178

Query  1224  LEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFSTGIGAGVD  1048
             +E G LSRL GD  FE  A RA++ LWS+RS+   LLG  +D+ TG W+   +G+GAG+D
Sbjct  179   VEFGILSRLLGDSTFEWVARRAVKALWSLRSNDTGLLGNVVDIQTGRWVGKQSGLGAGLD  238

Query  1047  SFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDADMRTGKA  901
             SFYEYL+K+YILFG +E  +MF +AY ++Q + R G           P Y + +M +G+ 
Sbjct  239   SFYEYLLKSYILFGEEEDLEMFNAAYQSIQNHLRRGREACNEGEGDPPLYVNVNMFSGQL  298

Query  900   TYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYY  721
                 + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+  P   +Y
Sbjct  299   MNTWIDSLQAFFPGLQVLMGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQAPDVLFY  356

Query  720   PLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHS  541
             PLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YT+V+ G+A++  V     ED   S
Sbjct  357   PLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTRVKCGYATLHHVIDKSKEDRMES  416

Query  540   FFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV  436
             FFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V
Sbjct  417   FFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHVVSV  454



>ref|XP_004368342.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Trichechus manatus latirostris]
Length=657

 Score =   391 bits (1004),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 229/527 (43%), Positives = 318/527 (60%), Gaps = 38/527 (7%)
 Frame = -1

Query  1770  RKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSA  1594
             R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL +  +   YS   
Sbjct  127   RAQMRDLARGMFAFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYS---  183

Query  1593  LTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATD  1414
             LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TD
Sbjct  184   LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITD  243

Query  1413  STNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetst  1246
             S       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK GV  +   ET T
Sbjct  244   SKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCT  303

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFST  1069
             +G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  +++ TG W+   +
Sbjct  304   AGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGRWVGKQS  363

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDA  922
             G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y + 
Sbjct  364   GLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLYVNV  423

Query  921   DMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQML  742
             +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+ 
Sbjct  424   NMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQ  481

Query  741   HPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTME  562
              P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++  V    
Sbjct  482   APDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKS  541

Query  561   LEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLSTWHDRLSEAYLPS  391
              ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V     D+L      S
Sbjct  542   KEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIVSV-----DKLLRE---S  593

Query  390   NWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDTR  253
              W  F  E+  +               SHE +  +  S C+ +PD R
Sbjct  594   PWKEFFSEEGEQDQEGKPMH----RPRSHEVKVINSSSNCNRVPDER  636



>ref|XP_533753.2| PREDICTED: ER degradation enhancer, mannosidase alpha-like 1 
[Canis lupus familiaris]
Length=670

 Score =   391 bits (1005),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 223/493 (45%), Positives = 307/493 (62%), Gaps = 34/493 (7%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  131   YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRVDPSNL  186

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  187   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  243

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  244   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLK  303

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  304   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  363

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  364   VNIQTGRWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYRSIQNYLRRGREAC  423

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  424   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  483

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  484   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  541

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV--  436
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  542   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTKYMFTTEGHIVSVDK  601

Query  435   ---LSTWHDRLSE  406
                 S W +  SE
Sbjct  602   HLRESPWKEFFSE  614



>ref|XP_006846688.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Chrysochloris asiatica]
Length=657

 Score =   391 bits (1004),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 233/529 (44%), Positives = 322/529 (61%), Gaps = 42/529 (8%)
 Frame = -1

Query  1770  RKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSA  1594
             R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL +  +   YS   
Sbjct  127   RAQMRDLARGMFVFGYDNYMAHAFPEDELNPIHCRGRGPDRGDPSNLNINDVLGNYS---  183

Query  1593  LTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATD  1414
             LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TD
Sbjct  184   LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITD  243

Query  1413  STNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetst  1246
             S       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK GV  +   ET T
Sbjct  244   SKQPFGDMTIEDYDNELLHMARDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCT  303

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFST  1069
             +G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  +++ TG W+   +
Sbjct  304   AGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWVGKQS  363

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDA  922
             G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y + 
Sbjct  364   GLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLYVNV  423

Query  921   DMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQML  742
             +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+ 
Sbjct  424   NMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQ  481

Query  741   HPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTME  562
              P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+ G+A++  V    
Sbjct  482   APDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKS  541

Query  561   LEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLSTWHDR-LSEAYLP  394
              ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V     DR L E    
Sbjct  542   KEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISV-----DRHLRE----  592

Query  393   SNWTSFKHEKHRKRASAMSQRICPA-TTLSHEQEYQHLESACH-IPDTR  253
             S W  F  E+  +      Q   P   T SH+ +  +  S C+ +PD R
Sbjct  593   SPWKEFFSEEGEQ-----DQEGKPVHRTKSHDVKVINASSNCNRVPDER  636



>gb|EFX90244.1| hypothetical protein DAPPUDRAFT_190238 [Daphnia pulex]
Length=591

 Score =   389 bits (998),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 226/527 (43%), Positives = 316/527 (60%), Gaps = 45/527 (9%)
 Frame = -1

Query  1770  RKRMSQKVRKMFYHAYENYMMHAFPHDELKP-LTKTYTDSLSELGNLKLEHLPQKYSGSA  1594
             R  M  + +KMFY  Y+NYM  AFP DEL P L            N+ +  +   YS   
Sbjct  51    RLEMVNETKKMFYFGYDNYMNLAFPMDELNPILCSGRGPDYDNPSNININDVLGNYS---  107

Query  1593  LTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATD  1414
             LTLI+SL +L+I+GN +EF++AV  +  N+SF+ D+ I +FE +IR+LGGL+SAH+L  D
Sbjct  108   LTLIDSLDTLLIMGNISEFKRAVKLVIENVSFEQDSTIQVFEASIRLLGGLLSAHLLIID  167

Query  1413  S---TNRLVQGTYKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetst  1246
             +      L    Y N+LLD+A DL  R LPAFD T TG+P+  ++L  GV     TET T
Sbjct  168   NFKYLGDLELDDYDNELLDMAHDLAARLLPAFDNTKTGIPHPRVHLINGVPVEGITETCT  227

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRS-SLNLLGTTLDVATGEWIEFST  1069
             +G G+L++E G LSRL  DP++E  A RA++ LW +++    LLG TLD+ TG+W    +
Sbjct  228   AGAGTLLVEFGILSRLIKDPVYENYARRAVKSLWDLKNKDTGLLGNTLDIQTGQWTGQLS  287

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDA  922
             GIGAG+DS+YEYL+K++ILF   E  + FQS+Y  ++ Y R G           P Y + 
Sbjct  288   GIGAGMDSYYEYLLKSFILFNEPEDLETFQSSYETIKAYLRKGRQKCNDGDGEHPIYVNV  347

Query  921   DMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQML  742
             DM+ G  +   + +LQA + G+QVL GDV+ A  SH  +F VWKK+  +PER+  + Q  
Sbjct  348   DMKNGATSTTWIDALQASFAGLQVLYGDVEEAICSHALYFAVWKKWDAIPERF--NWQRK  405

Query  741   HPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTME  562
              P   +YPLRPEFAEST+ LYQATK+P+Y+ VG+ I+ SLN Y +   G+A++  V    
Sbjct  406   EPDVSFYPLRPEFAESTYLLYQATKNPFYLRVGQAILESLNLYARAPCGYATLHSVIDKS  465

Query  561   LEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS-----TWHDRLSE  406
              ED   SFFL+ETCKYLYLLFD    +N N   Y+FTTEGH +P+ S      W D   +
Sbjct  466   QEDRMESFFLSETCKYLYLLFDIHHPINTNAERYLFTTEGHVIPITSALRPFNWDDDEVD  525

Query  405   AY----LPSNWTSFKHEKHRKRAS---------AMSQRICPATTLSH  304
             ++    LPS  + + H +H  R S           + R+C +  L H
Sbjct  526   SHTGRLLPS--SRYSHRRHASRVSDSDVVAVPNNSTHRVCSSVQLEH  570



>ref|XP_005066228.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Mesocricetus auratus]
Length=652

 Score =   390 bits (1003),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 224/519 (43%), Positives = 316/519 (61%), Gaps = 29/519 (6%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  113   YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIYCRGRGPDRGDPSNL  168

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  169   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  225

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  226   LGSLLSAHRIITDSRQPFGDMTIEDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLK  285

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  286   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNNTGLLGNV  345

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  346   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREAC  405

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  406   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  465

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  466   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  523

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  524   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISVDK  583

Query  429   TWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATT  313
                +   + +   +    + EK   R  +   RI  +++
Sbjct  584   RLRELPWKEFFSEDGERDQEEKFEHRPKSQELRIINSSS  622



>ref|XP_009237052.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Pongo abelii]
Length=655

 Score =   390 bits (1003),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 235/541 (43%), Positives = 325/541 (60%), Gaps = 44/541 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  116   YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  171

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  172   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  228

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF +T TG+PY  +NLK
Sbjct  229   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLK  288

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  289   TGVPPDTNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  348

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  349   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREAC  408

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  409   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  468

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  469   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  526

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  527   CGYATLHHVIDKSTEDRMESFFLSETCKYLYLLFDEDNPVHKSGTRYMFTTEGHIVSV--  584

Query  429   TWHDRLSEAYLPSNWTS-FKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDT  256
                + L E  LP  W   F  E  + +      R  P     HE +  +  S C+ +PD 
Sbjct  585   --DEHLRE--LP--WKEFFSEEGGQDQGGKSVHRPKP-----HELKVINSSSNCNRVPDE  633

Query  255   R  253
             R
Sbjct  634   R  634



>ref|XP_005149497.1| PREDICTED: LOW QUALITY PROTEIN: ER degradation-enhancing alpha-mannosidase-like 
protein 1 [Melopsittacus undulatus]
Length=613

 Score =   389 bits (1000),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 222/495 (45%), Positives = 305/495 (62%), Gaps = 31/495 (6%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL---TKTYTDSLSELG  1639
             +SG  PP      R R+    R MF  +Y++YM HAFP DEL PL    +          
Sbjct  78    YSGAXPPQ----LRARLRDAARGMFVFSYDSYMQHAFPRDELDPLHCRGRGPDRGDPVRS  133

Query  1638  NLKLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNI  1459
             NL +  +   YS   LTLI++L +L ++GN +EF+KAV  +   +SFD D+ + +FE  I
Sbjct  134   NLNINDVLGNYS---LTLIDALDTLAVMGNSSEFQKAVKLVIDTVSFDKDSTVQVFEATI  190

Query  1458  RVLGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWIN  1291
             RVLG L+SAHI+ TD+       T   Y N+LL +A DL  R LPAF +T TG+PY  +N
Sbjct  191   RVLGSLLSAHIIITDTKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVN  250

Query  1290  LKRGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLG  1114
             LK GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LWS+RS+   LLG
Sbjct  251   LKNGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWSLRSNNTGLLG  310

Query  1113  TTLDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG--  940
               +++ TG W+   +G+GAG DSFYEYL+K+YILFG  E  +MF  AY  +Q + R G  
Sbjct  311   NVVNIQTGHWVGKQSGLGAGSDSFYEYLLKSYILFGEKEDLEMFNDAYQNIQNHLRRGRE  370

Query  939   ---------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKK  787
                      P Y + +M TG+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK+
Sbjct  371   ACNEGEGDPPLYVNVNMFTGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKR  430

Query  786   FGVLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTK  607
             +G LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTK
Sbjct  431   YGALPERY--NWQLQAPDVPFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTK  488

Query  606   VQGGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV  436
              + G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V
Sbjct  489   AKCGYATLHHVVEKTKEDRMESFFLSETCKYLYLLFDEENPVHKSGNKYMFTTEGHIVTV  548

Query  435   LSTWHDRLSEAYLPS  391
                + + L +  LP 
Sbjct  549   DERFRNSLWQDILPG  563



>ref|NP_055489.1| ER degradation-enhancing alpha-mannosidase-like protein 1 [Homo 
sapiens]
 sp|Q92611.1|EDEM1_HUMAN RecName: Full=ER degradation-enhancing alpha-mannosidase-like 
protein 1 [Homo sapiens]
 gb|AAH19088.1| ER degradation enhancer, mannosidase alpha-like 1 [Homo sapiens]
 gb|EAW63925.1| ER degradation enhancer, mannosidase alpha-like 1, isoform CRA_a 
[Homo sapiens]
 gb|EAW63926.1| ER degradation enhancer, mannosidase alpha-like 1, isoform CRA_a 
[Homo sapiens]
 gb|ABM83604.1| ER degradation enhancer, mannosidase alpha-like 1 [synthetic 
construct]
 gb|ABM86847.1| ER degradation enhancer, mannosidase alpha-like 1 [synthetic 
construct]
 dbj|BAF85332.1| unnamed protein product [Homo sapiens]
 dbj|BAG09658.1| ER degradation-enhancing alpha-mannosidase-like 1 [synthetic 
construct]
Length=657

 Score =   390 bits (1003),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 235/541 (43%), Positives = 325/541 (60%), Gaps = 44/541 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  118   YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  173

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  174   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  230

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF +T TG+PY  +NLK
Sbjct  231   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLK  290

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  291   TGVPPDTNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  350

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  351   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREAC  410

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  411   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  470

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  471   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  528

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  529   CGYATLHHVIDKSTEDRMESFFLSETCKYLYLLFDEDNPVHKSGTRYMFTTEGHIVSV--  586

Query  429   TWHDRLSEAYLPSNWTS-FKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDT  256
                + L E  LP  W   F  E  + +      R  P     HE +  +  S C+ +PD 
Sbjct  587   --DEHLRE--LP--WKEFFSEEGGQDQGGKSVHRPKP-----HELKVINSSSNCNRVPDE  635

Query  255   R  253
             R
Sbjct  636   R  636



>ref|XP_007192550.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 isoform X2 [Balaenoptera acutorostrata scammoni]
Length=528

 Score =   386 bits (992),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 227/525 (43%), Positives = 316/525 (60%), Gaps = 40/525 (8%)
 Frame = -1

Query  1761  MSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSALTL  1585
             M    R MF   Y+NYM HAFP DEL P+  +       +  NL +  +   YS   LTL
Sbjct  1     MRDLARGMFVFGYDNYMAHAFPEDELNPIHCRGRGPDRGDPSNLNINDVLGNYS---LTL  57

Query  1584  IESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTN  1405
             +++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TDS  
Sbjct  58    VDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSKQ  117

Query  1404  RLVQGT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLKRGVMQNettetstSGC  1237
                  T   Y N+LL +A DL  R LPAF +T TG+PY  +NLK GV  +   ET T+G 
Sbjct  118   PFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCTAGA  177

Query  1236  GSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFSTGIG  1060
             GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  +++ TG W+   +G+G
Sbjct  178   GSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWVGKQSGLG  237

Query  1059  AGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDADMR  913
             AG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y + +M 
Sbjct  238   AGLDSFYEYLLKSYILFGEKEDLEMFNAAYKSIQNYLRRGREACNEGEGDPPLYVNVNMF  297

Query  912   TGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPT  733
             +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+  P 
Sbjct  298   SGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQAPD  355

Query  732   EKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELED  553
               +YPLRPE  EST+ LYQAT++P+Y+ VG  I+ SL ++TKV+ G+A++  V     ED
Sbjct  356   VFFYPLRPELVESTYLLYQATRNPFYLHVGMDILQSLEKHTKVKCGYATLHHVIDKSTED  415

Query  552   HQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLSTWHDRLSEAYLPSNWT  382
                SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V         E    S W 
Sbjct  416   RMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISV--------DEHLRESPWK  467

Query  381   SFKHEKHRKRASAMS-QRICPATTLSHEQEYQHLESACH-IPDTR  253
              F  E+  +     S  R  P     HE +  +  S C+ +PD R
Sbjct  468   EFFSEEGGQGPVGKSGHRPRP-----HELKVINSSSNCNRVPDER  507



>ref|XP_002758636.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Callithrix jacchus]
Length=657

 Score =   390 bits (1003),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 235/541 (43%), Positives = 327/541 (60%), Gaps = 44/541 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  118   YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  173

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  174   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDRDSTVQVFEATIRV  230

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF +T TG+P+  +NLK
Sbjct  231   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLYMAHDLAVRLLPAFENTKTGIPFPRVNLK  290

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  291   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  350

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  351   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREAC  410

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  411   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  470

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  471   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  528

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  529   CGYATLHHVIDKSTEDRMESFFLSETCKYLYLLFDEDNPVHKSGTRYMFTTEGHIISV--  586

Query  429   TWHDRLSEAYLPSNWTSFKHEKHRKRASAMS-QRICPATTLSHEQEYQHLESACH-IPDT  256
                + L E  LP  W  F  E+  +     S  R+ P     HE +  +  S C+ +PD 
Sbjct  587   --DEHLRE--LP--WKEFFSEEGGQDQEGRSVHRLKP-----HELKVINSSSNCNRVPDE  635

Query  255   R  253
             R
Sbjct  636   R  636



>dbj|BAA13203.2| KIAA0212 [Homo sapiens]
Length=666

 Score =   390 bits (1003),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 235/541 (43%), Positives = 325/541 (60%), Gaps = 44/541 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  127   YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  182

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  183   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  239

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF +T TG+PY  +NLK
Sbjct  240   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLK  299

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  300   TGVPPDTNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  359

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  360   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREAC  419

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  420   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  479

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  480   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  537

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  538   CGYATLHHVIDKSTEDRMESFFLSETCKYLYLLFDEDNPVHKSGTRYMFTTEGHIVSV--  595

Query  429   TWHDRLSEAYLPSNWTS-FKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDT  256
                + L E  LP  W   F  E  + +      R  P     HE +  +  S C+ +PD 
Sbjct  596   --DEHLRE--LP--WKEFFSEEGGQDQGGKSVHRPKP-----HELKVINSSSNCNRVPDE  644

Query  255   R  253
             R
Sbjct  645   R  645



>ref|XP_003473504.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Cavia porcellus]
Length=660

 Score =   390 bits (1003),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 234/540 (43%), Positives = 323/540 (60%), Gaps = 42/540 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+          +  NL
Sbjct  121   YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCCGRGPDRGDPSNL  176

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  177   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  233

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  234   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLK  293

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  294   TGVPPDSRNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  353

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG +E  +MF +AY ++Q Y R G    
Sbjct  354   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEEEDLEMFNAAYQSIQNYLRRGREAC  413

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  414   NEGVGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  473

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPER+  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  474   ALPERF--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  531

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  532   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISV--  589

Query  429   TWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDTR  253
                  L E    S W  F  E  R+      Q        SHE +  +  S C+ +PD R
Sbjct  590   --DKHLRE----SPWKEFFSEDERQN----QQGKFVHRPKSHELKVINSSSNCNRVPDER  639



>tpg|DAA17085.1| TPA: ER degradation enhancer, mannosidase alpha-like 1 [Bos taurus]
Length=658

 Score =   390 bits (1002),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 222/492 (45%), Positives = 304/492 (62%), Gaps = 30/492 (6%)
 Frame = -1

Query  1770  RKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSA  1594
             R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL +  +   YS   
Sbjct  128   RAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYS---  184

Query  1593  LTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATD  1414
             LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TD
Sbjct  185   LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITD  244

Query  1413  STNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetst  1246
             S       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK GV  +   ET T
Sbjct  245   SKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDSNNETCT  304

Query  1245  SGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFST  1069
             +G GSL++E G LSRL GD  FE  A RA++ LWS+RSS   LLG  +++ TG W+   +
Sbjct  305   AGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWSLRSSDTGLLGNVVNIQTGHWVGKQS  364

Query  1068  GIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDA  922
             G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G           P Y + 
Sbjct  365   GLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLYVNV  424

Query  921   DMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQML  742
             +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+ 
Sbjct  425   NMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQ  482

Query  741   HPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTME  562
              P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL ++TKV+ G+A++  V    
Sbjct  483   APDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKHTKVKCGYATLHHVIDKS  542

Query  561   LEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV-----LSTWHDRLSE  406
              ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V      S W +  SE
Sbjct  543   KEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISVDEHLRESPWKEFFSE  602

Query  405   AYLPSNWTSFKH  370
                P       H
Sbjct  603   EGGPDQVGKSGH  614



>ref|XP_004033576.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like 1 
[Gorilla gorilla gorilla]
Length=657

 Score =   390 bits (1002),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 236/541 (44%), Positives = 326/541 (60%), Gaps = 44/541 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  118   YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  173

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  174   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  230

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF +T TG+PY  +NLK
Sbjct  231   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLK  290

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  291   TGVPPDTNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  350

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  351   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREAC  410

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  411   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  470

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  471   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  528

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  529   CGYATLHHVIDKSTEDRMESFFLSETCKYLYLLFDEDNPVHKSGTRYMFTTEGHIVSV--  586

Query  429   TWHDRLSEAYLPSNWTSFKHEKHRKRASAMS-QRICPATTLSHEQEYQHLESACH-IPDT  256
                + L E  LP  W  F  E+  +     S  R  P     HE +  +  S C+ +PD 
Sbjct  587   --DEHLRE--LP--WKEFFSEEGGQDQGGRSVHRPKP-----HELKVINSSSNCNRVPDE  635

Query  255   R  253
             R
Sbjct  636   R  636



>ref|XP_006985094.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Peromyscus maniculatus bairdii]
Length=648

 Score =   390 bits (1001),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 235/541 (43%), Positives = 325/541 (60%), Gaps = 44/541 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  109   YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIYCRGRGPDRGDPSNL  164

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  165   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  221

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  222   LGSLLSAHRIITDSRQPFGDMTIEDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLK  281

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  282   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNNTGLLGNV  341

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  342   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQSYLRRGREAC  401

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  402   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  461

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  462   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  519

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  520   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISV--  577

Query  429   TWHDRLSEAYLPSNWTS-FKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDT  256
                 RL E  LP  W   F  +  R +      R     + S E +  +  S C+ +PD 
Sbjct  578   --DKRLRE--LP--WKEFFSEDGERDQEEKFVHR-----SKSQELKIINSSSNCNRVPDE  626

Query  255   R  253
             R
Sbjct  627   R  627



>ref|XP_007530015.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Erinaceus europaeus]
Length=515

 Score =   385 bits (989),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 215/474 (45%), Positives = 301/474 (64%), Gaps = 32/474 (7%)
 Frame = -1

Query  1761  MSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSALTL  1585
             M  + R MF   Y+NYM HAFP DEL P+  +       +  NL +  +   YS   LTL
Sbjct  1     MRDRARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRRDPSNLNINDVLGNYS---LTL  57

Query  1584  IESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDST-  1408
             +++L +L I+GN +EF KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TD+  
Sbjct  58    VDALDTLAIMGNSSEFRKAVRLVIDTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDARQ  117

Query  1407  ---NRLVQGTYKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetstSG  1240
                +  V+G Y N+LL +A DL  R LPAF+ T TG+PY  +NLK GV  +   ET T+G
Sbjct  118   PFGDMTVKG-YDNELLHMAHDLAVRLLPAFENTRTGIPYPRVNLKTGVPPDSNNETCTAG  176

Query  1239  CGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFSTGI  1063
              GSL++E G LSRL GD  FE  A RA++ LW +RS+   LLG  +++ TG W+   +G+
Sbjct  177   AGSLLVEFGILSRLLGDSTFEWVARRAVKALWDLRSNDTGLLGNVVNIQTGHWVGRQSGL  236

Query  1062  GAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDADM  916
             GAG+DSFYEYL+KAYILFG +E  +MF +AY ++Q Y R G           P Y + +M
Sbjct  237   GAGLDSFYEYLLKAYILFGEEEDLRMFNAAYRSIQSYLRRGREACNEGEGDPPLYVNVNM  296

Query  915   RTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHP  736
              +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +W+++G LPER+  + Q+  P
Sbjct  297   FSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWRRYGALPERF--NWQLQAP  354

Query  735   TEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELE  556
                +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL Q+T+V+ G+A++  V     E
Sbjct  355   DVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEQHTRVKCGYATLHHVIDKSKE  414

Query  555   DHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV-----LSTWHD  418
             D   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V      S W D
Sbjct  415   DRMESFFLSETCKYLYLLFDEENPVHQSGTRYMFTTEGHVVSVDEPLRESPWKD  468



>ref|NP_001252679.1| ER degradation-enhancing alpha-mannosidase-like 1 [Macaca mulatta]
 ref|XP_005547728.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 isoform X1 [Macaca fascicularis]
Length=657

 Score =   390 bits (1001),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 234/541 (43%), Positives = 325/541 (60%), Gaps = 44/541 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  118   YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  173

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L ++GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  174   NINDVLGNYS---LTLVDALDTLAVMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  230

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF +T TG+PY  +NLK
Sbjct  231   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLK  290

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  291   TGVPPDTNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  350

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  351   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREAC  410

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  411   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  470

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  471   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  528

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  529   CGYATLHHVIDKSTEDRMESFFLSETCKYLYLLFDEDNPVHKSGTRYMFTTEGHIVSV--  586

Query  429   TWHDRLSEAYLPSNWTS-FKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDT  256
                + L E  LP  W   F  E  + +      R  P     HE +  +  S C+ +PD 
Sbjct  587   --DEHLRE--LP--WKEFFSEEGGQDQGGKSVHRPKP-----HELKVINSSSNCNRVPDE  635

Query  255   R  253
             R
Sbjct  636   R  636



>ref|NP_619618.1| ER degradation-enhancing alpha-mannosidase-like protein 1 [Mus 
musculus]
 sp|Q925U4.1|EDEM1_MOUSE RecName: Full=ER degradation-enhancing alpha-mannosidase-like 
protein 1 [Mus musculus]
 dbj|BAB55676.1| EDEM [Mus musculus]
 dbj|BAC38688.1| unnamed protein product [Mus musculus]
 gb|AAH23237.2| ER degradation enhancer, mannosidase alpha-like 1 [Mus musculus]
Length=652

 Score =   390 bits (1001),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 223/519 (43%), Positives = 316/519 (61%), Gaps = 29/519 (6%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  113   YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIYCRGRGPDRGDPSNL  168

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  169   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  225

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  226   LGSLLSAHRIITDSKQPFGDMTIEDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLK  285

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  286   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  345

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  346   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQSYLRRGREAC  405

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  406   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  465

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  466   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  523

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  524   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISVDK  583

Query  429   TWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATT  313
                +   + +   +    + EK   R  +   R+  +++
Sbjct  584   RLRELPWKEFFSEDGERDQEEKFVHRPKSQELRVINSSS  622



>ref|XP_007983267.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Chlorocebus sabaeus]
Length=657

 Score =   390 bits (1001),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 234/541 (43%), Positives = 325/541 (60%), Gaps = 44/541 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  118   YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  173

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L ++GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  174   NINDVLGNYS---LTLVDALDTLAVMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  230

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF +T TG+PY  +NLK
Sbjct  231   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLK  290

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  291   TGVPPDTNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  350

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  351   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREAC  410

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  411   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  470

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  471   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  528

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  529   CGYATLHHVIDKSTEDRMESFFLSETCKYLYLLFDEDNPVHKSGTRYMFTTEGHIVSV--  586

Query  429   TWHDRLSEAYLPSNWTS-FKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDT  256
                + L E  LP  W   F  E  + +      R  P     HE +  +  S C+ +PD 
Sbjct  587   --DEHLRE--LP--WKEFFSEEGGQDQGGKSVHRPKP-----HELKVINSSSNCNRVPDE  635

Query  255   R  253
             R
Sbjct  636   R  636



>ref|XP_003894203.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Papio anubis]
Length=657

 Score =   390 bits (1001),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 234/541 (43%), Positives = 325/541 (60%), Gaps = 44/541 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  118   YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  173

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L ++GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  174   NINDVLGNYS---LTLVDALDTLAVMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  230

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF +T TG+PY  +NLK
Sbjct  231   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLK  290

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  291   TGVPPDTNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  350

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  351   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREAC  410

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  411   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  470

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  471   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  528

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  529   CGYATLHHVIDKSTEDRMESFFLSETCKYLYLLFDEDNPVHKSGTRYMFTTEGHIVSV--  586

Query  429   TWHDRLSEAYLPSNWTS-FKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPDT  256
                + L E  LP  W   F  E  + +      R  P     HE +  +  S C+ +PD 
Sbjct  587   --DEHLRE--LP--WKEFFSEEGGQDQGGKSVHRPKP-----HELKVINSSSNCNRVPDE  635

Query  255   R  253
             R
Sbjct  636   R  636



>ref|XP_004399487.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Odobenus rosmarus divergens]
Length=658

 Score =   390 bits (1001),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 223/493 (45%), Positives = 306/493 (62%), Gaps = 34/493 (7%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  119   YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNL  174

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  175   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVIDTVSFDKDSTVQVFEATIRV  231

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  232   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTKTGIPYPRVNLK  291

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW +RS+   LLG  
Sbjct  292   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWDLRSNDTGLLGNV  351

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  352   VNIQTGRWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYRSIQNYLRRGREAC  411

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  412   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  471

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  472   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  529

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV--  436
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  530   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTKYMFTTEGHIVSVDK  589

Query  435   ---LSTWHDRLSE  406
                 S W +  SE
Sbjct  590   HLRESPWKEFFSE  602



>ref|XP_004274830.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1 [Orcinus orca]
Length=660

 Score =   390 bits (1001),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 234/542 (43%), Positives = 323/542 (60%), Gaps = 46/542 (8%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  121   YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPEDELNPIHCRGRGPDRGDPSNL  176

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  177   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  233

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  234   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTRTGIPYPRVNLK  293

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  294   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  353

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF + Y ++Q Y R G    
Sbjct  354   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAVYKSIQNYLRRGREAC  413

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  414   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  473

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  474   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  531

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  532   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIVSV--  589

Query  429   TWHDRLSEAYL-PSNWTS-FKHEKHRKRASAMSQRICPATTLSHEQEYQHLESACH-IPD  259
                    +A+L  S W   F  E  R        R  P     HE +  +  S C+ +PD
Sbjct  590   -------DAHLRESPWKEFFSEEGGRDPVGKSGHRPRP-----HELKVINSSSNCNRVPD  637

Query  258   TR  253
              R
Sbjct  638   ER  639



>gb|ELK15172.1| ER degradation-enhancing alpha-mannosidase-like 1 [Pteropus alecto]
Length=513

 Score =   385 bits (988),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 212/455 (47%), Positives = 294/455 (65%), Gaps = 25/455 (5%)
 Frame = -1

Query  1740  MFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNLKLEHLPQKYSGSALTLIESLSSL  1564
             MF   Y+NYM HAFP DEL P+  +       +  NL +  +   YS   LTL+++L +L
Sbjct  1     MFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYS---LTLVDALDTL  57

Query  1563  VILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRVLGGLVSAHILATDSTNRLVQGT-  1387
              I+GN +EF+KAV  +   +SFD D+ + +FE  IRVLG L+SAH + TDS       T 
Sbjct  58    AIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSKQPFGDMTI  117

Query  1386  --YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLKRGVMQNettetstSGCGSLILEM  1216
               Y N+LL +A DL  R LPAF+ T TG+PY  +NLK GV  +   ET T+G GSL++E 
Sbjct  118   EDYDNELLHMAHDLAVRLLPAFENTRTGIPYPRVNLKTGVPPDSNNETCTAGAGSLLVEF  177

Query  1215  GALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTTLDVATGEWIEFSTGIGAGVDSFY  1039
             G LSRL GD  FE  A RA++ LWS+RS+   LLG  +D+ TG W+   +G+GAG+DSFY
Sbjct  178   GILSRLLGDSTFEWVARRAVKALWSLRSNDTGLLGNVVDIQTGRWVGKQSGLGAGLDSFY  237

Query  1038  EYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG-----------PWYHDADMRTGKATYW  892
             EYL+K+YILFG +E  +MF +AY ++Q + R G           P Y + +M +G+    
Sbjct  238   EYLLKSYILFGEEEDLEMFNAAYQSIQNHLRRGREACNEGEGDPPLYVNVNMFSGQLMNT  297

Query  891   QLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFGVLPERYLLDHQMLHPTEKYYPLR  712
              + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G LPERY  + Q+  P   +YPLR
Sbjct  298   WIDSLQAFFPGLQVLMGDVEDAICLHAFYYAIWKRYGALPERY--NWQLQAPDVLFYPLR  355

Query  711   PEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQGGFASVRDVTTMELEDHQHSFFL  532
             PE  EST+ LYQATK+P+Y+ VG  I+ SL +YT+V+ G+A++  V     ED   SFFL
Sbjct  356   PELVESTYLLYQATKNPFYLHVGMDILQSLEKYTRVKCGYATLHHVIDKSKEDRMESFFL  415

Query  531   AETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV  436
             +ETCKYLYLLFD+   V+++   Y+FTTEGH + V
Sbjct  416   SETCKYLYLLFDEENPVHKSGTRYMFTTEGHVVSV  450



>ref|XP_004329289.1| PREDICTED: ER degradation-enhancing alpha-mannosidase-like protein 
1-like, partial [Tursiops truncatus]
Length=597

 Score =   387 bits (995),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 222/493 (45%), Positives = 306/493 (62%), Gaps = 34/493 (7%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  87    YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPEDELNPIHCRGRGPDRGDPSNL  142

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  143   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  199

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAF-DTPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF +T TG+PY  +NLK
Sbjct  200   LGSLLSAHRIITDSKQPFGDMTIKDYDNELLHMAHDLAVRLLPAFENTRTGIPYPRVNLK  259

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  260   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  319

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF + Y ++Q Y R G    
Sbjct  320   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAVYKSIQNYLRRGREAC  379

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  380   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  439

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  440   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  497

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPV--  436
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  498   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIVSVDA  557

Query  435   ---LSTWHDRLSE  406
                 S W +  SE
Sbjct  558   HLRESPWKEFFSE  570



>dbj|BAC97900.1| mKIAA0212 protein [Mus musculus]
Length=674

 Score =   390 bits (1001),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 223/519 (43%), Positives = 316/519 (61%), Gaps = 29/519 (6%)
 Frame = -1

Query  1809  FSGFDPPNPMAARRKRMSQKVRKMFYHAYENYMMHAFPHDELKPL-TKTYTDSLSELGNL  1633
             +SG  PP      R +M    R MF   Y+NYM HAFP DEL P+  +       +  NL
Sbjct  135   YSGAFPPQ----LRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIYCRGRGPDRGDPSNL  190

Query  1632  KLEHLPQKYSGSALTLIESLSSLVILGNHTEFEKAVLWLSVNLSFDVDARINLFECNIRV  1453
              +  +   YS   LTL+++L +L I+GN +EF+KAV  +   +SFD D+ + +FE  IRV
Sbjct  191   NINDVLGNYS---LTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRV  247

Query  1452  LGGLVSAHILATDSTNRLVQGT---YKNQLLDLAEDLGRRFLPAFD-TPTGLPYAWINLK  1285
             LG L+SAH + TDS       T   Y N+LL +A DL  R LPAF+ T TG+PY  +NLK
Sbjct  248   LGSLLSAHRIITDSKQPFGDMTIEDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLK  307

Query  1284  RGVMQNettetstSGCGSLILEMGALSRLTGDPIFEIAALRALRKLWSMRSS-LNLLGTT  1108
              GV  +   ET T+G GSL++E G LSRL GD  FE  A RA++ LW++RS+   LLG  
Sbjct  308   TGVPPDSNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV  367

Query  1107  LDVATGEWIEFSTGIGAGVDSFYEYLVKAYILFGGDEFWKMFQSAYLAVQKYFRHG----  940
             +++ TG W+   +G+GAG+DSFYEYL+K+YILFG  E  +MF +AY ++Q Y R G    
Sbjct  368   VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQSYLRRGREAC  427

Query  939   -------PWYHDADMRTGKATYWQLTSLQAFWPGVQVLVGDVDAANSSHREFFHVWKKFG  781
                    P Y + +M +G+     + SLQAF+PG+QVL+GDV+ A   H  ++ +WK++G
Sbjct  428   NEGEGDPPLYVNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYG  487

Query  780   VLPERYLLDHQMLHPTEKYYPLRPEFAESTFYLYQATKDPWYMEVGELIINSLNQYTKVQ  601
              LPERY  + Q+  P   +YPLRPE  EST+ LYQATK+P+Y+ VG  I+ SL +YTKV+
Sbjct  488   ALPERY--NWQLQAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVK  545

Query  600   GGFASVRDVTTMELEDHQHSFFLAETCKYLYLLFDDSFLVNRN---YIFTTEGHPLPVLS  430
              G+A++  V     ED   SFFL+ETCKYLYLLFD+   V+++   Y+FTTEGH + V  
Sbjct  546   CGYATLHHVIDKSKEDRMESFFLSETCKYLYLLFDEENPVHKSGTRYMFTTEGHIISVDK  605

Query  429   TWHDRLSEAYLPSNWTSFKHEKHRKRASAMSQRICPATT  313
                +   + +   +    + EK   R  +   R+  +++
Sbjct  606   RLRELPWKEFFSEDGERDQEEKFVHRPKSQELRVINSSS  644



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5845906598316