BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18433_g2_i2 len=1059 path=[2289:0-29 1283:30-1058]

Length=1059
                                                                      Score     E

ref|XP_009614965.1|  PREDICTED: putative late blight resistance p...    195   4e-52   
ref|XP_004238948.1|  PREDICTED: putative late blight resistance p...    194   1e-51   
ref|XP_009772243.1|  PREDICTED: putative late blight resistance p...    191   1e-50   
ref|XP_006362574.1|  PREDICTED: putative late blight resistance p...    189   4e-50   
ref|XP_009776048.1|  PREDICTED: putative late blight resistance p...    186   8e-49   
ref|XP_006362572.1|  PREDICTED: disease resistance protein RPP13-...    179   9e-49   
ref|NP_001234202.1|  NRC1                                               184   3e-48   
ref|XP_009618298.1|  PREDICTED: disease resistance protein RPP13-...    182   3e-48   
ref|XP_004248798.1|  PREDICTED: putative late blight resistance p...    182   2e-47   
ref|XP_009624787.1|  PREDICTED: putative late blight resistance p...    180   7e-47   
ref|XP_009769019.1|  PREDICTED: putative late blight resistance p...    180   9e-47   
ref|XP_006359790.1|  PREDICTED: putative late blight resistance p...    179   1e-46   
gb|EYU29956.1|  hypothetical protein MIMGU_mgv1a001088mg                172   4e-44   
ref|XP_009774012.1|  PREDICTED: putative late blight resistance p...    167   5e-42   
ref|XP_011070823.1|  PREDICTED: putative late blight resistance p...    166   9e-42   
gb|AGX27500.1|  NBS-LRR class resistance protein Fy2-Ry2                166   9e-42   
ref|XP_009793189.1|  PREDICTED: putative late blight resistance p...    166   1e-41   
ref|XP_009614364.1|  PREDICTED: putative late blight resistance p...    163   7e-41   
emb|CDP05558.1|  unnamed protein product                                154   2e-37   
emb|CDP18959.1|  unnamed protein product                                151   1e-36   
emb|CDP16255.1|  unnamed protein product                                151   1e-36   
ref|XP_004248175.2|  PREDICTED: putative late blight resistance p...    148   2e-35   
ref|XP_009793040.1|  PREDICTED: putative late blight resistance p...    146   5e-35   
ref|XP_009630520.1|  PREDICTED: putative late blight resistance p...    146   5e-35   
ref|XP_009761103.1|  PREDICTED: putative late blight resistance p...    145   9e-35   
ref|XP_006366307.1|  PREDICTED: putative late blight resistance p...    145   9e-35   
ref|XP_009788462.1|  PREDICTED: putative late blight resistance p...    145   1e-34   
ref|XP_009594795.1|  PREDICTED: putative late blight resistance p...    145   2e-34   
ref|XP_006367931.1|  PREDICTED: putative late blight resistance p...    144   3e-34   
ref|XP_004234046.1|  PREDICTED: putative late blight resistance p...    144   4e-34   
emb|CDP00592.1|  unnamed protein product                                142   2e-33   
ref|XP_006367930.1|  PREDICTED: putative late blight resistance p...    141   3e-33   
ref|XP_011070551.1|  PREDICTED: putative late blight resistance p...    140   1e-32   
ref|XP_011072124.1|  PREDICTED: putative late blight resistance p...    138   1e-32   
ref|XP_009617443.1|  PREDICTED: putative disease resistance prote...    132   3e-32   
emb|CDP00590.1|  unnamed protein product                                138   5e-32   
ref|XP_006366074.1|  PREDICTED: probable disease resistance RPP8-...    135   6e-32   
ref|XP_011076798.1|  PREDICTED: putative late blight resistance p...    133   5e-31   
ref|XP_006366073.1|  PREDICTED: probable disease resistance RPP8-...    132   6e-31   
ref|XP_011072129.1|  PREDICTED: putative late blight resistance p...    134   6e-31   
ref|XP_011076796.1|  PREDICTED: putative late blight resistance p...    133   2e-30   
ref|XP_009757879.1|  PREDICTED: putative late blight resistance p...    132   3e-30   
ref|XP_009603761.1|  PREDICTED: putative late blight resistance p...    132   4e-30   
ref|XP_009603760.1|  PREDICTED: putative late blight resistance p...    132   5e-30   
ref|XP_006350238.1|  PREDICTED: putative late blight resistance p...    130   3e-29   
ref|XP_009630452.1|  PREDICTED: putative late blight resistance p...    129   4e-29   
emb|CAN81877.1|  hypothetical protein VITISV_034529                     125   4e-29   Vitis vinifera
gb|AEQ61802.1|  NBS-LRR class disease resistance protein                120   8e-29   
ref|XP_004236957.1|  PREDICTED: putative late blight resistance p...    128   1e-28   
ref|XP_011072127.1|  PREDICTED: putative late blight resistance p...    128   1e-28   
ref|XP_006367034.1|  PREDICTED: probable disease resistance RPP8-...    124   4e-28   
ref|XP_011072005.1|  PREDICTED: putative late blight resistance p...    126   4e-28   
ref|XP_010669410.1|  PREDICTED: putative disease resistance prote...    123   5e-28   
ref|XP_009622940.1|  PREDICTED: putative late blight resistance p...    124   1e-27   
ref|XP_009778215.1|  PREDICTED: putative late blight resistance p...    124   2e-27   
ref|XP_003633887.1|  PREDICTED: putative disease resistance prote...    124   2e-27   
ref|XP_010256251.1|  PREDICTED: probable disease resistance RPP8-...    124   2e-27   
gb|EYU24144.1|  hypothetical protein MIMGU_mgv1a001094mg                123   6e-27   
ref|XP_009604444.1|  PREDICTED: putative disease resistance prote...    117   6e-27   
ref|XP_009614325.1|  PREDICTED: putative late blight resistance p...    122   9e-27   
gb|KHN13835.1|  Disease resistance protein RPP13                        121   2e-26   
emb|CBI38085.3|  unnamed protein product                                117   7e-26   
emb|CDP08031.1|  unnamed protein product                                116   9e-26   
ref|XP_010661280.1|  PREDICTED: putative disease resistance RPP13...    118   9e-26   
ref|XP_009798793.1|  PREDICTED: putative late blight resistance p...    118   1e-25   
emb|CDP08033.1|  unnamed protein product                                119   1e-25   
ref|XP_010258825.1|  PREDICTED: putative disease resistance prote...    118   1e-25   
ref|XP_009629405.1|  PREDICTED: putative late blight resistance p...    116   7e-25   
ref|XP_003633890.1|  PREDICTED: putative disease resistance prote...    114   8e-25   
ref|XP_004236958.1|  PREDICTED: putative late blight resistance p...    115   1e-24   
gb|AAU88174.1|  disease resistance-like protein                         108   1e-24   Coffea wightiana
emb|CBI38087.3|  unnamed protein product                                114   1e-24   
ref|XP_009620169.1|  PREDICTED: disease resistance protein RPP13-...    115   2e-24   
ref|XP_009591235.1|  PREDICTED: putative late blight resistance p...    115   2e-24   
ref|XP_006347944.1|  PREDICTED: putative late blight resistance p...    114   2e-24   
ref|XP_007201771.1|  hypothetical protein PRUPE_ppa1027204mg            114   3e-24   
ref|XP_010244072.1|  PREDICTED: probable disease resistance RPP8-...    114   3e-24   
ref|XP_007131448.1|  hypothetical protein PHAVU_011G014200g             114   4e-24   
ref|XP_007046809.1|  Disease resistance protein RPH8A, putative         114   4e-24   
ref|XP_009763000.1|  PREDICTED: probable disease resistance RPP8-...    114   5e-24   
ref|XP_010250086.1|  PREDICTED: disease resistance protein RPP8-like    114   6e-24   
ref|XP_007131450.1|  hypothetical protein PHAVU_011G014400g             112   7e-24   
ref|XP_009411156.1|  PREDICTED: putative disease resistance RPP13...    113   7e-24   
ref|XP_009144124.1|  PREDICTED: disease resistance protein RPP8-like    110   8e-24   
emb|CAN70484.1|  hypothetical protein VITISV_008412                     112   8e-24   Vitis vinifera
ref|XP_003633889.1|  PREDICTED: probable disease resistance prote...    113   1e-23   
ref|XP_009604792.1|  PREDICTED: putative late blight resistance p...    112   2e-23   
ref|XP_006603606.1|  PREDICTED: disease resistance protein RPP13-...    112   2e-23   
gb|ACN56771.1|  disease resistance protein RPP13 variant                112   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb|ABF00977.1|  disease resistance protein RPP13 variant                112   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAS93942.1|  disease resistance protein RPP13 variant                112   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAS93947.1|  disease resistance protein RPP13 variant                112   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAS93946.1|  disease resistance protein RPP13 variant                112   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAU88165.1|  disease resistance-like protein                         105   2e-23   Coffea khasiana
gb|AAU88156.1|  disease resistance-like protein                         105   2e-23   Coffea arabica [arabica coffee]
gb|AAU88178.1|  disease resistance-like protein                         104   2e-23   Coffea wightiana
gb|ABF00976.1|  disease resistance protein RPP13 variant                111   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAU88170.1|  disease resistance-like protein                         105   2e-23   Coffea wightiana
gb|AAS93945.1|  disease resistance protein RPP13 variant                111   3e-23   Arabidopsis thaliana [mouse-ear cress]
gb|ABU51856.1|  putative NBS domain resistance protein                  104   3e-23   Coffea spp. mixed genomic library
gb|KHN15577.1|  Disease resistance protein RPP13                        111   3e-23   
gb|ABU51855.1|  putative NBS domain resistance protein                  104   3e-23   Coffea spp. mixed genomic library
gb|ABF00984.1|  disease resistance protein RPP13 variant                111   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006585845.1|  PREDICTED: putative disease resistance RPP13...    110   5e-23   
ref|XP_007131449.1|  hypothetical protein PHAVU_011G014300g             110   5e-23   
emb|CDX75047.1|  BnaA05g07930D                                          110   6e-23   
gb|AAU88172.1|  disease resistance-like protein                         103   8e-23   Coffea wightiana
ref|XP_007131451.1|  hypothetical protein PHAVU_011G014500g             110   8e-23   
ref|NP_190255.1|  putative disease resistance RPP13-like protein 2      110   1e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAU88162.1|  disease resistance-like protein                         103   1e-22   Coffea benghalensis
ref|XP_007009116.1|  Disease resistance protein RPP8                    109   1e-22   
gb|KDO61209.1|  hypothetical protein CISIN_1g002750mg                   109   1e-22   
ref|XP_006470643.1|  PREDICTED: disease resistance protein RPP13-...    109   1e-22   
ref|XP_009622842.1|  PREDICTED: putative late blight resistance p...    109   2e-22   
gb|ABF00983.1|  truncated disease resistance protein RPP13 variant      108   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010514978.1|  PREDICTED: disease resistance protein RPP13-...    108   2e-22   
ref|XP_010514976.1|  PREDICTED: disease resistance protein RPP13-...    108   2e-22   
gb|KDP30596.1|  hypothetical protein JCGZ_16249                         108   3e-22   
gb|ACN56759.1|  disease resistance protein RPP13 variant                108   3e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CAC82598.1|  disease resistance-like protein                        101   3e-22   Coffea arabica [arabica coffee]
ref|XP_011072177.1|  PREDICTED: disease resistance RPP8-like prot...    108   3e-22   
gb|ABU51859.1|  putative NBS domain resistance protein                  101   4e-22   Coffea spp. mixed genomic library
gb|ABU51854.1|  putative NBS domain resistance protein                  101   4e-22   Coffea spp. mixed genomic library
ref|XP_007009192.1|  Disease resistance protein RPP8                    108   4e-22   
gb|ABU51858.1|  putative NBS domain resistance protein                  101   5e-22   Coffea spp. mixed genomic library
gb|ABU51860.1|  putative NBS domain resistance protein                  101   5e-22   Coffea spp. mixed genomic library
gb|ABU51857.1|  putative NBS domain resistance protein                  101   5e-22   Coffea spp. mixed genomic library
ref|XP_009388233.1|  PREDICTED: probable disease resistance prote...    107   5e-22   
gb|KFK34000.1|  hypothetical protein AALP_AA5G088800                    107   6e-22   
ref|XP_006596446.1|  PREDICTED: disease resistance protein RPP13-...    107   7e-22   
gb|AEQ63711.1|  NBS-LRR class resistance protein                        100   8e-22   
gb|ACU82907.1|  nucleotide binding site-leucine rich repeat protein     100   9e-22   Solanum lycopersicum
ref|XP_010669409.1|  PREDICTED: putative disease resistance RPP13...    107   9e-22   
ref|XP_006603607.1|  PREDICTED: uncharacterized protein LOC100791776    107   1e-21   
ref|XP_006300614.1|  hypothetical protein CARUB_v10019807mg             106   1e-21   
ref|XP_007010081.1|  Disease resistance protein RPP8                    106   1e-21   
ref|XP_002535012.1|  Disease resistance protein RPH8A, putative         106   1e-21   Ricinus communis
ref|XP_009803472.1|  PREDICTED: putative late blight resistance p...    103   1e-21   
ref|XP_007009115.1|  Disease resistance protein RPP8                    106   1e-21   
gb|ACN56775.1|  disease resistance protein RPP13 variant                106   1e-21   Arabidopsis thaliana [mouse-ear cress]
gb|ABU51853.1|  putative NBS domain resistance protein                99.8    1e-21   Coffea spp. mixed genomic library
gb|ABF81448.1|  NBS-LRR type disease resistance protein                 105   2e-21   Populus trichocarpa [western balsam poplar]
gb|EYU40383.1|  hypothetical protein MIMGU_mgv1a001106mg                106   2e-21   
ref|XP_009626721.1|  PREDICTED: putative late blight resistance p...    105   2e-21   
gb|ACN56763.1|  disease resistance protein RPP13 variant                105   2e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AHB79188.1|  CC-NBS-LRR disease resistance protein                   105   2e-21   
gb|KHN19144.1|  Disease resistance protein RPP13                        105   2e-21   
ref|XP_006857617.1|  hypothetical protein AMTR_s00061p00116840          105   2e-21   
ref|XP_006591996.1|  PREDICTED: disease resistance protein RPP13-...    105   3e-21   
emb|CAN80606.1|  hypothetical protein VITISV_002648                     105   3e-21   Vitis vinifera
ref|XP_002303452.1|  hypothetical protein POPTR_0003s09790g             105   3e-21   Populus trichocarpa [western balsam poplar]
gb|ACE79506.1|  NBS-coding resistance gene analog                       101   3e-21   Nicotiana tabacum [American tobacco]
ref|XP_010045165.1|  PREDICTED: putative inactive disease suscept...    105   4e-21   
gb|ACE79501.1|  NBS-coding resistance gene analog                       101   4e-21   Nicotiana tabacum [American tobacco]
gb|ACE79503.1|  NBS-coding resistance gene analog                       101   4e-21   Nicotiana tabacum [American tobacco]
gb|ACE79502.1|  NBS-coding resistance gene analog                       101   4e-21   Nicotiana tabacum [American tobacco]
emb|CDP19464.1|  unnamed protein product                                103   4e-21   
ref|XP_010647711.1|  PREDICTED: disease resistance protein RPP13-...    105   4e-21   
ref|XP_009591232.1|  PREDICTED: putative late blight resistance p...    104   4e-21   
ref|XP_010426119.1|  PREDICTED: putative disease resistance RPP13...    105   4e-21   
ref|XP_010426118.1|  PREDICTED: putative disease resistance RPP13...    105   4e-21   
ref|XP_010426116.1|  PREDICTED: putative disease resistance RPP13...    104   4e-21   
ref|XP_006355046.1|  PREDICTED: putative late blight resistance p...    104   5e-21   
emb|CDP16256.1|  unnamed protein product                                104   5e-21   
gb|AAS93955.1|  disease resistance protein RPP13 variant                104   5e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004505810.1|  PREDICTED: probable disease resistance RPP8-...    105   5e-21   
gb|AAS93958.1|  disease resistance protein RPP13 variant                104   5e-21   Arabidopsis thaliana [mouse-ear cress]
gb|ABF00985.1|  disease resistance protein RPP13 variant                104   5e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ07904.1|  NBS-LRR protein                                       98.2    6e-21   Ipomoea batatas [batate]
gb|ACE79505.1|  NBS-coding resistance gene analog                       100   6e-21   Nicotiana tabacum [American tobacco]
ref|XP_006470645.1|  PREDICTED: disease resistance protein RPP13-...    102   6e-21   
gb|AAS93910.1|  RPP13-like protein                                      104   6e-21   Arabidopsis arenosa
ref|NP_190237.1|  disease resistance protein RPP13                      104   7e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007200226.1|  hypothetical protein PRUPE_ppa015433mg             104   7e-21   
ref|XP_010426089.1|  PREDICTED: disease resistance protein RPP13-...    103   7e-21   
emb|CDP16841.1|  unnamed protein product                                104   7e-21   
emb|CDP12769.1|  unnamed protein product                                103   8e-21   
ref|XP_007009118.1|  Disease resistance protein RPP8 isoform 2          104   8e-21   
emb|CDX75041.1|  BnaA05g07870D                                          103   8e-21   
ref|XP_007021587.1|  CC-NBS-LRR class disease resistance protein,...    104   8e-21   
ref|XP_010426085.1|  PREDICTED: disease resistance protein RPP13-...    103   8e-21   
gb|AAS93957.1|  disease resistance protein RPP13 variant                103   8e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006362840.1|  PREDICTED: putative late blight resistance p...    103   9e-21   
ref|XP_007009117.1|  Disease resistance protein RPP8 isoform 1          103   9e-21   
ref|XP_010661782.1|  PREDICTED: putative disease resistance prote...    103   9e-21   
ref|XP_002877509.1|  hypothetical protein ARALYDRAFT_323301             103   1e-20   
gb|ABF00982.1|  disease resistance protein RPP13 variant                103   1e-20   Arabidopsis thaliana [mouse-ear cress]
gb|AAS93948.1|  disease resistance protein RPP13 variant                103   1e-20   Arabidopsis thaliana [mouse-ear cress]
gb|ADH03608.1|  nucleotide binding site and leucine rich repeat p...  97.4    1e-20   
gb|ACE79504.1|  NBS-coding resistance gene analog                     99.4    1e-20   Nicotiana tabacum [American tobacco]
ref|XP_007009194.1|  Disease resistance protein RPP8                    103   1e-20   
emb|CDP12943.1|  unnamed protein product                                103   1e-20   
ref|XP_010105407.1|  Disease resistance protein RPM1                    103   1e-20   
emb|CDX84131.1|  BnaC04g08930D                                          103   2e-20   
ref|XP_007009190.1|  Disease resistance protein RPP8                    103   2e-20   
gb|AAS93962.1|  disease resistance protein RPP13 variant                103   2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010647713.1|  PREDICTED: putative disease resistance prote...  97.8    2e-20   
gb|KHN32382.1|  Disease resistance protein RPP13                        103   2e-20   
ref|XP_007009191.1|  Disease resistance protein RPP8                    103   2e-20   
gb|ACN56764.1|  disease resistance protein RPP13 variant                102   2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011028248.1|  PREDICTED: uncharacterized protein LOC105128333    103   2e-20   
emb|CDP16900.1|  unnamed protein product                                102   2e-20   
ref|XP_006446160.1|  hypothetical protein CICLE_v10014222mg             102   2e-20   
gb|ABF00980.1|  disease resistance protein RPP13 variant                102   2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010256293.1|  PREDICTED: putative disease resistance prote...    102   2e-20   
ref|XP_009608888.1|  PREDICTED: putative late blight resistance p...    101   2e-20   
ref|XP_002877510.1|  hypothetical protein ARALYDRAFT_905877             102   2e-20   
gb|AAS93960.1|  disease resistance protein RPP13 variant                102   2e-20   Arabidopsis thaliana [mouse-ear cress]
gb|ACN56769.1|  disease resistance protein RPP13 variant                102   3e-20   Arabidopsis thaliana [mouse-ear cress]
gb|AAS93961.1|  disease resistance protein RPP13 variant                102   3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136125.1|  PREDICTED: probable disease resistance RPP8-...    102   3e-20   
gb|ABF81442.1|  NBS-LRR type disease resistance protein                 102   3e-20   Populus trichocarpa [western balsam poplar]
gb|AAF42831.1|AF209731_1  RPP13                                         102   3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008236596.1|  PREDICTED: disease resistance protein RPP8-like    102   3e-20   
gb|AAS93953.1|  disease resistance protein RPP13 variant                102   4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008231039.1|  PREDICTED: probable disease resistance RPP8-...    102   4e-20   
ref|XP_009411155.1|  PREDICTED: probable disease resistance RPP8-...    102   4e-20   
ref|XP_006601748.1|  PREDICTED: NBS-LRR disease-resistance protei...    102   4e-20   
gb|ACP30582.1|  disease resistance protein                              102   4e-20   Brassica rapa subsp. pekinensis [bai cai]
gb|KHN13874.1|  Disease resistance protein RPP13                        102   4e-20   
ref|XP_010023627.1|  PREDICTED: disease resistance protein RPM1-like    102   4e-20   
gb|ABF00981.1|  disease resistance protein RPP13 variant                101   4e-20   Arabidopsis thaliana [mouse-ear cress]
gb|AAS93954.1|  disease resistance protein RPP13 variant                101   4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010503265.1|  PREDICTED: disease resistance protein RPP13-...    101   5e-20   
ref|XP_009112364.1|  PREDICTED: LOW QUALITY PROTEIN: putative dis...    101   5e-20   
ref|XP_009761982.1|  PREDICTED: putative late blight resistance p...    101   5e-20   
ref|XP_009608887.1|  PREDICTED: putative late blight resistance p...    101   5e-20   
ref|XP_004301647.1|  PREDICTED: disease resistance protein RPM1-like    101   5e-20   
ref|XP_009773958.1|  PREDICTED: putative late blight resistance p...    101   5e-20   
ref|XP_006300711.1|  hypothetical protein CARUB_v10019761mg             100   6e-20   
emb|CDP12404.1|  unnamed protein product                                101   6e-20   
emb|CDP12429.1|  unnamed protein product                                100   6e-20   
ref|XP_010647271.1|  PREDICTED: disease resistance protein RPP13-...    101   6e-20   
emb|CAN72324.1|  hypothetical protein VITISV_018384                     100   7e-20   Vitis vinifera
ref|XP_009761980.1|  PREDICTED: putative late blight resistance p...    100   7e-20   
emb|CDP00589.1|  unnamed protein product                                101   7e-20   
ref|XP_010277702.1|  PREDICTED: putative disease resistance prote...    101   7e-20   
gb|ACN56770.1|  disease resistance protein RPP13 variant                100   8e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009799403.1|  PREDICTED: putative late blight resistance p...    100   8e-20   
gb|ABF00975.1|  disease resistance protein RPP13 variant                100   8e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300720.1|  hypothetical protein CARUB_v10019767mg             100   8e-20   
emb|CDP16502.1|  unnamed protein product                                100   8e-20   
ref|XP_011018457.1|  PREDICTED: disease resistance protein RPM1-like    100   8e-20   
emb|CDP19586.1|  unnamed protein product                                100   9e-20   
ref|XP_006300712.1|  hypothetical protein CARUB_v10019761mg             100   9e-20   
gb|KDO61207.1|  hypothetical protein CISIN_1g045150mg                   100   9e-20   
ref|XP_009372853.1|  PREDICTED: disease resistance protein RPP8-like    100   9e-20   
emb|CDP12397.1|  unnamed protein product                                100   9e-20   
ref|XP_009604795.1|  PREDICTED: putative late blight resistance p...    100   1e-19   
gb|ACV85787.1|  NBS-LRR resistance protein                            94.7    1e-19   Hevea brasiliensis [jebe]
gb|ACV85795.1|  NBS-LRR resistance protein                            94.7    1e-19   Hevea brasiliensis [jebe]
ref|XP_011072179.1|  PREDICTED: putative late blight resistance p...    100   1e-19   
ref|XP_010647714.1|  PREDICTED: putative disease resistance prote...    100   1e-19   
ref|XP_004237189.1|  PREDICTED: putative late blight resistance p...    100   1e-19   
ref|XP_006446161.1|  hypothetical protein CICLE_v10017794mg             100   1e-19   
emb|CDP12950.1|  unnamed protein product                                100   1e-19   
ref|XP_010661285.1|  PREDICTED: putative disease resistance prote...    100   1e-19   
emb|CDP19561.1|  unnamed protein product                                100   1e-19   
gb|ACN56776.1|  disease resistance protein RPP13 variant                100   1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|EYU21175.1|  hypothetical protein MIMGU_mgv1a021134mg                100   1e-19   
gb|AAS93952.1|  disease resistance protein RPP13 variant                100   1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300705.1|  hypothetical protein CARUB_v10019755mg             100   1e-19   
gb|ACV85775.1|  NBS-LRR resistance protein                            94.4    1e-19   Hevea brasiliensis [jebe]
ref|XP_009589053.1|  PREDICTED: putative late blight resistance p...  99.8    2e-19   
gb|EMS53839.1|  Disease resistance RPP8-like protein 3                  100   2e-19   
ref|XP_002303450.2|  hypothetical protein POPTR_0003s09770g             100   2e-19   Populus trichocarpa [western balsam poplar]
emb|CDP20592.1|  unnamed protein product                              99.8    2e-19   
emb|CDP20516.1|  unnamed protein product                                100   2e-19   
ref|NP_175437.1|  NB-ARC domain-containing disease resistance pro...  99.8    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500573.1|  PREDICTED: putative disease resistance prote...  99.8    2e-19   
ref|NP_001068322.1|  Os11g0633500                                     99.0    2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|AAD50046.1|AC007980_11  Very similar to disease resistance pro...  99.8    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008797616.1|  PREDICTED: putative disease resistance prote...  99.8    2e-19   
gb|AAS93956.1|  disease resistance protein RPP13 variant              99.8    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010663514.1|  PREDICTED: putative disease resistance prote...  99.8    2e-19   
ref|XP_008376398.1|  PREDICTED: disease resistance protein RPP8-like  99.8    2e-19   
emb|CDP00688.1|  unnamed protein product                              99.0    2e-19   
ref|XP_007041955.1|  CC-NBS-LRR class disease resistance protein      99.8    2e-19   
gb|KCW90007.1|  hypothetical protein EUGRSUZ_A02202                   99.8    2e-19   
ref|XP_002303451.2|  NBS-LRR resistance gene-like protein ARGH35      99.8    2e-19   
ref|XP_010500572.1|  PREDICTED: putative disease resistance prote...  99.8    2e-19   
gb|ABF81450.1|  NBS-LRR type disease resistance protein               99.8    2e-19   
ref|XP_009618234.1|  PREDICTED: putative late blight resistance p...  99.4    2e-19   
ref|XP_009777085.1|  PREDICTED: putative late blight resistance p...  98.6    2e-19   
ref|XP_006368329.1|  NBS-LRR resistance gene-like protein ARGH35      99.4    3e-19   
gb|AGX27504.1|  NBS-LRR class resistance protein Fy8-Ry8              97.1    3e-19   
ref|XP_009370445.1|  PREDICTED: disease resistance protein RPP8-like  99.4    3e-19   
ref|XP_007032835.1|  CC-NBS-LRR class disease resistance protein,...  99.4    3e-19   
ref|XP_009107235.1|  PREDICTED: putative disease resistance prote...  99.4    3e-19   
ref|XP_006368333.1|  hypothetical protein POPTR_0001s017003g          98.6    3e-19   
ref|XP_011087333.1|  PREDICTED: putative late blight resistance p...  99.4    3e-19   
gb|ABJ99598.1|  NBS-LRR type resistance protein                       99.4    3e-19   
ref|XP_011018452.1|  PREDICTED: disease resistance protein RPM1-like  99.4    3e-19   
ref|XP_009774730.1|  PREDICTED: putative late blight resistance p...  99.0    3e-19   
gb|ACN56767.1|  disease resistance protein RPP13 variant              99.0    3e-19   
ref|XP_010907229.1|  PREDICTED: LOW QUALITY PROTEIN: probable dis...  99.0    3e-19   
ref|XP_009777083.1|  PREDICTED: putative late blight resistance p...  99.0    4e-19   
ref|XP_007009195.1|  Disease resistance protein RPP8                  99.4    4e-19   
gb|ABQ10216.1|  NBS resistance protein                                93.2    4e-19   
ref|XP_010661780.1|  PREDICTED: putative disease resistance prote...  98.6    4e-19   
ref|XP_004236959.1|  PREDICTED: putative late blight resistance p...  99.0    4e-19   
ref|XP_009345321.1|  PREDICTED: disease resistance protein RPM1-l...  99.0    4e-19   
gb|ABF81446.1|  NBS-NBS-LRR type disease resistance protein           99.4    4e-19   
ref|XP_009777084.1|  PREDICTED: putative late blight resistance p...  98.6    4e-19   
gb|ACN56773.1|  disease resistance protein RPP13 variant              98.6    4e-19   
emb|CDP17917.1|  unnamed protein product                              98.6    4e-19   
ref|XP_009345322.1|  PREDICTED: disease resistance protein RPM1-l...  98.6    5e-19   
gb|ACN56779.1|  disease resistance protein RPP13 variant              98.6    5e-19   
gb|ABB85175.1|  NBS-LRR type disease resistance protein               92.8    5e-19   
emb|CBI40355.3|  unnamed protein product                              98.6    6e-19   
emb|CDP11831.1|  unnamed protein product                              98.2    6e-19   
gb|ABB85205.1|  NBS-LRR type disease resistance protein               92.4    6e-19   
ref|XP_008779382.1|  PREDICTED: putative disease resistance RPP13...  98.2    6e-19   
gb|AID69934.1|  NBS-LRR resistance protein                            92.4    6e-19   
gb|ABB85178.1|  NBS-LRR type disease resistance protein               92.4    6e-19   
gb|AID69939.1|  NBS-LRR resistance protein                            92.4    6e-19   
emb|CAN75534.1|  hypothetical protein VITISV_009639                   98.6    6e-19   
gb|EAZ17339.1|  hypothetical protein OsJ_32864                        98.2    6e-19   
ref|XP_010647275.1|  PREDICTED: disease resistance protein RPP13-...  98.2    6e-19   
gb|ACN56774.1|  disease resistance protein RPP13 variant              98.2    6e-19   
ref|XP_008811538.1|  PREDICTED: putative disease resistance RPP13...  98.2    7e-19   
emb|CAN72325.1|  hypothetical protein VITISV_018385                   98.2    7e-19   
gb|AAF42832.1|AF209732_1  RPP13                                       98.2    7e-19   
ref|XP_006292716.1|  hypothetical protein CARUB_v10018962mg           98.2    7e-19   
emb|CDP10353.1|  unnamed protein product                              95.5    7e-19   
ref|XP_009378825.1|  PREDICTED: putative disease resistance prote...  98.2    8e-19   
emb|CAN71249.1|  hypothetical protein VITISV_030153                   98.2    8e-19   
ref|XP_010479468.1|  PREDICTED: putative disease resistance prote...  97.8    8e-19   
ref|XP_006392266.1|  hypothetical protein EUTSA_v10023861mg           97.8    8e-19   
gb|EAZ01114.1|  hypothetical protein OsI_23143                        97.4    9e-19   
emb|CDX75042.1|  BnaA05g07880D                                        97.8    9e-19   
ref|XP_010658279.1|  PREDICTED: putative disease resistance prote...  97.4    9e-19   
emb|CDP15682.1|  unnamed protein product                              97.8    1e-18   
ref|XP_007207932.1|  hypothetical protein PRUPE_ppa017999mg           97.4    1e-18   
ref|XP_006603027.1|  PREDICTED: putative disease resistance prote...  97.4    1e-18   
ref|XP_010658277.1|  PREDICTED: putative disease resistance prote...  97.1    1e-18   
emb|CAN67961.1|  hypothetical protein VITISV_033801                   97.4    1e-18   
ref|XP_007200018.1|  hypothetical protein PRUPE_ppa024623mg           97.4    1e-18   
emb|CDP10344.1|  unnamed protein product                              97.4    1e-18   
ref|XP_009151689.1|  PREDICTED: LOW QUALITY PROTEIN: disease resi...  95.9    1e-18   
gb|ACE79507.1|  NBS-coding resistance gene analog                     94.0    1e-18   
emb|CDP21814.1|  unnamed protein product                              97.1    1e-18   
gb|KEH30519.1|  NBS-LRR type disease resistance protein               97.1    1e-18   
gb|AET22504.1|  hypothetical protein                                  97.1    2e-18   
ref|XP_006364178.1|  PREDICTED: putative late blight resistance p...  97.1    2e-18   
gb|AGW23829.1|  NBS-LRR class resistance protein Fy8-Ry8              96.7    2e-18   
ref|XP_004251396.2|  PREDICTED: putative late blight resistance p...  96.7    2e-18   
ref|XP_010312513.1|  PREDICTED: putative late blight resistance p...  96.7    2e-18   
gb|AGW28125.1|  NBS-LRR class resistance protein Fy8-Ry8              96.7    2e-18   
gb|AAL32876.1|  disease resistance protein, putative                  96.3    2e-18   
emb|CDP03193.1|  unnamed protein product                              96.7    2e-18   
emb|CDP11633.1|  unnamed protein product                              96.7    2e-18   
gb|KDO61208.1|  hypothetical protein CISIN_1g037627mg                 96.7    2e-18   
emb|CDP12953.1|  unnamed protein product                              96.7    2e-18   
ref|XP_011075746.1|  PREDICTED: putative late blight resistance p...  96.7    2e-18   
dbj|BAA88265.1|  unnamed protein product                              95.9    2e-18   
gb|AGZ93654.1|  nonTIR-NBS-LRR disease resistance protein             90.9    2e-18   
ref|XP_006470644.1|  PREDICTED: putative disease resistance RPP13...  96.3    2e-18   
emb|CAN75123.1|  hypothetical protein VITISV_040992                   96.7    2e-18   
emb|CDP11825.1|  unnamed protein product                              96.7    3e-18   
gb|ABV30834.1|  NBS-containing resistance-like protein                90.5    3e-18   
gb|ACE79508.1|  NBS-coding resistance gene analog                     92.4    3e-18   
gb|ACE79510.1|  NBS-coding resistance gene analog                     92.4    3e-18   
ref|XP_008778805.1|  PREDICTED: putative disease resistance RPP13...  95.5    3e-18   
gb|ACE79512.1|  NBS-coding resistance gene analog                     92.4    3e-18   
gb|ACE79513.1|  NBS-coding resistance gene analog                     92.4    3e-18   
gb|ACE79509.1|  NBS-coding resistance gene analog                     92.4    3e-18   
ref|NP_176135.1|  CC-NBS-LRR class disease resistance protein         96.3    3e-18   
gb|AGZ93653.1|  nonTIR-NBS-LRR disease resistance protein             90.5    3e-18   
gb|KCW87318.1|  hypothetical protein EUGRSUZ_B03805                   95.9    3e-18   
emb|CDY03593.1|  BnaC03g68520D                                        95.9    3e-18   
emb|CDP12947.1|  unnamed protein product                              95.9    3e-18   
gb|KDP33396.1|  hypothetical protein JCGZ_12852                       95.9    3e-18   
emb|CDP00690.1|  unnamed protein product                              95.5    4e-18   
ref|XP_009372854.1|  PREDICTED: disease resistance protein RPP8-like  95.9    4e-18   
gb|ACE79511.1|  NBS-coding resistance gene analog                     91.7    4e-18   
ref|XP_003534302.1|  PREDICTED: disease resistance protein RPM1-like  95.9    4e-18   
ref|XP_006365682.1|  PREDICTED: putative late blight resistance p...  95.5    5e-18   
ref|XP_010256268.1|  PREDICTED: putative disease resistance prote...  95.5    5e-18   
ref|XP_006367915.1|  PREDICTED: putative disease resistance RPP13...  93.6    5e-18   
ref|XP_003537613.1|  PREDICTED: disease resistance RPP8-like prot...  95.5    5e-18   
ref|XP_010558894.1|  PREDICTED: disease resistance protein RPM1-like  95.1    5e-18   
gb|KHN41940.1|  Disease resistance RPP8-like protein 3                95.1    6e-18   
ref|XP_006446156.1|  hypothetical protein CICLE_v10014197mg           95.1    6e-18   
emb|CDO98498.1|  unnamed protein product                              95.1    6e-18   
emb|CDP11829.1|  unnamed protein product                              95.1    7e-18   
gb|AAP80287.1|  resistance protein Sorb5                              94.7    8e-18   
ref|XP_010058275.1|  PREDICTED: probable disease resistance RPP8-...  94.7    8e-18   
gb|AAX23925.1|  hypothetical protein At5g43480                        92.4    9e-18   
ref|XP_009596957.1|  PREDICTED: putative late blight resistance p...  94.4    9e-18   
ref|XP_009796671.1|  PREDICTED: putative late blight resistance p...  94.4    9e-18   
ref|XP_006282221.1|  hypothetical protein CARUB_v10028494mg           94.7    9e-18   
ref|NP_176137.1|  putative disease resistance protein RXW24L          94.7    9e-18   
ref|XP_003517205.1|  PREDICTED: probable disease resistance RPP8-...  94.7    9e-18   
gb|ADH03610.1|  nucleotide binding site and leucine rich repeat p...  89.4    1e-17   
ref|XP_008356190.1|  PREDICTED: LOW QUALITY PROTEIN: disease resi...  94.4    1e-17   
ref|XP_006596445.1|  PREDICTED: disease resistance protein RPP13-...  94.4    1e-17   
ref|XP_009345320.1|  PREDICTED: disease resistance protein RPM1-like  94.0    1e-17   
emb|CDP05538.1|  unnamed protein product                              94.7    1e-17   
gb|EYU21173.1|  hypothetical protein MIMGU_mgv1a002728mg              94.0    1e-17   
ref|XP_006836732.1|  hypothetical protein AMTR_s00088p00134370        94.4    1e-17   
ref|XP_004250464.1|  PREDICTED: putative late blight resistance p...  94.4    1e-17   
gb|KHN36075.1|  Disease resistance RPP8-like protein 3                94.4    1e-17   
ref|XP_010544855.1|  PREDICTED: probable disease resistance RPP8-...  94.4    1e-17   
ref|XP_006365680.1|  PREDICTED: putative late blight resistance p...  94.4    1e-17   
ref|XP_008779228.1|  PREDICTED: disease resistance protein RPP13-...  93.2    1e-17   
gb|KHN13873.1|  Disease resistance protein RPP13                      94.0    1e-17   
ref|XP_007041954.1|  CC-NBS-LRR class disease resistance protein,...  94.0    1e-17   
ref|XP_011083930.1|  PREDICTED: putative late blight resistance p...  94.0    1e-17   
ref|XP_010647281.1|  PREDICTED: putative disease resistance prote...  93.6    1e-17   
ref|XP_010544853.1|  PREDICTED: probable disease resistance RPP8-...  94.0    1e-17   
ref|XP_008353305.1|  PREDICTED: disease resistance protein RPM1-like  94.0    1e-17   
ref|XP_010093228.1|  Disease resistance protein RPM1                  94.0    1e-17   
emb|CDP12946.1|  unnamed protein product                              94.0    1e-17   
ref|XP_006281660.1|  hypothetical protein CARUB_v10027796mg           94.0    1e-17   
ref|XP_009796668.1|  PREDICTED: putative late blight resistance p...  94.0    2e-17   
ref|XP_009796664.1|  PREDICTED: putative late blight resistance p...  94.0    2e-17   
ref|NP_198395.1|  disease resistance RPP8-like protein 3              94.0    2e-17   
ref|XP_009782570.1|  PREDICTED: putative late blight resistance p...  93.6    2e-17   
ref|XP_002265419.1|  PREDICTED: disease resistance protein RPM1-like  93.6    2e-17   
ref|XP_006306712.1|  hypothetical protein CARUB_v10008237mg           93.6    2e-17   
ref|XP_009796670.1|  PREDICTED: putative late blight resistance p...  93.6    2e-17   
ref|XP_009796665.1|  PREDICTED: putative late blight resistance p...  93.6    2e-17   
ref|XP_002891560.1|  hypothetical protein ARALYDRAFT_474150           93.6    2e-17   
emb|CDP16903.1|  unnamed protein product                              93.6    2e-17   
gb|EMS47661.1|  Disease resistance protein RPP8                       93.6    2e-17   
ref|XP_011072144.1|  PREDICTED: putative late blight resistance p...  93.6    2e-17   
ref|XP_011075662.1|  PREDICTED: putative late blight resistance p...  93.2    2e-17   
dbj|BAC67706.1|  R-protein                                            93.6    2e-17   
ref|XP_010054922.1|  PREDICTED: disease resistance protein RPM1-like  93.6    2e-17   
ref|XP_006385821.1|  disease resistance family protein                93.2    2e-17   
gb|EYU24354.1|  hypothetical protein MIMGU_mgv1a019328mg              93.2    2e-17   
gb|KCW78491.1|  hypothetical protein EUGRSUZ_D02634                   93.2    2e-17   
ref|XP_010327575.1|  PREDICTED: putative late blight resistance p...  93.2    2e-17   
ref|XP_008369973.1|  PREDICTED: disease resistance protein RPM1-like  93.2    3e-17   
ref|XP_006300694.1|  hypothetical protein CARUB_v10019740mg           93.2    3e-17   
ref|XP_004289882.1|  PREDICTED: disease resistance protein RPM1-like  93.2    3e-17   
ref|XP_010531840.1|  PREDICTED: probable disease resistance RPP8-...  93.2    3e-17   
ref|XP_002528440.1|  Disease resistance protein RPP8, putative        93.2    3e-17   
gb|AID69937.1|  NBS-LRR resistance protein                            88.2    3e-17   
gb|EYU17666.1|  hypothetical protein MIMGU_mgv1a021453mg              92.8    3e-17   
ref|XP_010245031.1|  PREDICTED: probable disease resistance RPP8-...  92.8    3e-17   
ref|XP_006367920.1|  PREDICTED: putative late blight resistance p...  92.0    3e-17   
ref|XP_009373508.1|  PREDICTED: disease resistance protein RPM1-like  92.8    3e-17   
ref|XP_010914739.1|  PREDICTED: LOW QUALITY PROTEIN: putative dis...  92.8    3e-17   
ref|XP_008810409.1|  PREDICTED: disease resistance RPP8-like prot...  92.8    3e-17   
gb|AAP80285.1|  resistance protein Ler3                               92.8    4e-17   
sp|Q8W3K3.1|DRL8_ARATH  RecName: Full=Putative disease resistance...  92.8    4e-17   
ref|XP_002524239.1|  conserved hypothetical protein                   92.8    4e-17   
ref|XP_006367916.1|  PREDICTED: putative late blight resistance p...  92.0    4e-17   
ref|XP_011071868.1|  PREDICTED: putative late blight resistance p...  92.8    4e-17   
gb|ACE79515.1|  NBS-coding resistance gene analog                     89.4    4e-17   
ref|XP_006844850.1|  hypothetical protein AMTR_s00058p00097500        92.8    4e-17   
ref|XP_002862606.1|  predicted protein                                91.7    4e-17   
gb|KDP22480.1|  hypothetical protein JCGZ_26311                       92.4    4e-17   
ref|XP_006366075.1|  PREDICTED: putative late blight resistance p...  92.4    4e-17   
gb|ABO15685.1|  NBS-NBS-LRR type disease resistance protein           92.4    4e-17   
ref|XP_007148786.1|  hypothetical protein PHAVU_005G014200g           92.4    4e-17   
ref|XP_011007006.1|  PREDICTED: disease resistance protein RPM1-l...  92.4    4e-17   
gb|KEH32965.1|  NBS-LRR type disease resistance protein               92.4    4e-17   
emb|CDP12427.1|  unnamed protein product                              92.4    4e-17   
ref|XP_006300752.1|  hypothetical protein CARUB_v10019818mg           92.4    4e-17   
emb|CDY05425.1|  BnaA02g32660D                                        92.0    4e-17   
ref|XP_004300174.1|  PREDICTED: disease resistance protein RPM1-like  92.4    5e-17   
gb|ADL59408.1|  SNKR2GH7 protein                                      92.4    5e-17   
ref|XP_009103149.1|  PREDICTED: probable disease resistance prote...  92.4    5e-17   
ref|XP_007158603.1|  hypothetical protein PHAVU_002G166400g           92.4    5e-17   
gb|AEJ72566.1|  putative CC-NBS-LRR protein                           92.4    5e-17   
gb|ADL59406.1|  SNKR2GH5 protein                                      92.4    5e-17   
gb|ADL59407.1|  SNKR2GH6 protein                                      92.4    5e-17   
ref|XP_002301573.2|  Disease resistance protein RPM1                  92.4    5e-17   
emb|CDY48845.1|  BnaA09g14680D                                        92.4    5e-17   
ref|XP_009597654.1|  PREDICTED: putative late blight resistance p...  92.4    5e-17   
gb|ABH10959.1|  putative NBS-LRR disease resistance protein RIT-2     87.0    5e-17   
emb|CDP15268.1|  unnamed protein product                              92.4    5e-17   
ref|XP_009597655.1|  PREDICTED: putative late blight resistance p...  92.0    5e-17   
gb|KHN40407.1|  Disease resistance protein RPM1                       92.0    5e-17   
ref|XP_002265568.1|  PREDICTED: disease resistance protein RPM1-like  92.0    6e-17   
ref|XP_008778031.1|  PREDICTED: putative disease resistance prote...  92.0    6e-17   
gb|AAS93912.1|  RPP13-like protein                                    91.7    6e-17   
ref|XP_010914752.1|  PREDICTED: putative disease resistance RPP13...  92.0    6e-17   
ref|XP_010921526.1|  PREDICTED: disease resistance RPP8-like prot...  92.0    6e-17   
ref|XP_009774731.1|  PREDICTED: putative late blight resistance p...  92.0    6e-17   
ref|XP_009618066.1|  PREDICTED: putative late blight resistance p...  91.7    6e-17   
ref|XP_009803439.1|  PREDICTED: putative late blight resistance p...  92.0    6e-17   
gb|AAP80286.1|  resistance protein Sorb3                              92.0    6e-17   
ref|XP_009803436.1|  PREDICTED: putative late blight resistance p...  92.0    7e-17   
ref|XP_004293680.1|  PREDICTED: disease resistance protein RPM1-like  92.0    7e-17   
emb|CBI28079.3|  unnamed protein product                              92.0    7e-17   
emb|CDP12734.1|  unnamed protein product                              92.0    7e-17   
ref|NP_175742.4|  putative disease resistance RPP8-like protein       92.0    7e-17   
emb|CDP11830.1|  unnamed protein product                              92.0    7e-17   
ref|XP_006388615.1|  hypothetical protein POPTR_0137s00200g           91.7    7e-17   
ref|XP_007138746.1|  hypothetical protein PHAVU_009G233700g           92.0    7e-17   
sp|P0C8S1.1|RP8L2_ARATH  RecName: Full=Probable disease resistanc...  91.7    7e-17   
ref|XP_006357610.1|  PREDICTED: putative late blight resistance p...  92.0    7e-17   
ref|XP_002281054.1|  PREDICTED: putative disease resistance RPP13...  91.7    7e-17   
ref|NP_199160.1|  disease resistance protein RPP8                     91.7    7e-17   
ref|XP_010319327.1|  PREDICTED: disease resistance protein RPP13-...  90.9    7e-17   
ref|XP_010054114.1|  PREDICTED: disease resistance protein RPM1-l...  91.7    7e-17   



>ref|XP_009614965.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
 ref|XP_009614966.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=886

 Score =   195 bits (495),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 130/316 (41%), Positives = 199/316 (63%), Gaps = 21/316 (7%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            D  V  ++  ++Q + +N  LILG++ + E+LL +L  F A L++AAK   +  VL  +V
Sbjct  3    DVAVNFLLENLMQLLRDNAELILGVKGEAENLLQDLSDFNAFLTQAAKRRTENEVLRGLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            ++I+KVV  AEDAIDK+++ E+ H+ +G+  ++ + V +Y +V DAA+E+  I++  ++I
Sbjct  63   KRIRKVVNIAEDAIDKFVIAEKLHKDKGI-ARYMDLV-HYKRVQDAAEEIRGIRETVKEI  120

Query  578  RLD----LELLQ-----GGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDD  426
            R +    L+ LQ      G     +LP       V ED++VGFDE+A+ +  RL E  D+
Sbjct  121  RRNNSYGLQALQDEDPAPGVGEERKLPV------VEEDDVVGFDEEAKKVIDRLLEGSDN  174

Query  425  ttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKET  246
              V+ IVG  G+GKTTL   IF D  +  EFFTR+W+YVS +  R+ +F++IIS F + T
Sbjct  175  LKVVPIVGMPGLGKTTLANKIFKDATVEFEFFTRIWVYVSQSYKRRDLFLNIISKFRRNT  234

Query  245  SGYKDMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRV  69
            + Y  M E+ LA+ I+D+L   GKY IV+DD+W  E WD L+ AFPNN K +R+L+TTR 
Sbjct  235  TQYSHMSEDDLAQVIRDYLGRGGKYLIVLDDVWSGEAWDRLKIAFPNNNKCNRVLLTTRD  294

Query  68   LEVANHVDSKNAPHKF  21
              VA H +  + PHK 
Sbjct  295  NIVAKHYN--DDPHKL  308



>ref|XP_004238948.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
 ref|XP_010320774.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=891

 Score =   194 bits (492),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 129/308 (42%), Positives = 197/308 (64%), Gaps = 8/308 (3%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            D  V  ++  + Q + +N  LILGI+ +VE+LL +L  F A L EAAK+  +  VL+E+V
Sbjct  3    DVAVKFLLENLTQLLIDNADLILGIQGEVENLLTDLNYFNAFLKEAAKSRRENEVLKELV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            +KI+KVV DAED+IDK++VE + H  +    +W   +++  +    A E++SI++R ++I
Sbjct  63   KKIRKVVNDAEDSIDKFVVEAKRHDDKNKFAQW-FHITHVARAKGVADEIKSIRERVKEI  121

Query  578  R-LDLELLQGGSLN-NPQLPAADLQAHVAE-DELVGFDEDAQTIKYRLTEKLDDttviai  408
            R  D   LQ  +L+ N      + +A V E D++VGFD++A+T+  RL    D   V+ +
Sbjct  122  RDNDAYGLQAITLDDNFNRGDEERKAPVVEEDDVVGFDDEAKTVIDRLIGGSDYVEVVPV  181

Query  407  vggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDM  228
            VG  G+GKTTL   I+ D ++ +EFFTR+W+YVS T  R++IF++IIS FT+ T  Y D 
Sbjct  182  VGMPGLGKTTLAYKIYKDPKVEYEFFTRVWVYVSQTFKRREIFLNIISKFTRNTKQYDDT  241

Query  227  KEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANH  51
             E+ LA  +++ L + GKY IV+DD+W  E WD ++ AFPNN K +R+L+TTR   VA  
Sbjct  242  PEDDLANEVKELLGKGGKYLIVLDDVWTMEAWDRIKIAFPNNGKRNRVLMTTRQSNVAKR  301

Query  50   VDSKNAPH  27
             + K  PH
Sbjct  302  CNDK--PH  307



>ref|XP_009772243.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009772244.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=880

 Score =   191 bits (485),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 197/311 (63%), Gaps = 18/311 (6%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSF-WALSEAAKNCNDKAVLEEVV  759
            D  +  +I  + Q + +N  LI+GI+D  E LL +L+ F   L +AA   ++  +L+E+V
Sbjct  3    DLGLSFLIENLKQLLRDNGELIIGIKDAAESLLEDLKEFDVFLKKAAAYNSENKILKELV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            +KI+ VV  AEDAIDK+++E + H+GRGV  ++ + +++Y +V D A E+++I+++ ++I
Sbjct  63   KKIRTVVNAAEDAIDKFVIESKLHKGRGV-SRFVD-LTHYKRVRDVASEIKAIREKVKEI  120

Query  578  R------LDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttv  417
            R      L  E L G      + P       V ED++VGFD++ + I  RL E  D   V
Sbjct  121  RRTEVYALQNEDLSGRGGQERKSPV------VEEDDVVGFDDEVRKIINRLFEGSDSLEV  174

Query  416  iaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGY  237
            I IVG  G+GKTTL  +++   E+ ++FFTR+W+YVS T  R+++F++IIS FT+ T  Y
Sbjct  175  IPIVGMPGLGKTTLANLVYKHPEVGYKFFTRIWVYVSQTYRRRELFLNIISKFTRNTKQY  234

Query  236  KDMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEV  60
             D  EE LA+ I++FL + GKY IV+DD+W  E W+ +R AFP   KG+R+L+TTR  +V
Sbjct  235  HDRPEEDLADEIREFLGKTGKYLIVLDDVWSGEAWERIRIAFPETNKGNRVLLTTRDSKV  294

Query  59   ANHVDSKNAPH  27
            A +    + PH
Sbjct  295  AKYCS--HIPH  303



>ref|XP_006362574.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=891

 Score =   189 bits (481),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 127/308 (41%), Positives = 197/308 (64%), Gaps = 8/308 (3%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            D  V  ++  ++Q + +N  LILGI+ +VE+LL +L  F A L +AAK+  +  VL+E+V
Sbjct  3    DVAVKFLVENLMQLLIDNADLILGIKGEVENLLRDLNDFNAFLKQAAKSRRENEVLKEMV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            +KI+KVV DAED+IDK+++E + H  +    +W   +++  +    A E++SIK+R ++I
Sbjct  63   KKIRKVVNDAEDSIDKFVIEAKRHDDKNKFAQW-FHITHVARAKGVADEIKSIKERVKEI  121

Query  578  RL-DLELLQGGSLN-NPQLPAADLQAHVAE-DELVGFDEDAQTIKYRLTEKLDDttviai  408
            R  D   LQ  +L+ N      + +A V E D++VGFD++A+ +  RL    D   V+ +
Sbjct  122  RENDAYGLQAITLDDNFNRGDEERKAPVVEEDDVVGFDDEAKIVIDRLIGGSDYVEVVPV  181

Query  407  vggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDM  228
            VG  G+GKTTL   I+ D ++ +EFFTR+W+YVS T  R++IF++IIS FT+ T  Y D 
Sbjct  182  VGMPGLGKTTLAYKIYKDPKVEYEFFTRVWVYVSQTFKRREIFLNIISKFTRNTKQYHDT  241

Query  227  KEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANH  51
             E+ LA  +++ L + GKY IV+DD+W  E WD ++ AFPNN K +R+L+TTR   VA  
Sbjct  242  PEDDLANEVKELLGKGGKYLIVLDDVWTMEAWDRIKIAFPNNGKRNRVLMTTRESNVAKC  301

Query  50   VDSKNAPH  27
             + K  PH
Sbjct  302  CNDK--PH  307



>ref|XP_009776048.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=886

 Score =   186 bits (471),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 123/311 (40%), Positives = 197/311 (63%), Gaps = 12/311 (4%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            +  V  ++  ++Q + +N  LI+G++D  E LL +L  F A L + AK+ ++  V +E+V
Sbjct  3    NVAVEFLVQNLMQLLRDNAELIIGVKDSAESLLQDLNDFNAFLKQTAKSRSENDVHKELV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            +KI+ VV  AEDAIDK+++E + H+ +GV  ++ + V +Y +V D A E+++I+ + ++I
Sbjct  63   KKIKTVVNSAEDAIDKFVIEAKLHKDKGV-GRFVD-VKHYKRVYDVAGEIKTIRDKVKEI  120

Query  578  RLDLEL-LQGGSLNNPQLPAADLQAH----VAEDELVGFDEDAQTIKYRLTEKLDDttvi  414
            RL+  L LQ  +L +    A  +Q      V ED++VGF+E+A  +  RL        V+
Sbjct  121  RLNNALDLQ--ALQDEDQSAKGVQERKPPVVEEDDVVGFEEEADKVINRLLGGSSGLEVV  178

Query  413  aivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYK  234
             +VG  G+GKTTL   I+   ++ ++FFTR+W+YVS +  R+++F++IIS FT+ T  Y 
Sbjct  179  PVVGMPGLGKTTLANKIYKHPDIGYQFFTRIWVYVSQSYRRRELFLNIISKFTRNTKQYH  238

Query  233  DMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVA  57
            DM EE LA+ I+DFL + GKY IV+DD+W  + W+ +R AFPNN K +RIL+TTR  +VA
Sbjct  239  DMCEEDLADEIEDFLGKGGKYLIVLDDVWSPDAWERIRIAFPNNNKSNRILLTTRNSKVA  298

Query  56   NHV-DSKNAPH  27
                     PH
Sbjct  299  KQCKQCIGIPH  309



>ref|XP_006362572.1| PREDICTED: disease resistance protein RPP13-like [Solanum tuberosum]
Length=388

 Score =   179 bits (455),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 121/309 (39%), Positives = 191/309 (62%), Gaps = 10/309 (3%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            D  V  ++  ++Q + +N  LILGI+ +VE+LL +L  F A L +AAK+  +  VL+E+V
Sbjct  3    DVAVKFLVENLMQLLIDNADLILGIKGEVENLLRDLNDFNAFLKQAAKSRRENEVLKEMV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            +KI+KVV DAED+IDK+++E + H  +    +W    ++  +    A E++S ++R  +I
Sbjct  63   KKIRKVVNDAEDSIDKFVIEAKRHDDKNKFDEWFH-TTHVARAKGVADEIKSTRERVNEI  121

Query  578  RL-DLELLQGGSLNNPQLPAADLQAH---VAEDELVGFDEDAQTIKYRLTEKLDDttvia  411
            R  D   LQ  +L++      D +     V ED+ VGFD++ + +  RL    D   V+ 
Sbjct  122  RENDAYGLQAITLDD-NFNRGDEERKSPVVEEDDAVGFDDEVKIVIDRLMGGSDYVEVVP  180

Query  410  ivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKD  231
            +VG  G+GKTTL   I+ D ++ +EF+TR+W+YVS T  R++IF++IIS FT+ T  Y D
Sbjct  181  VVGMPGLGKTTLAYKIYKDPKVAYEFYTRVWVYVSQTFKRREIFLNIISKFTRNTKQYHD  240

Query  230  MKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVAN  54
              E+ LA  +++ L + GKY IV+DD+W  E WD ++ AFPNN K +R+L+TTR   VA 
Sbjct  241  TPEDDLANEVKELLGKGGKYLIVLDDVWTMEAWDCIKIAFPNNGKRNRVLMTTRQSHVAK  300

Query  53   HVDSKNAPH  27
              +  + PH
Sbjct  301  RFN--DEPH  307



>ref|NP_001234202.1| NRC1 [Solanum lycopersicum]
 gb|ABC26878.1| NRC1 [Solanum lycopersicum]
Length=888

 Score =   184 bits (468),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 124/319 (39%), Positives = 194/319 (61%), Gaps = 26/319 (8%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEV  762
            +D  V  ++  + Q V +N  LI G +D++E+L  +L  F A L +AA   ++  VL+E+
Sbjct  2    VDVGVEFLLENLKQLVLDNVELIGGAKDEIENLRDDLSEFNAFLKQAAMVRSENPVLKEL  61

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEK  582
            V+ I+KVV  AEDA+DK+++E + H+ +G    + +K  +Y +V DAA E++ I+ +  +
Sbjct  62   VRSIRKVVNRAEDAVDKFVIEAKVHKDKGFKGVF-DKPGHYRRVRDAAVEIKGIRDKMRE  120

Query  581  IRL-------------DLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLT  441
            IR              D  + +GG    P +        V ED++VGFD++AQT+  RL 
Sbjct  121  IRQNKAHGLQALLQDHDDSISRGGEERQPPV--------VEEDDVVGFDDEAQTVIDRLL  172

Query  440  EKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISN  261
            E   D  VI +VG  G+GKTTL   IF   ++ +EFFTRLW+YVS +   ++++++IIS 
Sbjct  173  EGSGDLEVIPVVGMPGLGKTTLATKIFKHPKIEYEFFTRLWLYVSQSYKTRELYLNIISK  232

Query  260  FTKETSGYKDMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRIL  84
            FT  T   +DM E+ LA ++Q+ L E GKY IV+DD+W T+ WD ++ AFP N KG+R+L
Sbjct  233  FTGNTKHCRDMSEKDLALKVQEILEEGGKYLIVLDDVWSTDAWDRIKIAFPKNDKGNRVL  292

Query  83   VTTRVLEVANHVDSKNAPH  27
            +TTR   VA + +   +PH
Sbjct  293  LTTRDHRVARYCN--RSPH  309



>ref|XP_009618298.1| PREDICTED: disease resistance protein RPP13-like [Nicotiana tomentosiformis]
Length=619

 Score =   182 bits (462),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 127/308 (41%), Positives = 196/308 (64%), Gaps = 10/308 (3%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            D  V  ++  ++Q + +N  LI+GI+ +VE+LL +L  F A L +AAK+  D  VL+ +V
Sbjct  3    DVAVKFLVENLMQLLIDNADLIVGIKGEVENLLQDLNDFNAFLKQAAKSRRDNEVLKSLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            +KI+KVV DAED+IDK+++E + H  +    +W   +++  +    A E+++I++R ++I
Sbjct  63   KKIRKVVNDAEDSIDKFVIEAKRHDDKNKFAQWFH-LTHVARAKGVADEIKTIRERVKEI  121

Query  578  RL-DLELLQGGSL--NNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttviai  408
            RL D   LQ  +   N+ Q         V ED++VGFDE+A+T+  RL    D   V+ +
Sbjct  122  RLNDSYGLQAITSDDNSNQGAQERKVPVVEEDDVVGFDEEAKTVIDRLIGGSD--YVVPV  179

Query  407  vggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDM  228
            VG  G+GKTTL   I+ D ++ +EFF R+W+YVS + NR++IF++IIS FT+ T  Y D 
Sbjct  180  VGMPGLGKTTLAYKIYKDPKVEYEFFNRIWVYVSQSFNRREIFLNIISKFTRNTKQYHDT  239

Query  227  KEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANH  51
             EE+LA  I++ L + GKY IV+DD+W  E WD ++ AFPNN K +R+L+TTR   VA  
Sbjct  240  PEEELANEIKELLGKGGKYLIVLDDVWTREAWDRIKIAFPNNDKQNRVLMTTRQSNVAKC  299

Query  50   VDSKNAPH  27
             + K  PH
Sbjct  300  CNDK--PH  305



>ref|XP_004248798.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=885

 Score =   182 bits (461),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 119/317 (38%), Positives = 190/317 (60%), Gaps = 26/317 (8%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNC--NDKAVLEEV  762
            +  V  ++  ++Q + +N  LI G+++  E LL +L  F A  + A  C  N+  VL E+
Sbjct  3    NVAVEFLVENLMQLLRDNVELISGVKEAAESLLQDLNDFNAFLKQAAKCHINENEVLREL  62

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGRGV--LMKWPEKVSYYNKVNDAAKEMESIKKRA  588
            V+KI+ VV  AEDAIDK+++E + H+ +GV  ++  P    +Y +V + A E+++I+ + 
Sbjct  63   VKKIRTVVNSAEDAIDKFVIEAKLHKDKGVTRVLDLP----HYKRVKEVAGEIKAIRNKV  118

Query  587  EKIRLDLELLQGGSLNNPQLPAADLQAH---------VAEDELVGFDEDAQTIKYRLTEK  435
             +IR      Q  ++    L   DL A          V ED++VGFDE+A  +  RL  +
Sbjct  119  REIR------QTDAIGLQALQDDDLSARGSEERKPPVVEEDDVVGFDEEADIVINRLLGE  172

Query  434  LDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFT  255
             +   V+ +VG  G+GKTTL   I+   ++ +EFFTR+W+YVS +  R+++F++IIS FT
Sbjct  173  SNHLEVVPVVGMPGLGKTTLANKIYKHPKIGYEFFTRIWVYVSQSYRRRELFLNIISKFT  232

Query  254  KETSGYKDMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVT  78
            + T  Y  M EE LA+ IQ+FL + GKY +V+DD+W  E W+ ++ AFPNN K +R+L+T
Sbjct  233  RNTKQYHGMCEEDLADEIQEFLGKGGKYLVVLDDVWSDEAWERIKIAFPNNNKPNRVLLT  292

Query  77   TRVLEVANHVDSKNAPH  27
            TR  +VA   +    PH
Sbjct  293  TRDSKVAKQCNP--IPH  307



>ref|XP_009624787.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=888

 Score =   180 bits (457),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 123/315 (39%), Positives = 196/315 (62%), Gaps = 19/315 (6%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            +  V  ++  ++Q + +N  LI+G++D+ E LL +L  F A L +A+K+ ++  V +E+V
Sbjct  3    NVAVEFLVENLMQLLRDNAELIIGVKDEAESLLQDLNEFNAFLKQASKSRSENDVHKELV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            +KI+ VV  AEDAIDK+++E + H+ +GV  ++ + V +Y +V D A E+++I+ + ++I
Sbjct  63   KKIKTVVNSAEDAIDKFVIEAKLHKDKGV-GRFVD-VKHYKRVYDVAGEIKAIRDKVKEI  120

Query  578  RLD----LELLQ----GGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDt  423
            RL+    L+ LQ           + P       V ED++VGF+E+A  +  RL    D  
Sbjct  121  RLNNSHGLQALQDEDQSARYVEERKPPV-----VEEDDVVGFEEEADKVINRLLGGSDGL  175

Query  422  tviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETS  243
             V+ +VG  G+GKTTL   I+   ++ +EFFTR+W+YVS +  R+++F++IIS FT+ T 
Sbjct  176  EVVPVVGMPGLGKTTLANKIYKHPKIGYEFFTRIWVYVSQSYRRRELFLNIISKFTRNTK  235

Query  242  GYKDMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFP-NNQKGSRILVTTRV  69
             Y  M EE LA+ IQDFL + GKY IV+DD+W  + W+ +R AFP NN K +RIL+TTR 
Sbjct  236  QYHGMCEEDLADEIQDFLGKGGKYLIVLDDVWSPDAWERIRIAFPNNNNKSNRILLTTRD  295

Query  68   LEVANHV-DSKNAPH  27
             +VA         PH
Sbjct  296  SKVAKQCKQCIGIPH  310



>ref|XP_009769019.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=884

 Score =   180 bits (456),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 126/308 (41%), Positives = 194/308 (63%), Gaps = 10/308 (3%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            D  V  ++  ++Q + +N  LI+GI+ +VE+LL +L  F A L +AAK+  D  VL+ +V
Sbjct  3    DVAVKFLVENLMQLLIDNADLIIGIKGEVENLLQDLNDFNAFLRQAAKSRRDNEVLKSLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            +KI+KVV DAED+IDK+++E + H  +    +W   +++  +    A E++ I++R ++I
Sbjct  63   KKIRKVVNDAEDSIDKFVIEAKRHDDKNKFAQWFH-LTHVARAKGVADEIKIIRERVKEI  121

Query  578  RL-DLELLQG-GSLNNPQLPAADLQAHVAEDELV-GFDEDAQTIKYRLTEKLDDttviai  408
            R  D   LQ   S +NP   A + +  V E++ V GFDE+A T+  RL    D   V+ +
Sbjct  122  RQNDAYGLQAITSDDNPNQGAQERKVPVVEEDDVVGFDEEATTVIDRLIGGSD--YVVPV  179

Query  407  vggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDM  228
            VG  G+GKTTL   IF D  + +EFF R+W+YVS + NR++IF++IIS FT+ T  Y D 
Sbjct  180  VGMPGLGKTTLAYKIFKDPTVEYEFFNRIWVYVSQSFNRREIFLNIISKFTRNTKQYHDT  239

Query  227  KEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANH  51
             EE+LA  I++ L + GKY +V+DD+W  E W+ ++ AFPNN K +R+L+TTR   VA  
Sbjct  240  PEEELANEIKELLGKGGKYLVVLDDVWTREAWNRIKIAFPNNNKRNRVLMTTRQSNVAKC  299

Query  50   VDSKNAPH  27
             + K  PH
Sbjct  300  CNDK--PH  305



>ref|XP_006359790.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=886

 Score =   179 bits (455),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 118/317 (37%), Positives = 189/317 (60%), Gaps = 26/317 (8%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNC--NDKAVLEEV  762
            +  V  ++  ++Q + +N  LI G+++  E LL +L  F A  + A  C  N+  VL E+
Sbjct  3    NVAVEFLVENLMQLLRDNAELISGVKEAAESLLQDLNDFNAFLKQAAKCHINENEVLREL  62

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEK  582
            V+KI+ VV  AEDAIDK+++E + H+ +G  M     + +Y +V + A E+++I+ + ++
Sbjct  63   VKKIRTVVNSAEDAIDKFVIEAKLHKDKG--MTRVLDLPHYKRVREVAGEIKAIRNKVKE  120

Query  581  IR----LDLELLQ-------GGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEK  435
            IR    + L+ LQ       G     P +        V ED++VGFDE+A  +  RL  +
Sbjct  121  IRQNDAIGLQALQDDDSSARGFEERKPPV--------VEEDDVVGFDEEADIVIKRLLGE  172

Query  434  LDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFT  255
             +   V+ +VG  G+GKTTL   I+   ++ +EFFTR+W+YVS +  R+++F++IIS FT
Sbjct  173  SNRLEVVPVVGMPGLGKTTLANKIYKHPKIGYEFFTRIWVYVSQSYRRRELFLNIISKFT  232

Query  254  KETSGYKDMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVT  78
            + T  Y  M EE LA+ IQ+FL + GKY +V+DD+W  E W+ ++ AFPNN K +R+L+T
Sbjct  233  RNTKQYHGMCEEDLADEIQEFLGKGGKYLVVLDDVWSDEAWERIKIAFPNNNKPNRVLLT  292

Query  77   TRVLEVANHVDSKNAPH  27
            TR  +VA        PH
Sbjct  293  TRDSKVAKQCTP--IPH  307



>gb|EYU29956.1| hypothetical protein MIMGU_mgv1a001088mg [Erythranthe guttata]
Length=893

 Score =   172 bits (437),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 115/308 (37%), Positives = 183/308 (59%), Gaps = 6/308 (2%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            DA V  ++  + Q +  N  LI  I+DQVE L  +L  F A L ++ +  +    L+E+V
Sbjct  3    DAAVEFLLENLKQLLLYNAKLITDIKDQVEFLYNDLTLFKAFLKDSTEKRSKHETLKELV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            ++I+ VV +AEDAID ++ +   H+ R  L K      Y  K+ +  +E+ESI+ + + I
Sbjct  63   KQIRNVVYEAEDAIDSFVAQAAAHKARKPLSKALHMFDYPAKLRNVGREIESIRTKVKDI  122

Query  578  ----RLDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttvia  411
                +   E++  G  +N           V ED +VGF+++A+ +   LT   D+  VI+
Sbjct  123  YEHKKFGFEIVNVGDGSNGGTKEKKPPV-VEEDNVVGFEDEAEKVINLLTGGSDELQVIS  181

Query  410  ivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKD  231
            IVG  G+GKTTL KMI+ + ++ +EF++R W+YVS   +RK++F++I+SNFT+ T     
Sbjct  182  IVGMPGLGKTTLAKMIYRNSKIEYEFYSRAWVYVSQDYSRKELFLNILSNFTQLTDSMYK  241

Query  230  MKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANH  51
            M +E L++ +  FL +GKY IV+DD+W  E W+ L+ AFP N K SRIL+T+R+  VA H
Sbjct  242  MNDENLSKELYKFLEKGKYLIVLDDVWTEEAWNDLKIAFPKNNKRSRILITSRIKRVAIH  301

Query  50   VDSKNAPH  27
             +    PH
Sbjct  302  ANPNLEPH  309



>ref|XP_009774012.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=887

 Score =   167 bits (422),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 116/308 (38%), Positives = 182/308 (59%), Gaps = 8/308 (3%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNC-NDKAVLEEVV  759
            D  V  ++  ++Q + +N   I+GI+D+VE+LL EL  F A    A  C ND  VL+ +V
Sbjct  3    DVAVKFLVENLMQLLRDNAGFIVGIKDEVENLLQELNDFNAFLRQAAECRNDNDVLKSLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            + I+KVV DAED+I K+++E + H  +    +W   +++  +  + A ++E  +++ + I
Sbjct  63   KTIRKVVNDAEDSIAKFVIEAKRHDDKNKFAQW-FHLTHVARTKEVAGDIEFAREKVKII  121

Query  578  RLD-LELLQG--GSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttviai  408
            R D    LQ      ++ + P       V ED++VGFDE+A+T+  RL    D   V+ I
Sbjct  122  RRDNTYALQAIFSDDDSSRGPQERKVPVVEEDDVVGFDEEAKTVIDRLIGGSDHLEVVPI  181

Query  407  vggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDM  228
             G  G+GKTTL   I+ D ++  EFF  +W+ VS    R+ IF++I+S FT+ T  Y D+
Sbjct  182  TGMPGLGKTTLAYKIYKDPKVECEFFPCIWVNVSQLYKRRDIFLNIVSKFTRNTKQYYDV  241

Query  227  KEEQLAERIQDFLMEG-KYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANH  51
             EE LA+  ++ L +G KY IV+DD+W  E WD ++ AFPNN K SR+L+TTR   VA +
Sbjct  242  PEEDLADEARELLGKGGKYLIVLDDVWTIEAWDRIKIAFPNNGKCSRVLMTTRKFNVARY  301

Query  50   VDSKNAPH  27
             + +  PH
Sbjct  302  CNDR--PH  307



>ref|XP_011070823.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
Length=892

 Score =   166 bits (420),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 117/314 (37%), Positives = 179/314 (57%), Gaps = 18/314 (6%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            DA V  ++  + Q +  N  LIL I+ QVE L  +L  F A L ++ +  +    L+E+V
Sbjct  3    DAAVEFLLENLKQLLLYNANLILDIKVQVEFLYNDLSLFKAFLKDSTEKRSKHETLKELV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            ++I+ VV +AEDAID ++     H+ R  + K      Y  K+   AK++E I+ + + I
Sbjct  63   KQIRDVVYEAEDAIDTFVAHAAVHKARKHIEKAFHIFDYPAKLRSVAKDIEQIRAKVKDI  122

Query  578  ----RLDLELLQGGSLNNPQLPAADLQAH------VAEDELVGFDEDAQTIKYRLTEKLD  429
                +   E L  G         AD          V ED +VGF+++A+ +   LT   D
Sbjct  123  YENKKFGFEALHVGD-------GADRGTKEKKPPIVEEDNVVGFEDEAEKVINLLTGGSD  175

Query  428  DttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKE  249
            +  VI+IVG  G+GKTTL KMI+ D ++ +EF++R WIY+S   +RK++F++I+SNFT+ 
Sbjct  176  ELEVISIVGMPGLGKTTLAKMIYRDPKIEYEFYSRAWIYISQDYSRKEVFLNILSNFTQL  235

Query  248  TSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRV  69
            T     M +E LA+ +   L +GKY IV+DD+W  E W+ L+ AFP N K SRIL+T+R+
Sbjct  236  TDSMYKMNDENLAKELCRILEKGKYLIVMDDVWSEEAWNDLKVAFPKNNKRSRILITSRI  295

Query  68   LEVANHVDSKNAPH  27
              VA H +    PH
Sbjct  296  KRVARHANPSREPH  309



>gb|AGX27500.1| NBS-LRR class resistance protein Fy2-Ry2 [Sesamum indicum]
Length=892

 Score =   166 bits (420),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 117/314 (37%), Positives = 179/314 (57%), Gaps = 18/314 (6%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            DA V  ++  + Q +  N  LIL I+ QVE L  +L  F A L ++ +  +    L+E+V
Sbjct  3    DAAVEFLLENLKQLLLYNANLILDIKVQVEFLYNDLSLFKAFLKDSTEKRSKHETLKELV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            ++I+ VV +AEDAID ++     H+ R  + K      Y  K+   AK++E I+ + + I
Sbjct  63   KQIRDVVYEAEDAIDTFVAHAAVHKARKHIEKAFHIFDYPAKLRSVAKDIEQIRAKVKDI  122

Query  578  ----RLDLELLQGGSLNNPQLPAADLQAH------VAEDELVGFDEDAQTIKYRLTEKLD  429
                +   E L  G         AD          V ED +VGF+++A+ +   LT   D
Sbjct  123  YENKKFGFEALHVGD-------GADRGTKEKKPPIVEEDNVVGFEDEAEKVINLLTGGSD  175

Query  428  DttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKE  249
            +  VI+IVG  G+GKTTL KMI+ D ++ +EF++R WIY+S   +RK++F++I+SNFT+ 
Sbjct  176  ELEVISIVGMPGLGKTTLAKMIYRDPKIEYEFYSRAWIYISQDYSRKEVFLNILSNFTQL  235

Query  248  TSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRV  69
            T     M +E LA+ +   L +GKY IV+DD+W  E W+ L+ AFP N K SRIL+T+R+
Sbjct  236  TDSMYKMNDENLAKELCRILEKGKYLIVMDDVWSEEAWNDLKVAFPKNNKRSRILITSRI  295

Query  68   LEVANHVDSKNAPH  27
              VA H +    PH
Sbjct  296  KRVARHANPSREPH  309



>ref|XP_009793189.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=873

 Score =   166 bits (419),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 113/315 (36%), Positives = 189/315 (60%), Gaps = 19/315 (6%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAA-----KNCNDKAVL  771
            D  +  VI  ++Q   +N  LI  I D V+ LL EL++  A  + A     +NCN+  +L
Sbjct  3    DTALDFVIDNLMQLYRDNTDLIAAIADDVQSLLVELQNLHAFLKQATKSRSRNCNE--IL  60

Query  770  EEVVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKR  591
            + +V+++   V +AE +I+K++++ + H+ +G+   +     +  K    A E++ IK++
Sbjct  61   KHLVKELSTAVNEAEVSIEKFVIKAKLHQKKGIRKIF--DFGHVMKARQCAAEIKFIKEK  118

Query  590  AEKIRLD----LELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDt  423
             ++IR +    ++     ++ + +L    L     ED++VGFDE+A  I  RL E  +D 
Sbjct  119  LKEIRRENAYHIQFEDQQNVTDQELRKVPLPE---EDDVVGFDEEAAEIINRLCEGSNDL  175

Query  422  tviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETS  243
             +I IVG  G+GKTTL   IF D  +++EFFTR+W+YV+ + NR+++F++IIS FT+   
Sbjct  176  EIIPIVGMPGLGKTTLANKIFKDNRVQYEFFTRIWVYVAQSYNRREVFLNIISKFTRNVK  235

Query  242  GYKDMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVL  66
             +K   EE LAE I++FL + GKY IV+DD+W  E  + L+ AFP+N KG++I++TTR  
Sbjct  236  QFKYEAEEDLAEPIREFLGKGGKYLIVLDDIWTLEALNELKIAFPHNHKGNKIMLTTRNS  295

Query  65   EVANHVDSKNAPHKF  21
             +A   +  N PHK 
Sbjct  296  SLAYSCN--NFPHKL  308



>ref|XP_009614364.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=887

 Score =   163 bits (413),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 116/308 (38%), Positives = 183/308 (59%), Gaps = 8/308 (3%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            D  V  ++  ++  + +N  LI+GI+ +VE LL +L  F A L +AAK+  D  VL+ +V
Sbjct  3    DVAVNFLVENLMHLIIDNAGLIIGIKGEVEHLLHDLNDFNAFLKQAAKSRRDNEVLKSLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            +KI+KVV DAED+IDK+++E + H       +W   +++  +    A E+ +I++R + I
Sbjct  63   KKIRKVVNDAEDSIDKFVIEAKRHDDMNKFAQW-FHLTHVTRAKGVADEINTIRERVKVI  121

Query  578  RL-DLELLQGGSLN-NPQLPAADLQAHVAE-DELVGFDEDAQTIKYRLTEKLDDttviai  408
            R  D   LQ  + + N    A + +  V E D + GFDE+ +T+   L    D   V+ I
Sbjct  122  RENDAYGLQAITFDDNFNKGAQERKVPVVEEDNVGGFDEEVKTVIDHLIGGSDHLEVVPI  181

Query  407  vggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDM  228
            VG  G+GKTTL   I+ D ++  EFF  +W+ VS    R++IF++IIS FT+ +  Y D+
Sbjct  182  VGMPGLGKTTLAYKIYKDPKVECEFFPCIWVNVSQLYKRREIFLNIISKFTRNSKQYYDV  241

Query  227  KEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANH  51
             E+ LA+  ++ L + GKY IV+DD+W  E WD ++ AFP+N K SR+L+TT    VA +
Sbjct  242  PEDDLADEARELLGKGGKYLIVLDDVWTMEAWDRIKIAFPDNGKCSRVLMTTTHRNVARY  301

Query  50   VDSKNAPH  27
             + K  PH
Sbjct  302  CNDK--PH  307



>emb|CDP05558.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 104/311 (33%), Positives = 182/311 (59%), Gaps = 8/311 (3%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            DAVV  ++  + + +  +  L+ G++DQVE L  EL    A L ++ +  ++ A + E+V
Sbjct  3    DAVVEFLLANLKELLLYHVDLLSGVKDQVESLHRELSLMKAFLKDSREKRDESAYVREIV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            ++I  V  +AED ID ++V     + R  L +    + + N +   +++++SIK + ++I
Sbjct  63   RQITDVTYEAEDIIDTFVVHAAMQKARSALKRVFHALDHSNMLRSVSEDIKSIKVKVKEI  122

Query  578  ----RLDLELLQGGSLNNPQLPAADLQAHVAEDE-LVGFDEDAQTIKYRLTEKLDDttvi  414
                   +E LQ G  ++   P+A  +A + E+E +VGFDE+A+T+  RLT+  +   VI
Sbjct  123  YDKKMFGIESLQSGEPSHK--PSARKRAPIVEEENVVGFDEEARTVVERLTDGPEQLEVI  180

Query  413  aivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYK  234
            ++VG  G+GKTTL K +++D  + + F+ R W+Y+S    R+++F+ I+ +    T    
Sbjct  181  SVVGMGGLGKTTLAKKVYSDPSIEYHFYIRAWVYMSQQYCRREVFLGILDSMGLITDQVY  240

Query  233  DMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVAN  54
             M +++LAE +   L   +Y IV+DD+W TE W+ ++ AFPN   GSRIL+T+R  EVA 
Sbjct  241  KMNDDRLAEELFRHLRSNRYLIVIDDVWTTEAWNDIKMAFPNTACGSRILLTSRNTEVAM  300

Query  53   HVDSKNAPHKF  21
            H +    PH+ 
Sbjct  301  HANPYCNPHRL  311



>emb|CDP18959.1| unnamed protein product [Coffea canephora]
Length=890

 Score =   151 bits (382),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 107/316 (34%), Positives = 168/316 (53%), Gaps = 17/316 (5%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCE----LRSFWALSEAAKNCNDKAVLE  768
            DA +G ++  + +SV+ N  LI G++D V++L CE    LR+F  + E     +D  +LE
Sbjct  6    DAALGFILQNLKESVQYNTELIGGVKDNVKEL-CEDLETLRAF--IREYTDKYSDNEILE  62

Query  767  EVVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRA  588
            ++  +I+ VV  AEDAI+ Y+      + R  + K    V Y + +    KE+E + K  
Sbjct  63   KLASEIRGVVYRAEDAIETYISCASVQKLRRAISKATHFVDYISDLRAVGKEIEKVSKDV  122

Query  587  EKI-----RLDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDt  423
            ++I      L    +Q   ++N +         V ED +VGFD+ A+ +   LT + DD 
Sbjct  123  QEIYQNRAALGFAAMQIEEISNRRQKKKKTPV-VEEDNVVGFDDAAKEVIELLTGESDDQ  181

Query  422  tviaivggagig----ktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFT  255
            +    V          KTTL K + ND ++ +EF+TR ++ VS    RK++F+ I+  FT
Sbjct  182  SDQLEVISIIGMLGLGKTTLAKKVLNDPKIEYEFYTRAFVNVSQEYERKEMFLKILGQFT  241

Query  254  KETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTT  75
            + T     M +EQL + + D L   KY IV+DD+W  E WD L+ AFPNN K SR+L+T+
Sbjct  242  QITDQMNKMSDEQLCKELHDQLKTRKYLIVMDDVWTNEAWDQLKGAFPNNNKRSRVLITS  301

Query  74   RVLEVANHVDSKNAPH  27
            R   VA H +    P+
Sbjct  302  RHKPVAVHANQSIDPY  317



>emb|CDP16255.1| unnamed protein product [Coffea canephora]
Length=886

 Score =   151 bits (382),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 108/317 (34%), Positives = 179/317 (56%), Gaps = 23/317 (7%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSE--AAKNCNDKAVLEEV  762
            +A V  V+  + Q +  N  LI  + + VE L  +L+      +     NC+ +A L+ +
Sbjct  3    EAAVSFVLENLKQILVYNSHLIADVRENVEKLCDQLKILNGFVKDYTEMNCSTEA-LKAL  61

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEK  582
             ++++ VV +AED +DKY+V     + RG + K  + V Y +K+ D  KE+E +  R  K
Sbjct  62   RRELKSVVSEAEDVVDKYIVHASMQKARGKVEKVFKIVDYGSKLRDLGKEIEQVSGRV-K  120

Query  581  IRLDLELLQGGSLNNPQLPAADLQ------------AHVAEDELVGFDEDAQTIKYRLTE  438
            + L+ +++       P+L AA +Q              V ED ++GFD+  + +   L  
Sbjct  121  VILESQIV-------PRLEAAQIQDIANERAKKKQAPIVEEDNVIGFDDATKAVMELLKA  173

Query  437  KLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNF  258
              +D  VI+IVG  G+GKTTL K + +D ++ ++FF R +IYVS    R ++F++I+ + 
Sbjct  174  GSEDLEVISIVGMHGLGKTTLAKKVLHDPKIEYDFFARAFIYVSQQFERAEVFLNILGSI  233

Query  257  TKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVT  78
             + T   K+M EE+LAE +++ L    Y IV+DD+W+ EDWD L+ AFPNN+K SR+L+T
Sbjct  234  GQLTEEAKNMPEEKLAEHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLIT  293

Query  77   TRVLEVANHVDSKNAPH  27
            TR   VA + +    P+
Sbjct  294  TRNTSVAIYANPAVEPY  310



>ref|XP_004248175.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Solanum lycopersicum]
Length=887

 Score =   148 bits (373),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 104/308 (34%), Positives = 172/308 (56%), Gaps = 6/308 (2%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            DAVV  ++  + Q +  +  L+ G++D+VE L  EL    A L ++ +  ++   + E+V
Sbjct  3    DAVVEFLLLNLKQLLLYHVDLLSGVKDEVESLHRELSLMKAFLKDSREKRSEYEYVRELV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
             +I  V  +AED ID ++      + R  + +      + +K+ + AKE+ESIK + ++I
Sbjct  63   SQITIVAYEAEDIIDTFVTNAAMQKARSTVRRAFHVFDHSSKLRNVAKEIESIKVKVKEI  122

Query  578  ----RLDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttvia  411
                   ++ L GG  ++   P   +   V E+ +VGFD++A+ I  RLT   ++  +I+
Sbjct  123  YDKKMFGIQSLHGGESSHRSPPQKRVPM-VEEENVVGFDDEARKISSRLTNGSEELEIIS  181

Query  410  ivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKD  231
            IVG  G+GKTTL K ++ D  +   F+ R WIYVS   +RK++F+ I+ + +  T     
Sbjct  182  IVGMGGLGKTTLAKKVYTDSSIEFHFYNRAWIYVSQLYSRKEVFLGILDSLSLITDEMYK  241

Query  230  MKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANH  51
            M +E+LA  +   L   +Y +V+DD+W  E WD L+ AFP    GSRIL+TTR  EVA H
Sbjct  242  MNDEKLAGELFSHLRSKRYLVVIDDVWTMEAWDDLQMAFPKTATGSRILLTTRNTEVALH  301

Query  50   VDSKNAPH  27
             + +  PH
Sbjct  302  ANPEGLPH  309



>ref|XP_009793040.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=881

 Score =   146 bits (369),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 106/309 (34%), Positives = 183/309 (59%), Gaps = 9/309 (3%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            DAVV  ++  ++Q + +N  LI   + ++E+LL E++     L +AAK  +D    + +V
Sbjct  3    DAVVNFLVENLLQLLSDNVKLIGSAKGELENLLKEVQHLKGFLDDAAKLPSDSEQWKVLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            ++IQK V  AEDA+DK++V+ + H+ +  + +  + V +   V + A E++ I  + +++
Sbjct  63   EEIQKTVHTAEDAVDKFVVQAKLHKEKNKMARILD-VGHLATVRNLAAEVKGIHDQVKEL  121

Query  578  RLDLELLQG-GSLNNPQ--LPAADLQAHVAED-ELVGFDEDAQTIKYRLTEKLDDttvia  411
            RL+ + LQ   +L  P+   P    Q    ED E+VGFDE+A  +  RL ++  D  +I 
Sbjct  122  RLNNQALQARPTLELPKKGAPETTQQGPALEDDEVVGFDEEANKVIERLVKESKDLDIIP  181

Query  410  ivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKD  231
            +VG  G+GKTTL + I+ D +L +EFF   W+YV  +   K +F++I+  FT+ T  Y+ 
Sbjct  182  VVGMPGLGKTTLARKIYKDPKLSYEFFGVHWVYVGQSYKIKDVFLNILKYFTRRTEDYQH  241

Query  230  MKEEQLAERIQDFLMEG-KYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVAN  54
               + LA+ I  F+ +G +  I +DD+W T+  DY++T FP N+KG R+++TTR   +A 
Sbjct  242  EDVDALAKVIAGFIKKGGRCLICLDDVWETKVIDYVKTIFPENEKGHRVMMTTRNKVLAT  301

Query  53   HVDSKNAPH  27
            + +S   PH
Sbjct  302  YANSD--PH  308



>ref|XP_009630520.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=889

 Score =   146 bits (369),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 103/314 (33%), Positives = 185/314 (59%), Gaps = 17/314 (5%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            DAV+  ++  ++Q + EN  LI G + ++E L+ E+++  A L EAAK  +D  + ++ +
Sbjct  3    DAVLSFLVENLLQIISENVKLIAGAKGELELLVEEVKTLNAFLDEAAKTQSDNKLWKQFI  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            + I+  V  AED IDK+LV+ + H  + ++ +  +  +Y   V +  +++  + ++ +K+
Sbjct  63   KDIRITVYKAEDIIDKFLVQAKLHADKNIVKRGFD-YNYAGAVKELGEQVGIVLQKVKKL  121

Query  578  RLD---------LELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDD  426
            R D         +   QG +    Q        H+ + E+VGFD++A+T+  RL E  D+
Sbjct  122  REDNKQAFQPTPVSARQGETSTQGQETQV---PHLEDAEVVGFDKEAETVIKRLVEGSDE  178

Query  425  ttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKET  246
              VI +VG AG+GK+TL   I+ND ++ ++FF+ +W+YV      K++ + I+ ++TK+ 
Sbjct  179  LEVIPVVGMAGLGKSTLAIKIYNDSKISYDFFSNIWVYVGQNYKLKEVLLSILKSYTKQM  238

Query  245  SGYKDMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRV  69
            + Y+D  E +L++ I DF+ + GK  IV+DD+W  E  D +  AFP N+KG RI++TTR 
Sbjct  239  NIYQDKNENELSKIICDFVSKGGKCLIVLDDVWNPEVVDSVMKAFPKNKKGHRIMMTTRE  298

Query  68   LEVANHVDSKNAPH  27
              VA + +  + PH
Sbjct  299  GRVAKYAN--DNPH  310



>ref|XP_009761103.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=880

 Score =   145 bits (367),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 103/295 (35%), Positives = 173/295 (59%), Gaps = 10/295 (3%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            DAVV  +   ++Q + +N  LI G + ++E+LL E++     L +AAK  +D    + +V
Sbjct  3    DAVVNFLAENLLQLLTDNVKLIGGAKGELENLLKEVQHLKGFLDDAAKLPSDSEQWKVLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            ++I K V  AEDAIDK+LV+ + H+ +  + ++   VS+   V + A E+  I  + +++
Sbjct  63   EEIHKTVHKAEDAIDKFLVQAKLHQEKSKMGRF-FNVSHLATVRNLAAEINGILGQVKEL  121

Query  578  RLDLELLQGGSLNNPQLPAADLQ-----AHVAEDELVGFDEDAQTIKYRLTEKLDDttvi  414
            R + + LQ   +   +LP    Q       + +DE+VGFDE+A  +  RL E  +D  +I
Sbjct  122  RKNNQALQARPVV--ELPKKGSQEVTQGPSLEDDEVVGFDEEANKVIKRLVEGSEDLDII  179

Query  413  aivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYK  234
             +VG  G+GKTTL + I+ND +L +EFF   W+YV  +   K +F++I+  FT+ T  Y+
Sbjct  180  PVVGMPGLGKTTLARKIYNDPQLSYEFFGVHWVYVGQSYKIKDVFLNILKFFTRRTEDYQ  239

Query  233  DMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTR  72
               E  LA+ I  F+ + G+  I +DD+W  +  DY++  FP N+KG R+++TTR
Sbjct  240  HEDENALAKVIASFIKKGGRCLICLDDVWEIKVIDYVKKVFPENKKGHRVMMTTR  294



>ref|XP_006366307.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006366308.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
Length=887

 Score =   145 bits (367),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 100/288 (35%), Positives = 160/288 (56%), Gaps = 6/288 (2%)
 Frame = -2

Query  875  LILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVVQKIQKVVIDAEDAIDKYLVE  699
            L+ G++DQVE L  EL    A L ++ +  ++   + E+V +I  V  +AED ID ++  
Sbjct  23   LLSGVKDQVESLHRELSLMKAFLKDSREKRSEYEYVRELVSQITIVAYEAEDIIDTFVTN  82

Query  698  ERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI----RLDLELLQGGSLNNPQ  531
                + R  + +      + +K+ + AKE+ESIK + ++I       ++ L GG  ++ +
Sbjct  83   AAMQKARSPVGRALHVFDHSSKLRNVAKEIESIKVKVKEIYDKKMFGIQSLHGGE-SSRR  141

Query  530  LPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFNDR  351
             P       V E+ +VGFD++A  I  RLT   ++  +I+IVG  G+GKTTL K ++ D 
Sbjct  142  SPPQKRVPMVEEENVVGFDDEAMKISSRLTNGSEELEIISIVGMGGLGKTTLAKKVYTDP  201

Query  350  ELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQDFLMEGKYF  171
             +   F+ R WIYVS   +RK++F+ I+ +    T     M +E+LA  +   L   +Y 
Sbjct  202  SVEFHFYNRAWIYVSQLYSRKEVFLGILDSLGLITDEMYKMNDEKLAGELFSHLRSKRYL  261

Query  170  IVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            +V+DD+W  E WD L+ AFP    GSRIL+TTR  EVA H + +  PH
Sbjct  262  VVIDDVWTMEAWDDLQMAFPKTASGSRILLTTRNTEVALHANPEGLPH  309



>ref|XP_009788462.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana sylvestris]
Length=877

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 106/309 (34%), Positives = 177/309 (57%), Gaps = 19/309 (6%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            DAV    +  ++Q + EN  LI G + Q+E L+ E+++  A L EAAK  +D  + ++ +
Sbjct  3    DAVRSFFVENLLQIISENVKLIAGTKGQLELLVEEVKTLNAFLDEAAKTQSDNKLWKQFI  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            + I+  V  AED IDK+LV+ + H  +   +K     +Y   V +  +++  + ++ +K+
Sbjct  63   KDIRITVYKAEDIIDKFLVQAKLHADKN-FVKRGFDYNYAGAVKELGEQVGIVLQKVKKL  121

Query  578  RLDLELLQGGSLNNPQ----LPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttvia  411
            R D          N Q     P +    H+ + E+VGFD++A+T+  RL E  D+  VI 
Sbjct  122  RED----------NKQAFQPTPVSARVPHLEDAEVVGFDKEAETVIKRLVEGSDELEVIP  171

Query  410  ivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKD  231
            +VG AG+GK+TL   I+ND ++ +EFF+ +W+YV      K++ + I+ +FTK+ + Y+D
Sbjct  172  VVGMAGLGKSTLAIKIYNDSKISYEFFSNIWVYVGQNYKLKEVLLSILKSFTKQMNIYQD  231

Query  230  MKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVAN  54
              E +L + I DF+ + GK  IV+DD+   E  D +  AFP N+KG RI++TTR   VA 
Sbjct  232  KNENELCKIICDFVSKGGKCLIVLDDVCNPEVVDSVMKAFPKNKKGHRIMMTTREGRVAK  291

Query  53   HVDSKNAPH  27
            + +    PH
Sbjct  292  YANEN--PH  298



>ref|XP_009594795.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=882

 Score =   145 bits (366),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 106/310 (34%), Positives = 185/310 (60%), Gaps = 10/310 (3%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            DAVV  ++  ++Q + +N  LI G + ++E+LL E++     L +AAK  +D    + +V
Sbjct  3    DAVVNFLVENLLQLLTDNVKLIGGAKGELENLLKEVQHLKGFLDDAAKLPSDSEQWKVLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            ++IQK V  AEDA+DK++V+ + H+ +  + +  + V +   V + A E++ I ++ +++
Sbjct  63   EEIQKTVHTAEDAVDKFVVQAKLHKEKSKVGRILD-VGHLATVRNLAAEVKGIHEQVKEL  121

Query  578  RLDLELLQG-GSLNNPQLPA---ADLQAHVAED-ELVGFDEDAQTIKYRLTEKLDDttvi  414
            R + + LQ   +L  P+  A    D Q    ED E+VGFDE+A  +  RL ++  D  +I
Sbjct  122  RQNNQALQARPTLELPKKGAPETTDQQGPALEDDEVVGFDEEADKVIKRLVKESKDLDII  181

Query  413  aivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYK  234
             +VG  G+GKTTL + I+ND +L +EFF   W+YV  +   K +F++I+  FT+ T  Y+
Sbjct  182  PVVGMPGLGKTTLARKIYNDPQLSYEFFGVHWVYVGQSYKIKDVFLNILKFFTRRTEDYQ  241

Query  233  DMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVA  57
                + LA+ I  F+ + G+  I +DD+W T+  DY++  FP N+KG R+++TTR   +A
Sbjct  242  HEDVDALAKVIAGFIKKGGRCLICLDDVWETKVIDYVKKVFPENEKGHRVMMTTRDKVLA  301

Query  56   NHVDSKNAPH  27
             + + +  PH
Sbjct  302  TYANPE--PH  309



>ref|XP_006367931.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
isoform X2 [Solanum tuberosum]
Length=932

 Score =   144 bits (363),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 108/311 (35%), Positives = 178/311 (57%), Gaps = 13/311 (4%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            D VV  ++  ++Q + EN  LI G +D+  +LL E++   A L +A+K  +D    +++V
Sbjct  3    DTVVNFLVENLLQLLSENVALIKGADDEFNNLLEEVQRLKAFLDDASKYHSDSKQWDQLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            + IQK V  AED IDK+LV+ + HR +G + ++ +KVS+   V D A E++ I  + +K+
Sbjct  63   KDIQKTVHKAEDVIDKFLVQSKQHREKGKVGRFFDKVSHIGTVRDLATEIKGIHDKVKKL  122

Query  578  RLDLELLQGGSLNNP--QLPAADLQ---AHVAEDELVGFDEDAQTIKYRLTE-KLDDttv  417
            R   E  Q      P  +LP   +Q     +  DE+VGFD++A  +  RL E   +   +
Sbjct  123  R---ENNQQAFQPRPVLELPKKGVQEQGPSLENDEVVGFDDEASKVIKRLVEGPAESLDI  179

Query  416  iaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGY  237
            I + G  G+GKTTL + I+ND +L +EFF+  W+YV      K I++ I+  F K    +
Sbjct  180  IPVAGMPGLGKTTLARKIYNDPKLSYEFFSIPWVYVGQEYKIKDIYLRILKCFKKSIEDH  239

Query  236  KDMKEEQLAERIQDFLMEG-KYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEV  60
             +   + LA+ I DF+ +G +  IV+DD+W  E  D ++  F  N+KG RI++TTR   +
Sbjct  240  LNDDVDTLAKVISDFINKGERCLIVLDDVWVAEVIDDVKKVFAENKKGHRIMMTTRDRYL  299

Query  59   ANHVDSKNAPH  27
            A + +++  PH
Sbjct  300  ATYANTE--PH  308



>ref|XP_004234046.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=866

 Score =   144 bits (363),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 108/311 (35%), Positives = 171/311 (55%), Gaps = 18/311 (6%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            +  +   +  + Q + +N  +I  I+D+V  LL EL    A L ++ +N     +L+  V
Sbjct  3    ETTLEFALSSLTQQLVDNMGVIGVIKDEVSCLLSELHHLRAFLIDSNRNRRGSKILKHFV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            +++ + +  AE++IDK+++E   H+ RG+   +   + Y  K      ++ SI ++ ++I
Sbjct  63   EELNRAINKAENSIDKFMIEVTLHKKRGIYRIF--DLCYLVKAKRCCSDIRSIMEKLKEI  120

Query  578  RLDLELLQGGSLNNPQLPAADLQAH-------VAEDELVGFDEDAQTIKYRLTEKLDDtt  420
            R D       SL   QL  +   AH       V EDE+VGFDE+A  I  RL    DD  
Sbjct  121  RRDTAYALSLSL---QLDDSKQTAHQLKRAPVVEEDEVVGFDEEADEIINRLLGGSDDVE  177

Query  419  viaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSG  240
             I+IVG  G+GKTTL   +F  + + +EF+ R+W+YVS +  R+ +F+ II+ FT+ T  
Sbjct  178  FISIVGMPGLGKTTLANKVF--KSVGYEFYNRIWVYVSQSYTRRDLFLKIINQFTRNTEQ  235

Query  239  YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEV  60
            Y+ + EE LAE I+  L+ GKY IV+DD+W  E  D ++ A PN  +G ++L TTR  EV
Sbjct  236  YRYVTEEALAEVIRKHLLFGKYLIVLDDVWTQEPLDDVKIALPNKMRG-KVLFTTRDDEV  294

Query  59   ANHVDSKNAPH  27
                   N PH
Sbjct  295  GKFCC--NEPH  303



>emb|CDP00592.1| unnamed protein product [Coffea canephora]
Length=933

 Score =   142 bits (358),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 104/331 (31%), Positives = 182/331 (55%), Gaps = 30/331 (9%)
 Frame = -2

Query  932  AVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVVQ  756
            +V+G ++  + +SV+ N  LI G+   V+ L  +L +  A + E  +  ++  +LE++  
Sbjct  25   SVLGFILQNLKESVQCNSELIGGVSKGVKGLCGDLDTLRAFIKEYYERRSNSQILEKLAN  84

Query  755  KIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVS-YYNKVNDAAKEMESIKKRAEKI  579
            +I+ VV  AEDAI+ Y+V E  H+GR  +    + +  Y +   +A K++E + ++ ++I
Sbjct  85   EIRNVVYQAEDAIETYIVLESKHKGRRTIGVAADHIGGYVSDALNATKQIEDVCRKLKEI  144

Query  578  -----RLDLELLQGGSLNNPQLPAADLQ---------AHVA-------------EDELVG  480
                  LD + +Q G  ++ ++P  + +         +HV              ED +VG
Sbjct  145  YQIKTPLDPDAMQVGQ-SSKRIPKKEEKFTYSMGYKFSHVVIIFQLLILAVTEEEDNVVG  203

Query  479  FDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMT  300
             D++A+ +   LTE   +  VI+++G  G+GKTTL K I ND  +  +F++R ++ VS  
Sbjct  204  LDDEAKNVIELLTEGSQELEVISVIGMHGLGKTTLAKKILNDPTIEFKFYSRAFVEVSQE  263

Query  299  VNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRT  120
              R+++F+ I+  FTK T   KD+ +++L + +   L   KY IV+DD+W  + WD L+ 
Sbjct  264  FERREVFLHILGAFTKITEEIKDLSDDKLVKELHRQLKTRKYLIVLDDVWTPDAWDQLKL  323

Query  119  AFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            AFPNN K SRIL+T+    VA H +    PH
Sbjct  324  AFPNNDKQSRILITSHNEPVAFHANPSCDPH  354



>ref|XP_006367930.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
isoform X1 [Solanum tuberosum]
Length=932

 Score =   141 bits (356),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 108/311 (35%), Positives = 177/311 (57%), Gaps = 13/311 (4%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            D VV  ++  ++Q + EN  LI G +D+  +LL E++   A L +A+K  +D    +++V
Sbjct  3    DTVVNFLVENLLQLLSENVALIKGADDEFNNLLEEVQRLKAFLDDASKYHSDSKQWDQLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            + IQK V  AED IDK+LV+ + HR +G + K  +KV++   V D A E++ I  + +K+
Sbjct  63   KDIQKTVHKAEDVIDKFLVQSKQHREKGKVGKILDKVNHIGIVRDLATEIKGIHDKVKKL  122

Query  578  RLDLELLQGGSLNNP--QLPAADLQ---AHVAEDELVGFDEDAQTIKYRLTE-KLDDttv  417
            R   E  Q      P  +LP   +Q     +  DE+VGFD++A  +  RL E   +   +
Sbjct  123  R---ENNQQAFQPRPVLELPKKGVQEQGPSLENDEVVGFDDEASKVIKRLVEGPAESLDI  179

Query  416  iaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGY  237
            I + G  G+GKTTL + I+ND +L +EFF+  W+YV      K I++ I+  F K    +
Sbjct  180  IPVAGMPGLGKTTLARKIYNDPKLSYEFFSIPWVYVGQEYKIKDIYLRILKCFKKSIEDH  239

Query  236  KDMKEEQLAERIQDFLMEG-KYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEV  60
             +   + LA+ I DF+ +G +  IV+DD+W  E  D ++  F  N+KG RI++TTR   +
Sbjct  240  LNDDVDTLAKVISDFINKGERCLIVLDDVWVAEVIDDVKKVFAENKKGHRIMMTTRDRYL  299

Query  59   ANHVDSKNAPH  27
            A + +++  PH
Sbjct  300  ATYANTE--PH  308



>ref|XP_011070551.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=891

 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 99/313 (32%), Positives = 177/313 (57%), Gaps = 12/313 (4%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDL---LCELRSFWALSEAAKNCNDKAVLEE  765
            DAVV  ++  + + +  +  LI G++DQVE L   L  +++F  L ++ +  N+   + E
Sbjct  3    DAVVEFLLSNLKELLLYHSDLIYGLKDQVESLHKDLSLMKAF--LKDSREKRNEFEYVRE  60

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAE  585
            VV++I  V  +AED ID ++V     + R  + +        + + +  +++ESI+ + +
Sbjct  61   VVRQITDVAYEAEDIIDTFVVNAAMQKSRSRMGRMIHVFDNASLLRNVGRQIESIRAKVK  120

Query  584  KI----RLDLELLQGGSLNNPQLPAADLQAHVAED-ELVGFDEDAQTIKYRLTEKLDDtt  420
            +I       +  + GG  +  +  A + +  V E+  +VGFDE+A+TI +RLTE  +   
Sbjct  121  EIYDKKMFGIVSMSGGEPS--RRSAREKRPPVVEEANVVGFDEEAKTIIHRLTEGPEHLE  178

Query  419  viaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSG  240
            V++++G  G+GKTTL + ++ D  + + F+ R W+YVS   +R+++F  I+ +     + 
Sbjct  179  VVSVIGMGGLGKTTLARKVYVDPSIEYHFYLRAWVYVSQEYSRREVFRGILESLGLMNNQ  238

Query  239  YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEV  60
              +M ++ LAE +   L   +Y IV+DD+W  E WD +R AFPN    SRIL+T+R  EV
Sbjct  239  MLNMSDDWLAEELCRHLRNNRYLIVIDDVWTREAWDDIRMAFPNTDLASRILLTSRNREV  298

Query  59   ANHVDSKNAPHKF  21
            A H ++ +APH  
Sbjct  299  ALHANADSAPHNL  311



>ref|XP_011072124.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=636

 Score =   138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 99/311 (32%), Positives = 168/311 (54%), Gaps = 13/311 (4%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            DA V  ++  + Q +  +  LI   ++QVE L   LR F A L ++ K       L E+V
Sbjct  3    DAAVQFLLDNLQQLLIYHTHLIADAKNQVEKLESNLRVFNAFLKDSTKKRRKDESLRELV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            ++I+ VV +AED ID ++ +    + +   ++  E      K++  A ++E +    ++I
Sbjct  63   RQIRDVVYEAEDIIDAFVTQAAESKAKNYFLRAFETPV---KLHSIATQIEKVSATVKEI  119

Query  578  -----RLDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttvi  414
                 R+D   L  G    P+   A +   V ++ +VGF+++A+ +   LTE+     V+
Sbjct  120  YGDKSRIDFAALNVGD-GGPEKSEAPV---VRQENVVGFEDEAEKLIGYLTEETQQLDVV  175

Query  413  aivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYK  234
            +I+G  G+GKTTL   IF D  +++EF TR+W+YVS    RK IF+ I+  FT+      
Sbjct  176  SIIGMPGLGKTTLAGKIFRDPAIQYEFPTRIWVYVSQEFTRKDIFLAILREFTRPDEEMY  235

Query  233  DMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVAN  54
               +++LA  +  +L  GK+ IV+DD+W  EDWD L+ A P + K  ++L+T+R +EV  
Sbjct  236  QKNDQELARLVASYLERGKFLIVMDDVWTAEDWDKLQIALPKSNKMGKVLITSRHVEVGQ  295

Query  53   HVDSKNAPHKF  21
            + +    PHK 
Sbjct  296  YANKNRHPHKL  306



>ref|XP_009617443.1| PREDICTED: putative disease resistance protein At1g50180, partial 
[Nicotiana tomentosiformis]
Length=250

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 99/250 (40%), Positives = 158/250 (63%), Gaps = 7/250 (3%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            D  V  ++  ++Q + +N  LI+GI+ +VE+LL +L  F A L +AAK+  D  VL+ +V
Sbjct  3    DVAVKFLVENLMQLLIDNADLIVGIKGEVENLLQDLNDFNAFLKQAAKSRRDNEVLKSLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            +KI+KVV DAED+IDK+++E + H  +    +W   +++  +    A E+++I++R ++I
Sbjct  63   KKIRKVVNDAEDSIDKFVIEAKRHDDKNKFAQWFH-LTHVARAKGVADEIKTIRERVKEI  121

Query  578  RL-DLELLQGGSL--NNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttviai  408
            RL D   LQ  +   N+ Q         V ED++VGFDE+A+T+  RL    D   V+ +
Sbjct  122  RLNDSYGLQAITSDDNSNQGAQERKVPVVEEDDVVGFDEEAKTVIDRLIGGSD--YVVPV  179

Query  407  vggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDM  228
            VG  G+GKTTL   I+ D ++ +EFF R+W+YVS + NR++IF++IIS FT+ T  Y D 
Sbjct  180  VGMPGLGKTTLAYKIYKDPKVEYEFFNRIWVYVSQSFNRREIFLNIISKFTRNTKQYHDT  239

Query  227  KEEQLAERIQ  198
             EE+LA  I+
Sbjct  240  PEEELANEIK  249



>emb|CDP00590.1| unnamed protein product [Coffea canephora]
Length=899

 Score =   138 bits (347),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 103/312 (33%), Positives = 167/312 (54%), Gaps = 7/312 (2%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWAL-SEAAKNCNDKAVLEEVV  759
            DA V  ++  + Q +  N  LI  + D +  L  EL +  AL  + ++  +D   L+E+V
Sbjct  5    DAAVTFLLDNLRQVLSYNYHLIADVRDNILILCQELETLKALMRDYSRYNHDSDFLKELV  64

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRA---  588
            ++I+ VV  AEDA+D Y+V+    R R  + K  + + Y  K+    K++E + K+    
Sbjct  65   KEIKTVVNQAEDAVDTYIVQASVQRSRSWISKTFQIIDYPTKLRGVGKQIEEVGKKVREI  124

Query  587  --EKIRLDLELLQGGSLNN-PQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttv  417
              EK R   E LQ  ++ N  ++P       V E+ +VGF+E  + +   LT       V
Sbjct  125  NQEKARNGFEALQYQAMANLNRIPKPKEAPKVEEEHVVGFEEATEKVSKLLTGGSQHLEV  184

Query  416  iaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGY  237
            I+IVG  G+GKTTL K +  D  + +EF  + ++YVS    ++++F+ I+ +FT+     
Sbjct  185  ISIVGMLGLGKTTLAKKVVKDPIVDYEFMIKAFVYVSKEYEKREVFLSILRSFTQINDEV  244

Query  236  KDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVA  57
              M E+QL E ++  L   +Y +V+DD+W  EDWD L+ AFP+N K  R+L+TTR   VA
Sbjct  245  NKMVEDQLEEYLRKQLEGKQYLVVMDDVWEKEDWDRLKKAFPSNNKRCRVLITTRNKNVA  304

Query  56   NHVDSKNAPHKF  21
             +       HK 
Sbjct  305  EYASRGIPFHKL  316



>ref|XP_006366074.1| PREDICTED: probable disease resistance RPP8-like protein 2-like 
isoform X4 [Solanum tuberosum]
Length=480

 Score =   135 bits (339),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 181/309 (59%), Gaps = 9/309 (3%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            DA V  ++G ++  +  N  LI G++D+ ++LL E++   A L + AK  ++ ++ +++V
Sbjct  3    DAGVNFLVGNLLDLLSGNIDLIRGVDDEFKNLLEEVQRLKAFLDDDAKFHSESSLWDQLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            ++IQK+V  +ED IDK+L++ + HR +  + ++ + V +   V D A E++ I ++ +K+
Sbjct  63   KEIQKMVHKSEDVIDKFLIQSKLHRDKNKVERFFD-VGHMAVVRDLAAEIKDIHEKVKKL  121

Query  578  RLDL--ELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDtt-viai  408
            R D          L+ P+      Q  + +DE+VGFDE+A  +  RL E + ++  +I +
Sbjct  122  RQDHTDSFSPKPLLDIPEKAHQVTQGPLEDDEVVGFDEEANEVMKRLVEGVSESVDIIPV  181

Query  407  vggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDM  228
            VG AG+GKTTL + I ND +L  EFF  +W+ V +    K I++ I++ FTK    + + 
Sbjct  182  VGMAGLGKTTLARKICNDSKLSFEFFRIIWVNVGLEYKIKDIYLTILNFFTKHIEDHFNE  241

Query  227  KEEQLAERIQDFLME--GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVAN  54
              + LA+ I  F+ E  G+  IV+DD+W  E  D ++  FP N+KG RI++TTR   +A 
Sbjct  242  DVDALAKTICGFMSEEGGRCLIVLDDVWVAEVVDAVKKVFPRNKKGHRIMLTTRDGYLAT  301

Query  53   HVDSKNAPH  27
            + +    PH
Sbjct  302  YTNPD--PH  308



>ref|XP_011076798.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Sesamum indicum]
Length=612

 Score =   133 bits (334),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 98/314 (31%), Positives = 162/314 (52%), Gaps = 28/314 (9%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSF-WALSEAAKNCNDKAVLEEVV  759
            DA V  ++ K+   +     LI+ ++ QVE L+ +L  F   L ++AKN      L E+ 
Sbjct  3    DAAVDFLLEKLQHLLFHQSLLIIDVKKQVEKLVEDLHLFKLFLEDSAKNRRKDESLRELA  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            + I  VV +AED ID  + +  N + R          SY+++  DA  ++ +I       
Sbjct  63   RHIHDVVYEAEDIIDALVTQAANSKSR----------SYFSRAFDAPTKLLTIIN-----  107

Query  578  RLDLELLQGGSLNNPQLPAADLQAH----------VAEDELVGFDEDAQTIKYRLTEKLD  429
              D++ +     N   + +ADL             + +D +VGF++ A+ +   L E+  
Sbjct  108  --DIDTICAMVGNKAWIHSADLAGDEGLQKSEVPLLRQDNVVGFEDGAKKLIGFLLEEAP  165

Query  428  DttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKE  249
               VI+IVG  G+GKTTL + IFND  +R+EF   +WIY+S    +K +F+ I+  FT+ 
Sbjct  166  QLDVISIVGMPGLGKTTLARKIFNDPVIRYEFPVCIWIYISKEFTKKDVFLAILKEFTRI  225

Query  248  TSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRV  69
                    + +LA+ +  +L  GK+ IV+DD+W  EDW  L+ A PNN    ++L+T+R 
Sbjct  226  DEHMNGKSDHELAQLVAAYLERGKFLIVMDDIWTVEDWYTLQIALPNNNNKGKVLITSRH  285

Query  68   LEVANHVDSKNAPH  27
            ++VA H +    PH
Sbjct  286  VQVARHANRSRFPH  299



>ref|XP_006366073.1| PREDICTED: probable disease resistance RPP8-like protein 2-like 
isoform X3 [Solanum tuberosum]
Length=481

 Score =   132 bits (331),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 104/314 (33%), Positives = 182/314 (58%), Gaps = 18/314 (6%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            DA V  ++G ++  +  N  LI G++D+ ++LL E++   A L + AK  ++ ++ +++V
Sbjct  3    DAGVNFLVGNLLDLLSGNIDLIRGVDDEFKNLLEEVQRLKAFLDDDAKFHSESSLWDQLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            ++IQK+V  +ED IDK+L++ + HR +  + ++ + V +   V D A E++ I ++ +K+
Sbjct  63   KEIQKMVHKSEDVIDKFLIQSKLHRDKNKVERFFD-VGHMAVVRDLAAEIKDIHEKVKKL  121

Query  578  RLDLELLQGGSLNNPQLPAADLQAH-------VAEDELVGFDEDAQTIKYRLTEKLDDtt  420
            R D       S +   L     +AH       + +DE+VGFDE+A  +  RL E + ++ 
Sbjct  122  RQD----HTDSFSPKPLLDIPEKAHQVTQKGPLEDDEVVGFDEEANEVMKRLVEGVSESV  177

Query  419  -viaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETS  243
             +I +VG AG+GKTTL + I ND +L  EFF  +W+ V +    K I++ I++ FTK   
Sbjct  178  DIIPVVGMAGLGKTTLARKICNDSKLSFEFFRIIWVNVGLEYKIKDIYLTILNFFTKHIE  237

Query  242  GYKDMKEEQLAERIQDFLME--GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRV  69
             + +   + LA+ I  F+ E  G+  IV+DD+W  E  D ++  FP N+KG RI++TTR 
Sbjct  238  DHFNEDVDALAKTICGFMSEEGGRCLIVLDDVWVAEVVDAVKKVFPRNKKGHRIMLTTRD  297

Query  68   LEVANHVDSKNAPH  27
              +A + +    PH
Sbjct  298  GYLATYTNPD--PH  309



>ref|XP_011072129.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=884

 Score =   134 bits (338),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 97/307 (32%), Positives = 165/307 (54%), Gaps = 5/307 (2%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDK-AVLEEVV  759
            DA V  ++  + Q +  +  LI   ++QVE L  +LR   A  +A+     K  +L ++V
Sbjct  3    DAAVQFLLDNLQQLLIYHTHLIADAKNQVEKLESDLRLINAFLKASTKKRRKDVILRQLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            ++I+ VV +AED ID ++ +    + +   ++         K++    ++E +    ++I
Sbjct  63   REIRDVVYEAEDIIDAFVTQAAESQAKNYFLR---AFQTRVKLDSITTQVEKVCATVKEI  119

Query  578  RLDLELLQGGSLNNPQLPAADLQAHVAEDE-LVGFDEDAQTIKYRLTEKLDDttviaivg  402
              D   +   +LN     A   +A V   E +VGF+++A+ +   LTE+     VI+I+G
Sbjct  120  YGDESRIDFAALNVGDGGAEKSEAPVVRQENVVGFEDEAEKLIGYLTEETQQLDVISIIG  179

Query  401  gagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKE  222
              G+GKTTL   IF D  +++EF TR+W+YVS    RK IF+ I+  FT+         +
Sbjct  180  MPGLGKTTLAGKIFRDPAIQYEFPTRIWVYVSQEFTRKDIFLAILREFTRPDEEMYQKND  239

Query  221  EQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDS  42
            ++LA  +  +L  GK+ IV+DD+W  EDWD L+ A P + K  ++L+T+R +EV  H + 
Sbjct  240  QELARLVASYLERGKFLIVMDDVWTAEDWDKLQIALPKSNKMGKVLITSRHVEVGQHANI  299

Query  41   KNAPHKF  21
               PHK 
Sbjct  300  NRHPHKL  306



>ref|XP_011076796.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Sesamum indicum]
Length=880

 Score =   133 bits (334),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 98/314 (31%), Positives = 162/314 (52%), Gaps = 28/314 (9%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSF-WALSEAAKNCNDKAVLEEVV  759
            DA V  ++ K+   +     LI+ ++ QVE L+ +L  F   L ++AKN      L E+ 
Sbjct  3    DAAVDFLLEKLQHLLFHQSLLIIDVKKQVEKLVEDLHLFKLFLEDSAKNRRKDESLRELA  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            + I  VV +AED ID  + +  N + R          SY+++  DA  ++ +I       
Sbjct  63   RHIHDVVYEAEDIIDALVTQAANSKSR----------SYFSRAFDAPTKLLTIIN-----  107

Query  578  RLDLELLQGGSLNNPQLPAADLQAH----------VAEDELVGFDEDAQTIKYRLTEKLD  429
              D++ +     N   + +ADL             + +D +VGF++ A+ +   L E+  
Sbjct  108  --DIDTICAMVGNKAWIHSADLAGDEGLQKSEVPLLRQDNVVGFEDGAKKLIGFLLEEAP  165

Query  428  DttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKE  249
               VI+IVG  G+GKTTL + IFND  +R+EF   +WIY+S    +K +F+ I+  FT+ 
Sbjct  166  QLDVISIVGMPGLGKTTLARKIFNDPVIRYEFPVCIWIYISKEFTKKDVFLAILKEFTRI  225

Query  248  TSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRV  69
                    + +LA+ +  +L  GK+ IV+DD+W  EDW  L+ A PNN    ++L+T+R 
Sbjct  226  DEHMNGKSDHELAQLVAAYLERGKFLIVMDDIWTVEDWYTLQIALPNNNNKGKVLITSRH  285

Query  68   LEVANHVDSKNAPH  27
            ++VA H +    PH
Sbjct  286  VQVARHANRSRFPH  299



>ref|XP_009757879.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=917

 Score =   132 bits (333),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 112/328 (34%), Positives = 181/328 (55%), Gaps = 26/328 (8%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCND--KAVLEE  765
            D  +  V+  +V  + EN  LI G +++   LL EL    A L +AAK   +  KA L++
Sbjct  3    DVALQFVVETLVPIIIENWKLIGGAKEESAHLLGELNRLKAFLQDAAKYXLNRLKAFLQD  62

Query  764  V--------------VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVN  627
                           ++++Q +V  AE  IDK LV+ + H+ + ++++  +   Y   V 
Sbjct  63   AAKYRQSNSEQWKYFIKEVQVMVYKAEGLIDKLLVKAKLHQEKNIIVQNLD-AKYAKTVW  121

Query  626  DAAKEMESIKKRAEKIRL-DLELLQGGSL--NNPQLPAADLQAHVAE-DELVGFDEDAQT  459
            D AKE+    ++ +KIR  + E  Q   +  + P + A   Q  V E +E+VGFDE+A+ 
Sbjct  122  DLAKEIRDALEQVKKIREENPEAFQAKPMLDDQPDIVAPGPQDSVLEENEVVGFDEEAKI  181

Query  458  IKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVS-MTVNRKQI  282
            +  RL E  +D  VI +VG AG+GKTTL   I+ND ++ +EFF  +W+YV       K++
Sbjct  182  VIDRLAEGTNDLDVIPVVGLAGLGKTTLAIKIYNDPKISYEFFKTIWVYVGPQQYKPKEV  241

Query  281  FMDIISNFTKETSGYKDMKEEQLAERIQDFLMEG-KYFIVVDDLWRTEDWDYLRTAFPNN  105
            F+ I+  FTK T+ Y++M    L   I++F+++G K  IV+DD+W T+  D +   FP N
Sbjct  242  FLSILEGFTKRTTEYQNMAVSDLTNTIREFILKGGKCLIVLDDVWATDVVDSVMKVFPEN  301

Query  104  QKGSRILVTTRVLEVANHVDSKNAPHKF  21
             KG RI++TTR L +  + +S+  PH  
Sbjct  302  SKGHRIMLTTRDLRIGRYANSE--PHSL  327



>ref|XP_009603761.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=880

 Score =   132 bits (332),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 102/319 (32%), Positives = 179/319 (56%), Gaps = 26/319 (8%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            D  +  ++ K++Q + E+  LI G++++ +DLL +++   A +++ +K      + +E+ 
Sbjct  3    DTAINFLLEKLLQVLSEDVRLIAGVQEEFQDLLEQVQILNAFINDFSKLVRKSIMWKEME  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMK---WPEKVSYYN----KVNDAAKEMESI  600
            + I   V   ED ID++LVE R ++ + +L K   +      +     K+ D  +EM+ I
Sbjct  63   KAILTTVFRTEDIIDEFLVEARLNQEKNILRKAFHFAHNTVRHRDLSIKIKDIIEEMKKI  122

Query  599  KK-------RAEKIRLDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLT  441
             +        AE ++L++E ++G     P+         + +DE+VGFDE+AQ +  RLT
Sbjct  123  PRGDKQALSPAENLQLEIESVKGS--EEPK------DISLEDDEVVGFDEEAQRLIKRLT  174

Query  440  EKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISN  261
            E  +D  +I IVG  G+GKTTL + I+ND  + +EFF+++WI+V      K +F+ I++ 
Sbjct  175  EGSEDLDIIPIVGMPGLGKTTLARKIYNDPRISYEFFSKIWIHVGQLYKIKDVFLRILNR  234

Query  260  FTKETSGYKDMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRIL  84
            F +    Y+DM   +LA+ I  F+ + GK  IV+DD+W +E  D +   FP N  G RI+
Sbjct  235  FRRNIKEYQDMDANELAKLICSFVAKGGKCLIVLDDVWESEVVDSVMKVFPRNWVGHRII  294

Query  83   VTTRVLEVANHVDSKNAPH  27
            +TTR+  VA + +    PH
Sbjct  295  MTTRLGYVATYANEN--PH  311



>ref|XP_009603760.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=884

 Score =   132 bits (331),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 102/319 (32%), Positives = 179/319 (56%), Gaps = 26/319 (8%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            D  +  ++ K++Q + E+  LI G++++ +DLL +++   A +++ +K      + +E+ 
Sbjct  7    DTAINFLLEKLLQVLSEDVRLIAGVQEEFQDLLEQVQILNAFINDFSKLVRKSIMWKEME  66

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMK---WPEKVSYYN----KVNDAAKEMESI  600
            + I   V   ED ID++LVE R ++ + +L K   +      +     K+ D  +EM+ I
Sbjct  67   KAILTTVFRTEDIIDEFLVEARLNQEKNILRKAFHFAHNTVRHRDLSIKIKDIIEEMKKI  126

Query  599  KK-------RAEKIRLDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLT  441
             +        AE ++L++E ++G     P+         + +DE+VGFDE+AQ +  RLT
Sbjct  127  PRGDKQALSPAENLQLEIESVKGS--EEPK------DISLEDDEVVGFDEEAQRLIKRLT  178

Query  440  EKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISN  261
            E  +D  +I IVG  G+GKTTL + I+ND  + +EFF+++WI+V      K +F+ I++ 
Sbjct  179  EGSEDLDIIPIVGMPGLGKTTLARKIYNDPRISYEFFSKIWIHVGQLYKIKDVFLRILNR  238

Query  260  FTKETSGYKDMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRIL  84
            F +    Y+DM   +LA+ I  F+ + GK  IV+DD+W +E  D +   FP N  G RI+
Sbjct  239  FRRNIKEYQDMDANELAKLICSFVAKGGKCLIVLDDVWESEVVDSVMKVFPRNWVGHRII  298

Query  83   VTTRVLEVANHVDSKNAPH  27
            +TTR+  VA + +    PH
Sbjct  299  MTTRLGYVATYANEN--PH  315



>ref|XP_006350238.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006350239.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
isoform X2 [Solanum tuberosum]
Length=908

 Score =   130 bits (326),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 108/323 (33%), Positives = 169/323 (52%), Gaps = 26/323 (8%)
 Frame = -2

Query  941  AMDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCE---LRSFWALSEAAKNCNDKAVL  771
            A    V  ++  + Q + EN  LI G +   + LL E   L    A   A     +   L
Sbjct  12   AATKAVSFLVDSLSQLLSENVELIRGAKGDFQRLLDEIEPLNELLAGDSAQLKTKNNIDL  71

Query  770  EEVVQKIQKVVIDAEDAIDKYLVEERNHRGRGV-----LMKWPEKVSYYNKVNDAAKEME  606
            +++  KIQ++V  AEDAIDK+L++ +  +         + KW        +  D  +++ 
Sbjct  72   DKLFLKIQRIVYKAEDAIDKFLIQAKIDQDNVFSKILPIHKWIHNWKIAPEFKDILEQVT  131

Query  605  SIKKRAEKI----RLDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTE  438
             I++ ++++     +    LQ G     Q PA +      + E+VGFD+ A+ +  RL E
Sbjct  132  GIREESQQVFQKSHIQSTALQPGKGTGTQGPAEE------DIEVVGFDKPAEDVIKRLGE  185

Query  437  KLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNF  258
               D  VI IVG  G+GKTTL + ++ND  L   F+ R+WIYV  +   K I ++I++  
Sbjct  186  GSKDLDVIPIVGMPGLGKTTLSRKVYNDSSLDFHFYKRMWIYVGTSKKPKDILVEIVNEV  245

Query  257  TKETSG--YKDMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQ---KG  96
                S    KD  E+QLA  I+DFL+E GKY IV+DD+W T+  D+++ AFPNN+   +G
Sbjct  246  APSNSKELIKDKDEDQLAHIIRDFLVERGKYLIVLDDVWDTQVVDFVKKAFPNNKSQPRG  305

Query  95   SRILVTTRVLEVANHVDSKNAPH  27
             RI++TTR   VA  V ++  PH
Sbjct  306  DRIMLTTRQQRVAEAVSAR--PH  326



>ref|XP_009630452.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=902

 Score =   129 bits (324),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 107/313 (34%), Positives = 174/313 (56%), Gaps = 9/313 (3%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAK-NCNDKAVLEEV  762
            D  +  V+  ++  + EN  LI G ++    LL EL    A L +AAK   ++    +  
Sbjct  3    DVALQFVVETLMPIIIENWKLIGGAKEDSAHLLGELNRLKAFLQDAAKYRQSNSEQWKYF  62

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEK  582
            ++++Q +V  AE  IDK LV+ + H+ + +LM+  +   Y   V D AKE+    ++ +K
Sbjct  63   IKEVQVMVYKAEGLIDKLLVKGKLHQDKNILMQNLD-AKYAKTVWDLAKEIRDALEQVKK  121

Query  581  IRL-DLELLQGGSL--NNPQLPAADLQ-AHVAEDELVGFDEDAQTIKYRLTEKLDDttvi  414
            IR  + E  Q   +  + P++ A   Q   + E+E+VGFDE+A+ +  RL +  DD  VI
Sbjct  122  IREENPEAFQAKPMLDDQPEIVAPGPQDTLLEENEVVGFDEEAKIVIERLAKGTDDLDVI  181

Query  413  aivggagigktTLMKMIFNDRELRHEFFTRLWIYVS-MTVNRKQIFMDIISNFTKETSGY  237
             +VG AG+GKTTL   I+ND ++ +EFF  +W+YV       K++F+ I+  FTK T+ Y
Sbjct  182  PVVGLAGLGKTTLAIKIYNDPKISYEFFKTIWVYVGPQQYKPKEVFLSILEEFTKRTTEY  241

Query  236  KDMKEEQLAERIQDFLMEG-KYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEV  60
            ++M    L   I++F+++G K  IV+DD+W T+  D +   FP   KG RI+ TTR L +
Sbjct  242  QNMAVSDLTNIIREFILKGGKCLIVLDDVWATDVVDSVMKVFPEISKGHRIMFTTRDLRI  301

Query  59   ANHVDSKNAPHKF  21
              + +      KF
Sbjct  302  GRYANPDPHSLKF  314



>emb|CAN81877.1| hypothetical protein VITISV_034529 [Vitis vinifera]
Length=331

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 101/315 (32%), Positives = 174/315 (55%), Gaps = 16/315 (5%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCEL---RSFWALSEAAKNCNDKAVLEE  765
            +++V   + K+   + +   L+  +E+QV+ L  EL   R F   ++A +  + +  L  
Sbjct  3    ESIVTFFLEKLTDLLSQEAFLLSRVEEQVKLLSNELEWMRLFLKDADAKRRYDPRIKL--  60

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGVL--MKWPEKVSYYNKVNDAAKEME-SIKK  594
             V +I+ V  DAED ID+++ E  NH+ +G L  +K+  K+ + +K+    +E+   I+K
Sbjct  61   WVSQIRDVTYDAEDVIDRFMFE-MNHQQQGSLKCLKFL-KLRFVHKLESRIREINIKIEK  118

Query  593  -RAEKIRLDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttv  417
              A K R  +E L   S +N  +P  + +A + E  +VG  EDA+++K  L        V
Sbjct  119  IMANKSRYGVETLPAASSSNEAVPHKEKRAPIVEVNVVGIQEDAKSVKQNLLNGEMRRAV  178

Query  416  iaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDI---ISNFTKET  246
            ++IVG  G+GKTTL K ++ND ++R  F    WIYVS     +++ + +   +   ++E 
Sbjct  179  VSIVGMGGLGKTTLAKKVYNDNDVRQCFDCHAWIYVSQEYTIRELLLGVAVCVRILSEEE  238

Query  245  SGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVL  66
                 M E +L +R++D+L   KY IV+DD+WR E WD L   FP++  GSR+L+T+R  
Sbjct  239  RS--KMDESELGDRLRDYLTTKKYLIVLDDMWRNEAWDRLGLYFPDSVNGSRVLITSRNK  296

Query  65   EVANHVDSKNAPHKF  21
            E+  + D +  PH+ 
Sbjct  297  EIGFYADPQAIPHEL  311



>gb|AEQ61802.1| NBS-LRR class disease resistance protein [Sesamum indicum]
Length=174

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 79/119 (66%), Gaps = 0/119 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L KMI+ D ++ +EF++R WIY+S   +RK++F++I+SNFT+ T     M +E LA+ + 
Sbjct  10   LAKMIYRDPKIEYEFYSRAWIYISQDYSRKEVFLNILSNFTQLTDSMYKMNDENLAKELC  69

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
              L +GKY IV+DD+W  E W+ L+ AFP N K SRIL+T+R+  VA H +    PH  
Sbjct  70   RILEKGKYLIVMDDVWSEEAWNDLKVAFPKNNKRSRILITSRIKRVARHANPSREPHNL  128



>ref|XP_004236957.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010319428.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=879

 Score =   128 bits (321),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 105/318 (33%), Positives = 182/318 (57%), Gaps = 26/318 (8%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENET-LILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEV  762
            DAVV  ++  ++Q ++EN   LI G+ED+ ++LL E++     L +AAK  ++ ++ + +
Sbjct  3    DAVVNFLVENLLQLLQENIIDLIKGVEDEFKNLLEEVQRLKGFLDDAAKFHSESSLWDLL  62

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEK  582
            V+ IQK+V  +ED IDK+LV+ + HR +  + ++ + + +   V   A +++ I ++ +K
Sbjct  63   VKDIQKMVHKSEDVIDKFLVQAKLHRDKNKVGRFFD-MGHLAVVRALAADIKDIHEKVKK  121

Query  581  IRLD----------LELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTE-K  435
            +R D          L++ + G     Q P+ D      +DE+VGFDE+A+ +  RL E  
Sbjct  122  LREDNKESFQPRPILDIPKKGH-EVTQGPSLD------DDEVVGFDEEAKKVIKRLVEGP  174

Query  434  LDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFT  255
             +   ++ +VG  G+GKTTL + I+ND  L  EFF+ +WIY       K ++  I+ +F 
Sbjct  175  AESLAIVPVVGMPGLGKTTLARKIYNDTTLSFEFFSTIWIYAGPECKIKDLYHKILKHFK  234

Query  254  KETSGYKDMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVT  78
            K    + D  +  LA+ I  F+ + G+  IV+DD+W     D+++  FP N+KG RI++T
Sbjct  235  KNIDEHLDEDDHTLAKVISGFMSKGGRCLIVLDDVWEANVIDHVKKVFPENKKGHRIMMT  294

Query  77   TRVLEVANHVDSKNA-PH  27
            TR   +A +   KNA PH
Sbjct  295  TRDGLLAAY---KNAEPH  309



>ref|XP_011072127.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=885

 Score =   128 bits (321),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 91/294 (31%), Positives = 160/294 (54%), Gaps = 19/294 (6%)
 Frame = -2

Query  875  LILGIEDQVEDLLCELRSFWALSEAAKNCNDK-AVLEEVVQKIQKVVIDAEDAIDKYLVE  699
            LI  +++QVE L  +LR   A  +A+     K  +L ++V++I+ VV +AED ID ++ +
Sbjct  23   LIADVKNQVEKLESDLRLINAFLKASTKKRRKDVILRQLVREIRDVVYEAEDIIDAFVTQ  82

Query  698  ERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKIRLDLELLQG--GSLNNPQLP  525
                + +          +Y+ +      +++SI  + EK+   ++ + G    ++   L 
Sbjct  83   AAESQAK----------NYFLRAFQTRVKLDSITTQVEKVCATVKEIYGDESRIDFAALN  132

Query  524  AADLQAH------VAEDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMI  363
              D  A       V ++ +VGF+++A+ +   LTE+     V++I+G  G+GKTTL   I
Sbjct  133  VGDGGAEKSERPVVRQENVVGFEDEAEKLIGYLTEETQLLDVVSIIGMPGLGKTTLAGKI  192

Query  362  FNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQDFLME  183
            F D  +++EF TR+W+YVS    RK IF+ I+  FT+         +++LA  +  +L  
Sbjct  193  FRDPAIQYEFSTRIWVYVSQEFTRKDIFLAILREFTRPDEEMYQKNDDELARLVASYLER  252

Query  182  GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
            GK+ IV+DD+W  EDWD L+ A P + K  ++L+T+R +EV  + +    PHK 
Sbjct  253  GKFLIVMDDVWTAEDWDKLQIALPKSNKMGKVLITSRHVEVGQYANKNRHPHKL  306



>ref|XP_006367034.1| PREDICTED: probable disease resistance RPP8-like protein 2-like 
[Solanum tuberosum]
Length=559

 Score =   124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 103/315 (33%), Positives = 174/315 (55%), Gaps = 17/315 (5%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLL---CELRSFWALSEAAK-NCNDKAVLE  768
            DAVV  ++  ++Q + EN  LI   + ++++LL    +L++F  L +AAK    +    +
Sbjct  3    DAVVDFLVENLLQLLTENVKLIGSAKGELDNLLKVAQQLKAF--LDDAAKYGYTNSEQWK  60

Query  767  EVVQKIQKVVIDAEDAIDKYLVEERNHRGR---GVLMKWPEKVSYYNKVNDAAKEMESIK  597
             +V +I K V  AEDAIDK+LV+ + H+ R   G +  WP  +    KV + A E++ I 
Sbjct  61   VLVIEIHKTVHRAEDAIDKFLVQAKLHQERNTMGRIFDWPRNLI---KVRNLAAEIKGIN  117

Query  596  KRAEKIRLDLELLQGGS-LNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTE-KLDDt  423
             + +++R   + LQ    +  P+         +  D +VGFD++A  +  RL E  +D  
Sbjct  118  DQVKELRSSNQALQATHVIELPKRGEVTQGPSLENDAVVGFDDEANKVIKRLVEGPMDSV  177

Query  422  tviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETS  243
             +I +VG  G+GKTTL + I+ND +L +EF++ +W+YV      K I++ I+  F K   
Sbjct  178  DIIPVVGMPGLGKTTLARKIYNDSKLTYEFYSIVWVYVGQECKAKDIYLRILKFFKKNIE  237

Query  242  GYKDMKEEQLAERIQDFLMEG-KYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVL  66
             + +   + LA+ I  ++ +G +  IV+DD+W  E  D+ R  F  N+KG RI++TTR L
Sbjct  238  DHLNDDVDTLAKAIGGYIKKGGRCLIVLDDVWEDEVIDHARKVFAENKKGHRIMMTTRDL  297

Query  65   EVANHVDSKNAPHKF  21
             VA   + +  PH+ 
Sbjct  298  RVAKFANRE--PHEL  310



>ref|XP_011072005.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=886

 Score =   126 bits (316),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 93/305 (30%), Positives = 162/305 (53%), Gaps = 5/305 (2%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            DA V  ++  + Q +  +  LI   ++QVE L  +LR F A L ++ K       L E+V
Sbjct  3    DAAVEFLLDNLQQLLIYHTHLISDAKNQVEKLESDLRLFKAFLRDSTKKRRKDESLRELV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            ++I+ VV +AED ID ++ +    + +   ++         K++  A ++E +  + + I
Sbjct  63   RQIRDVVYEAEDIIDAFVTQAAESKSKSYFLR---AFQTPVKLHGIAVDIERVGVKVKDI  119

Query  578  RLDLELLQGGSLN-NPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttviaivg  402
              D   +   SLN     P       V ++ +VGF+++A+ +   LT++     V++I+G
Sbjct  120  YGDKNRIDFASLNVGDGGPEESEPPTVRQENVVGFEDEAEKLIGYLTQETTQLDVVSIIG  179

Query  401  gagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKE  222
              G+GKTTL   IF D  + +EF TR+W+YVS    RK IF+ I+  FT+         +
Sbjct  180  MPGLGKTTLAGKIFRDPAILYEFPTRIWVYVSQDFTRKNIFLAILREFTRIDEEMYHKSD  239

Query  221  EQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDS  42
            ++LA  +   L  GK+ +V+DD+W  EDW+ L+ A P + K  ++L+T+R +EV  + + 
Sbjct  240  QELARLVASHLERGKFLLVMDDVWTAEDWEKLQIALPKSNKMGKVLITSRHVEVGQYANK  299

Query  41   KNAPH  27
               PH
Sbjct  300  NRLPH  304



>ref|XP_010669410.1| PREDICTED: putative disease resistance protein At1g50180 [Beta 
vulgaris subsp. vulgaris]
Length=440

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 94/290 (32%), Positives = 153/290 (53%), Gaps = 16/290 (6%)
 Frame = -2

Query  866  GIEDQVEDLLCELR---SFWALSEAAKNCNDKAVLEEVVQKIQKVVIDAEDAIDKYLVEE  696
            G+ DQ+  L  ELR    F   SE  +   +  ++ E+V +I++V  +AED I+ +L+  
Sbjct  26   GVGDQLSSLEYELRFMKKFLRNSEGKQQ--EHELVGELVDQIKEVAFEAEDVIESFLLNV  83

Query  695  RNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI-----RLDLELLQGGSLNNPQ  531
               + R    +      Y   ++  AK +  IK R + I     +  +E+ +G    NP 
Sbjct  84   ERQKCRSAFGRVFHGPEYAVMLHGVAKHINGIKTRIDGIYDNKEKYGIEMGEGSM--NPH  141

Query  530  LPAADLQAHVAE--DELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFN  357
              A  LQ    E  +E+VGF ++A T+  +LTE      +I+IVG  G+GKTT+ K +FN
Sbjct  142  FEAT-LQRRRKEVDEEMVGFKDEADTLLKKLTEGSIGLEIISIVGMGGLGKTTIAKRLFN  200

Query  356  DRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQDFLMEGK  177
            DR ++  F +  W+ VS   N +Q+ +DI+        G   +  ++L E ++  L + K
Sbjct  201  DRIIKDHFKSHAWVSVSEDYNSRQLILDILEKVASNKEGIDKLDTDKLKEMLKTRLKDRK  260

Query  176  YFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            Y + +DD+W+   WD ++T FP+   GSRIL+TTRV +VA +  S   PH
Sbjct  261  YIVFLDDVWQPHMWDEVKTCFPDTSNGSRILITTRVTDVARYT-SPRKPH  309



>ref|XP_009622940.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=890

 Score =   124 bits (312),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 101/307 (33%), Positives = 161/307 (52%), Gaps = 15/307 (5%)
 Frame = -2

Query  926  VGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-----LSEAAKNCNDKAVLEEV  762
            V  ++  +V  V +N+ LI G E     LL E +   A      ++  KN N      E+
Sbjct  17   VNFLVETLVNVVRQNKELIKGAEGDFHSLLDEAQGLNASLAADYADLNKNSNPTK-WNEL  75

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWP-----EKVSYYNKVNDAAKEMESIK  597
              KI +    AED+IDK+LV+ +  +   +    P     ++ +   ++N+   E+  I 
Sbjct  76   SLKILRTAYKAEDSIDKFLVQAKIDQDNKLKKLLPVDKVIDRWTKLPEINEILTELREI-  134

Query  596  KRAEKIRLDLELLQGGSLNNPQLPAADLQAHVAED-ELVGFDEDAQTIKYRLTEKLDDtt  420
             R E  +   E  Q G        A   Q    ED E++GFDE A+ ++ RL E  +D  
Sbjct  135  -RQESQQAIQESSQTGLQPENSSTAQQTQGSALEDHEVIGFDESAEKVRKRLVEGSEDLE  193

Query  419  viaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSG  240
            V +IVG  G+GKTTL + +++D  +  EFF R+W+YV  +   K IF++I       + G
Sbjct  194  VASIVGMPGLGKTTLARKVYHDPVISFEFFKRVWVYVGPSYVEKDIFLNIHKGLELSSEG  253

Query  239  YKDMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLE  63
             +D   EQLA+ I DF+++ G+Y IV+DD+W  +  D+++TAFP+ +   RIL+TTR  +
Sbjct  254  VQDKNGEQLAKEIHDFVIKGGRYLIVLDDVWEAKAVDFVKTAFPDKKGRHRILMTTREKQ  313

Query  62   VANHVDS  42
            VA  V +
Sbjct  314  VATPVSA  320



>ref|XP_009778215.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=899

 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 101/317 (32%), Positives = 166/317 (52%), Gaps = 21/317 (7%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAA---KNCNDKAVLEE  765
            D V+  V+  ++  ++E   LI G ++    LL E+ S  A  E A   +  N K   + 
Sbjct  3    DVVLKFVVENLLAIIKETWKLIGGAKEDCAQLLEEVDSLKAFLEDAAHYRQSNSKQ-WKH  61

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAE  585
             V K+Q +V  AED IDK  ++ + H+ +  ++      +Y   V +    ++++  + +
Sbjct  62   FVNKVQVIVYKAEDLIDKLHIQAKQHQEKYRVL-----TNYAKTVKECVINIKAVLDKVK  116

Query  584  KIRLDLELLQGGSLNNPQLP-AADLQAH-------VAEDELVGFDEDAQTIKYRLTEKLD  429
            KIR   E  Q      P L    ++ AH       + E E+VGFDE+ +T+  RL E  D
Sbjct  117  KIR---EENQHAFQAKPMLHFQQEIVAHGSQKETLLEETEVVGFDEETETVIKRLVEGTD  173

Query  428  DttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKE  249
            D   I +VG  G+GKTTL   I+ D ++ + F+T +WI V +     ++F+ I+  FTK 
Sbjct  174  DLDAIPVVGLPGLGKTTLALKIYKDSQISYHFYTTIWIKVGLQYKLTEVFLSILKVFTKL  233

Query  248  TSGYKDMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTR  72
            T  ++DM    LA+ I++F+ + GK  IV+DD+W       ++ AFP N+KG RI++TTR
Sbjct  234  TKEHQDMNVNDLAKIIREFISKGGKCLIVLDDVWEPNVVHAIKEAFPKNKKGHRIMITTR  293

Query  71   VLEVANHVDSKNAPHKF  21
               VA + ++     KF
Sbjct  294  DASVARYANAHPHSLKF  310



>ref|XP_003633887.1| PREDICTED: putative disease resistance protein At1g50180 [Vitis 
vinifera]
Length=897

 Score =   124 bits (311),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 100/314 (32%), Positives = 172/314 (55%), Gaps = 14/314 (4%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCEL---RSFWALSEAAKNCNDKAVLEE  765
            +++V + + K+   + +   L+  +E+QV+ L  EL   R F   ++A +  + +  L  
Sbjct  3    ESIVTVFLEKLTDLLSKEAFLLSRVEEQVKLLSSELEWMRLFLKDADAKRRYDPRIKL--  60

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWP-EKVSYYNKVNDAAKEME-SIKK-  594
             V +I+ V  DAED ID+++ E  NH+ +G L      K+ + +K+    +E+   I+K 
Sbjct  61   WVSQIRDVTYDAEDVIDRFMFE-MNHQQQGSLKCLQFLKLRFVHKLESRIREINIKIEKI  119

Query  593  RAEKIRLDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttvi  414
             A K R  +E L   S +N  +P  + +A + E  +VG  EDA+++K  L        V+
Sbjct  120  MANKSRYGVETLPAASSSNEAVPHKEKRAPIVEVNVVGIQEDAKSVKQNLLNGEMRRAVV  179

Query  413  aivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDI---ISNFTKETS  243
            +IVG  G+GKTTL K ++ND ++R  F    WIYVS     +++ + +   +   ++E  
Sbjct  180  SIVGMGGLGKTTLAKKVYNDNDVRQCFDCHAWIYVSQEYTIRELLLGVAVCVRILSEEER  239

Query  242  GYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLE  63
                M E +L +R++D+L   KY IV+DD+WR E WD L   FP++  GSR+L+T+R  E
Sbjct  240  S--KMDESELGDRLRDYLTTKKYLIVLDDMWRNEAWDRLGLYFPDSVNGSRVLITSRNKE  297

Query  62   VANHVDSKNAPHKF  21
            +  + D +  PH+ 
Sbjct  298  IGFYADPQAIPHEL  311



>ref|XP_010256251.1| PREDICTED: probable disease resistance RPP8-like protein 2 [Nelumbo 
nucifera]
Length=909

 Score =   124 bits (310),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 100/326 (31%), Positives = 170/326 (52%), Gaps = 19/326 (6%)
 Frame = -2

Query  941  AMDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCEL-RSFWALSEAAKNCNDKAVLEE  765
            A  AV  +V    V    E E L+ G+ +QVE L  EL R    L  A +N  +   +  
Sbjct  2    AESAVASVVFRLGVLLAREAEVLLSGVSNQVEWLRSELIRMQGFLRYAEENQLEGQPINN  61

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKV----SYYNKVNDAAKEMESIK  597
             + +I+ +  + EDAI  Y+ +E   R R     +P +V    S +  ++   K++E I+
Sbjct  62   WITEIRDLASEIEDAITLYIQKEAARRERRGWKGFPNRVFTINSKWKDLHKFGKQIEEIQ  121

Query  596  KRAEKIRLDLELLQGG---SLNNPQLPAADLQ-------AHVAEDELVGFDEDAQTIKYR  447
             +   I    ++   G   + N  ++ A + Q       +H  E+++ GF+E+   +  +
Sbjct  122  NKIASIHRSRQIYGIGENSNSNTAKISAIETQKQLRRTYSHGVEEDVTGFEENTHQLVAQ  181

Query  446  LTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDII  267
            L  +     V++IVG  G+GKTTL K +++ +++RH F    W ++S   +R+ +    I
Sbjct  182  LLNEDRRLRVVSIVGMGGLGKTTLAKQVYHHKDVRHHFDCSAWAFISQQPSRRDVLHGFI  241

Query  266  ---SNFTKE-TSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQK  99
               ++F KE     + M EE+L  ++   L   +Y +V+DD+WR EDWD L++AFPN +K
Sbjct  242  KRANHFCKEDIEMIQQMNEEELVSKLYKILDSKRYLLVLDDIWRKEDWDCLKSAFPNGRK  301

Query  98   GSRILVTTRVLEVANHVDSKNAPHKF  21
            GS+I++TTR  EVA H D  + P+K 
Sbjct  302  GSKIIITTRNKEVALHADPFSIPYKL  327



>gb|EYU24144.1| hypothetical protein MIMGU_mgv1a001094mg [Erythranthe guttata]
Length=891

 Score =   123 bits (308),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 99/315 (31%), Positives = 164/315 (52%), Gaps = 21/315 (7%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            DA V  ++  + Q +  +  LI+  +D+VE L  +LR F A L ++ K       L ++V
Sbjct  3    DAAVEFLLENLTQLLLHHAHLIIDAKDKVEKLETDLRFFKAFLRDSTKKRKKDDRLRDLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            + I+ VV +AED ID ++ +    + R          SY+ K   +  ++  I  + E I
Sbjct  63   RSIRDVVYEAEDIIDAFVTQAAVAKSR----------SYFGKAFSSPAKLLDIAGQVESI  112

Query  578  RLDLELLQGGSLN--------NPQLPAADLQAHVA-EDELVGFDEDAQTIKYRLTEKLDD  426
               +   +GG  N            P   L+  +  +D +VG +++A+ +   L +K + 
Sbjct  113  CGKIRDFKGGKDNFDFAILDIGDDGPETALEVPIVRKDNIVGLEDEAEKLIGYLNDKTEQ  172

Query  425  ttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKET  246
              VI+I+G  G+GKTTL   IF+D  L+ EF TR+W+YVS     K +F+ I+     + 
Sbjct  173  LDVISIIGMPGLGKTTLAAKIFDDPALQFEFPTRIWVYVSQEFTSKNVFLAILKKMITKL  232

Query  245  SGYKDMKEE-QLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRV  69
            S     K + +LA+ +   L  GK+ IV+DD+W  +DWD L+ AFP+N +  ++L+T+R 
Sbjct  233  SDEMYAKSDVELAQEVASRLEGGKFLIVMDDVWTAQDWDKLKIAFPSNARMGKVLITSRQ  292

Query  68   LEVANHVDSKNAPHK  24
             EVA   + K  PHK
Sbjct  293  QEVALAANRKRPPHK  307



>ref|XP_009604444.1| PREDICTED: putative disease resistance protein At1g50180 [Nicotiana 
tomentosiformis]
Length=267

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 160/271 (59%), Gaps = 15/271 (6%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            D  V  VI  + Q + +N  LI  I D V+ LL EL++  A L +A KN +   +L+ +V
Sbjct  3    DTAVDFVIDNLKQLLRDNTDLIAAIVDDVKSLLVELQNLHAFLKQATKNRSH--ILKHLV  60

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            +++   V +AE +IDK++++ + H+ +G+   +     +  K    A E++SIK++ ++I
Sbjct  61   EELITAVNEAEVSIDKFVIKAKLHQKKGIRKMFD--CGHIMKARQCATEIKSIKEKLKEI  118

Query  578  RLD----LELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttvia  411
            R +    ++     ++ + +L    L     E+++VGFDE+A  I  RL +  +D  +I 
Sbjct  119  RRENAYHIQFEDHQNVKDQELRKVPLPE---EEDVVGFDEEAIEIINRLCKGSNDLEIIP  175

Query  410  ivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKD  231
            IVG  G+GKTTL   IF D  L++EFFT +W+YV+ + NR+++F++IIS FT+    ++ 
Sbjct  176  IVGMPGLGKTTLANKIFKDDRLQYEFFTCIWVYVAQSYNRREVFLNIISKFTRNVKQFEY  235

Query  230  MKEEQLAERIQDFLME-GKYFIV--VDDLWR  147
              EE LAE I++FL + GKY IV  +   WR
Sbjct  236  EAEEDLAEAIREFLGKGGKYLIVRMIYGHWR  266



>ref|XP_009614325.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
 ref|XP_009614326.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
Length=806

 Score =   122 bits (305),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 99/312 (32%), Positives = 175/312 (56%), Gaps = 13/312 (4%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIED---QVEDLLCELRSFWALSEAAKNCNDKAVLEE  765
            D  +  V+  +V  ++E   LI G  +   ++ D L EL++F   +   +  N K    +
Sbjct  3    DVALKFVVENLVPLIKETWELIGGAPEDCARLVDELDELKAFLDDAARYRQSNSKQ-WSQ  61

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAE  585
             V K+Q +V  AE  +DK LV+ + H+ + +  ++ +  +Y   V + AK ++   ++ +
Sbjct  62   FVHKVQVIVYQAEGLVDKLLVQVKLHQDKNIFKQFFD-ANYAISVRELAKNIKVALEQVK  120

Query  584  KIRL-DLELLQGGSL--NNPQLPAADLQ-AHVAEDELVGFDEDAQTIKYRLTEKLDDttv  417
            KIR  + E  Q   +  + P++ A   Q   + E+E+VGFDE+A+T+  RL E  ++  V
Sbjct  121  KIRQENPEAFQKKPMLDDQPEIVAPRPQDTLLEENEVVGFDEEAKTVIKRLAEGRNELDV  180

Query  416  iaivggagigktTLMKMIFNDRELRHEFFTRLWIYVS-MTVNRKQIFMDIISNFTKETSG  240
            I +VG AG+GKTTL   I+ D ++ +EFF  +W+YV       K+IF+ I+  FTK T+ 
Sbjct  181  IPVVGLAGLGKTTLAIKIYKDPKVTYEFFNSIWVYVGPQEYKPKEIFLRILEGFTKRTAE  240

Query  239  YKDMKEEQLAERIQDFLMEG-KYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLE  63
            +++M   +L  +IQ+ + +G K  IV+DD+W  +    +R+ FP N KG +I++TTR   
Sbjct  241  HQNMSVNELTSKIQESMSKGGKCLIVLDDVWHPDVVKSVRSVFPKNSKGHKIMITTRDAS  300

Query  62   VANHVDSKNAPH  27
            +  + ++   PH
Sbjct  301  IGRYANAN--PH  310



>gb|KHN13835.1| Disease resistance protein RPP13 [Glycine soja]
Length=874

 Score =   121 bits (304),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 92/317 (29%), Positives = 166/317 (52%), Gaps = 14/317 (4%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVVQ  756
            D+VV  ++  + + +E+   L+ G+ED+V  L  EL+      + ++       ++EVV 
Sbjct  3    DSVVAFLLDNLSRLLEDEHKLLSGVEDKVNSLCNELKFIHIFLKNSEGKRSHDTVKEVVS  62

Query  755  KIQKVVIDAEDAIDKYLVEERNHRGRGVLMKW---PEKVSYYNKVNDAAKEMESIKKRAE  585
            +I+ V   AED +D Y+     HR R +L K     E+V   ++VN    ++E I+ R +
Sbjct  63   QIRDVAHKAEDVVDTYVANITKHRQRNILSKLFHLREQVMVLHQVNS---DIEKIRTRID  119

Query  584  KIRLDLELLQGG-------SLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDD  426
            +I  + +    G              P    +  V E+++VG   D+  +   L E    
Sbjct  120  EIYKNRDRYGIGEGEFRSEEAAAEAEPLLKRRREVEEEDVVGLVHDSSHVIQELMESESR  179

Query  425  ttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKET  246
              V++I+G  G+GKTTL + I+N+ +++  F    W+ VS     K+  + ++      T
Sbjct  180  LKVVSIIGMGGLGKTTLARKIYNNNQVQLWFPCLAWVSVSNDYRPKEFLLSLLKCSMSST  239

Query  245  SGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVL  66
            S ++++ E +L +++ ++L   KY +V+DD+W T+ WD ++ AFP++Q GSRIL+T+R  
Sbjct  240  SEFEELSEAELKKKVAEWLKGKKYLVVLDDIWETQVWDEVKGAFPDDQTGSRILITSRNK  299

Query  65   EVANHVDSKNAPHKFPI  15
            EVA H     +P+  PI
Sbjct  300  EVA-HYAGTASPYYLPI  315



>emb|CBI38085.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   117 bits (294),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 100/316 (32%), Positives = 172/316 (54%), Gaps = 17/316 (5%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCEL---RSFWALSEAAKNCNDKAVLEE  765
            +++V   + K+   + +   L+  +E+QV+ L  EL   R F   ++A +  + +  L  
Sbjct  3    ESIVTFFLEKLTDLLSQEAFLLSRVEEQVKLLSNELEWMRLFLKDADAKRRYDPRIKL--  60

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGVL--MKWPEKVSYYNKVNDAAKEME-SIKK  594
             V +I+ V  DAED ID+++ E  NH+ +G L  +K+  K+ + +K+    +E+   I+K
Sbjct  61   WVSQIRDVTYDAEDVIDRFMFE-MNHQQQGSLKCLKFL-KLRFVHKLESRIREINIKIEK  118

Query  593  -RAEKIRLDLELLQGGSLNNPQLPAADLQAHVAED-ELVGFDEDAQTIKYRLTEKLDDtt  420
              A K R  +E L   S +N  +P  + +A + E+  +VG  EDA+++K  L        
Sbjct  119  IMANKSRYGVETLPAASSSNEVVPHKERRAPIVEEVNVVGIQEDAKSVKQNLLNGEMRRA  178

Query  419  viaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDI---ISNFTKE  249
            V++IVG  G+GKTTL K ++ND ++R  F    WIYVS     +++ + +   +   ++E
Sbjct  179  VVSIVGMGGLGKTTLAKKVYNDNDVRQCFDCHAWIYVSQEYTIRELLLGVAVCVRILSEE  238

Query  248  TSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRV  69
                  M E  L   ++D+L   KY IV+DD+WR E WD L   FP++  GSR+L+T+R 
Sbjct  239  ERS--KMNESDLGNSLRDYLTTRKYLIVMDDMWRNEAWDRLGLYFPDSVNGSRVLITSRN  296

Query  68   LEVANHVDSKNAPHKF  21
             E+  + D +  PH+ 
Sbjct  297  KEIGLYADPQTIPHEL  312



>emb|CDP08031.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   116 bits (290),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 96/322 (30%), Positives = 171/322 (53%), Gaps = 26/322 (8%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDL---LCELRSFWALSEAAKNCNDKAVLEE  765
            +  VG V+  +VQ + EN +LI G   ++ DL   L  L++F A     K+ N + ++E 
Sbjct  6    EVAVGFVLQNLVQLINENRSLIGGNYGKISDLQDGLRLLKTFMA-DYNEKHYNSRTLME-  63

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAE  585
            + + I+ +V D ED ++ Y++EE  ++ +  L    + VS  + + +  K  E+++K + 
Sbjct  64   LAEDIRHLVFDVEDLLETYIMEETLYKYKNTL---SQVVSAKDHLENLRKIGETVQKLSA  120

Query  584  KIRLDLELLQGGSLNNPQLPAADLQAHVAEDEL--------------VGFDEDAQTIKYR  447
            K++   +  +      P L    L  H + DE               VG  E+       
Sbjct  121  KVKQTYK--ENKDFGVPALGRKGLARHNSIDEHNQVTDSNCIFDSLEVGIAEEQTPSGAE  178

Query  446  LTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDII  267
               +     V+AI G  G+GKTTL K + ND  + + FFTR+++ VS   N++++   I+
Sbjct  179  QHGESKQLEVVAIHGMFGLGKTTLAKKVLNDPRIDYHFFTRIFVRVSNVYNKQEVLFSIL  238

Query  266  SNFTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRI  87
            S FTK     +++  ++L +++++ L + KY IV+DD+W T+ WD L+  FP+N KGSR+
Sbjct  239  SAFTKNIKD-QNLSMKELEDKVKETL-KNKYLIVIDDVWATKAWDDLKKVFPDNNKGSRV  296

Query  86   LVTTRVLEVANHVDSKNAPHKF  21
            L+TT++  VA +V +K  P+  
Sbjct  297  LITTQLEPVAKYVTTKTEPYNL  318



>ref|XP_010661280.1| PREDICTED: putative disease resistance RPP13-like protein 3 [Vitis 
vinifera]
Length=611

 Score =   118 bits (295),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 100/316 (32%), Positives = 172/316 (54%), Gaps = 17/316 (5%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCEL---RSFWALSEAAKNCNDKAVLEE  765
            +++V   + K+   + +   L+  +E+QV+ L  EL   R F   ++A +  + +  L  
Sbjct  3    ESIVTFFLEKLTDLLSQEAFLLSRVEEQVKLLSNELEWMRLFLKDADAKRRYDPRIKL--  60

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGVL--MKWPEKVSYYNKVNDAAKEME-SIKK  594
             V +I+ V  DAED ID+++ E  NH+ +G L  +K+  K+ + +K+    +E+   I+K
Sbjct  61   WVSQIRDVTYDAEDVIDRFMFE-MNHQQQGSLKCLKFL-KLRFVHKLESRIREINIKIEK  118

Query  593  -RAEKIRLDLELLQGGSLNNPQLPAADLQAHVAED-ELVGFDEDAQTIKYRLTEKLDDtt  420
              A K R  +E L   S +N  +P  + +A + E+  +VG  EDA+++K  L        
Sbjct  119  IMANKSRYGVETLPAASSSNEVVPHKERRAPIVEEVNVVGIQEDAKSVKQNLLNGEMRRA  178

Query  419  viaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDI---ISNFTKE  249
            V++IVG  G+GKTTL K ++ND ++R  F    WIYVS     +++ + +   +   ++E
Sbjct  179  VVSIVGMGGLGKTTLAKKVYNDNDVRQCFDCHAWIYVSQEYTIRELLLGVAVCVRILSEE  238

Query  248  TSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRV  69
                  M E  L   ++D+L   KY IV+DD+WR E WD L   FP++  GSR+L+T+R 
Sbjct  239  ERS--KMNESDLGNSLRDYLTTRKYLIVMDDMWRNEAWDRLGLYFPDSVNGSRVLITSRN  296

Query  68   LEVANHVDSKNAPHKF  21
             E+  + D +  PH+ 
Sbjct  297  KEIGLYADPQTIPHEL  312



>ref|XP_009798793.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana sylvestris]
Length=704

 Score =   118 bits (296),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 79/120 (66%), Gaps = 3/120 (3%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L   IF D  +  EFFTR+W+YVS +  R+ +F++IIS F + T+ Y  M E+ LA+ I+
Sbjct  9    LANKIFKDATVEFEFFTRIWVYVSQSYKRRDLFLNIISKFKRNTTQYSHMSEDDLAQVIR  68

Query  197  DFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
            DFL   GKY IV+DD+W  E WD L+ AFPNN K +R+L+TTR   VA H +  + PHK 
Sbjct  69   DFLGRGGKYLIVLDDVWSGEAWDRLKIAFPNNNKCNRVLLTTRDNIVAKHCN--DDPHKL  126



>emb|CDP08033.1| unnamed protein product [Coffea canephora]
Length=869

 Score =   119 bits (297),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 86/314 (27%), Positives = 169/314 (54%), Gaps = 16/314 (5%)
 Frame = -2

Query  926  VGLVIGKVVQSVEENETLILGIEDQVEDL---LCELRSFWALSEAAKNCNDKAVLEEVVQ  756
            VG V+  +VQ ++EN  L+ G  +++ DL   L  L++F A  +  +   + ++L  +  
Sbjct  9    VGFVLQNLVQLIDENRRLLSGNYEKISDLRDGLRLLKTFMA--DYNEKHYNSSILMGLAH  66

Query  755  KIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKIR  576
             I+ +V + ED ++ Y+VEE  ++ +  L +     ++   +    K ++ +  + ++  
Sbjct  67   DIRSLVFEVEDFLETYIVEETLYKNKNTLSQVVSAKNHQENLRKIGKAVQKLSTKVKQAY  126

Query  575  LDLE-------LLQGGSLNNPQLPAADLQAHVAEDELVGF-DEDAQTIKYRLTEKLDDtt  420
             D+E       +L+G +L +       +  +V  D ++GF D   + +K    +KL    
Sbjct  127  KDIEDFGEAALVLEGMALLDSVDEHNQIGDNVGADGIIGFTDATDEVLKLLGGQKLSTQL  186

Query  419  viaivggagigktTLMK-MIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETS  243
             +A + G      T +   + ND  +++ FFTR+++ VS   N++++   I+S FT E  
Sbjct  187  EVAAIHGMLGLGKTTLAWKVLNDPRIKYHFFTRIFVRVSNVYNKQEVLFSILSAFT-ENI  245

Query  242  GYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLE  63
              +++  ++L +++++ L + KY IV+DD+  TE WD L+  FP+N KGSR+L+TTR+  
Sbjct  246  KDQNLSMKELEDKVKEAL-KNKYLIVIDDVSATEAWDDLKNVFPDNNKGSRVLITTRLNP  304

Query  62   VANHVDSKNAPHKF  21
            VA +V +K  P+K 
Sbjct  305  VAKYVTTKTEPYKL  318



>ref|XP_010258825.1| PREDICTED: putative disease resistance protein At1g50180 [Nelumbo 
nucifera]
Length=850

 Score =   118 bits (296),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 98/310 (32%), Positives = 161/310 (52%), Gaps = 25/310 (8%)
 Frame = -2

Query  875  LILGIEDQVEDLLCEL---RSFWALSEAAKNCNDKAVLEEVVQKIQKVVIDAEDAIDKYL  705
            L+LG+++Q+  L  EL   RSF  L +A +       ++  V +I+ +  DAED ID ++
Sbjct  23   LLLGVDEQIRSLHDELEWIRSF--LRDADQKRKKYERVKVWVSQIRDLAYDAEDIIDAFV  80

Query  704  VEERNHRGR-----GVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI-----RLDLELLQ  555
            ++    R +     G + ++    +    ++   K++E I +R EK+     +  LE +Q
Sbjct  81   LKVEQQRQKNLGLIGFIRRYLLCANQLTAIHKVGKQIEEINRRVEKVSASKAKYGLEYIQ  140

Query  554  ----GGSLNNPQLPAADLQAHVAED--ELVGFDEDAQTIKYRLTEKLDDttviaivggag  393
                 GSLN   L   + +  + ED   +VG  +  +T+   LTE     TV+++VG  G
Sbjct  141  PGESSGSLNEDLLLWKEKRPALVEDFDMVVGLKDHKKTVVKLLTEGNARRTVVSVVGMGG  200

Query  392  igktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKD----MK  225
            +GKTTL K  FN + ++  F    WIYVS     +++   +I      +   K+    M 
Sbjct  201  LGKTTLAKKAFNSKTIKEHFNCHAWIYVSQEYRMRELLQGVIKCIMVLSKDDKENVEKMN  260

Query  224  EEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVD  45
            EE L   + D L + +Y IVVDDLW  EDW+ L+ A P  +KGS+IL+TTR  +VA H +
Sbjct  261  EEDLGTMLSDHLKQKRYLIVVDDLWTIEDWEKLKVALPEGEKGSKILLTTRNRDVALHAN  320

Query  44   SKNAPHKFPI  15
               +P++ P+
Sbjct  321  PPGSPYELPL  330



>ref|XP_009629405.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
 ref|XP_009629406.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
Length=701

 Score =   116 bits (290),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 80/118 (68%), Gaps = 3/118 (3%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L   ++   E+ +EF+TR+W+YVS T  R+++F++IIS FT+ T  Y D  EE LA+ I+
Sbjct  9    LANQVYKHPEVVYEFYTRIWVYVSQTYRRRELFLNIISKFTRNTKQYHDSPEEDLADEIR  68

Query  197  DFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            +FL + GKY IV+DD+W  E WD +R AFP   KG+R+L+TTR  +VA +    + PH
Sbjct  69   EFLGKSGKYLIVLDDVWSGEAWDRIRIAFPATNKGNRVLLTTRDSKVAKYCS--HIPH  124



>ref|XP_003633890.1| PREDICTED: putative disease resistance protein At1g50180 [Vitis 
vinifera]
Length=531

 Score =   114 bits (286),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 97/316 (31%), Positives = 170/316 (54%), Gaps = 17/316 (5%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCEL---RSFWALSEAAKNCNDKAVLEE  765
            +++V + + K+   + +   L+  +E+QV  L  +L   R F   ++A +  + +  L  
Sbjct  3    ESIVTVFLEKLTDLLSQEAFLLSRVEEQVNLLSIDLEWMRHFLKDADAKRRYDPRIKL--  60

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGVL--MKWPEKVSYYNKVNDAAKEMESI--K  597
             V +I+ V  DAED ID+++ E  NH+ +G L  +K+  K+   +K+    +E+ +   K
Sbjct  61   WVSQIRDVTYDAEDVIDRFMFE-MNHQQQGSLKCLKFL-KLRLVHKLESRIREINTKIEK  118

Query  596  KRAEKIRLDLELLQGGSLNNPQLPAADLQAHVAED-ELVGFDEDAQTIKYRLTEKLDDtt  420
             +A K    +E L   S  N  +P  + +A + E+  +VG  EDA+++K +L        
Sbjct  119  IKAAKSTFVVETLPAASSPNEVVPHRERRAPIVEEVNVVGIQEDAKSVKQKLLNGEMRRA  178

Query  419  viaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDI---ISNFTKE  249
            V++IVG  G+GKTTL K ++ND +++  F    WIYVS     +++ + I   +   ++E
Sbjct  179  VVSIVGMGGLGKTTLAKKVYNDNDVQQCFDCHAWIYVSQEYTIRELLLGIAVRVGILSEE  238

Query  248  TSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRV  69
                  M E  L   ++D+L   KY IV+DD+WR E WD L   FP++  GSR+L+T+R 
Sbjct  239  ERS--KMNESDLGNSLRDYLTTKKYLIVMDDMWRNEAWDRLGLYFPDSVNGSRVLITSRN  296

Query  68   LEVANHVDSKNAPHKF  21
             E+  + D +  PH+ 
Sbjct  297  KEIGLYADPQTIPHEL  312



>ref|XP_004236958.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Solanum lycopersicum]
Length=869

 Score =   115 bits (289),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 99/312 (32%), Positives = 172/312 (55%), Gaps = 11/312 (4%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLL---CELRSFWALSEAAKNCNDKAVLEE  765
            DAVV  ++  ++Q + EN  LI   + ++E+LL    +L+ F  L +AAK  +  +   +
Sbjct  3    DAVVNFLVENLLQLLVENVKLIGSAKGELENLLKISQQLKGF--LDDAAKYGHTNSEQWK  60

Query  764  V-VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRA  588
            V V++I K V  AEDAIDK+LV+ + H+ + +  +  + +    KV + A +++ I  + 
Sbjct  61   VLVEQIHKTVYRAEDAIDKFLVQAKLHQDKNIAERTFDWLGNQIKVRNFAADIKGIHDQI  120

Query  587  EKIRLDLELLQGGS-LNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTE-KLDDttvi  414
            + IR + + LQ    L  P+         +  D +VGFD++A  +  RL E  LD   +I
Sbjct  121  KDIRNNNQALQATPVLELPKKGEVTQGPSLENDAVVGFDDEANKVIKRLVEGPLDSVDII  180

Query  413  aivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYK  234
             +VG  G+GKTTL + I+ND +L +EF++ +W+YV      K I++ I+  F K    + 
Sbjct  181  PVVGMPGLGKTTLARKIYNDPKLTYEFYSIVWVYVGQEYKAKDIYLRILKFFKKNIEDHL  240

Query  233  DMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVA  57
            +   + LA+ I  ++ + G+  IV+DD+W  +  D++   F  N+KG RI++TTR   + 
Sbjct  241  NDDVDTLAKAIGGYIKKGGRCLIVLDDVWEDDVIDHVMKVFAENKKGHRIMMTTRDTRLG  300

Query  56   NHVDSKNAPHKF  21
               + +  PHK 
Sbjct  301  FFANKE--PHKL  310



>gb|AAU88174.1| disease resistance-like protein [Coffea wightiana]
Length=169

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K + +D ++ ++FF R +IYVS    R ++F++I+ +  + T   K+M EE+LAE ++
Sbjct  7    LAKKVLHDPKIEYDFFARAFIYVSQQFERTEVFLNILGSIGQLTEEAKNMPEEKLAEHVR  66

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + L    Y IV+DD+W+ EDWD L+ AFPNN+KGSR+L+TTR   VA + +    P+
Sbjct  67   EQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKGSRVLITTRNTSVAIYANPAVEPY  123



>emb|CBI38087.3| unnamed protein product [Vitis vinifera]
Length=597

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 97/316 (31%), Positives = 170/316 (54%), Gaps = 17/316 (5%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCEL---RSFWALSEAAKNCNDKAVLEE  765
            +++V + + K+   + +   L+  +E+QV  L  +L   R F   ++A +  + +  L  
Sbjct  3    ESIVTVFLEKLTDLLSQEAFLLSRVEEQVNLLSIDLEWMRHFLKDADAKRRYDPRIKL--  60

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGVL--MKWPEKVSYYNKVNDAAKEMESI--K  597
             V +I+ V  DAED ID+++ E  NH+ +G L  +K+  K+   +K+    +E+ +   K
Sbjct  61   WVSQIRDVTYDAEDVIDRFMFE-MNHQQQGSLKCLKFL-KLRLVHKLESRIREINTKIEK  118

Query  596  KRAEKIRLDLELLQGGSLNNPQLPAADLQAHVAED-ELVGFDEDAQTIKYRLTEKLDDtt  420
             +A K    +E L   S  N  +P  + +A + E+  +VG  EDA+++K +L        
Sbjct  119  IKAAKSTFVVETLPAASSPNEVVPHRERRAPIVEEVNVVGIQEDAKSVKQKLLNGEMRRA  178

Query  419  viaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDI---ISNFTKE  249
            V++IVG  G+GKTTL K ++ND +++  F    WIYVS     +++ + I   +   ++E
Sbjct  179  VVSIVGMGGLGKTTLAKKVYNDNDVQQCFDCHAWIYVSQEYTIRELLLGIAVRVGILSEE  238

Query  248  TSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRV  69
                  M E  L   ++D+L   KY IV+DD+WR E WD L   FP++  GSR+L+T+R 
Sbjct  239  ERS--KMNESDLGNSLRDYLTTKKYLIVMDDMWRNEAWDRLGLYFPDSVNGSRVLITSRN  296

Query  68   LEVANHVDSKNAPHKF  21
             E+  + D +  PH+ 
Sbjct  297  KEIGLYADPQTIPHEL  312



>ref|XP_009620169.1| PREDICTED: disease resistance protein RPP13-like isoform X1 [Nicotiana 
tomentosiformis]
Length=838

 Score =   115 bits (288),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 99/313 (32%), Positives = 179/313 (57%), Gaps = 6/313 (2%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            D +V  ++  ++Q V EN  LI G + ++++LL ++RS  A LS+AA   ++ ++ ++ V
Sbjct  3    DTLVNFLVENLLQLVTENVKLIAGAKGELDNLLEDVRSLNAFLSDAAVEESNSSLWKDFV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            +KI+  V  AED ++K+LV+ + H  +    K      +  +V + AK++  I+++ ++I
Sbjct  63   RKIRIQVHKAEDVVEKFLVQAKLHEEKNAAEKVFYIFGHTKRVRNLAKDINDIREKVKEI  122

Query  578  RLD-LELLQGGSLNNPQLPAA-DLQAHVAE-DELVGFDEDAQTIKYRLTEKLDDttviai  408
            R D  E LQ   + + Q   A + Q    E  ++VGFD+ A+ +  RL E  +D   + I
Sbjct  123  RRDNPEALQPKRMLDQQRTVAREPQDTFLEVKQVVGFDDKAKYVIRRLIEGSEDLEFVPI  182

Query  407  vggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDM  228
            VG AG+GKTTL + +++D ++  EF   +W+ V  +   KQIF  +I  F      ++  
Sbjct  183  VGMAGLGKTTLARKVWSDSQVTTEFSKNIWVSVGQSNELKQIFF-VILKFMGGVEEFRCD  241

Query  227  KEEQLAERIQDFLMEG-KYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANH  51
              ++LA+ I++F+ E  K  IV+D++W  +  D+++   P N+KG RI++TTR+ +VA++
Sbjct  242  DGKELAKVIREFVTEKDKCLIVLDNVWARDLVDFVKNVLPENKKGHRIMMTTRLRDVASY  301

Query  50   VDSKNAPHKFPIS  12
                    KF  S
Sbjct  302  ASEYPYDLKFLTS  314



>ref|XP_009591235.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=837

 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 107/315 (34%), Positives = 176/315 (56%), Gaps = 15/315 (5%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            DAVV  ++  ++Q V  N  LI G+E   ++LL E+R   A L +AAK  +D ++ +++V
Sbjct  3    DAVVNFLLENLLQLVTNNVKLIAGVEKDFQNLLEEVRRLKAFLDDAAKYHSDSSLWKQLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            + I+  V  AED IDK+LV+ + H+ +   +K    V +  KV D AK++++I +  ++ 
Sbjct  63   RDIRITVHRAEDVIDKFLVQAKLHQEKNK-VKRSFDVCHVRKVWDLAKDIKTIHQNVKEF  121

Query  578  RLDLE--LLQGGSLNNPQLPAADLQAHVAE-DELVGFDEDAQTIKYRLTEKLDDttviai  408
            R + +        L+ PQ    + Q  + E  E+VGFD +A+ +  RL E   D   + I
Sbjct  122  RQNNQKAFQPKPMLDLPQRVTREPQDTLLEYKEVVGFDYEAEYVIKRLVEGSKDLEFVPI  181

Query  407  vggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTK--ETSGYK  234
            VG AGIGKTTL + + +   + + F  ++W+YV  +   K +   I+ +FT+  E   YK
Sbjct  182  VGMAGIGKTTLARKVCSHSRISNIFSKKIWVYVGRSYELKGMLSKILKSFTERIEEFRYK  241

Query  233  DMKEEQLAERIQDFLME--GKYFIVVDDLWRTE--DWDYLRTAFPNNQKGSRILVTTRVL  66
            D+ E  LAE I +F+ +  G+Y IV+DD+W  E    D ++     N KG RI++TTR  
Sbjct  242  DVNE--LAEVICEFMAKEGGRYLIVLDDVWAKELVVVDLVKRILQENNKGHRIMMTTRDE  299

Query  65   EVANHVDSKNAPHKF  21
             VA++  +   PH+ 
Sbjct  300  YVASY--ASEHPHRL  312



>ref|XP_006347944.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006347945.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006347946.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X3 [Solanum tuberosum]
Length=703

 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 80/118 (68%), Gaps = 3/118 (3%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L   IF   ++ +EFFTRLW+YVS +   ++++++IIS FT  T   +DM E  LA +++
Sbjct  9    LATKIFKHPKIEYEFFTRLWLYVSQSYKTRELYLNIISKFTGNTKNCRDMSETDLAHKVR  68

Query  197  DFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + L E GKY IV+DD+W T+ WD ++ AFP N KG+R+L+TTR  +VA H +   +PH
Sbjct  69   EILDEGGKYLIVLDDVWSTDAWDRIKIAFPKNDKGNRVLLTTRDHKVAKHCN--RSPH  124



>ref|XP_007201771.1| hypothetical protein PRUPE_ppa1027204mg, partial [Prunus persica]
 gb|EMJ02970.1| hypothetical protein PRUPE_ppa1027204mg, partial [Prunus persica]
Length=817

 Score =   114 bits (286),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 95/314 (30%), Positives = 165/314 (53%), Gaps = 20/314 (6%)
 Frame = -2

Query  929  VVGLVIGKVVQSVEENETLILGIEDQVEDL---LCELRSFWALSEAAKNCNDKAVLEEVV  759
            VV  V+ K+   + E   L+ G+ D+VE L   L  ++SF   ++A +  N++      V
Sbjct  5    VVSTVVEKLTDWITEEALLLEGVGDKVEQLRDKLQWMQSFLKDADAEQEKNER--FRNWV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
             +I++V +DAED I+ Y+ E  +H    +  K         K+      +++I  + E  
Sbjct  63   SQIREVALDAEDVIETYIAEAASHSTWNIAAKLINLYWAGKKIGKIQSRVQNISSQKEHF  122

Query  578  RLD---LELLQGGSLNNPQLPAADLQ------AHVAEDELVGFDEDAQTIKYRLTEKLDD  426
             +     E+ +G S +    P   L+       ++ ED+LVG  ED + +  +L+     
Sbjct  123  GITGTAREVHEGTSAS----PNERLRWWRQTSPNIEEDDLVGLIEDTEALLRQLSTMEPR  178

Query  425  ttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKET  246
              V++IVG  G+GKTTL K ++N  EL+ +F  R ++YVS    R+     II     + 
Sbjct  179  RRVVSIVGMGGLGKTTLAKKLYNHSELKKQFDCRAFVYVSKDYRRRDTLQGIIVAVNPDC  238

Query  245  S--GYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTR  72
            +    K ++EE+L  ++   L E +Y +V+DD+W T+ WD L++AFPN + GS++++TTR
Sbjct  239  NIQDLKKLQEEELVLKLHQLLQEKRYLLVLDDIWETKVWDSLQSAFPNGKMGSKVMLTTR  298

Query  71   VLEVANHVDSKNAP  30
              EVA + D+ + P
Sbjct  299  NKEVALYADAMSEP  312



>ref|XP_010244072.1| PREDICTED: probable disease resistance RPP8-like protein 4 [Nelumbo 
nucifera]
Length=925

 Score =   114 bits (286),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 105/336 (31%), Positives = 175/336 (52%), Gaps = 31/336 (9%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCEL---RSFWALSEAAKNCNDKAVLEE  765
            ++VV   + K+ + + +   L+ G+++Q+  L  EL   RSF  L +A +   +   ++ 
Sbjct  10   ESVVTFFLQKLSEFITQEANLLTGVDEQICSLRDELQWIRSF--LKDADRERKENERVKV  67

Query  764  VVQKIQKVVIDAEDAIDKY---LVEERNHRGR--GVLMKWPEKVSYYNKVN------DAA  618
             V +++ V   AED ID++   LV +R H+    GV M      S++++ N      D  
Sbjct  68   WVNQVRDVSHQAEDVIDEFMLKLVLQRQHQKSIGGVYMYRSLAASWFSRTNKLKTLHDLG  127

Query  617  KEMESIKKRAEKI-----RLDLELLQG--------GSLNNPQLPAADLQAHVAEDELVGF  477
             ++E IK+R E+I     +  +E +Q          S  +PQ     +Q    E ++VGF
Sbjct  128  NQIEKIKRRVEEISANKSKYGIEAIQTQVGESSSRSSNQDPQWKQRRVQV-AEEADVVGF  186

Query  476  DEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTV  297
            D++ QT+   L E     +VI+IVG  G+GKTTL K ++N   +   F  R  IYVS   
Sbjct  187  DKETQTLVRELIEGDPWLSVISIVGMGGLGKTTLAKKVYNHNLVTKHFDCRALIYVSQEY  246

Query  296  NRKQIFMDIISNFTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTA  117
              + I   I++  T+ +   K + +E+L +++  +L + +Y +VVDD+W  E WD L   
Sbjct  247  RVRDILEXILNQITEFSKEDKKLSDEELEKKLILYLKQRRYLVVVDDIWSVEAWDRLEHI  306

Query  116  FPNNQKGSRILVTTRVLEVANHVDSKNAPHKF-PIS  12
            FP    GSRIL+TTR  +VA H D +  PH+  P++
Sbjct  307  FPKEMMGSRILLTTRKKDVARHADVERIPHELQPLT  342



>ref|XP_007131448.1| hypothetical protein PHAVU_011G014200g [Phaseolus vulgaris]
 gb|ESW03442.1| hypothetical protein PHAVU_011G014200g [Phaseolus vulgaris]
Length=915

 Score =   114 bits (285),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 97/331 (29%), Positives = 169/331 (51%), Gaps = 29/331 (9%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVVQ  756
            D+VV  V+  + Q V     L+ G+ED+V+ L  EL+    L   +K    K +   VV 
Sbjct  8    DSVVTFVLDHLSQLVAHEANLLYGVEDRVQSLQNELQMINDLLNTSKR--KKGIENTVVN  65

Query  755  KIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKIR  576
            +I+ V   AED ID ++ +   ++ R +L +     +    ++  A +++ IK    +IR
Sbjct  66   QIRDVAHLAEDVIDTFVAKVAIYKRRTILGRMLRGFAQARLLHHVADKIDKIKTTLNEIR  125

Query  575  LDLELLQGGSLNNPQLPAA------------DLQAHVAEDELVGFDEDAQTIKYRLTEKL  432
             + +        N Q  A              L+  V E+ +VGF +D++ I  RL E  
Sbjct  126  ENKDKYDAFKEINNQSAAEEEEEKERAQSLHKLRRDVEEENVVGFVDDSKDIIKRLLEGG  185

Query  431  DDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDI----IS  264
             +  V++I+G  G+GKTTL + ++N  E++  F  R W+YVS     +++ + +    + 
Sbjct  186  SNRKVVSIIGMGGLGKTTLARKVYNSNEVKQHFECRAWVYVSNECRVRELLLGLLKHLMP  245

Query  263  NFTKETSGYK----------DMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAF  114
            NF ++  G K           + EE+L + +++ L    Y +VVDDLW+ +DWD ++  F
Sbjct  246  NFEQQCRGKKKGKKSTQDNSSLSEEELKKLVRNSLESRTYLVVVDDLWKRQDWDEVQDVF  305

Query  113  PNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
            P+N +GSR+L+T+R+ EVA H  S + P+  
Sbjct  306  PDNNRGSRVLITSRLKEVALHT-SHDLPYHL  335



>ref|XP_007046809.1| Disease resistance protein RPH8A, putative [Theobroma cacao]
 gb|EOX90966.1| Disease resistance protein RPH8A, putative [Theobroma cacao]
Length=924

 Score =   114 bits (285),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 99/322 (31%), Positives = 161/322 (50%), Gaps = 34/322 (11%)
 Frame = -2

Query  929  VVGLVIGKVVQSVEENETLILGIEDQVEDLLCELR---SFWALSEAAKNCNDKAVLEEVV  759
             V LV+ K+   +      + G+  ++  L  ELR   SF  L +A     +  ++++ V
Sbjct  5    AVSLVVEKLTNLLAMQAAYLDGVSQKIVQLRNELRWMQSF--LKDADMKQEEDELMQQWV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
              ++ V  D E+ I+ Y+    + +   ++ K      Y+ KV    + +ESI+ R   I
Sbjct  63   SDVRDVAYDTEEVIETYVSRAASQKPFDLVTK----PFYHYKV---GRRIESIRSRIRAI  115

Query  578  RLDLELLQG---------GSLNNPQL-----PAADLQAHVAEDELVGFDEDAQTIKYRLT  441
                E   G         G+  N +L     P+     HV ED+++   ED + +  +LT
Sbjct  116  TGRRETYGGLGNGRSGREGAAANDRLRWWRQPSP----HVEEDDIIELVEDTKALLTKLT  171

Query  440  EKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISN  261
                   V++IVG  G+GKTTL K ++N  ++++ F  R WIYVS    RK+I   II++
Sbjct  172  SMESRRRVVSIVGMGGLGKTTLAKRLYNHNDVKNHFDCRAWIYVSKEYRRKEILQGIITD  231

Query  260  FTK----ETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGS  93
                   E    + +KEE L +++ +FL E +Y +V+DD+W  E WD L  AFP+ + GS
Sbjct  232  VNAVNRDEMEVLEKLKEEVLLKKLHEFLEERRYLVVLDDVWSMEVWDCLENAFPSGKTGS  291

Query  92   RILVTTRVLEVANHVDSKNAPH  27
            +++VTTR  EVA H D    PH
Sbjct  292  KVMVTTRNKEVALHADGGGIPH  313



>ref|XP_009763000.1| PREDICTED: probable disease resistance RPP8-like protein 2 [Nicotiana 
sylvestris]
 ref|XP_009763001.1| PREDICTED: probable disease resistance RPP8-like protein 2 [Nicotiana 
sylvestris]
 ref|XP_009763002.1| PREDICTED: probable disease resistance RPP8-like protein 2 [Nicotiana 
sylvestris]
Length=840

 Score =   114 bits (284),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 105/315 (33%), Positives = 176/315 (56%), Gaps = 15/315 (5%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVV  759
            DAVV  ++  ++Q V  N  LI G+E + ++LL E+R   A L +AAK  +D ++ +++V
Sbjct  3    DAVVNFLLENLLQLVTNNVKLISGVEKEFQNLLEEVRRLKAFLDDAAKYHSDSSLWKQLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            + I+  V  AED IDK+LV+ + H+ +   +K    + +  KV D AK++E+I +  ++ 
Sbjct  63   RDIRITVHRAEDVIDKFLVQAKLHQEKNK-VKRSFDLCHVRKVWDLAKDIEAIHQNVKEF  121

Query  578  RLDLE--LLQGGSLNNPQLPAADLQAHVAE-DELVGFDEDAQTIKYRLTEKLDDttviai  408
            R + +        L+ PQ    + Q  + E  E+VGFD +A+ +  RL +   D   + I
Sbjct  122  RQNNQKAFQPKPMLDLPQRVTREPQDTLLEYKEVVGFDYEAEYVIKRLVKGSKDLEFVPI  181

Query  407  vggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTK--ETSGYK  234
            VG AGIGKTTL + + +  ++ + F  ++W+YV  +   K I   I+ + T+  E   YK
Sbjct  182  VGMAGIGKTTLARKVCSHSQISNNFSKKIWVYVGRSYELKGILSKILQSLTERIEEFRYK  241

Query  233  DMKEEQLAERIQDFLME--GKYFIVVDDLWRTE--DWDYLRTAFPNNQKGSRILVTTRVL  66
            D+ E  LAE I DF+ +  G+Y  V+DD+W  E    D ++     N +G RI++TTR  
Sbjct  242  DVNE--LAEVICDFMAKEGGRYLFVLDDVWAKELVVVDLVKRILQENNRGHRIMMTTRDE  299

Query  65   EVANHVDSKNAPHKF  21
             VA++  +   PH+ 
Sbjct  300  YVASY--ASEHPHRL  312



>ref|XP_010250086.1| PREDICTED: disease resistance protein RPP8-like [Nelumbo nucifera]
Length=952

 Score =   114 bits (284),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 98/329 (30%), Positives = 167/329 (51%), Gaps = 24/329 (7%)
 Frame = -2

Query  941  AMDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAA--KNCNDKAVLE  768
            A +A+V +V+ K+ + + +    + G+ DQ E +  ELR        A  K     A + 
Sbjct  2    ATEAIVAVVVEKIAELIIQEAVFLRGVRDQFEWMKGELRQMKCFLTHADEKQQEGDARIT  61

Query  767  EVVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEK-VSYYNKVNDAAKEMESIKKR  591
              V   + +  DAED I+ +++     R RG + ++    +S     +  ++E+E IK R
Sbjct  62   NWVADFRDIAYDAEDVIENFILSRAVQRRRGFITRYASIFLSDLLNRHRVSQEIERIKAR  121

Query  590  AEKIR-------LDLELLQGGSLNNPQLPAADLQ-------AHVAEDELVGFDEDAQTIK  453
             E I        +  E++ G  +      A            H  E ++ G +ED  ++K
Sbjct  122  IEDISKRQVTYGIQEEMIGGERVGEGSSSARRRLRERRRISPHSDEPDIFGLEEDINSLK  181

Query  452  YRLTEKLD-DttviaivggagigktTLMKMIFNDRELRHEFF-TRLWIYVSMTVNRKQIF  279
             +L  K +   +VI+IVG  G+GKTTL K ++N  ++R +F   R W+YVS   N K+I 
Sbjct  182  GQLINKWNLRRSVISIVGMGGLGKTTLAKQVYNSVDVRSQFRECRAWVYVSQVYNTKEIL  241

Query  278  MDI---ISNFTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPN  108
             D+   +    ++ S  K+M  E+L E++  FL E +Y +++DD+W T+ WD ++ AFP+
Sbjct  242  QDLAKKVMGLPRKES--KEMSVEELEEKLHRFLQERRYLVIMDDVWVTDVWDEIKGAFPD  299

Query  107  NQKGSRILVTTRVLEVANHVDSKNAPHKF  21
               GSRI++TTR  +VA H D  +  H+ 
Sbjct  300  MGNGSRIVLTTRSKDVALHADPASPVHEL  328



>ref|XP_007131450.1| hypothetical protein PHAVU_011G014400g [Phaseolus vulgaris]
 gb|ESW03444.1| hypothetical protein PHAVU_011G014400g [Phaseolus vulgaris]
Length=616

 Score =   112 bits (281),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 95/332 (29%), Positives = 170/332 (51%), Gaps = 33/332 (10%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVVQ  756
            D+VV  V+  + + V     L+ G+ED+++ L  EL+    L   +K+   K +   VV 
Sbjct  3    DSVVTFVLDHLSELVAREAHLLYGVEDRIQSLQNELQMINDLLNTSKS--KKGIDNTVVN  60

Query  755  KIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKIR  576
            +I+ V   AED ID ++ +   ++ R +L +     +    ++D A ++  IK    +IR
Sbjct  61   QIRDVAHLAEDVIDTFVAKVAIYKRRTMLGRMLHGFAQARLLHDVADKVNKIKTTLNEIR  120

Query  575  LDLELLQGGSLNNPQLPAAD------------LQAHVAEDELVGFDEDAQTIKYRLTEKL  432
             + +        N Q  A +            L+ +V E+ +VGF  D+  +  RL E  
Sbjct  121  ENKDKYDAFEEINNQSAAKEEEEKKRAQSLHKLRKNVEEEGVVGFVHDSNVVIKRLLEGG  180

Query  431  DDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDI----IS  264
             +   ++I+G  G+GKTTL + ++N+ E++  F  R W+YVS     +++ + +    + 
Sbjct  181  SNRKAVSIIGMGGLGKTTLARKVYNNSEVKQHFECRAWVYVSNECRVRELLLGLLKHLMP  240

Query  263  NFTKETSGYK----------DMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAF  114
            NF ++    K          ++ EE+L + +++ L   +Y +VVDDLW+ +DWD ++ AF
Sbjct  241  NFDQQCKDKKKGKKSSRASSNLSEEELKKLVRNKLESRRYLVVVDDLWKRQDWDEVQDAF  300

Query  113  PNNQKGSRILVTTRVLEVANHVDSKNAPHKFP  18
            P+N +GSRIL+T+R+ EVA H       H  P
Sbjct  301  PDNNRGSRILITSRLKEVALH-----TAHDLP  327



>ref|XP_009411156.1| PREDICTED: putative disease resistance RPP13-like protein 3 [Musa 
acuminata subsp. malaccensis]
Length=883

 Score =   113 bits (283),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 90/318 (28%), Positives = 151/318 (47%), Gaps = 19/318 (6%)
 Frame = -2

Query  932  AVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELR---SFWALSEAAKNCNDKAVLEEV  762
            AVV LV+GK+ + V    T IL + D+VE     LR   SF    +   N     ++EE 
Sbjct  4    AVVNLVLGKMSEYVFREVTPILNVGDEVEVSRITLRLLLSFLEDVDRKPNYQYSKLVEEW  63

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEK  582
            V  I+ +  D ED + +Y +     R +  L       +     +  AK ++ I +  ++
Sbjct  64   VSLIRGLAYDIEDVVAEYTLRVGRSRWKCSLKCIANLPTRIFARHHLAKSLQRINRNLQE  123

Query  581  IRLDLELLQGGSLNNPQLPAA-----DLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttv  417
                   L    + +  LP+       L+  VAED +VGFD D Q I    T +L D  V
Sbjct  124  TSKHASELGIQGIPSTSLPSIKDTNLTLRYDVAED-VVGFDHDIQVI----TNQLRDLHV  178

Query  416  iaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRKQIFMDII-SNFT  255
                  + +G   L K      ++N + ++H F  R WI VS +   +++  +I+     
Sbjct  179  TRRAVISIVGMGGLGKTTLANKVYNSQAVKHHFQCRAWIVVSQSYTARELLTNIMKQTMN  238

Query  254  KETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTT  75
             E +  ++M E ++  +I++ L   +Y +V+DD+W+  DW+ ++TAFP     SR+L+TT
Sbjct  239  IENNQIREMDEAEMKNKIKEHLKGTRYLVVMDDIWKVSDWETIKTAFPEEFTASRVLLTT  298

Query  74   RVLEVANHVDSKNAPHKF  21
            R ++VA   D  + PH  
Sbjct  299  RKMDVAETADPDSPPHHL  316



>ref|XP_009144124.1| PREDICTED: disease resistance protein RPP8-like, partial [Brassica 
rapa]
Length=369

 Score =   110 bits (274),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 84/314 (27%), Positives = 156/314 (50%), Gaps = 11/314 (4%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVVQ  756
            + VV   + K+   +      + G+ ++V+DL C++R   +L + A     ++V+   ++
Sbjct  3    EGVVSFGVEKLWDLLSRESERLQGVHEKVDDLKCQMRMLQSLLKDADAKKYESVVRNFLE  62

Query  755  KIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKIR  576
             ++  V DAED I+ +L++E +   +G+         +     D + E+E I KR  K+ 
Sbjct  63   DVKDTVFDAEDIIESFLLKESSGDEKGIKRHLKRLSCFLVDRRDISMEIEGITKRMSKVV  122

Query  575  LDLELL-------QGGSLNNPQLPAADLQAH--VAEDELVGFDEDAQTIKYRLTEKLDDt  423
            + +++        +  SL   Q P  + Q +   ++ +LVG ++    +   L E  D  
Sbjct  123  VQMQVFGIQQIIYRSLSLQERQRPRENPQTYPKTSQKDLVGVEQSVNELVGHLVEN-DSI  181

Query  422  tviaivggagigktTLMKMIFNDRELRHEFFTRL-WIYVSMTVNRKQIFMDIISNFTKET  246
             V++I G  GIGKTTL + + +   +R  F     WI VS    +K I+  ++ +     
Sbjct  182  QVVSISGMGGIGKTTLARQVLHHDIVRSHFVDGFAWICVSQEFKKKDIWQKLLRDLRPHD  241

Query  245  SGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVL  66
            +G + M E+ L  +I   L   KY IV+DD+W+TEDWD ++  FP  ++G ++++T+R  
Sbjct  242  TGIEQMNEDTLQAKIFQLLETSKYLIVMDDVWKTEDWDVIKDVFPQERRGWKMILTSRDE  301

Query  65   EVANHVDSKNAPHK  24
             V  H D    P +
Sbjct  302  GVGLHADPTCFPFR  315



>emb|CAN70484.1| hypothetical protein VITISV_008412 [Vitis vinifera]
Length=597

 Score =   112 bits (280),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 96/316 (30%), Positives = 169/316 (53%), Gaps = 17/316 (5%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCEL---RSFWALSEAAKNCNDKAVLEE  765
            +++V + + K+   + +   L+  +E+QV  L  +L   R F   ++A +  + +  L  
Sbjct  3    ESIVTVFLEKLTDLLSQEAFLLSRVEEQVNLLSIDLEWMRHFLKDADAKRRYDPRIKL--  60

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGVL--MKWPEKVSYYNKVNDAAKEMESI--K  597
             V +I+ V  DAED ID+++ E  NH+ +G L  +K+  K+   +K+    +E+ +   K
Sbjct  61   WVSQIRDVTYDAEDVIDRFMFE-MNHQQQGSLKCLKFL-KLRLVHKLESRIREINTKIEK  118

Query  596  KRAEKIRLDLELLQGGSLNNPQLPAADLQAHVAED-ELVGFDEDAQTIKYRLTEKLDDtt  420
             +A K    +E L   S  N  +P  + +A + E+  +VG  EDA+++K +L        
Sbjct  119  IKAAKSTFVVETLPAASSPNEVVPHRERRAPIVEEVNVVGIQEDAKSVKQKLLNGEMRRA  178

Query  419  viaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDI---ISNFTKE  249
            V++IVG  G+GKTTL K ++ND +++  F    WIYVS     +++ +     +   ++E
Sbjct  179  VVSIVGMGGLGKTTLAKKVYNDNDVQQCFDCHAWIYVSQEYTIRELLLGXAVRVGILSEE  238

Query  248  TSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRV  69
                  M E  L   ++D+L   KY IV+DD+WR E WD L   FP++  GSR+L+T+R 
Sbjct  239  ERS--KMNESDLGNSLRDYLTTKKYLIVMDDMWRXEAWDRLGLYFPDSVNGSRVLITSRN  296

Query  68   LEVANHVDSKNAPHKF  21
             E+  + D +  PH+ 
Sbjct  297  KEIGLYADPQTIPHEL  312



>ref|XP_003633889.1| PREDICTED: probable disease resistance protein RF9 [Vitis vinifera]
Length=899

 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 95/316 (30%), Positives = 170/316 (54%), Gaps = 17/316 (5%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCEL---RSFWALSEAAKNCNDKAVLEE  765
            +++V + + K+   + +   L+  +E+QV  L  +L   R F   ++A +  + +  L  
Sbjct  3    ESIVTVFLEKLTDLLSQEAFLLSRVEEQVNLLSIDLEWMRQFLKDADAKRRYDPRIKL--  60

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGVL--MKWPEKVSYYNKVNDAAKEMESI--K  597
             V +I+ V  DAED ID+++ E  NH+ +G L  +K+  K+   +K+    +E+ +   K
Sbjct  61   WVSQIRDVTYDAEDVIDRFMFE-MNHQQQGSLKCLKF-LKLRLVHKLESRIREINTKIEK  118

Query  596  KRAEKIRLDLELLQGGSLNNPQLPAADLQAHVAED-ELVGFDEDAQTIKYRLTEKLDDtt  420
             +A K    +E L   S  N  +P  + +A + E+  +VG  EDA+++K +L        
Sbjct  119  IKAAKSTFIVETLPAASWPNEVVPHRERRAPIVEEVNVVGIQEDAKSVKQKLLNGEMRRA  178

Query  419  viaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDI---ISNFTKE  249
            V++IVG  G+GKTTL K ++ND +++  F    WIYVS     +++ + +   +   ++E
Sbjct  179  VVSIVGMGGLGKTTLAKKVYNDNDVQQCFDCHAWIYVSQEYTIRELLLGVAVRVGILSEE  238

Query  248  TSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRV  69
                  M E  L   ++D+L   KY IV+DD+WR E WD L   FP++  GSR+L+T+R 
Sbjct  239  ERS--KMNESDLGNSLRDYLTTKKYLIVMDDMWRNEAWDRLGLYFPDSVNGSRVLITSRN  296

Query  68   LEVANHVDSKNAPHKF  21
             ++  + D +  PH+ 
Sbjct  297  KQIGLYADPQTIPHEL  312



>ref|XP_009604792.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009604793.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=875

 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 96/321 (30%), Positives = 163/321 (51%), Gaps = 28/321 (9%)
 Frame = -2

Query  932  AVVGLVIGKVVQSVEENETLILGIEDQVEDL---LCELRSFWALSEAAKNCNDKAVLEEV  762
            AV+  ++  + Q ++ N +LI    + V+ L   L  L+SF  L +  K  +D+  L  +
Sbjct  4    AVITSIMTTIEQVLQFNPSLISECRESVDSLYGTLSFLQSF--LEDTGKQISDQEALMFL  61

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEK  582
             +KI+     AED ID  L   R H      ++   +   Y+++    + M+SI+    K
Sbjct  62   EEKIRDAGYKAEDTID--LCLRRIHVADSEKVQNNARCKLYDELLQIIEVMDSIQGEVMK  119

Query  581  IRLDLELLQGGSLNNPQLPAADLQAHVA------------EDELVGFDEDAQTIKYRLTE  438
             + D         +N Q    DL A  +            E+ LVG ++D   I+ +L  
Sbjct  120  FKNDR--------HNNQQDIKDLSAITSSPLRSSGRVWDEENSLVGMEDDFNIIRDQLFR  171

Query  437  KLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNF  258
            +  +  V++IVG  GIGK+TL + +FN   +   F    W+ VS   + K++ +D++S  
Sbjct  172  QTPELNVVSIVGMGGIGKSTLARSLFNHPSVSPRFDISSWVTVSQAYDAKEMLLDVLSFG  231

Query  257  TKETSG-YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILV  81
            T      Y++M E++L +++   L   +Y IV+DD+W  E WD +R +FP+++ GSRI++
Sbjct  232  TPGGKAMYRNMSEDELLDQVHRKLKRKRYLIVLDDMWTIEAWDQVRRSFPDDENGSRIMI  291

Query  80   TTRVLEVANHVDSKNAPHKFP  18
            TTR+LEVAN   +   PH  P
Sbjct  292  TTRLLEVANCAGNDFPPHHIP  312



>ref|XP_006603606.1| PREDICTED: disease resistance protein RPP13-like [Glycine max]
Length=858

 Score =   112 bits (279),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 91/318 (29%), Positives = 166/318 (52%), Gaps = 14/318 (4%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +D+VV  ++  + + +E+   L+ G+ED++  L  EL+      + ++      +++EVV
Sbjct  2    VDSVVTFLLDNLSRLLEDEHKLLSGVEDKINSLCNELKFIHIFLKNSEGKRSHEMVKEVV  61

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKW---PEKVSYYNKVNDAAKEMESIKKRA  588
             +I+ V + AED +D YL      + R  L K     E V   ++VN    ++E I+ R 
Sbjct  62   SQIRDVSLKAEDVVDTYLSNIAQQKQRSKLSKLFHLKEHVMVLHQVNS---DIEKIRTRI  118

Query  587  EKIRLDLELLQGG-----SLNNPQLPAADLQAH--VAEDELVGFDEDAQTIKYRLTEKLD  429
            ++I  + +    G     S        + L+    V E+++VG   D+  +   L E   
Sbjct  119  DEIYKNRDRYGIGEGDFRSEEAAAEAESLLKRRREVEEEDVVGLVHDSSHVIQELMESES  178

Query  428  DttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKE  249
               V++I+G  G+GKTTL + I+N+ +++  F    W+ VS     K+  + ++      
Sbjct  179  RLKVVSIIGMGGLGKTTLARKIYNNNQVQLRFPCLAWVSVSNDYRPKECLLSLLKCSMSS  238

Query  248  TSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRV  69
            TS ++ + EE L +++ ++L    Y +V+DD+W T+ WD ++ AFP++Q GSRIL+T+R 
Sbjct  239  TSEFEKLSEEDLKKKVAEWLKGKSYLVVLDDIWETQVWDEVKGAFPDDQIGSRILITSRN  298

Query  68   LEVANHVDSKNAPHKFPI  15
             EVA H     +P+  PI
Sbjct  299  KEVA-HYAGTASPYYLPI  315



>gb|ACN56771.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=842

 Score =   112 bits (279),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 99/329 (30%), Positives = 163/329 (50%), Gaps = 30/329 (9%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++++G++D +E+L  ELR    +    K+   +   +E  
Sbjct  2    VDAITEFVVGKIGNYLIEEASMLIGVKDDLEELKTELR---CIHGYLKDVEAREREDEAS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  YN V+D    ++ 
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYNIVDD----IKI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+ + 
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKILL  174

Query  452  YRLTEKLD-DttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFM  276
             +L    D +  +I+I G  G+GKT L + ++N  +++  F  R W YVS       I M
Sbjct  175  EKLLYYEDKNRFIISIFGMGGLGKTALARKLYNSGDVKERFKYRAWTYVSQEYKTGDILM  234

Query  275  DIISN----FTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPN  108
             II +    F +E+   +   EE+L   +   L   KY +VVDD+W  E W+ L+ A P 
Sbjct  235  RIIRSLRMTFGEESEKIRKFAEEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPC  294

Query  107  NQKGSRILVTTRVLEVANHVDSKNAPHKF  21
            N +GSR+++TTR+  VA  VD +   HK 
Sbjct  295  NHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>gb|ABF00977.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=842

 Score =   112 bits (279),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 99/329 (30%), Positives = 163/329 (50%), Gaps = 30/329 (9%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++++G++D +E+L  ELR    +    K+   +   +E  
Sbjct  2    VDAITEFVVGKIGNYLIEEASMLIGVKDDLEELKTELR---CIHGYLKDVEAREREDEAS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  YN V+D    ++ 
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYNIVDD----IKI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+ + 
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKILL  174

Query  452  YRLTEKLD-DttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFM  276
             +L    D +  +I+I G  G+GKT L + ++N  +++  F  R W YVS       I M
Sbjct  175  EKLLYYEDKNRFIISIFGMGGLGKTALARKLYNSGDVKERFKYRAWTYVSQEYKTGDILM  234

Query  275  DIISN----FTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPN  108
             II +    F +E+   +   EE+L   +   L   KY +VVDD+W  E W+ L+ A P 
Sbjct  235  RIIRSLRMTFGEESEKIRKFAEEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPC  294

Query  107  NQKGSRILVTTRVLEVANHVDSKNAPHKF  21
            N +GSR+++TTR+  VA  VD +   HK 
Sbjct  295  NHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>gb|AAS93942.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
 gb|AAS93943.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
 gb|AAS93944.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
 gb|ABF00974.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
 gb|ACN56761.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=842

 Score =   112 bits (279),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 99/329 (30%), Positives = 163/329 (50%), Gaps = 30/329 (9%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++++G++D +E+L  ELR    +    K+   +   +E  
Sbjct  2    VDAITEFVVGKIGNYLIEEASMLIGVKDDLEELKTELR---CIHGYLKDVEAREREDEAS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  YN V+D    ++ 
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYNIVDD----IKI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+ + 
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKILL  174

Query  452  YRLTEKLD-DttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFM  276
             +L    D +  +I+I G  G+GKT L + ++N  +++  F  R W YVS       I M
Sbjct  175  EKLLYYEDKNRFIISIFGMGGLGKTALARKLYNSGDVKERFKYRAWTYVSQEYKTGDILM  234

Query  275  DIISN----FTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPN  108
             II +    F +E+   +   EE+L   +   L   KY +VVDD+W  E W+ L+ A P 
Sbjct  235  RIIRSLRMTFGEESEKIRKFAEEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPC  294

Query  107  NQKGSRILVTTRVLEVANHVDSKNAPHKF  21
            N +GSR+++TTR+  VA  VD +   HK 
Sbjct  295  NHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>gb|AAS93947.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=834

 Score =   112 bits (279),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 97/333 (29%), Positives = 155/333 (47%), Gaps = 38/333 (11%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++++G++D +E+L  ELR    +    K+   +   +E  
Sbjct  2    VDAITEFVVGKIGNYLIEEASMLIGVKDDLEELKTELR---CIHGYLKDVEAREREDEAS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  YN V+D    ++ 
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYNIVDD----IKI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N  +++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSGDVKERFKYRAWTYVSQEYKTG  230

Query  287  QIFMDIISN----FTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRT  120
             I M II +    F +E+   +   EE+L   +   L   KY +VVDD+W  E W+ L+ 
Sbjct  231  DILMRIIRSLRMTFGEESEKIRKFAEEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKR  290

Query  119  AFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
            A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  291  ALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>gb|AAS93946.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=843

 Score =   112 bits (279),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 97/333 (29%), Positives = 153/333 (46%), Gaps = 38/333 (11%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++++G++D +E+L  ELR    +    K+   +   +E  
Sbjct  2    VDAITEFVVGKIGNYLIEEASMLIGVKDDLEELKTELR---CIHGYLKDVEAREREDEAS  58

Query  758  QKIQKVVID----AEDAIDKY---LVEERNHRG-RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y   L E    RG R +  K   K+  YN V+D    ++ 
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLDERSQRRGLRRLTNKIGRKMDAYNIVDD----IKI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N  +++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSGDVKERFKYRAWTYVSQEYKTG  230

Query  287  QIFMDIISN----FTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRT  120
             I M II +    F +E+   +   EE+L   +   L   KY +VVDD+W  E W+ L+ 
Sbjct  231  DILMRIIRSLRMTFGEESEKIRKFAEEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKR  290

Query  119  AFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
            A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  291  ALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>gb|AAU88165.1| disease resistance-like protein [Coffea khasiana]
Length=169

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 77/117 (66%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K + +D ++ ++FF R +IYVS    R ++F++I+ +  + T   K+M EE+LAE ++
Sbjct  7    LAKKVLHDPKIEYDFFARAFIYVSQQFERTEVFLNILGSIGQLTEEAKNMPEEKLAEHVR  66

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + L    Y IV+DD+W+ EDWD L+ AFPNN+K SR+L+TTR   VA + +    P+
Sbjct  67   EQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLITTRNTSVAIYANPAVEPY  123



>gb|AAU88156.1| disease resistance-like protein [Coffea arabica]
Length=168

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 77/117 (66%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K + +D ++ ++FF R +IYVS    R ++F++I+ +  + T   K+M EE+LAE ++
Sbjct  7    LAKKVLHDPKIEYDFFARAFIYVSQQFERTEVFLNILGSIGQLTEEAKNMPEEKLAEHVR  66

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + L    Y IV+DD+W+ EDWD L+ AFPNN+K SR+L+TTR   VA + +    P+
Sbjct  67   EQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLITTRNTSVAIYANPAVEPY  123



>gb|AAU88178.1| disease resistance-like protein [Coffea wightiana]
Length=149

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 77/117 (66%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K + +D ++ ++FF R +IYVS    R ++F++I+ +  + T   K+M EE+LAE ++
Sbjct  7    LAKKVLHDPKIEYDFFARAFIYVSQQFERTEVFLNILGSIGQLTEEAKNMPEEKLAEHVR  66

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + L    Y IV+DD+W+ EDWD L+ AFPNN+K SR+L+TTR   VA + +    P+
Sbjct  67   EQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLITTRNTSVAIYANPAVEPY  123



>gb|ABF00976.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=825

 Score =   111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 99/329 (30%), Positives = 163/329 (50%), Gaps = 30/329 (9%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++++G++D +E+L  ELR    +    K+   +   +E  
Sbjct  2    VDAITEFVVGKIGNYLIEEASMLIGVKDDLEELKTELR---CIHGYLKDVEAREREDEAS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  YN V+D    ++ 
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYNIVDD----IKI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+ + 
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKILL  174

Query  452  YRLTEKLD-DttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFM  276
             +L    D +  +I+I G  G+GKT L + ++N  +++  F  R W YVS       I M
Sbjct  175  EKLLYYEDKNRFIISIFGMGGLGKTALARKLYNSGDVKERFKYRAWTYVSQEYKTGDILM  234

Query  275  DIISN----FTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPN  108
             II +    F +E+   +   EE+L   +   L   KY +VVDD+W  E W+ L+ A P 
Sbjct  235  RIIRSLRMTFGEESEKIRKFAEEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPC  294

Query  107  NQKGSRILVTTRVLEVANHVDSKNAPHKF  21
            N +GSR+++TTR+  VA  VD +   HK 
Sbjct  295  NHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>gb|AAU88170.1| disease resistance-like protein [Coffea wightiana]
 gb|AAU88173.1| disease resistance-like protein [Coffea wightiana]
 gb|AAU88176.1| disease resistance-like protein [Coffea wightiana]
Length=169

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 77/117 (66%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K + +D ++ ++FF R +IYVS    R ++F++I+ +  + T   K+M EE+LAE ++
Sbjct  7    LAKKVLHDPKIEYDFFARAFIYVSQQFERTEVFLNILGSIGQLTEEAKNMPEEKLAEHVR  66

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + L    Y IV+DD+W+ EDWD L+ AFPNN+K SR+L+TTR   VA + +    P+
Sbjct  67   EQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLITTRNTSVAIYANPAVEPY  123



>gb|AAS93945.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=842

 Score =   111 bits (278),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 99/329 (30%), Positives = 162/329 (49%), Gaps = 30/329 (9%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++++G++D +E+L  ELR    +    K+   +   +E  
Sbjct  2    VDAITEFVVGKIGNYLIEEASMLIGVKDDLEELKTELR---CIHGYLKDVEAREREDEAS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  YN V+D    ++ 
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYNIVDD----IKI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+ + 
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKILL  174

Query  452  YRLTEKLD-DttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFM  276
             +L    D    +I+I G  G+GKT L + ++N  +++  F  R W YVS       I M
Sbjct  175  EKLLYYEDKSRFIISIFGMGGLGKTALARKLYNSGDVKERFKYRAWTYVSQEYKTGDILM  234

Query  275  DIISN----FTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPN  108
             II +    F +E+   +   EE+L   +   L   KY +VVDD+W  E W+ L+ A P 
Sbjct  235  RIIRSLRMTFGEESEKIRKFAEEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPC  294

Query  107  NQKGSRILVTTRVLEVANHVDSKNAPHKF  21
            N +GSR+++TTR+  VA  VD +   HK 
Sbjct  295  NHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>gb|ABU51856.1| putative NBS domain resistance protein [Coffea spp. mixed genomic 
library]
Length=164

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 77/117 (66%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K + +D ++ ++FF R +IYVS    R ++F++I+ +  + T   K+M EE+LAE ++
Sbjct  6    LAKKVLHDPKIEYDFFARAFIYVSQQFERTEVFLNILGSIGQLTEEAKNMPEEKLAEHVR  65

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + L    Y IV+DD+W+ EDWD L+ AFPNN+K SR+L+TTR   VA + +    P+
Sbjct  66   EQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLITTRNTSVAIYANPAVEPY  122



>gb|KHN15577.1| Disease resistance protein RPP13 [Glycine soja]
Length=894

 Score =   111 bits (278),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 93/327 (28%), Positives = 169/327 (52%), Gaps = 24/327 (7%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVVQ  756
            D VV  ++  + + +E+   L  G+ED++  L  EL+      ++++  ++  V++EVV 
Sbjct  3    DGVVAFLLQNLSRLLEDELKLFSGVEDKISSLCNELKFIDIFLKSSEGKSNDKVVKEVVS  62

Query  755  KIQKVVIDAEDAIDKYLVEERNHRGRGVLMK---WPEKVSYYNKVNDAAKEMESIKKRAE  585
            +I+ V   AED +D Y+     HR R  L K   + E+    +KV+    E+E IK   +
Sbjct  63   QIRDVAYKAEDVVDTYIANITKHRTRNTLSKLFHFKERFMVLHKVD---AEIEKIKICID  119

Query  584  KI-----RLDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDtt  420
            +I     R  +   +  S           +  V E+++VG   D+  +  +LT + D   
Sbjct  120  EIYKNKERYGIRESEYKSEEEEAETLRKRRRDVEEEDVVGLVHDSSVVIKQLTMESDSCR  179

Query  419  viaivggagig-ktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISN------  261
             +  + G G   KTTL + I+N+ ++   F  R W YVS     +++ + ++        
Sbjct  180  KVVSIIGMGGLGKTTLARKIYNNNQVSELFTCRAWGYVSNDYRARELLLSLLKCLLSTDE  239

Query  260  ----FTKET-SGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKG  96
                F K    G +D+ EE+L +++ ++L   KY +V+DD+W T+ WD ++ AFP++Q+G
Sbjct  240  YNDLFKKRMDGGGEDISEEELKKKVAEWLKGKKYLVVLDDIWETQVWDEVKGAFPDDQRG  299

Query  95   SRILVTTRVLEVANHVDSKNAPHKFPI  15
            SRIL+T+R  EVA ++ +K +P+  P 
Sbjct  300  SRILITSRDKEVAYYIGTK-SPYYLPF  325



>gb|ABU51855.1| putative NBS domain resistance protein [Coffea spp. mixed genomic 
library]
Length=164

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 77/117 (66%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K + +D ++ ++FF R +IYVS    R ++F++I+ +  + T   K+M EE+LAE ++
Sbjct  6    LAKKVLHDPKIEYDFFARAFIYVSQQFERTEVFLNILGSIGQLTEEAKNMPEEKLAEHVR  65

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + L    Y IV+DD+W+ EDWD L+ AFPNN+K SR+L+TTR   VA + +    P+
Sbjct  66   EQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLITTRNTSVAIYANPAVEPY  122



>gb|ABF00984.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=843

 Score =   111 bits (278),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 97/333 (29%), Positives = 152/333 (46%), Gaps = 38/333 (11%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++++G++D +E+L  ELR    +    K+   +   +E  
Sbjct  2    VDAITEFVVGKIGNYLIEEASMLIGVKDDLEELKTELR---CIHGYLKDVEAREREDEAS  58

Query  758  QKIQKVVID----AEDAIDKY---LVEERNHRG-RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y   L E    RG R +  K   K+  YN V+D    ++ 
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLDERSQRRGLRRLTNKIGRKMDAYNIVDD----IKI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGTTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N  +++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSGDVKERFKYRAWTYVSQEYKTG  230

Query  287  QIFMDIISN----FTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRT  120
             I M II +    F +E    +   EE+L   +   L   KY +VVDD+W  E W+ L+ 
Sbjct  231  DILMRIIRSLGMTFGEELEKIRKFAEEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKR  290

Query  119  AFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
            A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  291  ALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>ref|XP_006585845.1| PREDICTED: putative disease resistance RPP13-like protein 3-like 
isoform X1 [Glycine max]
Length=894

 Score =   110 bits (276),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 92/327 (28%), Positives = 169/327 (52%), Gaps = 24/327 (7%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVVQ  756
            D VV  ++  + + +E+   L  G+ED++  L  EL+      ++++  ++  V++EVV 
Sbjct  3    DGVVAFLLQNLSRLLEDELKLFSGVEDKISSLCNELKFIDIFLKSSEGKSNDKVVKEVVS  62

Query  755  KIQKVVIDAEDAIDKYLVEERNHRGR---GVLMKWPEKVSYYNKVNDAAKEMESIKKRAE  585
            +I+ V   AED +D Y+     HR R    +L  + E+    +KV+    E+E IK   +
Sbjct  63   QIRDVAYKAEDVVDTYIANITKHRTRNTLSMLFHFKERFMVLHKVD---AEIEKIKICID  119

Query  584  KI-----RLDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDtt  420
            +I     R  +   +  S           +  V E+++VG   D+  +  +LT + D   
Sbjct  120  EIYKNKERYGIRESEYKSEEEEAETLRKRRRDVEEEDVVGLVHDSSVVIKQLTMESDSCR  179

Query  419  viaivggagig-ktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISN------  261
             +  + G G   KTTL + I+N+ ++   F  R W YVS     +++ + ++        
Sbjct  180  KVVSIIGMGGLGKTTLARKIYNNNQVSELFTCRAWGYVSNDYRARELLLSLLKCLLSTDE  239

Query  260  ----FTKET-SGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKG  96
                F K    G +D+ EE+L +++ ++L   KY +V+DD+W T+ WD ++ AFP++Q+G
Sbjct  240  YNDLFKKRMDGGGEDISEEELKKKVAEWLKGKKYLVVLDDIWETQVWDEVKGAFPDDQRG  299

Query  95   SRILVTTRVLEVANHVDSKNAPHKFPI  15
            SRIL+T+R  EVA ++ +K +P+  P 
Sbjct  300  SRILITSRDKEVAYYIGTK-SPYYLPF  325



>ref|XP_007131449.1| hypothetical protein PHAVU_011G014300g [Phaseolus vulgaris]
 gb|ESW03443.1| hypothetical protein PHAVU_011G014300g [Phaseolus vulgaris]
Length=947

 Score =   110 bits (276),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 94/329 (29%), Positives = 169/329 (51%), Gaps = 29/329 (9%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVVQ  756
            D+VV  V+  + + V     L+ G++D+V+ L  EL+    L   +K    K +   VV 
Sbjct  36   DSVVSFVLDHLSELVAREANLLYGVKDRVQSLQNELQMINELLNTSKR--KKGISNTVVN  93

Query  755  KIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKIR  576
            +I+ V   AED ID ++ +   ++ R +L +          ++D A +++ +K    +IR
Sbjct  94   QIRDVAHLAEDVIDTFVAKVAIYKRRTMLGRMLHGFGQVRLLHDVADKVDKMKTTLNEIR  153

Query  575  LDLELLQGGSLNNPQLPAA------------DLQAHVAEDELVGFDEDAQTIKYRLTEKL  432
             + +        N Q  A              L+  V E+ +VGF +D++ I  R+ E  
Sbjct  154  DNKDKYDAFKEINNQSAAEEEEEKERAQSLHKLRRDVEEENVVGFVDDSKDIIKRILEGG  213

Query  431  DDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDI----IS  264
             +  V++I+G  G+GKTTL + ++N  E++  F  R W+YVS     +++ + +    + 
Sbjct  214  SNRKVVSIIGMGGLGKTTLARKVYNSSEVQQHFECRAWVYVSNECRVRELLLGLLKHLMP  273

Query  263  NFTKETSGYK----------DMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAF  114
            NF ++  G K           + EE+L + +++ L    Y +VVDDLW+ +DWD ++  F
Sbjct  274  NFEQQCRGKKKGKKSTQDNSSLSEEELKKLVRNSLESRTYLVVVDDLWKRQDWDEVQDVF  333

Query  113  PNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            P+N +GSR+L+T+R+ EVA H  S + P+
Sbjct  334  PDNNRGSRVLITSRLKEVALHT-SHDLPY  361



>emb|CDX75047.1| BnaA05g07930D [Brassica napus]
Length=692

 Score =   110 bits (274),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 88/318 (28%), Positives = 157/318 (49%), Gaps = 16/318 (5%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAA-KNCNDKAVLEEVV  759
            D VV   + K+   +      + G+ ++V+DL C++R   +L E A     +  V+   +
Sbjct  3    DGVVSFGVEKLWDLLSRESERLQGVHEKVDDLKCQMRMLQSLLEDADAKRYESKVVRSFL  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            + ++ +V DAED I+ +L++E +   +G+         +     D + E+E I KR  K+
Sbjct  63   EDVKDIVFDAEDIIESFLLKESSGDEKGIKRHLKRLSCFLVDRRDISMEIEGITKRMSKV  122

Query  578  RLDLELL-------QGGSLNNPQLPAADLQAH--VAEDELVGFDEDAQTIKYRLTEKLDD  426
             + +++        +  SL   Q P  + Q +   ++ +LVG ++    +   L E  D 
Sbjct  123  VVQMQVFGIQQIIYRSLSLQERQRPRENPQTYPKTSQKDLVGVEQSVNELVGHLVEN-DS  181

Query  425  ttviaivggagigktTLMKMIFNDRELRHEFFTRL-WIYVSMTVNRKQIFMDIISNFTKE  249
              V++I G  GIGKTTL + + +   +R  F     WI VS    +K I+  ++ +    
Sbjct  182  IQVVSISGMGGIGKTTLARQVLHHDIVRSHFVDGFAWICVSQEFKKKDIWQKLLRDLRPH  241

Query  248  TSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRV  69
             +G + M E+ L  +I   L   KY IV+DD+W+TEDWD ++  FP  ++G ++++T+R 
Sbjct  242  DTGIEQMNEDTLQAKIFQLLETSKYLIVMDDVWKTEDWDVIKDVFPQERRGWKMILTSRD  301

Query  68   LEVANHVDSKNAPHKFPI  15
              V  H D    P  FP 
Sbjct  302  EGVGLHAD----PTCFPF  315



>gb|AAU88172.1| disease resistance-like protein [Coffea wightiana]
Length=174

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K + +D ++  +FF R +IYVS    R ++F++I+ +  + T   K+M EE+LAE ++
Sbjct  7    LAKKVLHDPKIELDFFARAFIYVSQQFERTEVFLNILGSIGQLTEEAKNMPEEKLAEHVR  66

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + L    Y IV+DD+W+ EDWD L+ AFPNN+K SR+L+TTR   VA + +    P+
Sbjct  67   EQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLITTRNTSVAIYANPAVEPY  123



>ref|XP_007131451.1| hypothetical protein PHAVU_011G014500g [Phaseolus vulgaris]
 gb|ESW03445.1| hypothetical protein PHAVU_011G014500g [Phaseolus vulgaris]
Length=876

 Score =   110 bits (274),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 92/329 (28%), Positives = 170/329 (52%), Gaps = 29/329 (9%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVVQ  756
            D+VV  V+  + + V     L+ G+ED+++ L  EL+    L   +K+   K +   VV 
Sbjct  3    DSVVTFVLDHLSELVAREANLLYGVEDRIQSLQNELQMINDLLNTSKS--KKGIENTVVN  60

Query  755  KIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKIR  576
            +I+ V   AED ID ++ +   ++ R +L +          ++  A +++ IK    +IR
Sbjct  61   QIRDVAHLAEDVIDTFVAKVAIYKRRTILGRMLRGFGQARLLHHVADKIDKIKTTLNEIR  120

Query  575  LDLELLQGGSLNNPQLPAA------------DLQAHVAEDELVGFDEDAQTIKYRLTEKL  432
             + +       +N Q                +L+ +V E+ +VGF  D++ +  RL    
Sbjct  121  DNKDKYDAFKESNNQSAEEEEKEKERVQSLHELRRNVEEEGVVGFVHDSKVVIKRLLGGG  180

Query  431  DDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDI----IS  264
                V++I+G  G+GKTTL + ++N+ ++   F  R W+YVS     +++ + +    + 
Sbjct  181  SKRNVVSIIGMGGLGKTTLARKVYNNSQVEQHFTCRAWVYVSNECRVRELLLGLLKHLMP  240

Query  263  NFTKE----------TSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAF  114
            NF ++          T    ++ EE+L + +++ L   +Y +VVDDLW+ +DWD ++ AF
Sbjct  241  NFEQQCKDKKKGKKSTRASSNLSEEELKKLVRNKLESRRYLVVVDDLWKRQDWDEVQDAF  300

Query  113  PNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            P+N +GSRIL+T+R+ EVA H  S + P+
Sbjct  301  PDNNRGSRILITSRLKEVALHT-SHDLPY  328



>ref|NP_190255.1| putative disease resistance RPP13-like protein 2 [Arabidopsis 
thaliana]
 sp|Q9STE5.1|R13L2_ARATH RecName: Full=Putative disease resistance RPP13-like protein 
2 [Arabidopsis thaliana]
 emb|CAB51194.1| putative protein [Arabidopsis thaliana]
 gb|AEE78196.1| putative disease resistance RPP13-like protein 2 [Arabidopsis 
thaliana]
Length=847

 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 87/319 (27%), Positives = 164/319 (51%), Gaps = 18/319 (6%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCN-DKAVLEEV  762
            +DA+   V+GK+   + E   +++G++D +E+L  EL       +  + C+ +  V +E 
Sbjct  2    VDAITEFVVGKIDNYLIEEAPMLIGVKDDLEELKTELTCIQVYLKNVEVCDKEDEVSKEW  61

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEK  582
             + +  +  D ED +D Y ++      R  LM+    +S      +   +++++K+R   
Sbjct  62   TKLVLDIAYDVEDVLDTYFLKLEKRLHRLGLMRLTNIISDKKDAYNILDDIKTLKRRTLD  121

Query  581  IRLDLELLQGGSLNNPQLPAADLQAHVA--------EDELVGFDEDAQTIKYRLTEKLDD  426
            +   LE+   G+ N  ++ A+  +            E+ +VG  +DA+ +   LT+ LDD
Sbjct  122  VTRKLEMYGIGNFNEHRVVASTSRVREVRRARSDDQEERVVGLTDDAKVL---LTKLLDD  178

Query  425  -----ttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISN  261
                   +I+I G  G+GKT+L + +FN  +++  F  R+W  VS   N + I M IIS+
Sbjct  179  DGDNKIYMISIFGMEGLGKTSLARKLFNSSDVKESFEYRVWTNVSGECNTRDILMRIISS  238

Query  260  FTKETSG-YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRIL  84
              + + G  + M +++L   + D L E +Y +VVDD+W +E  + L+ A P + +GSR++
Sbjct  239  LEETSEGELEKMAQQELEVYLHDILQEKRYLVVVDDIWESEALESLKRALPCSYQGSRVI  298

Query  83   VTTRVLEVANHVDSKNAPH  27
            +TT +  VA   D +   H
Sbjct  299  ITTSIRVVAEGRDKRVYTH  317



>gb|AAU88162.1| disease resistance-like protein [Coffea benghalensis]
Length=169

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K + +D ++  +FF R +IYVS    R ++F++I+ +  + T   K+M EE+LAE ++
Sbjct  7    LAKKVLHDPKIELDFFARAFIYVSQQFERTEVFLNILGSIGQLTEEAKNMPEEKLAEHVR  66

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + L    Y IV+DD+W+ EDWD L+ AFPNN+K SR+L+TTR   VA + +    P+
Sbjct  67   EQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLITTRNTSVAIYANPAVEPY  123



>ref|XP_007009116.1| Disease resistance protein RPP8 [Theobroma cacao]
 gb|EOY17926.1| Disease resistance protein RPP8 [Theobroma cacao]
Length=923

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 91/315 (29%), Positives = 163/315 (52%), Gaps = 19/315 (6%)
 Frame = -2

Query  932  AVVGLVIGKVVQSVEENETLILGIEDQVEDLLCEL---RSFWALSEAAKNCNDKAVLEEV  762
            ++V L I ++   +      +  ++++VE L  EL   +SF  L +  +       L   
Sbjct  4    SIVSLTIERIADLLIHEALFLNDVKEEVESLKGELERMKSF--LKDVDRKQEQDERLRTR  61

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEK  582
            V++I+ +  DAED ID Y+++  N  G   ++K    +S  +K+ +   E+ +I  + E 
Sbjct  62   VREIRDLAYDAEDVIDSYILKVANRGGFCTIIKRFTTLSSTHKIGN---EVNTILTKLEN  118

Query  581  IRLDLELLQGGSLNNPQLPAADLQ-------AHVAEDELVGFDEDAQTIKYRLTEKLDDt  423
            I   L +            AA++Q        H+ ED++V  +   + +  +L +K D  
Sbjct  119  ISKTLLVFGISREGEGSNSAAEMQHRLRRSYPHIEEDDVVSLEVSTRDVMDQLMKKEDRL  178

Query  422  tviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIF----MDIISNFT  255
             V++IVG  GIGKTTL K ++N  +++  F    W+++S     +++     + I+S   
Sbjct  179  HVVSIVGIGGIGKTTLAKKVYNHNDVKKHFDCCAWVFISQQCKPREVLHGVLIKILSPSI  238

Query  254  KETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTT  75
            K+      +KE++L E++ D L + +Y +V DD+WR EDWD L+ AFP   +GS++L TT
Sbjct  239  KDRELIDKLKEDELVEKLYDVLKDKRYLVVFDDIWRYEDWDSLKPAFPKGNEGSKLLFTT  298

Query  74   RVLEVANHVDSKNAP  30
            R  EVA   D +++P
Sbjct  299  RNKEVAMLADPRSSP  313



>gb|KDO61209.1| hypothetical protein CISIN_1g002750mg [Citrus sinensis]
Length=885

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 93/346 (27%), Positives = 177/346 (51%), Gaps = 44/346 (13%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDL---LCELRSFWALSEAAKNCNDKAVLE  768
            +DA+V  V+ K+   + +    +  + ++VE L   L  ++ F  + +A +  +D  ++ 
Sbjct  2    VDAIVSFVVQKLGDYLIQEAIFLKEVRNEVESLKNTLGWMQCF--VKDAEEKQDDNPLIR  59

Query  767  EVVQKIQKVVIDAEDAIDKYLVEERNHR-------------------GRGVLMKWPEKVS  645
            + V +I+++  DAED +DK+L++                        G G+  K  EKV 
Sbjct  60   KWVSEIREIAYDAEDVLDKFLLQVHKGGSSGISGKGSKSKFFASIKAGCGLFHKGKEKVK  119

Query  644  YYNKVNDAAKEMESIKKRAEKIRLDLEL--LQGGSLNNPQLPAADLQAH-----------  504
             Y+      +E+ +++KR +    + EL  LQ  + N  +  A + +AH           
Sbjct  120  LYS----IGEEIAALRKRLDDSARNRELFCLQDINYNKREAAAENSKAHQKLKQLRRSAS  175

Query  503  --VAEDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFF  330
                E+ +VGF++DA  +   L ++    +VI+I G  G+GKTTL + +++  +++H+F 
Sbjct  176  FYAVEENVVGFEDDANKLLAHLLKEDPRRSVISIFGMGGLGKTTLARKLYHHNDVKHKFA  235

Query  329  TRLWIYVSMTVNRKQIFMDIISNFTKET-SGYKDMKEEQLAERIQDFLMEGKYFIVVDDL  153
               W+ VS     + + M II++F  ++ S  + M+EE L   +   L    Y +V+DD+
Sbjct  236  CCAWVSVSQEYRTEDLLMRIINSFNIDSPSNLEKMREEDLERCLYQSLQGYSYLVVIDDV  295

Query  152  WRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKFPI  15
            W+ E W+ L+ AFP+++ GSR+++TTR+ EVA   D +   ++ P 
Sbjct  296  WQKETWESLKRAFPDSKNGSRVILTTRIREVAERSDERTHAYELPF  341



>ref|XP_006470643.1| PREDICTED: disease resistance protein RPP13-like [Citrus sinensis]
Length=927

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 93/346 (27%), Positives = 177/346 (51%), Gaps = 44/346 (13%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDL---LCELRSFWALSEAAKNCNDKAVLE  768
            +DA+V  V+ K+   + +    +  + ++VE L   L  ++ F  + +A +  +D  ++ 
Sbjct  44   VDAIVSFVVQKLGDYLIQEAIFLKEVRNEVESLKNTLGWMQCF--VKDAEEKQDDNPLIR  101

Query  767  EVVQKIQKVVIDAEDAIDKYLVEERNHR-------------------GRGVLMKWPEKVS  645
            + V +I+++  DAED +DK+L++                        G G+  K  EKV 
Sbjct  102  KWVSEIREIAYDAEDVLDKFLLQVHKGGSSGISGKGSKSKFFASIKAGCGLFHKGKEKVK  161

Query  644  YYNKVNDAAKEMESIKKRAEKIRLDLEL--LQGGSLNNPQLPAADLQAH-----------  504
             Y+      +E+ +++KR +    + EL  LQ  + N  +  A + +AH           
Sbjct  162  LYS----IGEEIAALRKRLDDSARNRELFCLQDINYNKREAAAENSKAHQKLKQLRRSAS  217

Query  503  --VAEDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFF  330
                E+ +VGF++DA  +   L ++    +VI+I G  G+GKTTL + +++  +++H+F 
Sbjct  218  FYAVEENVVGFEDDANKLLAHLLKEDPRRSVISIFGMGGLGKTTLARKLYHHNDVKHKFA  277

Query  329  TRLWIYVSMTVNRKQIFMDIISNFTKET-SGYKDMKEEQLAERIQDFLMEGKYFIVVDDL  153
               W+ VS     + + M II++F  ++ S  + M+EE L   +   L    Y +V+DD+
Sbjct  278  CCAWVSVSQEYRTEDLLMRIINSFNIDSPSNLEKMREEDLERCLYQSLQGYSYLVVIDDV  337

Query  152  WRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKFPI  15
            W+ E W+ L+ AFP+++ GSR+++TTR+ EVA   D +   ++ P 
Sbjct  338  WQKETWESLKRAFPDSKNGSRVILTTRIREVAERSDERTHAYELPF  383



>ref|XP_009622842.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009622843.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=880

 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 89/311 (29%), Positives = 156/311 (50%), Gaps = 12/311 (4%)
 Frame = -2

Query  932  AVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKN-CNDKAVLEEVVQ  756
            AV+  ++  + Q ++ N +LI      ++ L   L       E   N  ND+  L+ + +
Sbjct  4    AVITSILTTIEQVLQFNPSLISESRGSIDSLYGTLSFLQDFLENTGNWINDQEALKILEK  63

Query  755  KIQKVVIDAEDAIDKYL----VEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRA  588
             I+     AED ID  L    V + +H       K       Y+++ +  + M+SI++  
Sbjct  64   NIRDAGYKAEDTIDGCLRRIHVADTDHNQNNARHK------LYDELQEILEAMDSIQRDV  117

Query  587  EKIRLDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttviai  408
             K +   + ++         P +  +    E+ LVG ++    I+ +L  +     V++I
Sbjct  118  MKFKNVHKRIKDVPATTYLPPRSSGRVLDEENTLVGMEDVFNNIRDQLFGQTPALNVVSI  177

Query  407  vggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSG-YKD  231
            VG  GIGK+TL + +FN   + H F    W+ VS   + K++ +D++S  T      Y+D
Sbjct  178  VGMGGIGKSTLARSLFNHPSVYHRFDISSWVTVSQACDAKEMLLDVLSFGTPGGKAMYRD  237

Query  230  MKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANH  51
            M E++L +++   L   +Y IV+DD+W  E WD +R +FP+++ GSRI++TTR+LEVAN 
Sbjct  238  MSEDELLDQVHRKLKRKRYLIVLDDMWTIEAWDQVRRSFPDDENGSRIMITTRLLEVANC  297

Query  50   VDSKNAPHKFP  18
              +   PH  P
Sbjct  298  AGNDFPPHHMP  308



>gb|ABF00983.1| truncated disease resistance protein RPP13 variant [Arabidopsis 
thaliana]
 gb|ACN56760.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
 gb|ACN56777.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=586

 Score =   108 bits (269),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 97/334 (29%), Positives = 155/334 (46%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++++G++D +E+L  ELR    +    K+   +   +E  
Sbjct  2    VDAITEFVVGKIGNYLIEEASMLIGVKDDLEELKTELR---CIHGYLKDVEAREREDEAS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  Y+ V+D    +  
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSIVDD----IRI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D      +  +  G   L K      ++N R+++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRLIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   +E+L   +   L   KY +VVDD+W  E W+ L+
Sbjct  231  DILMRIIRSLGM-TSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  290  RALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>ref|XP_010514978.1| PREDICTED: disease resistance protein RPP13-like isoform X2 [Camelina 
sativa]
Length=824

 Score =   108 bits (271),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 99/331 (30%), Positives = 166/331 (50%), Gaps = 33/331 (10%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+ G V+GK+   + E  ++++G++D +EDL  EL          K+   +   +EV 
Sbjct  2    VDAITGFVVGKIGNYLIEEASMLMGVKDDLEDLKTELTCIQGF---LKDVEAREQEDEVS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRGRGV---LMKWPEKVSYYNKVNDAAKEME  606
            ++  K+V+D     ED +D Y +  EER+ R RG+     K   K+  YN V+D    + 
Sbjct  59   KEWTKLVLDFAYDVEDVLDTYFLKLEERSQR-RGLKRLTNKIGRKIDAYNIVDD----IR  113

Query  605  SIKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTI  456
             +K+R   +    E    G+ +  +   ++L   V           E+ +VG ++DA+ +
Sbjct  114  ILKRRILDVTRKRETYGIGNFSERRGGESNLSLRVRELRRARSIDQEELVVGLEDDAKIL  173

Query  455  KYRLT-EKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIF  279
              +L  E+  +  +I+I G  G+GKT L + ++N  E++  F  R W YVS       I 
Sbjct  174  LAKLLDEREYNRFIISIFGMGGLGKTALARKLYNSEEVKRRFKYRAWTYVSQEYKTGDIL  233

Query  278  MDIISNF----TKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFP  111
            M II +      KE    +   EE+L   +   L   KY +VVDD+W  E W+ L+ A P
Sbjct  234  MRIIRSLGVASAKELEKIRKFTEEELEVYLHGILEGKKYLVVVDDIWEREAWESLKRALP  293

Query  110  -NNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             N+++GS +++TTR+  VA  VD +   HK 
Sbjct  294  CNHEEGSIVIITTRIRAVAEGVDGRFYAHKL  324



>ref|XP_010514976.1| PREDICTED: disease resistance protein RPP13-like isoform X1 [Camelina 
sativa]
Length=854

 Score =   108 bits (271),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 99/331 (30%), Positives = 166/331 (50%), Gaps = 33/331 (10%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+ G V+GK+   + E  ++++G++D +EDL  EL          K+   +   +EV 
Sbjct  2    VDAITGFVVGKIGNYLIEEASMLMGVKDDLEDLKTELTCIQGF---LKDVEAREQEDEVS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRGRGV---LMKWPEKVSYYNKVNDAAKEME  606
            ++  K+V+D     ED +D Y +  EER+ R RG+     K   K+  YN V+D    + 
Sbjct  59   KEWTKLVLDFAYDVEDVLDTYFLKLEERSQR-RGLKRLTNKIGRKIDAYNIVDD----IR  113

Query  605  SIKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTI  456
             +K+R   +    E    G+ +  +   ++L   V           E+ +VG ++DA+ +
Sbjct  114  ILKRRILDVTRKRETYGIGNFSERRGGESNLSLRVRELRRARSIDQEELVVGLEDDAKIL  173

Query  455  KYRLT-EKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIF  279
              +L  E+  +  +I+I G  G+GKT L + ++N  E++  F  R W YVS       I 
Sbjct  174  LAKLLDEREYNRFIISIFGMGGLGKTALARKLYNSEEVKRRFKYRAWTYVSQEYKTGDIL  233

Query  278  MDIISNF----TKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFP  111
            M II +      KE    +   EE+L   +   L   KY +VVDD+W  E W+ L+ A P
Sbjct  234  MRIIRSLGVASAKELEKIRKFTEEELEVYLHGILEGKKYLVVVDDIWEREAWESLKRALP  293

Query  110  -NNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             N+++GS +++TTR+  VA  VD +   HK 
Sbjct  294  CNHEEGSIVIITTRIRAVAEGVDGRFYAHKL  324



>gb|KDP30596.1| hypothetical protein JCGZ_16249 [Jatropha curcas]
Length=878

 Score =   108 bits (270),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 98/323 (30%), Positives = 163/323 (50%), Gaps = 30/323 (9%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELR---SFWALSEAAKNCNDKAVLEE  765
            D +VG ++  + + +     L+LG+ED+V  L  EL+   S+    E   N + +A+ EE
Sbjct  3    DVLVGFLLDNLTRLLSHEANLLLGVEDEVRTLKDELKLTHSYLKSFEGKYNHHHQALTEE  62

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAE  585
             + +I  +V +AED ID+Y+  +   +G           S++  V     ++   ++ AE
Sbjct  63   YISQIWDLVHEAEDVIDEYVAFDFRKQG----------YSFWESVKSKYYQLTVRRRVAE  112

Query  584  KI---RLDLELLQGG------SLNNPQLPAADLQAH-------VAEDELVGFDEDAQTIK  453
            KI         L G          NP   +A  +A        + E ++VGFD +A+ I 
Sbjct  113  KITNINTRFNTLYGNRDKFRIQEPNPSEVSACAEASDSRKRLPIEETDVVGFDLEAKMII  172

Query  452  YRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMD  273
             +LT+   +  VI IVG  GIGKTTL   ++ND  +   F  + W+ VS   + +++   
Sbjct  173  EQLTKGKAERDVIPIVGMGGIGKTTLAAKVYNDPIVLSWFDHKAWVVVSKDYSVRELLEA  232

Query  272  IISNFTKETSGYKDMKEEQLAERIQDFLMEGK-YFIVVDDLWRTEDWDYLRTAFPNNQKG  96
            +I +    T   K M +++L   ++ +L   + Y IV+DD+W TE W+ ++  FPNN +G
Sbjct  233  VIKSTMLLTDEMKKMTDKELGLELRGYLRGARRYLIVLDDVWETELWEKIQHCFPNNLRG  292

Query  95   SRILVTTRVLEVANHVDSKNAPH  27
            SRI++TTR  EVA   +  N PH
Sbjct  293  SRIILTTRKKEVALSANPSNDPH  315



>gb|ACN56759.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
 gb|ACN56762.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=841

 Score =   108 bits (270),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 97/334 (29%), Positives = 155/334 (46%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++++G++D +E+L  ELR    +    K+   +   +E  
Sbjct  2    VDAITEFVVGKIGNYLIEEASMLIGVKDDLEELKTELR---CIHGYLKDVEAREREDEAS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  Y+ V+D    +  
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSIVDD----IRI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D      +  +  G   L K      ++N R+++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRLIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   +E+L   +   L   KY +VVDD+W  E W+ L+
Sbjct  231  DILMRIIRSLGM-TSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  290  RALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>emb|CAC82598.1| disease resistance-like protein [Coffea arabica]
Length=168

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K + +D ++ ++FFTR +IYVS    R ++F++I+ +    T   ++M EE+LAE ++
Sbjct  7    LAKKVLHDPKIEYDFFTRAFIYVSQQFERTEVFLNILWSIGHLTKKAQNMPEEKLAEHVR  66

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + L    Y IV+DD+W+ EDWD L+ AFPNN+K SR+L+TTR   VA + +     H
Sbjct  67   EQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLITTRNTSVAIYANPVEPYH  123



>ref|XP_011072177.1| PREDICTED: disease resistance RPP8-like protein 3 [Sesamum indicum]
Length=861

 Score =   108 bits (269),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 89/297 (30%), Positives = 152/297 (51%), Gaps = 29/297 (10%)
 Frame = -2

Query  863  IEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVVQKIQKVVIDAEDAIDKYLVEERNH  687
            ++ +V+ L  +LR F A LS+  K       L E+V++I+ VV +AED ID  + +    
Sbjct  1    MDKKVQKLESDLRLFKAFLSDTTKKRRKDESLRELVRQIRDVVYEAEDIIDALVTQAAES  60

Query  686  RGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI------------RLDLELL---QG  552
            + +          SY+++  D   ++ SI K  EK+            R D   L    G
Sbjct  61   KSK----------SYFSEAFDTPLKLHSIVKDMEKVSDQVKEIYGDKTRFDFSSLIVGDG  110

Query  551  GSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLM  372
            G   +  +    LQ      ++VGF+++A+ +   L E+     VI+I+G  G+GKTTL 
Sbjct  111  GPDESELITQPPLQRR---GKVVGFEDEAKKLVGCLFEETQQLDVISIIGMPGLGKTTLA  167

Query  371  KMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQDF  192
            + IF +  +++EF  R+W+ VS    RK IF+ I+  FT+         +++LAE +  +
Sbjct  168  EKIFTNSVIQYEFPRRIWVSVSQEFTRKDIFLTILREFTRLDEDMYHKSDQELAELVSSY  227

Query  191  LMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
            L + K+F+V+DD+W  +DW+ L+ A P   K  ++L+T+R  EV    +    PH+ 
Sbjct  228  LEKDKFFLVMDDVWTGKDWEKLQIALPKRNKMGKVLITSRHEEVGWSANRDRRPHRL  284



>gb|ABU51859.1| putative NBS domain resistance protein [Coffea spp. mixed genomic 
library]
Length=163

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K + +D ++ ++FFTR +IYVS    R ++F++I+ +    T   ++M EE+LAE ++
Sbjct  6    LAKKVLHDPKIEYDFFTRAFIYVSQQFERTEVFLNILWSIGHLTKKAQNMPEEKLAEHVR  65

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + L    Y IV+DD+W+ EDWD L+ AFPNN+K SR+L+TTR   VA + +     H
Sbjct  66   EQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLITTRNTSVAIYANPVEPYH  122



>gb|ABU51854.1| putative NBS domain resistance protein [Coffea spp. mixed genomic 
library]
Length=164

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 77/117 (66%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K + +D ++ ++FFTR +IYVS    R ++F++I+ +    T   ++M EE+LA+ ++
Sbjct  6    LAKKVLHDPKIEYDFFTRAFIYVSQQFERTEVFLNILWSIGHLTKKAQNMPEEKLAKHVR  65

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + L    Y IV+DD+W+ EDWD L+ AFPNN+K SR+L+TTR   VA + +    P+
Sbjct  66   EQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLITTRNTSVAIYANPAVEPY  122



>ref|XP_007009192.1| Disease resistance protein RPP8 [Theobroma cacao]
 gb|EOY18002.1| Disease resistance protein RPP8 [Theobroma cacao]
Length=920

 Score =   108 bits (269),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 91/317 (29%), Positives = 162/317 (51%), Gaps = 10/317 (3%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCEL-RSFWALSEAAKNCNDKAVLEEVV  759
            +A+V L I ++   + +    +LG+ D+VE L  EL R   +L +A K  +   +   +V
Sbjct  3    EAIVSLAIERISDLLIQEAVFLLGVRDEVEGLKAELERMKSSLKDADKKPDQNELTRTLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            ++I  +  +AED ID ++++  +  G   ++K   K  + +K+    K +++  +   K 
Sbjct  63   RQISDLAYEAEDVIDSFILQVAHRGGFHGIIKRFTKPFHLHKIGVKVKAIQTKLEGLSKA  122

Query  578  RLDLELLQGG----SLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRL-TEKLDDttvi  414
                  + GG    S+   Q        HV E+++V        +  +L TE+     V+
Sbjct  123  LPAYNQISGGEGSSSIFEMQQRLRRTYTHVEEEDVVSLQGITNEVLAQLMTEEDRPHVVV  182

Query  413  aivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNF---TKETS  243
            +IVG  GIGKTTL K ++   ++R  F    W ++S     +++  D++      +KE  
Sbjct  183  SIVGMGGIGKTTLAKKVYKHIDVRQSFDCFAWAFISRQCMPREVLHDLLIKLLTPSKEER  242

Query  242  GYKD-MKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVL  66
               D ++E +L E++ + L E ++ +V DD+WR E W+ L+ AFP  ++GS+IL TTR  
Sbjct  243  KLIDKLQENELMEKVYNLLKEKRFLVVFDDIWRNEHWNILKPAFPRGKRGSKILFTTRHK  302

Query  65   EVANHVDSKNAPHKFPI  15
            EVA H D  N P + P+
Sbjct  303  EVALHADPCNFPIELPL  319



>gb|ABU51858.1| putative NBS domain resistance protein [Coffea spp. mixed genomic 
library]
Length=165

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K + +D ++ ++FF   +IYVS    R ++F++I+ +  + T   K+M EE+LAE ++
Sbjct  6    LAKKVLHDPKIEYDFFAWAFIYVSQQFERTEVFLNILGSIGQLTEEAKNMPEEKLAEHVR  65

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + L    Y IV+DD+W+ EDWD L+ AFPNN+K SR+L+TTR   VA + +    P+
Sbjct  66   EQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLITTRNTSVAIYANPAVEPY  122



>gb|ABU51860.1| putative NBS domain resistance protein [Coffea spp. mixed genomic 
library]
Length=164

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 75/117 (64%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K + +D ++ ++FF R +IYVS    R ++F++I+ +  + T   K+M EE+LAE ++
Sbjct  6    LAKKVLHDPKIEYDFFARAFIYVSQQFERTEVFLNILGSIGQLTEEAKNMPEEKLAEHVR  65

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + L    Y IV+DD+W+ EDWD L+ AFP N+K SR+L+TTR   VA + +     H
Sbjct  66   EQLKTRMYLIVMDDVWKIEDWDKLKVAFPTNKKRSRVLITTRNTSVAIYANPVEPYH  122



>gb|ABU51857.1| putative NBS domain resistance protein [Coffea spp. mixed genomic 
library]
Length=165

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 73/117 (62%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K + +D ++ H+FF R +IYVS    R ++F++I+ +  + T   K+M EE+LAE ++
Sbjct  6    LAKKVLHDPKIEHDFFARAFIYVSQQFERAEVFLNILGSIGQLTEEAKNMPEEKLAEHVR  65

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + L    Y IV+DD+W  E WD L+ A PNN K SR+L+T+R   VA H +    P+
Sbjct  66   EQLKTRMYLIVMDDVWTNEAWDQLKGALPNNNKRSRVLITSRHKPVAVHANQSIDPY  122



>ref|XP_009388233.1| PREDICTED: probable disease resistance protein At1g58602 [Musa 
acuminata subsp. malaccensis]
Length=886

 Score =   107 bits (268),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 89/314 (28%), Positives = 158/314 (50%), Gaps = 11/314 (4%)
 Frame = -2

Query  932  AVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELR---SFWALSEAAKNCNDKAVLEEV  762
            AVV +V+GK+ +      TL+L ++D++E    +LR   SF    +         +++E 
Sbjct  4    AVVDMVLGKLSEYALREVTLLLNVDDEIEVSKRKLRLLLSFLKDVDQTPRDQHSELVQEW  63

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEK  582
            V +I+ +  D ED +DKY +     R +  L      ++     +   K ++ I +  ++
Sbjct  64   VNQIRGLAYDIEDVVDKYTLRVGRSRQKRTLKCIANLLTRILARHQLTKSLQRINRNLQE  123

Query  581  IR-----LDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTE-KLDDtt  420
                   L ++ +   SL   +     L+  VA DE+ GFD D Q I  +L +  +    
Sbjct  124  TSKHASELGIQGIPSASLAPIKDTNLTLRDDVA-DEVFGFDHDIQVITDQLCDLHVTRRA  182

Query  419  viaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSG  240
            VI+IVG  G GKTTL   ++N + ++  F  R WI VS +   +++  +I+       +G
Sbjct  183  VISIVGMGGSGKTTLANKVYNSQAVKDHFQCRAWIVVSQSYTARELLTNIMKQTMNIGNG  242

Query  239  -YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLE  63
              ++M E ++  +I++ L   +Y +V+DD+W+  DW+ ++TAFP     SR+L+TTR ++
Sbjct  243  QTREMDEREMKNKIREHLKGTRYLVVMDDIWKVSDWETIKTAFPEEFTASRVLLTTRKMD  302

Query  62   VANHVDSKNAPHKF  21
            VA   D    PH  
Sbjct  303  VAETADPDRPPHHL  316



>gb|KFK34000.1| hypothetical protein AALP_AA5G088800 [Arabis alpina]
Length=859

 Score =   107 bits (268),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 85/328 (26%), Positives = 155/328 (47%), Gaps = 28/328 (9%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSE--AAKNCNDKAVLEE  765
            +DA+ G V+ K+   + E  ++++GIED++E+L  EL       +   A++  D+A  + 
Sbjct  2    VDAITGFVVEKMGNYLIEEASMLMGIEDELEELKTELTCIQGYLKDVEARDREDEAS-KA  60

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAE  585
              + +  +  D ED +D Y ++      R  L +   K+      ++   E+ ++K+R +
Sbjct  61   WTKLVLDIAYDVEDVLDSYNLKADKRSQRRGLARLTNKIGKMKDSSNIVDEIRTLKRRIK  120

Query  584  KIRLDLELLQGGSLNNP------------QLPAADLQAHVAEDELVGFDEDAQTIKYRLT  441
             +    E    G+ + P            QL  A    H  E+ +VG ++DA+ +   L 
Sbjct  121  DVTRKRETYGIGNFSEPRGGDNPSSLRVKQLRRARSVDH--EEFVVGLEDDAKIL---LA  175

Query  440  EKLDDttviaivggagig----ktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMD  273
            + LDD      +          KT + + ++N  +++  F  R W YVS   N + + M 
Sbjct  176  KLLDDRENKRYMISIFGMGGLGKTAIARKLYNSGDVKRRFDCRAWTYVSQEYNTRDMLMR  235

Query  272  IISNF----TKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNN  105
            II +      +E    ++  EE+L   +   L   +Y +VVDD+W T+ W+ L+ A P +
Sbjct  236  IIRSLGVASAEELEKIRNYAEEELEVHLHGLLEGKRYLVVVDDIWETDAWESLKRALPCD  295

Query  104  QKGSRILVTTRVLEVANHVDSKNAPHKF  21
              GSR+++TTR+  VA  VD +   HK 
Sbjct  296  DGGSRVIITTRIRAVAEGVDERVYAHKL  323



>ref|XP_006596446.1| PREDICTED: disease resistance protein RPP13-like isoform X2 [Glycine 
max]
Length=670

 Score =   107 bits (266),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 91/317 (29%), Positives = 165/317 (52%), Gaps = 16/317 (5%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVVQ  756
            D+VV  V+  + + +E+   L+ G+ED++  L  EL+      + ++      +++EVV 
Sbjct  3    DSVVAFVLDNLSRLLEDEHKLLSGVEDKINSLCNELKFIDIFLKNSEGKRSHEMVKEVVS  62

Query  755  KIQKVVIDAEDAIDKYLVEERNHRGRGVLMKW---PEKVSYYNKVNDAAKEMESIKKRAE  585
            +I+ V   AED +D Y+      + R  L K     E V   ++VN    ++E I+ R +
Sbjct  63   QIRDVAHKAEDVVDTYVSNIAKQKQRSKLSKLFHLKEHVMVLHQVNS---DIEKIRNRID  119

Query  584  KIRLDLELLQGG-----SLNNPQLPAADLQAH--VAEDELVGFDEDAQTIKYRLTEKLDD  426
            +I  + +    G     S        + L+    V E+++VG   D+  +   L E    
Sbjct  120  EIYKNRDRYGIGEGEFRSEEAAAEAESLLKRRREVEEEDVVGLVHDSSHVIQELMESESR  179

Query  425  ttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKET  246
              V++I+G  G+GKTTL + I+N+ +++  F    W+ VS     K+  + ++      T
Sbjct  180  LKVVSIIGMGGLGKTTLARKIYNNNQVQLRFPCLAWVSVSNDYRPKEFLLSLLKCSMSST  239

Query  245  SGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVL  66
            S  +++ E +L +++ ++L   KY +V+DD+W T+ WD ++ AFP++Q GSRIL+T+R  
Sbjct  240  S--EELSEVELKKKVAEWLKGKKYLVVLDDIWETQVWDEVKGAFPDDQTGSRILITSRNK  297

Query  65   EVANHVDSKNAPHKFPI  15
            EVA H     +P+  PI
Sbjct  298  EVA-HYAGTASPYYLPI  313



>gb|AEQ63711.1| NBS-LRR class resistance protein [Sesamum indicum]
Length=157

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 72/117 (62%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L + IFND  ++++F   +WIY+S    +K IF+ I+  FT+         + +LA+ + 
Sbjct  8    LARKIFNDPVIQYKFPVCIWIYISKEFTKKDIFLAILKEFTRIDENVNGKSDHELAQLVA  67

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
              L  GK+ IV+DD+W  EDW+ L+ A PNN K  ++L+T+R +EVA+HV+    PH
Sbjct  68   AHLDRGKFLIVMDDVWTVEDWNTLQIALPNNNKKGKVLITSRHVEVAHHVNRHRFPH  124



>gb|ACU82907.1| nucleotide binding site-leucine rich repeat protein, partial 
[Solanum lycopersicum]
Length=170

 Score =   100 bits (249),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 68/117 (58%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K ++ D  +   F+ R WIYVS   +RK++F+ I+ + +  T     M +E+LA  + 
Sbjct  8    LAKKVYTDSSIEFHFYNRAWIYVSQLYSRKEVFLGILDSLSLITDEMYKMNDEKLAGELF  67

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
              L   +Y +V+DD+W  E WD L+ AFP    GSRIL+TTR  EVA H + +  PH
Sbjct  68   SHLRSKRYLVVIDDVWTMEAWDDLQMAFPKTATGSRILLTTRSTEVALHANPEGLPH  124



>ref|XP_010669409.1| PREDICTED: putative disease resistance RPP13-like protein 3 [Beta 
vulgaris subsp. vulgaris]
Length=866

 Score =   107 bits (266),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 84/283 (30%), Positives = 144/283 (51%), Gaps = 10/283 (4%)
 Frame = -2

Query  866  GIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVVQKIQKVVIDAEDAIDKYLVEERN  690
            G+ DQ+  L  ELR     L  A     +  ++ E+V +I++V  +AED I+ +L+    
Sbjct  26   GVGDQLNSLENELRFMKKFLRNAEGKQREHLMVSELVDQIKEVAFEAEDTIEMFLLNVER  85

Query  689  HRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI-----RLDLELLQGGSLNNPQLP  525
             R R    K      Y    +  A  ++ IK R  +I     +  +E+  G    NP   
Sbjct  86   QRRRSTCSKLLHSGGYMVMHSKTANRIDGIKTRINEIYDNKEKFGIEIGDGSM--NPHFE  143

Query  524  AA-DLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFNDRE  348
                 +    ++E+VGF++ A T+  +LT+  D   +I+IVG  G+GKTT+ K ++N+R 
Sbjct  144  GLLRRRRKEVDEEMVGFEDVANTLLKQLTQG-DALEIISIVGMGGLGKTTVAKRLYNNRI  202

Query  347  LRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQDFLMEGKYFI  168
            ++  F    W+ VS   N  QI + +++       G   +   QL E ++  L + K+ I
Sbjct  203  IKDHFGCHAWVSVSEDYNTHQIILHMLNRVAPNKVGLDKLNTVQLVETLKGRLNDRKFII  262

Query  167  VVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSK  39
             +DD+W+ + WD ++  FPN + GSRI++T+RV +VA H   +
Sbjct  263  FLDDIWQPDMWDEVKACFPNKENGSRIVITSRVAKVAMHASPR  305



>ref|XP_006603607.1| PREDICTED: uncharacterized protein LOC100791776 [Glycine max]
Length=1976

 Score =   107 bits (267),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 87/314 (28%), Positives = 157/314 (50%), Gaps = 9/314 (3%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVVQ  756
            D+VV  V+  +   +E+   L+ G+ED+V  L  EL+      + ++        +EVV 
Sbjct  3    DSVVAFVLDNL-SLLEDEHKLLSGVEDKVNSLCNELKFIHIFLKNSEGKRSHDTGKEVVS  61

Query  755  KIQKVVIDAEDAIDKYLVEERNHRGRGVLMKW---PEKVSYYNKVNDAAK----EMESIK  597
            +I+ V   AE+ +D Y+      + R  L K     E V   ++VN   +    ++E I 
Sbjct  62   QIRDVAHKAENVVDTYVANIAQQKQRSKLSKLFHLKEHVMVLHQVNSEIEKIRSQIEEIY  121

Query  596  KRAEKIRLDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttv  417
            K  ++  +     +              +  V E+++VG   D+  + + L E      V
Sbjct  122  KNGDRYGIGEGEFRSEEAAAEAESLLKRRREVEEEDIVGLVHDSSHVIHELMESESRLKV  181

Query  416  iaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGY  237
            ++I+G  G+GKTTL + I+N+ +++  F    W+ VS     K+  + ++      TS +
Sbjct  182  VSIIGMGGLGKTTLARKIYNNNQVQLRFPCLAWVSVSNDYRPKECLLSLLKCSMSSTSEF  241

Query  236  KDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVA  57
            + + EE L +++ ++L    Y +V+DD+W T+ WD ++ AFP++Q GSRIL+T+R  EVA
Sbjct  242  EKLSEEDLKKKVAEWLKGKSYLVVLDDIWETKVWDEVKGAFPDDQIGSRILITSRNKEVA  301

Query  56   NHVDSKNAPHKFPI  15
             H     +P+  PI
Sbjct  302  -HYAGTASPYDLPI  314


 Score =   105 bits (263),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 91/317 (29%), Positives = 166/317 (52%), Gaps = 14/317 (4%)
 Frame = -2

Query  935   DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVVQ  756
             D+VV  ++  + + +E+   L+ G+ED++  L  EL+      + ++      +++EVV 
Sbjct  1117  DSVVVFLLDNLSRLLEDEHKLLSGVEDKINSLCNELKFIHIFLKNSEGKRSHEMVKEVVS  1176

Query  755   KIQKVVIDAEDAIDKYLVEERNHRGRGVLMKW---PEKVSYYNKVNDAAKEMESIKKRAE  585
             +I+ V + AED +D YL      + R  L K     E V   ++VN    ++E I+ R +
Sbjct  1177  QIRDVTLKAEDVVDTYLSNIAQQKQRSKLSKLFHLKEHVMVLHQVNS---DIEKIRTRID  1233

Query  584   KIRLDLELLQGG-------SLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDD  426
             +I  + +    G              P    +  V E+++VG   D+  +   L E    
Sbjct  1234  EIYKNRDRYGIGEGDFRSEEAAAEAEPLLKRRREVEEEDVVGLVHDSSHVIQELMESESR  1293

Query  425   ttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKET  246
               V++I+G  G+GKTTL + I+N+ +++  F    W+ VS     K+  + ++      T
Sbjct  1294  LKVVSIIGMGGLGKTTLARKIYNNNQVQLWFPCLAWVSVSNDYRPKEFLLSLLKCSMSST  1353

Query  245   SGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVL  66
             S ++++ EE+L +++ ++L   KY +V+DD+W T+ WD ++ AFP++Q GSRIL+T+R  
Sbjct  1354  SEFEELSEEELKKKVAEWLKGKKYLVVLDDIWETQVWDEVKGAFPDDQSGSRILITSRNK  1413

Query  65    EVANHVDSKNAPHKFPI  15
             EVA H     +P+  PI
Sbjct  1414  EVA-HYAGTASPYYLPI  1429



>ref|XP_006300614.1| hypothetical protein CARUB_v10019807mg [Capsella rubella]
 gb|EOA33512.1| hypothetical protein CARUB_v10019807mg [Capsella rubella]
Length=823

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 87/282 (31%), Positives = 160/282 (57%), Gaps = 16/282 (6%)
 Frame = -2

Query  866  GIEDQVEDL---LCELRSFWALSEAAKNCNDKAVLEEVVQKIQKVVIDAEDAIDKYLVEE  696
            G+EDQV++L   L  L+SF   +EA K+ +  A ++  V+ I++++ DAED ++ +++++
Sbjct  26   GVEDQVDELKTDLGRLKSFMQDAEAKKHTS--ARVKNCVEVIKEIIFDAEDILETFILKD  83

Query  695  RNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKIRLDLELLQG-----GSLNNPQ  531
            +  +  G+  +         +  + A E+ S+  R  K+  D+E  QG     G + +P+
Sbjct  84   QLQKSGGIKERMRRLACIIPERREIALEIGSLSNRISKVIRDMET-QGVQQIIGDMRDPE  142

Query  530  -LPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFND  354
             LP     A   +  LVG +E+ + +   L E+ DD  ++ + G  G+GKTTL +  F+ 
Sbjct  143  PLPERKEFARQEKSNLVGLEENVEKLVGYLVEE-DDDPIVLVTGMGGLGKTTLARQAFHH  201

Query  353  RELRHEFFTRLWIYVSMTVNRKQIFMDIISNF-TK-ETSGYKDMKEEQLAERIQDFLMEG  180
             ++R +F   +W+ VS   +RK ++ +I+ +F TK E +    MKEE+L + +   L   
Sbjct  202  DKVREKFDRLVWVCVSQVCDRKNVWQNILQSFRTKAEENEIMQMKEERLQDELSRLLETS  261

Query  179  KYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVAN  54
            K  IV+DD+W+ EDW+ ++  FP ++KG ++L+T+R   VA 
Sbjct  262  KSLIVIDDIWKEEDWNLIKPIFP-HKKGWKVLLTSRNERVAG  302



>ref|XP_007010081.1| Disease resistance protein RPP8 [Theobroma cacao]
 gb|EOY18891.1| Disease resistance protein RPP8 [Theobroma cacao]
Length=918

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 92/323 (28%), Positives = 167/323 (52%), Gaps = 24/323 (7%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCEL---RSFWALSEAAKNCNDKAVLEE  765
            +A+V L I ++   +      +  + ++VE +  EL   +SF    +  +  +++  L  
Sbjct  3    EAIVSLAIERITDLLIYEAFCLNDVREEVESIKAELERMKSFLKDVDHKQEQDER--LRT  60

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMESIKKR  591
             V++I+ +  DAED ID Y++E   HRG   G++ ++    ++  K+    K +++    
Sbjct  61   RVREIRDLAYDAEDVIDSYILEV-AHRGGFHGIIKRFTSLSTH--KIGKQVKAIQTKLGD  117

Query  590  AEKIRLDLELLQGGSLNNPQLPAADLQ-------AHVAEDELVGFDEDAQTIKYRLTEKL  432
              K      + + G  +N    AA++Q        HV E+++V  +   + +   L +K 
Sbjct  118  ISKTLTTYGISREGEGSNS---AAEMQRRLRRSYPHVEEEDVVSLEVSTKDVMDLLMKKA  174

Query  431  DDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIF----MDIIS  264
            D   V+++VG  GIGKTTL K I+N  +++  F    W+++S     +++F    + ++S
Sbjct  175  DRLHVVSVVGMGGIGKTTLAKKIYNHNDVKRHFDCCAWVFISQQCMPREVFHGVLIKVLS  234

Query  263  NFTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRIL  84
               KE      +KE +L E++ D L E +Y +V+DD+WR EDW  L+ AFP   KGS++ 
Sbjct  235  PSRKEKERIDKLKEHELVEKLYDVLKEKRYLVVLDDIWRCEDWVSLKPAFPKGNKGSKLF  294

Query  83   VTTRVLEVANHVDSKNAPHKFPI  15
             TTR  EVA   D  ++P + P+
Sbjct  295  FTTRNKEVALLADPCSSPIELPL  317



>ref|XP_002535012.1| Disease resistance protein RPH8A, putative [Ricinus communis]
 gb|EEF27370.1| Disease resistance protein RPH8A, putative [Ricinus communis]
Length=808

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 92/311 (30%), Positives = 166/311 (53%), Gaps = 12/311 (4%)
 Frame = -2

Query  926  VGLVIGKVVQSVEENETLILGIEDQVEDLLCELR---SFWALSEAAKNCNDKAVLEEVVQ  756
            VG+V+ K+   + +    + G+ ++V+ L  EL+   SF   ++A +  N+  ++   V 
Sbjct  6    VGIVVEKLTNILAQEAGHLDGVSEKVQQLRNELKWMQSFLKDADAKQGSNE--LVRNWVS  63

Query  755  KIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEK--  582
            +I+ V  DAE+ ID Y+ +  +HR R ++ K  +      K+      ++ I  R E   
Sbjct  64   EIRDVAYDAEEVIDAYISKAASHRKRDLITKPIDLYKVGRKIASIRSRIQEISSRRETYG  123

Query  581  -IRLDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttviaiv  405
             + ++ E  +G + N            + ED+++   ED + +  +LT      +V++IV
Sbjct  124  VVSINSEGGEGNAANERLKWWRQPSPLIEEDDVIELVEDTKVLVEKLTSLEYRRSVVSIV  183

Query  404  ggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFT----KETSGY  237
            G  G+GKTTL K ++   ++++ F  + W+YVS    R++I   II +      +E    
Sbjct  184  GMGGLGKTTLAKKLYTHNDVKYHFDCKAWVYVSKDYRRREILQGIIMDANALNKEEMENM  243

Query  236  KDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVA  57
            + +KEE+L + + +FL E +Y +V+DD+W  E WD ++TAFP+ + GS+IL+TTR  EVA
Sbjct  244  EKLKEEELLKILSEFLEERRYLVVLDDIWSMEAWDGVKTAFPHGKNGSKILLTTRNKEVA  303

Query  56   NHVDSKNAPHK  24
             H      PH+
Sbjct  304  LHAGPGCEPHE  314



>ref|XP_009803472.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana sylvestris]
Length=388

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 96/142 (68%), Gaps = 1/142 (1%)
 Frame = -2

Query  494  DELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWI  315
            +E+VGFDE+A+ +  RL E      V+ +VG  G+GKTTL + I+ND ++ +EFF+ +W+
Sbjct  65   NEVVGFDEEAEKVIKRLVEGSGYLDVVPVVGMPGLGKTTLARKIYNDPKIPYEFFSCIWV  124

Query  314  YVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQDFLME-GKYFIVVDDLWRTED  138
            +V  +  ++ IF++I+  FTK    ++D  E ++AE I+  +   GK  +++DD+W T  
Sbjct  125  FVGQSYIKRDIFINILKGFTKRNEEFQDKNETEIAEEIRYHVANGGKCLVILDDVWETGV  184

Query  137  WDYLRTAFPNNQKGSRILVTTR  72
             D++RTAFP N+KG RI++TTR
Sbjct  185  VDFVRTAFPENKKGHRIMMTTR  206



>ref|XP_007009115.1| Disease resistance protein RPP8 [Theobroma cacao]
 gb|EOY17925.1| Disease resistance protein RPP8 [Theobroma cacao]
Length=927

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 92/321 (29%), Positives = 163/321 (51%), Gaps = 20/321 (6%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCEL---RSFWALSEAAKNCNDKAVLEE  765
            +A+V L I ++   +      +  +  +VE L  EL   +SF  L +  +       L  
Sbjct  3    EAIVFLAIERIADLLIHEALFLNDVRQEVESLKAELERMKSF--LKDVDRKQEQDERLRT  60

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAE  585
             V++I+ +  DAED ID Y++E  +  G   ++K    +S     +   K++ +I+ +  
Sbjct  61   RVREIRDLAYDAEDVIDSYILEVAHRGGFHEIIKRFTTLS----THKVGKQVRAIQNKLG  116

Query  584  KIRLDLELLQGGSLNNPQLPAADLQ-------AHVAEDELVGFDEDAQTIKYRLTEKLDD  426
             I   L                ++Q        HV ED++V  +   + +  +L +K D 
Sbjct  117  DISRTLPAYGISGGGGGSNSTDEMQRRLRRSYPHVEEDDVVSLELSTRDVIDQLMKKEDR  176

Query  425  ttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIF----MDIISNF  258
              V++IVG  GIGKTTL K ++N  +++  F    W+++S     +++F    M ++S  
Sbjct  177  LHVVSIVGMGGIGKTTLAKRLYNHNDVKRHFDCCAWVFISQQCLPREVFHGVLMKVLSPS  236

Query  257  TKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVT  78
             KE      +KE++L E++ D L E +Y +V+DD+W  +DWD L+ AFP  Q+GS++L+T
Sbjct  237  RKERKLIDKLKEDELVEKLYDVLKEKRYLVVLDDIWSYKDWDSLKPAFPKGQEGSKLLLT  296

Query  77   TRVLEVANHVDSKNAPHKFPI  15
            TR  +VA  VD  ++P + P+
Sbjct  297  TRKKKVALLVDPCSSPVELPL  317



>gb|ACN56775.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=843

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 97/334 (29%), Positives = 152/334 (46%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++++G++D +E+L  ELR    +    K+   +   +E  
Sbjct  2    VDAITEFVVGKIGNYLIEEASMLIGVKDDLEELKTELR---CIHGYLKDVEAREREDEAS  58

Query  758  QKIQKVVID----AEDAIDKY---LVEERNHRG-RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y   L E    RG R +  K   K+  YN V+D    ++ 
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLDERSQRRGLRRLTNKIGRKMDAYNIVDD----IKI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N  +++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSGDVKRRFEYRAWTYVSQEYKAG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   EE+L   +   L   KY +VVDD+W  E W+ L+
Sbjct  231  DILMRIIKSLGM-TSGEELEKIRMFAEEELEVYLHGLLEGKKYLVVVDDIWEREAWESLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++TTR+  VA  +D +   HK 
Sbjct  290  RALPCNHEGSRVIITTRIKAVAEGLDGRFYAHKL  323



>gb|ABU51853.1| putative NBS domain resistance protein [Coffea spp. mixed genomic 
library]
Length=163

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 75/117 (64%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K + +D ++ ++FF R +IYVS    R ++F++I+ +    T   ++M EE+LAE ++
Sbjct  6    LAKKVLHDPKIEYDFFARAFIYVSQQFERTEVFLNILWSIGHLTKKAQNMPEEKLAEHVR  65

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + L    Y IV+DD+W+ EDWD L+ AFPNN+K SR+L+TTR   VA + +     H
Sbjct  66   EQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLITTRNTSVAIYANPVEPYH  122



>gb|ABF81448.1| NBS-LRR type disease resistance protein [Populus trichocarpa]
Length=676

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 100/329 (30%), Positives = 163/329 (50%), Gaps = 24/329 (7%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDK-AVLEEVV  759
            + VV  ++ K+   + E    + G+E +VE +  EL    A         D   VL+ +V
Sbjct  3    EGVVTFLLTKLADFLVERGKNLAGVECEVEYISDELEFMTAFLRLGDTMEDSDPVLKCLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDA----AKEMESIKKR  591
            +K++    D EDA+D + +   + RG G+   +  K+S   K   A    A +++SIK R
Sbjct  63   KKVRDAAYDTEDALDNFSLSHVSDRGHGIFSCF-RKISRSIKDKRARRRIASKIQSIKSR  121

Query  590  AEKIRLDLE--------LLQGGSLNN-PQLPAADLQAHVAEDELVGFDEDA-QTIKYRLT  441
               I             ++QG S N+ P+L        + E +LVG ++   Q I++ L 
Sbjct  122  VISISESHRRYCNKNNIMIQGSSSNSIPRLECQRDALLIEEADLVGIEKPKKQLIEWLLG  181

Query  440  EKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISN  261
             K     VI++VG  G+GK+TL+K +++D  ++  F  R W+ VS +  R+ +  D+I  
Sbjct  182  SK-TGREVISVVGMGGLGKSTLVKRVYDDSNVKKHFKFRAWVTVSQSFKREDLLKDMIQQ  240

Query  260  FTK-----ETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKG  96
              +     +  G   M   +L   I +FL + KY IV+DD+W    W   + A PNN  G
Sbjct  241  LFRVHRKPDPKGVNSMDYNKLRSVIHEFLQQKKYLIVLDDVWHPSAWHAFQHALPNNICG  300

Query  95   SRILVTTRVLEVANHVDSKNAPHK-FPIS  12
            SRILVTTR  EVA+     ++P K +P++
Sbjct  301  SRILVTTRNTEVAS-TSCMDSPDKVYPLN  328



>gb|EYU40383.1| hypothetical protein MIMGU_mgv1a001106mg [Erythranthe guttata]
Length=888

 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 91/310 (29%), Positives = 161/310 (52%), Gaps = 7/310 (2%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKA-VLEEVV  759
            +A +  ++  + + + ++  LI G E +++ L  EL    A    + N  +K  +  +  
Sbjct  3    EAAITFLLENLQKLLSDHVHLISGAEGELKQLQNELDLMKAFLVQSANRREKGELFRQFE  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKW--PEKVSYYNKVNDAAK-EMESIKKRA  588
             +I+ VV +AED +D  LVE      R  L +   P+  S   KV    + E++ I +RA
Sbjct  63   TQIRDVVHEAEDTLDTCLVEAAAGMKRNFLSRNLNPKGASLAKKVKTLRETEVKPIFERA  122

Query  587  EKIRLDLELLQGGSLNNPQLPA-ADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttvia  411
            +    +L++    +  +      A     + ED +VGF+ +A T+   L E+ ++  VI+
Sbjct  123  KINFANLQIADPSATGDEDTKGKAKKIPLLREDNIVGFEGEADTLISYLNEESEELEVIS  182

Query  410  ivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKD  231
            I+G  G+GKTTL   I+ D  ++ EF T +W+YVS   NR+ +F+ I+  FT+     K 
Sbjct  183  IIGMPGLGKTTLAWKIYKDSRVQFEFPTMIWVYVSQEFNRRDVFLTILKKFTQVDMSSKT  242

Query  230  MKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANH  51
              + +LA  ++ +L + K+ + +DD+W TEDW  +  A P   K  ++L+T+R   VA H
Sbjct  243  --DNELACLVRSYLEKSKFILFMDDVWTTEDWKNIEAALPKGNKLGKVLITSRHERVAVH  300

Query  50   VDSKNAPHKF  21
             + K  PH+ 
Sbjct  301  ANRKREPHQL  310



>ref|XP_009626721.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
 ref|XP_009626722.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=903

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 139/265 (52%), Gaps = 21/265 (8%)
 Frame = -2

Query  752  IQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKR------  591
            I+ +V + ED ID++LV+ +  + + +           ++V D + +++SI  R      
Sbjct  67   IRSIVYETEDEIDEFLVQAKLQQEKNLFGIKCLDFDRGDRVQDLSSKIDSILDRINRSIH  126

Query  590  ------AEKIRL--------DLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIK  453
                  A+++ +        D+   + G+   PQ    +    V  +E+VG DE+A  + 
Sbjct  127  SKNHPDAKRVLIEDMRREARDVLPRKDGASVEPQDVWLENNEVVRNNEVVGLDEEANKVI  186

Query  452  YRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMD  273
             RL E  ++  VI IVG  G+GKTTL   ++ND  + +EFF+ +WIYV  + N K IF+ 
Sbjct  187  KRLVEGTNELDVIPIVGMFGLGKTTLASKVYNDSRISYEFFSVIWIYVGQSYNMKDIFLI  246

Query  272  IISNFTKETSGYKDMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPNNQKG  96
            ++  FTK    Y+D     LA+ I DFL + GK  IV+DD+W ++  + L   FP N KG
Sbjct  247  LLRYFTKRIREYQDEDVNGLAQIIHDFLAKGGKCLIVLDDVWDSQVVNSLVKVFPKNNKG  306

Query  95   SRILVTTRVLEVANHVDSKNAPHKF  21
             RI++TTR   VAN+ +      KF
Sbjct  307  HRIMMTTRDTSVANYGNENPHNMKF  331



>gb|ACN56763.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=841

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 96/334 (29%), Positives = 153/334 (46%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++++G++D +E+L  EL     +    K+   +   +E  
Sbjct  2    VDAITEFVVGKIGNYLIEEASMLIGVKDDLEELKTEL---MCIHGYLKDVEAREREDEAS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  Y+ V+D    +  
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSIVDD----IRI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N R+++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   +E+L   +   L   KY +VVDD+W  E W+ L+
Sbjct  231  DILMRIIRSLGM-TSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  290  RALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>gb|AHB79188.1| CC-NBS-LRR disease resistance protein [Cicer arietinum]
Length=692

 Score =   105 bits (262),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 87/333 (26%), Positives = 174/333 (52%), Gaps = 31/333 (9%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELR--SFWALSEAAKNCNDKAVLEEV  762
            D+VV  ++  + Q ++    L+ G+EDQ+  L  EL+  + +  + +  N N+K + + +
Sbjct  3    DSVVAFLLEHLSQLLQRETNLLCGVEDQITSLRNELQIINIYLKTSSGNNNNNKEMEQLI  62

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEK  582
            + +I+ +   AED ID ++     ++ + +L +    V +   ++D A++++ IK   ++
Sbjct  63   LSQIRDIAHVAEDVIDTFIANVAVYKRKNLLKRMLHSVGHAKLLHDVAEKIDKIKNTLKE  122

Query  581  IRLD-LELLQGGSLNNPQ-----LPAADLQAHVAEDELVGFDEDAQTIKYRLT-EKLDDt  423
            I  + ++  Q  S    +          L+++V   ++VGF  +++ +  RL  E     
Sbjct  123  INENKIKYYQDSSDQTREDGMKMQSLHILRSNVEVKDVVGFVHESEVVINRLIGEGSLHL  182

Query  422  tviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNF--TKE  249
             V++I+G  G+GKTTL + I+N  +++  F    W+YVS     K+I + ++ +     E
Sbjct  183  NVVSIIGMGGLGKTTLARKIYNSDKVKKHFNCLAWVYVSNECRTKEILLGLLKHLMPNHE  242

Query  248  TSGYKD-------------------MKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYL  126
              G ++                   + E ++ E I+  L   KY +V+DDLW  +DWD +
Sbjct  243  YEGRRNNNTKKGKKKHKELAQDLSSLSEGEMKETIRKCLELKKYLLVLDDLWNRQDWDAV  302

Query  125  RTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + AFP+  KGSR+L+T+R+ E+A+H  S++ P+
Sbjct  303  KDAFPDGNKGSRVLITSRLKEIASHT-SRDPPY  334



>gb|KHN19144.1| Disease resistance protein RPP13 [Glycine soja]
Length=877

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 92/317 (29%), Positives = 165/317 (52%), Gaps = 16/317 (5%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVVQ  756
            D+VV  V+  + + +E+   L+ G+ED++  L  EL+      + ++      +++EVV 
Sbjct  3    DSVVAFVLDNLSRLLEDEHKLLSGVEDKINSLCNELKFIDIFLKNSEGKRSHEMVKEVVS  62

Query  755  KIQKVVIDAEDAIDKYLVEERNHRGRGVLMKW---PEKVSYYNKVNDAAKEMESIKKRAE  585
            +I+ V   AED +D Y+      + R  L K     E V   ++VN    ++E I+ R +
Sbjct  63   QIRDVAHKAEDVVDTYVSSIAKQKQRSKLSKLFHLKEHVMVLHQVNS---DIEKIRSRID  119

Query  584  KIRLDLELLQGG-----SLNNPQLPAADLQAH--VAEDELVGFDEDAQTIKYRLTEKLDD  426
            +I  + +    G     S        + L+    V E+++VG   D+  +   L E    
Sbjct  120  EIYKNRDRYGIGEGEFRSEEAAAEAESLLKRRREVEEEDVVGLVHDSNHVIQELMESESR  179

Query  425  ttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKET  246
              V++I+G  G+GKTTL + I+N+ +++  F    W+ VS     K+  + ++      T
Sbjct  180  LKVVSIIGMGGLGKTTLARKIYNNNQVQLWFPCLAWVSVSNDYRPKEFLLSLLKCSMSST  239

Query  245  SGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVL  66
            S  +++ E +L ++I ++L   KY +V+DD+W T+ WD ++ AFP++Q GSRIL+T+R  
Sbjct  240  S--EELSEVELKKKIAEWLKGKKYLVVLDDIWETQVWDEVKGAFPDDQTGSRILITSRNK  297

Query  65   EVANHVDSKNAPHKFPI  15
            EVA H     +P+  PI
Sbjct  298  EVA-HYAGTASPYYLPI  313



>ref|XP_006857617.1| hypothetical protein AMTR_s00061p00116840 [Amborella trichopoda]
 gb|ERN19084.1| hypothetical protein AMTR_s00061p00116840 [Amborella trichopoda]
Length=885

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 89/325 (27%), Positives = 164/325 (50%), Gaps = 30/325 (9%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVVQ  756
            +AVV  ++  + + + +   L  G++++++ + CE  S  A     ++ + +A  EE V+
Sbjct  3    EAVVTYLLSNLGELLTDRVQLYWGLDEEIDWIKCEFESIQAF---LRDADQRAAREESVK  59

Query  755  ----KIQKVVIDAEDAIDKYLVEERNHRGRGVLMKW-PEKVSYYNKVNDAAKEMESIKKR  591
                +++ VV D ED +DK+ +       +G    W    V  +  V + A E+  IK R
Sbjct  60   VWMKQVRDVVYDVEDVLDKFSLRSAKQL-QGSSRNWLCGHVERFKGVQEVAIEIRKIKAR  118

Query  590  AEKI-----RLDLELLQ---------GGSLNNPQLP-AADLQAHVAEDELVGFDEDAQTI  456
             E+I     R   ++ Q          G+  +P  P   D+      D +VG DEDA++I
Sbjct  119  IEEISKRRLRYQFQITQQEASSPWNRNGNSASPSFPLVPDV------DGIVGLDEDAKSI  172

Query  455  KYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFM  276
            +  + +     T+I+  G  GIGKTTL K ++N  +++  F  + W++VS + +   +  
Sbjct  173  ERWILDVDSRLTLISFAGMGGIGKTTLAKKVYNSEQIKRSFECQGWVHVSQSFHVWDLLQ  232

Query  275  DIISNFTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKG  96
            +++      +   ++M E +LA ++ D L + +Y IV+DD+W TE W+ +R A P   +G
Sbjct  233  EMVKGIMGSSIELENMNEGELARKLYDHLEDKRYIIVLDDVWDTEVWERVRIALPEGHQG  292

Query  95   SRILVTTRVLEVANHVDSKNAPHKF  21
            SR+++TTR ++VA      N  H  
Sbjct  293  SRVILTTRKMDVATPGGITNRVHAL  317



>ref|XP_006591996.1| PREDICTED: disease resistance protein RPP13-like [Glycine max]
Length=929

 Score =   105 bits (262),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 90/333 (27%), Positives = 167/333 (50%), Gaps = 40/333 (12%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVVQ  756
            D+VV  V+  + Q +     L+ G+ED++  L  EL         +K+   K + + VV 
Sbjct  3    DSVVSFVLDHLSQLLAREAKLLCGVEDRILSLQNELEMINEFLNTSKS--KKGIEKIVVS  60

Query  755  KIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKIR  576
            +I+ V   AED ID +L +   H+ R +L +    V       D AK +  + ++ +KI+
Sbjct  61   QIRDVAHLAEDVIDTFLAKVVVHKRRSMLGRMLHGV-------DHAKLLHDLSEKIDKIK  113

Query  575  LDLELLQGGSLNNPQLPAADLQAHVAEDE----------------LVGFDEDAQTIKYRL  444
            + L  ++   +   +   ++ Q+ + E+E                +VGF  D++ +  +L
Sbjct  114  ITLNEIRDNKIKYVEFQESNNQSTIKEEEKAESLHERRRNVEVENVVGFVHDSKVVIKQL  173

Query  443  TEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVS----MTVNRKQIFM  276
             E       ++I+G  G+GKTTL + ++N  +++  F  R W+YVS    +      +  
Sbjct  174  VEGGSLRNAVSIIGMGGLGKTTLARKVYNSSQVKQYFGCRAWVYVSNECRVRELLLGLLE  233

Query  275  DIISNFTKETSGYK----------DMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYL  126
             ++ N   E +G K          ++ EE+L + +   L   +Y +V+DD+W+  DWD +
Sbjct  234  QLMPNPEYEYAGKKKGKKHTQDVSNLSEEELKKLVWKRLERKRYLVVLDDMWKRRDWDEV  293

Query  125  RTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + AFP+N +GSRIL+T+R+ E+A+H  S + P+
Sbjct  294  QDAFPDNNEGSRILITSRLKELASHT-SHHPPY  325



>emb|CAN80606.1| hypothetical protein VITISV_002648 [Vitis vinifera]
Length=1150

 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 101/333 (30%), Positives = 164/333 (49%), Gaps = 31/333 (9%)
 Frame = -2

Query  941  AMDAVVGLVIGKVVQSVEENETLILGIEDQVEDL---LCELRSFWALSEAAKNCNDKAVL  771
            A +AVV   + ++   + +    + G+  +VE L   L  ++ F  L EA K   +   +
Sbjct  2    ATEAVVSFAVERIGDMLIQEAIFLKGVRGKVERLKKDLGAMKCF--LEEAEKKQEEDVRV  59

Query  770  EEVVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKR  591
               V +I++ V D ED ID +++   + R    L +  +K+   +KV    K++E+I+  
Sbjct  60   RNWVSEIREAVYDVEDIIDMFILNAESLRTVYFLKRVFKKLINRHKV---GKKIEAIQLH  116

Query  590  AEKIRLDLELL------QGGSLNNPQLPAADLQAHVAEDE-LVGFDEDAQTIKYRLTEKL  432
             + I    E L      +G S +  +L      +  AE+  +VG  E+   +  +LT   
Sbjct  117  LQDISNRREALGIKNIGEGTSGSGQKLQDLRRSSPRAEERVIVGLTEEVNKLVKQLTVGD  176

Query  431  DDttviaivggagigktTLMKMIFNDRELRHEFF-TRLWIYVSMTVNRKQIFMDIISNFT  255
                VI++VG  GIGKTTL K ++N  ++   F   R WIYVS     ++++M II+  +
Sbjct  177  QRRRVISLVGMGGIGKTTLAKKVYNHEKIVEHFPDCRAWIYVSQDCRPREVYMQIINQVS  236

Query  254  KETSGYKDM----KEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR-----------T  120
              T    +M     E QL + + D L E KY IV+DD+WR  DWD+L             
Sbjct  237  APTKEQAEMIEKYGENQLGDFLHDHLKEKKYLIVLDDVWRCADWDFLAKVSSNDPDCLGN  296

Query  119  AFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             FP+   GSR+L+TTR  +VA H D++  PH+ 
Sbjct  297  VFPDGSNGSRLLLTTRYKDVALHADARTIPHEM  329



>ref|XP_002303452.1| hypothetical protein POPTR_0003s09790g [Populus trichocarpa]
 gb|EEE78431.1| hypothetical protein POPTR_0003s09790g [Populus trichocarpa]
Length=1006

 Score =   105 bits (262),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 100/329 (30%), Positives = 163/329 (50%), Gaps = 24/329 (7%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDK-AVLEEVV  759
            + VV  ++ K+   + E    + G+E +VE +  EL    A         D   VL+ +V
Sbjct  3    EGVVTFLLTKLADFLVERGKNLAGVECEVEYISDELEFMTAFLRLGDTMEDSDPVLKCLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDA----AKEMESIKKR  591
            +K++    D EDA+D + +   + RG G+   +  K+S   K   A    A +++SIK R
Sbjct  63   KKVRDAAYDTEDALDNFSLSHVSDRGHGIFSCF-RKISRSIKDKRARRRIASKIQSIKSR  121

Query  590  AEKIRLDLE--------LLQGGSLNN-PQLPAADLQAHVAEDELVGFDEDA-QTIKYRLT  441
               I             ++QG S N+ P+L        + E +LVG ++   Q I++ L 
Sbjct  122  VISISESHRRYCNKNNIMIQGSSSNSIPRLECQRDALLIEEADLVGIEKPKKQLIEWLLG  181

Query  440  EKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISN  261
             K     VI++VG  G+GK+TL+K +++D  ++  F  R W+ VS +  R+ +  D+I  
Sbjct  182  SK-TGREVISVVGMGGLGKSTLVKRVYDDSNVKKHFKFRAWVTVSQSFKREDLLKDMIQQ  240

Query  260  FTK-----ETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKG  96
              +     +  G   M   +L   I +FL + KY IV+DD+W    W   + A PNN  G
Sbjct  241  LFRVHRKPDPKGVNSMDYNKLRSVIHEFLQQKKYLIVLDDVWHPSAWHAFQHALPNNICG  300

Query  95   SRILVTTRVLEVANHVDSKNAPHK-FPIS  12
            SRILVTTR  EVA+     ++P K +P++
Sbjct  301  SRILVTTRNTEVAS-TSCMDSPDKVYPLN  328



>gb|ACE79506.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=279

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 97/162 (60%), Gaps = 1/162 (1%)
 Frame = -2

Query  497  EDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLW  318
            E+ LVG ++    I+ +L  +     V++IVG  GIGK+TL + +FN   + H F    W
Sbjct  18   ENTLVGMEDVFNNIRDQLFGQTPALNVVSIVGMGGIGKSTLARSLFNHPSVYHRFDISSW  77

Query  317  IYVSMTVNRKQIFMDIISNFTKETSG-YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTE  141
            + VS   + K++ +D++S  T      Y+DM E++L +++   L   +Y IV+DD+W  E
Sbjct  78   VTVSQACDAKEMLLDVLSFGTPGGKAMYRDMSEDELLDQVHRELKRKRYLIVLDDMWTIE  137

Query  140  DWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKFPI  15
             WD +R +FP+++ GSRI++TTR+LEVAN   +   PH  P 
Sbjct  138  AWDQVRRSFPDDENGSRIMITTRLLEVANCAGNDFPPHHMPF  179



>ref|XP_010045165.1| PREDICTED: putative inactive disease susceptibility protein LOV1 
[Eucalyptus grandis]
Length=1008

 Score =   105 bits (262),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 84/270 (31%), Positives = 145/270 (54%), Gaps = 27/270 (10%)
 Frame = -2

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKV---NDAAKEMESIKK  594
            +V+ I+++++ AED +  ++ E R H   G   +    + ++  +   +    E+E I+ 
Sbjct  146  LVEDIRQLLVHAEDVVSAFVNERRRHTNWGCFKR---TIFFFRDMIARHRFQDEIEKIRL  202

Query  593  RAEKIRLDLELLQGGSLNNPQLPAA-DLQA---------HVAE-DELVGFDEDAQTIKYR  447
            +  +I+L     QG S+   Q+ A+ D Q+         HV E D+++G +   + IK R
Sbjct  203  KKNRIKL-----QGTSIGIGQIDASEDTQSAALWGPSGSHVEESDDIMGLELHYKVIKSR  257

Query  446  L---TEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFM  276
            L       +  +VI+IVG +G GKT L   I+ND E++  F  R WI +S     + +  
Sbjct  258  LMYTAGSGEKQSVISIVGKSGAGKTALAHKIYNDSEIKKHFTCRAWITLSPKFVPETLLR  317

Query  275  DIISNF--TKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQ  102
            DI +    + + +  +     +L + + DFL   +Y +V+DD+W TEDWD LR AFP  +
Sbjct  318  DISTQVQASLQVTDQRTRNFHELTKILSDFLSSKRYLVVLDDVWMTEDWDKLRMAFPKTE  377

Query  101  KGSRILVTTRVLEVANHVDSKNAPHKFPIS  12
            +GS I+VTTRV +VA H + K+ P++  +S
Sbjct  378  EGSGIIVTTRVRKVALHTNPKSPPYELQLS  407



>gb|ACE79501.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=283

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 97/162 (60%), Gaps = 1/162 (1%)
 Frame = -2

Query  497  EDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLW  318
            E+ LVG ++    I+ +L  +     V++IVG  GIGK+TL + +FN   + H F    W
Sbjct  18   ENTLVGMEDVFNNIRDQLFGQTPALNVVSIVGMGGIGKSTLARSLFNHPSVYHRFDISSW  77

Query  317  IYVSMTVNRKQIFMDIISNFTKETSG-YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTE  141
            + VS   + K++ +D++S  T      Y+DM E++L +++   L   +Y IV+DD+W  E
Sbjct  78   VTVSQACDAKEMLLDVLSFGTPGGKAMYRDMSEDELLDQVHRELKRKRYLIVLDDMWTIE  137

Query  140  DWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKFPI  15
             WD +R +FP+++ GSRI++TTR+LEVAN   +   PH  P 
Sbjct  138  AWDQVRRSFPDDENGSRIMITTRLLEVANCAGNDFPPHHMPF  179



>gb|ACE79503.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=285

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 97/162 (60%), Gaps = 1/162 (1%)
 Frame = -2

Query  497  EDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLW  318
            E+ LVG ++    I+ +L  +     V++IVG  GIGK+TL + +FN   + H F    W
Sbjct  18   ENTLVGMEDVFNNIRDQLFGQTPALNVVSIVGMGGIGKSTLARSLFNHPSVYHRFDISSW  77

Query  317  IYVSMTVNRKQIFMDIISNFTKETSG-YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTE  141
            + VS   + K++ +D++S  T      Y+DM E++L +++   L   +Y IV+DD+W  E
Sbjct  78   VTVSQACDAKEMLLDVLSFGTPGGKAMYRDMSEDELLDQVHRELKRKRYLIVLDDMWTIE  137

Query  140  DWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKFPI  15
             WD +R +FP+++ GSRI++TTR+LEVAN   +   PH  P 
Sbjct  138  AWDQVRRSFPDDENGSRIMITTRLLEVANCAGNDFPPHHMPF  179



>gb|ACE79502.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=282

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 97/162 (60%), Gaps = 1/162 (1%)
 Frame = -2

Query  497  EDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLW  318
            E+ LVG ++    I+ +L  +     V++IVG  GIGK+TL + +FN   + H F    W
Sbjct  19   ENTLVGMEDVFNNIRDQLFGQTPALNVVSIVGMGGIGKSTLARSLFNHPSVYHRFDISSW  78

Query  317  IYVSMTVNRKQIFMDIISNFTKETSG-YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTE  141
            + VS   + K++ +D++S  T      Y+DM E++L +++   L   +Y IV+DD+W  E
Sbjct  79   VTVSQACDAKEMLLDVLSFGTPGGKAMYRDMSEDELLDQVHRELKRKRYLIVLDDMWTIE  138

Query  140  DWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKFPI  15
             WD +R +FP+++ GSRI++TTR+LEVAN   +   PH  P 
Sbjct  139  AWDQVRRSFPDDENGSRIMITTRLLEVANCAGNDFPPHHMPF  180



>emb|CDP19464.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   103 bits (257),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 96/323 (30%), Positives = 163/323 (50%), Gaps = 23/323 (7%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDL---LCELRSFWALSEAAKNCNDKAVLEE  765
            D V+  VI +    + +    + G+  QVE L   L  +R F  L +  +  ++ A +  
Sbjct  3    DPVISFVIERTGDLLIQKLVFLKGVRRQVERLQYDLVRMRCF--LKDGDQRQDEDARIRN  60

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGV---LMKWPEKVSYYNKVNDAAKEMESIKK  594
             V +I+    DAED I+ +  +    + +G+   L  +P K+    K+    KE+ES++ 
Sbjct  61   WVSEIRAAAYDAEDIIEIFASKVEFIKDKGLVTQLTHYPLKIVNVYKI---GKEIESLQM  117

Query  593  RAEKIRLDLE------LLQGGSLNNPQLPAADLQAHVAED-ELVGFDEDAQTIKYRLTEK  435
            R   I    E      L +G S    +L      + ++ED ++VGF++  +++   L + 
Sbjct  118  RINDIADSREKYGIKNLGEGTSTQGEELQRLRRSSPISEDTDIVGFEKITKSLVKELLKG  177

Query  434  LDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFT  255
              +  V++I+G  G GKTTL K ++N  ++R  F  R+W+ VS   N K+    II    
Sbjct  178  DKNRRVVSIIGMGGAGKTTLAKKVYNHADVRARFNCRVWVCVSSIYNHKETLRTIIKQLN  237

Query  254  KETSGYKDM----KEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYL-RTAFPNNQKGSR  90
              T+   DM    +E+ L ER+   L +  Y +V+DD+W+ E WD L R AFP+    SR
Sbjct  238  PITNELLDMLEKMQEQDLEERLYKDLKDKCYLVVLDDVWKEEAWDCLARRAFPDVNTSSR  297

Query  89   ILVTTRVLEVANHVDSKNAPHKF  21
            +L+T+R  +VA H D+ + PH+ 
Sbjct  298  VLLTSRNQDVAVHADALSKPHEL  320



>ref|XP_010647711.1| PREDICTED: disease resistance protein RPP13-like [Vitis vinifera]
Length=911

 Score =   105 bits (261),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 97/326 (30%), Positives = 159/326 (49%), Gaps = 23/326 (7%)
 Frame = -2

Query  941  AMDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEE  765
            A DAVV   + ++   + +    + G+  +VE L  +LR+    L EA K   +   + +
Sbjct  2    ATDAVVSFAVERIGDMLIQEAIFLKGVRGKVERLQKDLRAMKCFLEEAEKKQEEDLRVRK  61

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRG----RGVLMKWPEKVSYYNKVNDAAKEMESIK  597
             V +I+ VV D ED ID +++   + R     + V  K   +     K+ D    ++ I 
Sbjct  62   WVSEIRDVVYDVEDIIDMFILNAESLRTDYFLKRVFKKLINRHKVGKKIEDIQLTLQDIS  121

Query  596  KRAEKIRLDLELLQGGSLNNPQLPAADLQAHVAEDE-LVGFDEDAQTIKYRLTEKLDDtt  420
             R E + +   + +G S +   L      +  AE+  +VG  ++A  +  +L        
Sbjct  122  NRREALGIK-NIGEGTSGSGQMLQDLRRSSPRAEERVIVGLTQEAHKLVEQLIGGGQRRR  180

Query  419  viaivggagigktTLMKMIFNDRELRHEFFT-RLWIYVSMTVNRKQIFMDIISNFTKETS  243
            VI++VG  GIGKTTL K ++N  ++   F   R WIYVS     ++++M II+  ++ T 
Sbjct  181  VISLVGMGGIGKTTLAKKVYNHEKIVEHFPEFRAWIYVSQDCRPREVYMQIINQVSEPTK  240

Query  242  GYKDM----KEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR-----------TAFPN  108
               +M     E +L + + D L E KY IV+DD+WR  DWD+L              FP+
Sbjct  241  EQAEMIEKYGENELGDFLHDHLKEKKYLIVLDDVWRCADWDFLAKVSSNDPDCLGNVFPD  300

Query  107  NQKGSRILVTTRVLEVANHVDSKNAP  30
               GSR+L+TTR  +VA H D++  P
Sbjct  301  GSNGSRLLLTTRYKDVALHADARTIP  326



>ref|XP_009591232.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
Length=743

 Score =   104 bits (260),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 93/143 (65%), Gaps = 1/143 (1%)
 Frame = -2

Query  497  EDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLW  318
            +DE+VGFDE+A  +  RL E  +D  +I +VG  G+GKTTL + IFND ++ +EFF   W
Sbjct  15   DDEVVGFDEEANKMIKRLVEGSEDLDIIPVVGMPGLGKTTLARKIFNDPQISYEFFGVYW  74

Query  317  IYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQDFLME-GKYFIVVDDLWRTE  141
            +YV  +   K +F++I+  FT+ T  Y+   E  LA+ I  F+ + G+  I +DD+W T+
Sbjct  75   VYVGQSYKIKDVFLNILKFFTRRTEDYQHEDENALAKVIAGFIKKGGRCLICLDDVWETK  134

Query  140  DWDYLRTAFPNNQKGSRILVTTR  72
              DY++  FP N+KG R+++TTR
Sbjct  135  VIDYVKKVFPENEKGHRVMMTTR  157



>ref|XP_010426119.1| PREDICTED: putative disease resistance RPP13-like protein 3 isoform 
X2 [Camelina sativa]
Length=818

 Score =   105 bits (261),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 102/333 (31%), Positives = 159/333 (48%), Gaps = 36/333 (11%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEV  762
            +DA+ G V+GK+   + E  ++ +G++D +E L  EL      L +      +  V +E 
Sbjct  2    VDAITGFVVGKIGNYLIEEASMFMGVKDDLEYLKTELTCIQGYLKDVEAREREDEVSKEW  61

Query  761  VQKIQKVVIDAEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMESIKK  594
             + +  +  D ED +D Y +  EER+ R   R +  K  EK+  YN V+D    +  +K 
Sbjct  62   TKLVLDLAYDVEDVLDSYTLKLEERSQRRGLRRLTNKVGEKMDAYNIVDD----VRILKT  117

Query  593  RAEKIRLDLELLQGGSLNNPQ--------------LPAADLQAHVAEDELVGFDEDAQTI  456
            R   I    E    GS N  +               P  D      E ++VG ++DA+ +
Sbjct  118  RILDITRKRETYGIGSFNESRGESSTNLRVRQLRRTPPVD-----QEQQVVGMEDDAKIL  172

Query  455  KYRLT--EKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQI  282
              +L    K D   +I+I G  G+GKT L + ++N  E++  F  R W YVS     + I
Sbjct  173  LVKLLGDNKEDKRHIISIFGMGGLGKTALARKLYNSVEVKRRFDCRAWTYVSQEYKTRDI  232

Query  281  FMDIISNF----TKETSGYKDM-KEEQLAERIQDFLMEGK-YFIVVDDLWRTEDWDYLRT  120
             + II +     TKE     +M KE++  E     L+EGK Y +VVDD+W    W+ L+ 
Sbjct  233  LVRIIRSLGVVSTKEIDEKINMLKEDEELEVYLYGLLEGKKYLVVVDDVWDPPAWESLKR  292

Query  119  AFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
            A P N  GSR+++TTR+  +A  VD     HK 
Sbjct  293  ALPCNHGGSRVIITTRIRAIAEGVDGTVYAHKL  325



>ref|XP_010426118.1| PREDICTED: putative disease resistance RPP13-like protein 3 isoform 
X1 [Camelina sativa]
Length=847

 Score =   105 bits (261),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 102/333 (31%), Positives = 159/333 (48%), Gaps = 36/333 (11%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEV  762
            +DA+ G V+GK+   + E  ++ +G++D +E L  EL      L +      +  V +E 
Sbjct  2    VDAITGFVVGKIGNYLIEEASMFMGVKDDLEYLKTELTCIQGYLKDVEAREREDEVSKEW  61

Query  761  VQKIQKVVIDAEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMESIKK  594
             + +  +  D ED +D Y +  EER+ R   R +  K  EK+  YN V+D    +  +K 
Sbjct  62   TKLVLDLAYDVEDVLDSYTLKLEERSQRRGLRRLTNKVGEKMDAYNIVDD----VRILKT  117

Query  593  RAEKIRLDLELLQGGSLNNPQ--------------LPAADLQAHVAEDELVGFDEDAQTI  456
            R   I    E    GS N  +               P  D      E ++VG ++DA+ +
Sbjct  118  RILDITRKRETYGIGSFNESRGESSTNLRVRQLRRTPPVD-----QEQQVVGMEDDAKIL  172

Query  455  KYRLT--EKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQI  282
              +L    K D   +I+I G  G+GKT L + ++N  E++  F  R W YVS     + I
Sbjct  173  LVKLLGDNKEDKRHIISIFGMGGLGKTALARKLYNSVEVKRRFDCRAWTYVSQEYKTRDI  232

Query  281  FMDIISNF----TKETSGYKDM-KEEQLAERIQDFLMEGK-YFIVVDDLWRTEDWDYLRT  120
             + II +     TKE     +M KE++  E     L+EGK Y +VVDD+W    W+ L+ 
Sbjct  233  LVRIIRSLGVVSTKEIDEKINMLKEDEELEVYLYGLLEGKKYLVVVDDVWDPPAWESLKR  292

Query  119  AFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
            A P N  GSR+++TTR+  +A  VD     HK 
Sbjct  293  ALPCNHGGSRVIITTRIRAIAEGVDGTVYAHKL  325



>ref|XP_010426116.1| PREDICTED: putative disease resistance RPP13-like protein 2 [Camelina 
sativa]
Length=849

 Score =   104 bits (260),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 96/325 (30%), Positives = 167/325 (51%), Gaps = 29/325 (9%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSF--WALSEAAKNCNDKAVLEE  765
            +DA+   V+GK+   + E  ++++G++D +E+L  EL     +     A++  D+   +E
Sbjct  2    VDAITEFVVGKIDNYLIEEASMLMGVKDDLEELKTELTCIQIYLKDVEARDREDENS-KE  60

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWP----EKVSYYNKVNDAAKEMESIK  597
              Q++  +    ED +D Y ++      R  LM+      EK   YN V+D    + ++K
Sbjct  61   WAQQVLDIAYGVEDVLDTYFLKLEKRPQRLGLMRLTNIRGEKNDAYNIVDD----IRTLK  116

Query  596  KRAEKIRLDLELLQGGSLNNPQLPAA-----DLQAHVAEDE---LVGFDEDAQTIKYRLT  441
            +R   +    E     + N  +  A+     +L+    +D+   +VGF +DA+ +   LT
Sbjct  117  RRMLDLTCKRETYAIRNFNEHRAVASTQRVKELRRARTDDQEECVVGFADDAKVL---LT  173

Query  440  EKLDD-----ttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFM  276
            + LDD     T +I I G  G+GKTTL + ++N  +++ +F  R+W  VS     + I M
Sbjct  174  KLLDDDGDNKTYMIFIFGMGGLGKTTLARKLYNSSDVKEKFEYRVWTNVSRECKTRDILM  233

Query  275  DIISNFTKETSG--YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQ  102
             II +  +E S    + M EE+L   + D L E +Y +VVDD+W  E W+ L+ A P N 
Sbjct  234  RIIRSLGEEASEVELEKMAEEELEFYLHDILQEKRYMVVVDDIWERETWESLKRALPYND  293

Query  101  KGSRILVTTRVLEVANHVDSKNAPH  27
            +GSR+++TTR+  +A   D +   H
Sbjct  294  EGSRVIITTRIRAMAEGADQRVYAH  318



>ref|XP_006355046.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=887

 Score =   104 bits (260),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 93/313 (30%), Positives = 160/313 (51%), Gaps = 26/313 (8%)
 Frame = -2

Query  923  GLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVVQKIQ  747
             L++  +   +  N  L  G++   EDL  E++   A L + A   ++    E +V KI+
Sbjct  18   SLLVENLSHLISYNWKLYTGLKKSCEDLFDEVKRLNAFLVDNANQRSNSTQWEVLVDKIR  77

Query  746  KVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKIRLDL  567
            + V  AED +DK L++ +  +   +  K   K +Y N+        E I +  E++R  L
Sbjct  78   RTVYKAEDVVDKLLIQAKIDQESSIAKKLIHK-TYKNR-----NFTEEINEILEEVRKIL  131

Query  566  ELLQGGSLNNPQL-----------PAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDtt  420
            +  Q     NP +             + L+ H    E+VGFDE+A  +  RL E ++   
Sbjct  132  DENQHLFEANPMIDHHAEKVVQEEQGSSLENH----EVVGFDEEAAKVINRLVEGVECLD  187

Query  419  viaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSM-TVNRKQIFMDIISNFTKETS  243
            VI +VG  G+GKTTL + I+ND ++  EFF+ +W+++   T  ++ I  +I+  FT    
Sbjct  188  VIPVVGMPGLGKTTLARKIYNDPKISREFFSYIWVFIGQSTCVKRDILFNILKKFTNSVD  247

Query  242  GYKDMKEEQLAERIQDFLMEG-KYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVL  66
             +K+  E  + + I+  +  G K  IV+DD+W     D+++T FP+N+K  RI++TTR  
Sbjct  248  EFKNRNEADITQEIRKRVANGGKCLIVLDDVWDPNVVDFVKTVFPDNKKAHRIMMTTRHE  307

Query  65   EVANHVDSKNAPH  27
            ++A  V+    PH
Sbjct  308  DIARSVNK--YPH  318



>emb|CDP16256.1| unnamed protein product [Coffea canephora]
Length=702

 Score =   104 bits (259),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 77/117 (66%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K + +D ++ ++FFTR +IYVS    R ++F++I+ +    T   ++M EE+LAE ++
Sbjct  9    LAKKVLHDPKIEYDFFTRAFIYVSQQFERTEVFLNILWSLGHLTKKAQNMPEEKLAEHVR  68

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + L    Y IV+DD+W+ EDWD L+ AFPNN+K SR+L+TTR   VA + +    P+
Sbjct  69   EQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLITTRNTSVAIYANPAVEPY  125



>gb|AAS93955.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=829

 Score =   104 bits (260),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 97/334 (29%), Positives = 153/334 (46%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++ + +++ +E+L  EL     +    K+   +   +EV 
Sbjct  2    VDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELT---CIHGYLKDVEAREREDEVS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  Y+ V+D    +  
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSIVDD----IRI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N R+++  F  R WIYVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWIYVSQEYKTG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   EE+L   +   L   KY +VVDD+W  E W+ L+
Sbjct  231  DILMRIIRSLGM-TSGEELEKIRKFAEEELEVYLYGLLEGKKYLVVVDDIWEREAWESLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  290  RALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>ref|XP_004505810.1| PREDICTED: probable disease resistance RPP8-like protein 2-like 
[Cicer arietinum]
Length=1592

 Score =   105 bits (261),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 87/333 (26%), Positives = 174/333 (52%), Gaps = 31/333 (9%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELR--SFWALSEAAKNCNDKAVLEEV  762
            D+VV  ++  + Q ++    L+ G+EDQ+  L  EL+  + +  + +  N N+K + + +
Sbjct  3    DSVVAFLLEHLSQLLQRETNLLCGVEDQITSLRNELQIINIYLKTSSGNNNNNKEMEQLI  62

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEK  582
            + +I+ +   AED ID ++     ++ + +L +    V +   ++D A++++ IK   ++
Sbjct  63   LSQIRDIAHVAEDVIDTFIANVAVYKRKNLLKRMLHSVGHAKLLHDVAEKIDKIKNTLKE  122

Query  581  IRLD-LELLQGGSLNNPQ-----LPAADLQAHVAEDELVGFDEDAQTIKYRLT-EKLDDt  423
            I  + ++  Q  S    +          L+++V   ++VGF  +++ +  RL  E     
Sbjct  123  INENKIKYYQDSSDQTREDGMKMQSLHILRSNVEVKDVVGFVHESEVVINRLIGEGSLHL  182

Query  422  tviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNF--TKE  249
             V++I+G  G+GKTTL + I+N  +++  F    W+YVS     K+I + ++ +     E
Sbjct  183  NVVSIIGMGGLGKTTLARKIYNSDKVKKHFNCLAWVYVSNECRTKEILLGLLKHLMPNHE  242

Query  248  TSGYKD-------------------MKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYL  126
              G ++                   + E ++ E I+  L   KY +V+DDLW  +DWD +
Sbjct  243  YEGRRNNNTKKGKKKHKELAQDLSSLSEGEMKETIRKCLELKKYLLVLDDLWNRQDWDAV  302

Query  125  RTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            + AFP+  KGSR+L+T+R+ E+A+H  S++ P+
Sbjct  303  KDAFPDGNKGSRVLITSRLKEIASHT-SRDPPY  334



>gb|AAS93958.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
 gb|AAS93959.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=830

 Score =   104 bits (260),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 95/334 (28%), Positives = 154/334 (46%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++ + +++ +E+L  EL     +    K+   +   +EV 
Sbjct  2    VDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELT---CIHGYLKDVEAREREDEVS  58

Query  758  QKIQKVVID----AEDAIDKYL--VEERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y   +EER+ R   R +  K   K+  Y+ V+D    ++ 
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHFKLEERSQRRGLRRLTNKIGRKMDAYSVVDD----IKI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ   + L   V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGSTLSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N  +++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSGDVKERFEYRAWTYVSQEYKTG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   +E+L   +   L   KY +VVDD+W  E W+ L+
Sbjct  231  DILMRIIRSLGM-TSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  290  RALPCNHRGSRVIITTRIKAVAEGVDGRFYAHKL  323



>gb|ABF00985.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=831

 Score =   104 bits (260),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 97/334 (29%), Positives = 152/334 (46%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++ + +++ +E+L  EL     +    K+   +   +EV 
Sbjct  2    VDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELT---CIHGYLKDVEAREREDEVS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  Y+ V+D    +  
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSIVDD----IRI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N R+++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   EE+L   +   L   KY +VVDD+W  E WD L+
Sbjct  231  DILMRIIRSLGM-TSGEELEKIRKFAEEELEVYLYGLLEGKKYLVVVDDIWEREAWDSLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  290  RALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>gb|AAZ07904.1| NBS-LRR protein [Ipomoea batatas]
Length=173

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 69/117 (59%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K ++ D  + + F+ R WIYVS   +RK++F+ I+ +    +     M +++LAE + 
Sbjct  10   LAKKVYTDPSIEYHFYNRAWIYVSQQYSRKEVFLGILDSLGLLSEQMYRMNDDRLAEELC  69

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
              L   +Y IV+DD+W  E WD L+ AFP    GSRIL+TTR  EVA H D ++  H
Sbjct  70   GQLKSNRYLIVIDDVWTKEAWDDLKMAFPKTSYGSRILLTTRNTEVALHADPESPHH  126



>gb|ACE79505.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=302

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 97/162 (60%), Gaps = 1/162 (1%)
 Frame = -2

Query  497  EDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLW  318
            E+ LVG ++    I+ +L  +     V++IVG  GIGK+TL + +FN   + H F    W
Sbjct  39   ENTLVGMEDVFNNIRDQLFGQTPALNVVSIVGMGGIGKSTLARSLFNHPSVYHRFDISSW  98

Query  317  IYVSMTVNRKQIFMDIISNFTKETSG-YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTE  141
            + VS   + K++ +D++S  T      Y+DM E++L +++   L   +Y IV+DD+W  E
Sbjct  99   VTVSQACDAKEMLLDVLSFGTPGGKAMYRDMSEDELLDQVHRELKRKRYLIVLDDMWTIE  158

Query  140  DWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKFPI  15
             WD +R +FP+++ GSRI++TTR+LEVAN   +   PH  P 
Sbjct  159  AWDQVRRSFPDDENGSRIMITTRLLEVANCAGNDFPPHHMPF  200



>ref|XP_006470645.1| PREDICTED: disease resistance protein RPP13-like [Citrus sinensis]
Length=398

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 98/337 (29%), Positives = 163/337 (48%), Gaps = 40/337 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCEL---RSFWALSEAAKNCNDKAVLE  768
            +DAVV  V+ ++   + +    + G+ D+VE L  EL   + F   +EA +  ND  ++ 
Sbjct  2    VDAVVSFVVQRLGDYLIQEAKTLGGVRDEVESLKKELEWMQCFVKDAEAKQAGND--LIR  59

Query  767  EVVQKIQKVVIDAEDAIDKYLVE-ERNHRGR---------GVLMKWPEKVSYYNKVNDAA  618
            + V  I+ +  DAED +DKY++      R R          +  K  EKVS Y+      
Sbjct  60   QWVSDIRDIAYDAEDVLDKYMLSVTPKKRQRLFAYSIKELNLFSKGKEKVSLYS----IG  115

Query  617  KEMESIKKRAEKIRLDLELLQGGSLNN--PQLPAADLQAHV-----------AEDELVGF  477
            KE+E++ KR  ++    E      L N   +  A   + H+            E+  VGF
Sbjct  116  KEIETLNKRLGEVSRRCESY---GLQNIIDKSEAEKHELHILKQLRRVSWFDVEENPVGF  172

Query  476  DEDAQTIKYRLTEKLDDttviai-vggagigktTLMKMIFNDRELRHEFFTRLWIYVSMT  300
            ++D   +  +L    +   ++    G  G+GKTTL K +++  +++++F    W+ VS  
Sbjct  173  EDDTDVLLSKLLAGDEPRRLVISIYGMGGLGKTTLAKKLYHSSDVKNKFECCAWVSVSQD  232

Query  299  VNRKQIFMDIISNF----TKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWD  132
               + + + II +F    + E  G ++  EE L   +   L    Y +V+DD+WR  DW+
Sbjct  233  YQFQYLLLRIIKSFNIISSAEEGGLENKSEEDLERCLYKSLQGKTYLMVLDDVWRKVDWE  292

Query  131  YLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             LR AFP+N+ GSR+++TTR  EVA   D K   HK 
Sbjct  293  NLRRAFPDNKNGSRVIITTRNREVAERSDEKTYVHKL  329



>gb|AAS93910.1| RPP13-like protein [Arabidopsis arenosa]
Length=799

 Score =   104 bits (259),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 93/322 (29%), Positives = 159/322 (49%), Gaps = 28/322 (9%)
 Frame = -2

Query  920  LVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEVVQKIQK  744
             V+GK+   + E  ++++G++D +E+L  EL      L +      +  V +E  + +  
Sbjct  1    FVVGKIGNYLIEEASMLIGVKDDLEELKTELTCIQGYLKDVEAREREDEVSKEWTKLVLD  60

Query  743  VVIDAEDAIDKYL--VEERNHRGRGVLMKWPEKVS----YYNKVNDAAKEMESIKKRAEK  582
            +  D ED +D Y   +EER+ R RGV  +W  K+      YN ++D    +  +K+R   
Sbjct  61   IAYDVEDVLDTYHMKLEERSKR-RGV-KRWTNKIGRKIDAYNIIDD----IRILKRRILD  114

Query  581  IRLDLELLQGGSLNNPQ-------LPAADLQAHVAEDE---LVGFDEDAQTIKYRLTEKL  432
            I    E    G L  PQ       L    L+  ++ D+   +VG ++DA+ +  +L +  
Sbjct  115  ITRKRETYGIGGLKEPQGGGNISSLRVRQLRRALSVDQEELVVGLEDDAKILLAKLLDVR  174

Query  431  D-DttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFT  255
            + +  +I+I G  G+GKT L + ++N  +++  F  R W YVS       I + II +  
Sbjct  175  EYNRFIISIFGMGGLGKTALARKLYNSGDVKRRFDCRAWTYVSQEYKTGDILVRIIRSLG  234

Query  254  ----KETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRI  87
                +E    +   EE+L   +   L   KY +VVDD+W  E W+ L+ A P N +GS++
Sbjct  235  MTSGEELENIRKFAEEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPCNHEGSKV  294

Query  86   LVTTRVLEVANHVDSKNAPHKF  21
            ++TTR+  VA  VD +   HK 
Sbjct  295  IITTRIRAVAEGVDGRFYAHKL  316



>ref|NP_190237.1| disease resistance protein RPP13 [Arabidopsis thaliana]
 sp|Q9M667.2|RPP13_ARATH RecName: Full=Disease resistance protein RPP13; AltName: Full=Resistance 
to Peronospora parasitica protein 13 [Arabidopsis 
thaliana]
 gb|AAF42830.1|AF209730_1 RPP13 [Arabidopsis thaliana]
 emb|CAB62323.1| putative protein [Arabidopsis thaliana]
 gb|AAK59764.1| AT3g46530/F12A12_50 [Arabidopsis thaliana]
 gb|AAN72257.1| At3g46530/F12A12_50 [Arabidopsis thaliana]
 gb|AEE78169.1| disease resistance protein RPP13 [Arabidopsis thaliana]
Length=835

 Score =   104 bits (259),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 97/334 (29%), Positives = 152/334 (46%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++ + +++ +E+L  EL     +    K+   +   +EV 
Sbjct  2    VDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELT---CIHGYLKDVEAREREDEVS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  Y+ V+D    +  
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSIVDD----IRI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N R+++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   EE+L   +   L   KY +VVDD+W  E WD L+
Sbjct  231  DILMRIIRSLGM-TSGEELEKIRKFAEEELEVYLYGLLEGKKYLVVVDDIWEREAWDSLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  290  RALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>ref|XP_007200226.1| hypothetical protein PRUPE_ppa015433mg [Prunus persica]
 gb|EMJ01425.1| hypothetical protein PRUPE_ppa015433mg [Prunus persica]
Length=838

 Score =   104 bits (259),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 87/310 (28%), Positives = 158/310 (51%), Gaps = 12/310 (4%)
 Frame = -2

Query  929  VVGLVIGKVVQSVEENETLILGIEDQVEDLLCELR---SFWALSEAAKNCNDKAVLEEVV  759
             +  V+ K+   + E   L+ G+  +VE L  ELR   SF   ++  +  N++      V
Sbjct  5    AISTVVEKLTSCITEEALLLEGVGGKVEQLRNELRWMQSFLKDADTEQEKNER--FRNWV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
             +I++V +DAED I  Y+ E  +H    +  K         K+ +    +++I  +    
Sbjct  63   SQIREVALDAEDVIATYIAEAASHSSWNIAAKLINLHQAGKKIREIKFTVQNISSQKAHF  122

Query  578  RLDLELLQG--GSLNNPQLPAA---DLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttvi  414
             +     +G  G+  +P            ++ ED+LV   ED + +  +L+       V+
Sbjct  123  GITGTAREGREGTSASPNERLRWWRHTSPNIEEDDLVDLVEDTKALLTQLSSMDPHRRVV  182

Query  413  aivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETS--G  240
            +IVG  G+GKTTL K ++N  ++  +F  + ++YVS   +R+     II+  + + +   
Sbjct  183  SIVGMGGLGKTTLAKKLYNHCDITKQFDCKAFVYVSNDYSRRDTLQGIIAATSPDCNMED  242

Query  239  YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEV  60
             K + EE L  ++ + L E +Y +V+DD+W+TE WD +++AFP  +KGS++++TTR  EV
Sbjct  243  LKKLAEEALVLKLYELLKERRYLVVLDDIWQTEVWDSMQSAFPRGKKGSKVMLTTRNKEV  302

Query  59   ANHVDSKNAP  30
            A + D  N P
Sbjct  303  ALYADPMNEP  312



>ref|XP_010426089.1| PREDICTED: disease resistance protein RPP13-like isoform X2 [Camelina 
sativa]
Length=599

 Score =   103 bits (257),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 89/324 (27%), Positives = 157/324 (48%), Gaps = 20/324 (6%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEV  762
            +DA+ G V+GK+   + E  ++++ ++D +EDL  EL      L +      +  V +E 
Sbjct  2    VDAITGFVVGKIGNYLIEEASMLMVVKDDLEDLKTELTCIQGYLKDVEAREQEDEVSKEW  61

Query  761  VQKIQKVVIDAEDAIDKYL--VEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRA  588
             + +  +  D ED +D +   +EER+ R RG   +W  K+       +  +++  +K+R 
Sbjct  62   TKLVLDIAYDVEDVLDTHHMKLEERSQR-RG-FKRWNNKIGRKMDAYNIVEDIRILKRRI  119

Query  587  EKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIKYRLT-  441
              +    E    G+ +  +   ++L   V           E+ +VG ++D + +  +L  
Sbjct  120  LDVTRKRETYGIGNFSERRGGESNLSLRVRELRRARSVDQEELVVGLEDDVKILLEKLLD  179

Query  440  EKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISN  261
            E+  +  +I+I G  G+GKT L + ++N  +++  F  R W YVS       I M II +
Sbjct  180  EREYNRFIISIFGMGGLGKTALARKLYNSEDVKRRFEYRAWTYVSQDFKTGDILMRIIRS  239

Query  260  F----TKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGS  93
                  KE    +   EE+L   +   L   KY +VVDD+W  E W+ L+ A P N +GS
Sbjct  240  LGLASAKELEKIRKFTEEELEVYLHSILEGKKYLVVVDDIWEREAWESLKRALPCNHEGS  299

Query  92   RILVTTRVLEVANHVDSKNAPHKF  21
             +++TTR+  VA  VD +   HK 
Sbjct  300  IVIITTRIRAVAEGVDGRFYAHKL  323



>emb|CDP16841.1| unnamed protein product [Coffea canephora]
Length=900

 Score =   104 bits (259),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 83/319 (26%), Positives = 167/319 (52%), Gaps = 16/319 (5%)
 Frame = -2

Query  941  AMDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCEL---RSFWALSEAAKNCNDKAVL  771
            A+   V  ++  V+Q +++N  LI   + ++++L  +L   ++F  + +  +   D  VL
Sbjct  4    AVGVGVRFILQNVLQLIQDNRKLISSNDTKLDELCSDLDLLKTF--MDKYGEEHYDNEVL  61

Query  770  EEVVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKR  591
             ++    +++  + ED ++ ++V++  +  + +  K      + N + +  K++ ++  +
Sbjct  62   RKLAGDFRRLAREVEDVLETHIVDKLVYTNKNIFKKAVGVFDHLNSLRNTGKDVLNLSMK  121

Query  590  AEK-------IRLDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIK--YRLTE  438
             +K       I +    ++    +N         ++   D +VGFD+ A  +     L  
Sbjct  122  MKKAEDDNRGIGIPTWTMEEIKKDNSTSEDNKAGSNQEGDRIVGFDDAADDVLELLELHN  181

Query  437  KLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNF  258
                  V++I G  G+GKTTL + + ND  + + FFTR+++ VS   ++K++ + I+  F
Sbjct  182  ASKQLEVVSIHGMVGLGKTTLARKVLNDPRIEYHFFTRIFVSVSQQYDKKKVLLGILRYF  241

Query  257  TKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVT  78
             K+T   +D+ E  L   + + L  GKY IV+DD+W TE WD ++ AFP+N KGSR+L+T
Sbjct  242  DKKTRD-QDVSENDLVAEVAEKLT-GKYLIVMDDVWNTEVWDDIKDAFPDNSKGSRVLIT  299

Query  77   TRVLEVANHVDSKNAPHKF  21
            TR++ VAN   + + P+  
Sbjct  300  TRLVSVANCAKTSSEPYPL  318



>emb|CDP12769.1| unnamed protein product [Coffea canephora]
Length=841

 Score =   103 bits (258),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 85/281 (30%), Positives = 149/281 (53%), Gaps = 22/281 (8%)
 Frame = -2

Query  830  LRSFWALSEAAKNCNDKAVLEEVVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEK  651
            +R F  L +A +  ++ A +   V  ++    DAED I+ +  +  + + +G + +    
Sbjct  1    MRCF--LKDAEQRQDEDARIRNWVSLVRAAAYDAEDVIEIFASKVESIKDKGFVTR----  54

Query  650  VSYYN----KVNDAAKEMESIKKRAEKIRLDLE------LLQGGSLNNPQLPAADLQAHV  501
            ++YY      +N   KE+ES++ R + I    E      L +G S +  +L    ++  V
Sbjct  55   LAYYPWRNVSLNKIGKEIESLQTRLDDIAASREKFGIKNLGEGTSTHGEEL--QRIRRSV  112

Query  500  AEDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRL  321
             + ++VGF+E  +++   L ++  +  +++IVG  G GKTTL K  +N  ++R  F  R 
Sbjct  113  EDKDIVGFEEKTKSLVAELLKEDKNRRLVSIVGMGGAGKTTLAKKAYNHADVRTRFDCRA  172

Query  320  WIYVSMTVNRKQIFMDIISNFTKETSGYKDM----KEEQLAERIQDFLMEGKYFIVVDDL  153
            W+ VS + N K+    II      T+   DM    +E+ L ER++  L + +Y +V+DD+
Sbjct  173  WVCVSSSYNHKETLRTIIKQLNPITNELLDMLEKMQEQDLEERLRQDLQDKRYLVVLDDV  232

Query  152  WRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAP  30
            W+ E WD L  AFP+    SR+L+T+R LEVA H D+ + P
Sbjct  233  WKEEAWDCLAGAFPDVNASSRLLLTSRNLEVAQHADALSHP  273



>ref|XP_007009118.1| Disease resistance protein RPP8 isoform 2 [Theobroma cacao]
 gb|EOY17928.1| Disease resistance protein RPP8 isoform 2 [Theobroma cacao]
Length=932

 Score =   104 bits (259),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 79/264 (30%), Positives = 140/264 (53%), Gaps = 14/264 (5%)
 Frame = -2

Query  773  LEEVVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKK  594
            L   V++I+ +  DAED ID Y+++  + RG    +K    V   +K+    K++++   
Sbjct  130  LRNRVREIRDLAYDAEDVIDSYILKVAHRRGFHGFIKRFTTVFITHKMGKQVKDIQTKLG  189

Query  593  RAEKIRLDLELLQGGSLNNPQLPAADLQ-------AHVAEDELVGFDEDAQTIKYRLTEK  435
               K      +   G  +N    AA++Q        HV ED++V  +   + +  +L +K
Sbjct  190  DISKTLPTYGISGEGEGSNS---AAEMQHRLRRSYPHVEEDDVVSLEVSTRDVMDQLMKK  246

Query  434  LDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIF----MDII  267
             D   V++IVG  GIGKTTL K ++N  +++  F    W+++S     K++     + ++
Sbjct  247  EDRLHVVSIVGMGGIGKTTLAKKVYNHNDVKKYFDCCAWVFISQQCKPKEVLHGVLIKVL  306

Query  266  SNFTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRI  87
            +   K+      +KE++L E++ D L E +Y +V DD+W+ EDW+ L+ AFP   +GS++
Sbjct  307  TPSIKDRELIDKLKEDELVEKLYDVLKEKRYLVVFDDIWKCEDWESLKPAFPKGNEGSKL  366

Query  86   LVTTRVLEVANHVDSKNAPHKFPI  15
            L TTR  EVA   D +++P + P 
Sbjct  367  LFTTRNKEVAMIADPRSSPIELPF  390



>emb|CDX75041.1| BnaA05g07870D [Brassica napus]
Length=772

 Score =   103 bits (258),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 79/289 (27%), Positives = 140/289 (48%), Gaps = 9/289 (3%)
 Frame = -2

Query  866  GIEDQVEDLLCELRSFWAL-SEAAKNCNDKAVLEEVVQKIQKVVIDAEDAIDKYLVEERN  690
            G+ ++V+DL C++R   +L  +A    +   V+   ++ ++ +V DAED I+ +L++E +
Sbjct  26   GVHEKVDDLKCQMRMLQSLLKDADAKKHGSEVVRNFLEDVKDIVFDAEDIIESFLLKESS  85

Query  689  HRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKIRLDLE-------LLQGGSLNNPQ  531
               +G+         +     D + E+E I KR  K+   ++       + +  SL   Q
Sbjct  86   GDEKGIKRHLKRLSCFLVDRRDISMEIEGITKRMSKVVAHMQSFGIQHNVYRSPSLQERQ  145

Query  530  LPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFNDR  351
                      ++ +LVG ++    +   L E  D   V++I G  GIGKTTL + +F+  
Sbjct  146  REIRQTYPKRSQKDLVGVEQSVNELVGHLVEN-DSIQVVSISGMGGIGKTTLARQVFHHD  204

Query  350  ELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQDFLMEGKYF  171
             +R  F    WI VS    RK I+  ++ +      G + M E  L   +   L   KY 
Sbjct  205  IVRSHFDGFAWICVSQDFKRKDIWQKLLQDLRPHDKGIEHMNENTLQAELFHLLETSKYL  264

Query  170  IVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHK  24
            IV+DD+W+ EDWD ++  FP  ++G ++++T+R   V  H D    P +
Sbjct  265  IVMDDVWKKEDWDIIKHVFPQERRGWKMILTSRDESVGFHADRTCFPFR  313



>ref|XP_007021587.1| CC-NBS-LRR class disease resistance protein, putative [Theobroma 
cacao]
 gb|EOY13112.1| CC-NBS-LRR class disease resistance protein, putative [Theobroma 
cacao]
Length=959

 Score =   104 bits (259),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 87/318 (27%), Positives = 164/318 (52%), Gaps = 24/318 (8%)
 Frame = -2

Query  926  VGLVIGKVVQSVEENETLILGIEDQVEDLLCELR---SFWALSEAAKNCNDKAVLEEVVQ  756
            V  VI ++ + + +  T + G+E+QV+ L  EL+   SF   ++A +  ++   L   V 
Sbjct  6    VSSVIIRIGELLTQEATSLWGVEEQVDRLQKELKWMQSFLIDADARRGESETVRL--WVA  63

Query  755  KIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI-  579
            +I+ V  DAED I+ + ++  + +  G    +P  V     +    + +   + + EKI 
Sbjct  64   EIRDVAYDAEDVIETFALKIGSKKKGG----FPNVVRRSACILKEGRMLHKTRSKIEKII  119

Query  578  -----------RLDLELLQGGSLNNPQLPAADLQ---AHVAEDELVGFDEDAQTIKYRLT  441
                          ++ L+GG  +       +L+    H+ ED +VG D++ Q +   L 
Sbjct  120  TRITNLTRQLQTYGIKELRGGEESCSSYERRELRRSYPHIIEDNVVGMDDEIQKLVSVLV  179

Query  440  EKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISN  261
            ++     V++I G  G+GKTTL K +++  ++R  F    W+YVS    R+ ++  I+S+
Sbjct  180  DEESHRRVVSICGMGGLGKTTLAKKVYHHSQIRGHFNQLAWVYVSQQCQRRNVWEGILSS  239

Query  260  FTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILV  81
            F       +  ++E+LAE++ +F  + K  +V+DD+W  + WD ++ AFP  +  S+IL+
Sbjct  240  FKIMAEEDRKRRDEELAEKLFNFFKDKKCLVVLDDIWSIQAWDKIKPAFPMRETSSKILL  299

Query  80   TTRVLEVANHVDSKNAPH  27
            T+R  EVA+H D ++  H
Sbjct  300  TSRNKEVASHADRRSYLH  317



>ref|XP_010426085.1| PREDICTED: disease resistance protein RPP13-like isoform X1 [Camelina 
sativa]
 ref|XP_010426086.1| PREDICTED: disease resistance protein RPP13-like isoform X1 [Camelina 
sativa]
 ref|XP_010426087.1| PREDICTED: disease resistance protein RPP13-like isoform X1 [Camelina 
sativa]
 ref|XP_010426088.1| PREDICTED: disease resistance protein RPP13-like isoform X1 [Camelina 
sativa]
Length=629

 Score =   103 bits (257),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 89/324 (27%), Positives = 157/324 (48%), Gaps = 20/324 (6%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEV  762
            +DA+ G V+GK+   + E  ++++ ++D +EDL  EL      L +      +  V +E 
Sbjct  2    VDAITGFVVGKIGNYLIEEASMLMVVKDDLEDLKTELTCIQGYLKDVEAREQEDEVSKEW  61

Query  761  VQKIQKVVIDAEDAIDKYL--VEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRA  588
             + +  +  D ED +D +   +EER+ R RG   +W  K+       +  +++  +K+R 
Sbjct  62   TKLVLDIAYDVEDVLDTHHMKLEERSQR-RG-FKRWNNKIGRKMDAYNIVEDIRILKRRI  119

Query  587  EKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIKYRLT-  441
              +    E    G+ +  +   ++L   V           E+ +VG ++D + +  +L  
Sbjct  120  LDVTRKRETYGIGNFSERRGGESNLSLRVRELRRARSVDQEELVVGLEDDVKILLEKLLD  179

Query  440  EKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISN  261
            E+  +  +I+I G  G+GKT L + ++N  +++  F  R W YVS       I M II +
Sbjct  180  EREYNRFIISIFGMGGLGKTALARKLYNSEDVKRRFEYRAWTYVSQDFKTGDILMRIIRS  239

Query  260  F----TKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGS  93
                  KE    +   EE+L   +   L   KY +VVDD+W  E W+ L+ A P N +GS
Sbjct  240  LGLASAKELEKIRKFTEEELEVYLHSILEGKKYLVVVDDIWEREAWESLKRALPCNHEGS  299

Query  92   RILVTTRVLEVANHVDSKNAPHKF  21
             +++TTR+  VA  VD +   HK 
Sbjct  300  IVIITTRIRAVAEGVDGRFYAHKL  323



>gb|AAS93957.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=825

 Score =   103 bits (258),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 95/334 (28%), Positives = 154/334 (46%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++ + +++ +E+L  EL     +    K+   +   +EV 
Sbjct  2    VDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELT---CIHGYLKDVEAREREDEVS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  Y+ V+D    ++ 
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSVVDD----IKI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ   + L   V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGSTLSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N  +++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSGDVKERFEYRAWTYVSQEYKTG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   +E+L   +   L   KY +VVDD+W  E W+ L+
Sbjct  231  DILMRIIRSLGM-TSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  290  RALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>ref|XP_006362840.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=876

 Score =   103 bits (258),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 142/265 (54%), Gaps = 12/265 (5%)
 Frame = -2

Query  806  EAAKNCNDKAVLEEVVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVN  627
            +  K+  D   LE +   I+ V   AED +++ + E   +     L K   K    N+V 
Sbjct  43   DTGKDHEDIKCLEGI---IRDVSCKAEDLVEEIMFE---YSSSSSLKKNAIKFLGVNRV-  95

Query  626  DAAKEMESIKKRAEKIRLDLELLQGGSLNNPQLPAA--DLQAHVA--EDELVGFDEDAQT  459
               ++++SI+     +  D+  ++G S  +  +     D+   ++  +D +VG D+D   
Sbjct  96   -LFRKIKSIEAAITSVYNDISAIKGRSTPSSSVNGCSRDVTQTLSSQKDVVVGLDDDFLL  154

Query  458  IKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIF  279
            I  +LT   D   V+ I G  GIGKTTL K IF+D+ +   F+ R WI VS     + + 
Sbjct  155  IADKLTGYPDKLDVVVIFGMGGIGKTTLAKRIFHDKLIEEHFYVRAWITVSERYKVRNML  214

Query  278  MDIISNFTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQK  99
            +D++   +K      +M+ E+LAER+   L   +Y IV+DD+W T+ WD +R  FPN++ 
Sbjct  215  LDLLGCTSKVPFIMDEMENEELAERLYKSLKGQRYLIVMDDVWNTKAWDDVRRYFPNDKI  274

Query  98   GSRILVTTRVLEVANHVDSKNAPHK  24
            GSR++VT+R+++VA  ++  N PH+
Sbjct  275  GSRVMVTSRIMKVARFINPLNPPHQ  299



>ref|XP_007009117.1| Disease resistance protein RPP8 isoform 1 [Theobroma cacao]
 gb|EOY17927.1| Disease resistance protein RPP8 isoform 1 [Theobroma cacao]
Length=993

 Score =   103 bits (258),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 79/264 (30%), Positives = 140/264 (53%), Gaps = 14/264 (5%)
 Frame = -2

Query  773  LEEVVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKK  594
            L   V++I+ +  DAED ID Y+++  + RG    +K    V   +K+    K++++   
Sbjct  130  LRNRVREIRDLAYDAEDVIDSYILKVAHRRGFHGFIKRFTTVFITHKMGKQVKDIQTKLG  189

Query  593  RAEKIRLDLELLQGGSLNNPQLPAADLQ-------AHVAEDELVGFDEDAQTIKYRLTEK  435
               K      +   G  +N    AA++Q        HV ED++V  +   + +  +L +K
Sbjct  190  DISKTLPTYGISGEGEGSNS---AAEMQHRLRRSYPHVEEDDVVSLEVSTRDVMDQLMKK  246

Query  434  LDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIF----MDII  267
             D   V++IVG  GIGKTTL K ++N  +++  F    W+++S     K++     + ++
Sbjct  247  EDRLHVVSIVGMGGIGKTTLAKKVYNHNDVKKYFDCCAWVFISQQCKPKEVLHGVLIKVL  306

Query  266  SNFTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRI  87
            +   K+      +KE++L E++ D L E +Y +V DD+W+ EDW+ L+ AFP   +GS++
Sbjct  307  TPSIKDRELIDKLKEDELVEKLYDVLKEKRYLVVFDDIWKCEDWESLKPAFPKGNEGSKL  366

Query  86   LVTTRVLEVANHVDSKNAPHKFPI  15
            L TTR  EVA   D +++P + P 
Sbjct  367  LFTTRNKEVAMIADPRSSPIELPF  390



>ref|XP_010661782.1| PREDICTED: putative disease resistance protein At1g50180 [Vitis 
vinifera]
 emb|CBI40359.3| unnamed protein product [Vitis vinifera]
Length=920

 Score =   103 bits (258),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 81/258 (31%), Positives = 138/258 (53%), Gaps = 19/258 (7%)
 Frame = -2

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGR-----GVLMKWPEKVSYYNK----------VN  627
            V +I+    DAED ID+++V   +HR R      +L   P  V + +K          V 
Sbjct  62   VNQIRNATHDAEDVIDEFIVN-MDHRQRRLNTLKLLKCLPTCVGFADKLPFIHELDSRVK  120

Query  626  DAAKEMESIKKRAEKIRLDLELLQGGSLNNPQLPAADLQAH--VAEDELVGFDEDAQTIK  453
            D    + +I     K  L  +L+   S    Q+ A   +    V E ++VG ++  + +K
Sbjct  121  DINVMIGAIMANRSKYGLG-DLVASSSSTTDQVAAHKEKRPPVVEESDVVGIEDGTEEVK  179

Query  452  YRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMD  273
              L ++    +V++IVG  G+GKTTL K ++N R+++  F  + W+YVS     ++I +D
Sbjct  180  QMLMKEETRRSVVSIVGMGGLGKTTLAKKVYNQRDVQQHFDCKAWVYVSQEFRAREILLD  239

Query  272  IISNFTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGS  93
            I + F   +   K+M+E +L E++ ++L E KY +V+DD+W +E W  LR+  P  + GS
Sbjct  240  IANRFMSLSEKEKEMRESELGEKLCEYLKEKKYLVVMDDVWSSEVWSRLRSHLPEAKDGS  299

Query  92   RILVTTRVLEVANHVDSK  39
            ++L+TTR  E+A H  S+
Sbjct  300  KVLITTRNKEIALHATSQ  317



>ref|XP_002877509.1| hypothetical protein ARALYDRAFT_323301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53768.1| hypothetical protein ARALYDRAFT_323301 [Arabidopsis lyrata subsp. 
lyrata]
Length=829

 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 98/328 (30%), Positives = 157/328 (48%), Gaps = 27/328 (8%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEV  762
            +DA+ G V+ K+   +    ++++G++D +E+L  EL      L +      ++ V +E 
Sbjct  2    VDAITGFVLKKIGGYLINEVSMLIGVKDDLEELKTELTCIHGYLKDVEAREREEEVSKEW  61

Query  761  VQKIQKVVIDAEDAIDKYL--VEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRA  588
             + +  +  D ED +D Y   VEER+ R RG L +   K+           ++ ++K+R 
Sbjct  62   TKLVLDIAYDIEDVLDTYFLKVEERSQR-RG-LSRMTNKIGKTKDAYSIGCDIRNLKRRI  119

Query  587  EKIRLDLELL--------QGG----SLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRL  444
              I    E          QGG    SL   QL  A    H  E+ ++G ++DA+ +  +L
Sbjct  120  LDITRKRETYGIGGFKEPQGGGNISSLRVRQLGRARSVDH--EELVIGLEDDAKILLVKL  177

Query  443  T--EKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDI  270
                K D   +I+I G  G+GKT L + ++N  +++  F  R W YVS       I M I
Sbjct  178  LGDNKEDKRHIISIFGMGGLGKTALARKLYNSGDVKRRFDCRAWTYVSQEYKTGDILMRI  237

Query  269  ISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNN  105
            I +    TSG      +   EE+L   +   L   KY +VVDD+W  E W+ L+ A P N
Sbjct  238  IRSLGM-TSGEELEKIRKFAEEELEVYLHGLLEGKKYLVVVDDIWEQEAWESLKRALPYN  296

Query  104  QKGSRILVTTRVLEVANHVDSKNAPHKF  21
              GSR+++TTR+  +A  VD     HK 
Sbjct  297  HGGSRVIITTRIRALAEGVDGTVYAHKL  324



>gb|ABF00982.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=835

 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 96/330 (29%), Positives = 162/330 (49%), Gaps = 32/330 (10%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++ + +++ +E+L  EL     +    K+   +   +EV 
Sbjct  2    VDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELT---CIHGYLKDVEAREREDEVS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  Y+ V+D    ++ 
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSVVDD----IKI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ   +     V           E+ +VG ++DA+ + 
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGSTSSLRVRQLRRARSVDQEEVVVGLEDDAKILL  174

Query  452  YRLTEKLD-DttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFM  276
             +L +  + +  +I+I G  G+GKT L + ++N  +++  F  R W YVS       I M
Sbjct  175  EKLLDYYEKNRFIISIFGMGGLGKTALARKLYNSGDVKERFKYRAWTYVSQEYKTGDILM  234

Query  275  DIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFP  111
             II +    TSG      +   EE+L   +   L   KY +VVDD+W  E W+ L+ A P
Sbjct  235  RIIRSLGM-TSGEDLEKIRKFAEEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALP  293

Query  110  NNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             N +GSR+++TTR+  VA  VD +   HK 
Sbjct  294  CNHRGSRVIITTRIKAVAEGVDGRFYAHKL  323



>gb|AAS93948.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
 gb|AAS93949.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
 gb|AAS93950.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
 gb|AAS93951.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=835

 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 96/330 (29%), Positives = 162/330 (49%), Gaps = 32/330 (10%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++ + +++ +E+L  EL     +    K+   +   +EV 
Sbjct  2    VDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELT---CIHGYLKDVEAREREDEVS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  Y+ V+D    ++ 
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSVVDD----IKI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ   +     V           E+ +VG ++DA+ + 
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGSTSSLRVRQLRRARSVDQEEVVVGLEDDAKILL  174

Query  452  YRLTEKLD-DttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFM  276
             +L +  + +  +I+I G  G+GKT L + ++N  +++  F  R W YVS       I M
Sbjct  175  EKLLDYYEKNRFIISIFGMGGLGKTALARKLYNSGDVKERFKYRAWTYVSQEYKTGDILM  234

Query  275  DIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFP  111
             II +    TSG      +   EE+L   +   L   KY +VVDD+W  E W+ L+ A P
Sbjct  235  RIIRSLGM-TSGEDLEKIRKFAEEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALP  293

Query  110  NNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             N +GSR+++TTR+  VA  VD +   HK 
Sbjct  294  CNHRGSRVIITTRIKAVAEGVDGRFYAHKL  323



>gb|ADH03608.1| nucleotide binding site and leucine rich repeat protein 4 [Solanum 
melongena]
Length=171

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 68/117 (58%), Gaps = 0/117 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K ++ D  + + F  R WIYVS   +RK++F+ I+ + +  T     + +E+LA  + 
Sbjct  13   LAKKVYTDPSIEYHFHNRAWIYVSQQYSRKEVFLGILESLSLITDEKYKVNDEKLAVELF  72

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
              L   +Y +V+DD+W  E WD L+ AFP    GSRIL+TTR  EVA H + +  PH
Sbjct  73   SHLKSKRYLVVIDDVWTMEAWDDLKMAFPKTASGSRILLTTRNTEVALHANPEGPPH  129



>gb|ACE79504.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=274

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 73/122 (60%), Gaps = 1/122 (1%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSG-YKDMKEEQLAERI  201
            L + +FN   + H F    W+ VS   + K++ +D++S  T      Y+DM E++L +++
Sbjct  41   LARSLFNHPSVYHRFDISSWVTVSQACDAKEMLLDVLSFGTPGGKAMYRDMSEDELLDQV  100

Query  200  QDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
               L   +Y IV+DD+W  E WD +R +FP+++ GSRI++TTR+LEVAN   +   PH  
Sbjct  101  HRELKRKRYLIVLDDMWTIEAWDQVRRSFPDDENGSRIMITTRLLEVANCAGNDFPPHHM  160

Query  20   PI  15
            P 
Sbjct  161  PF  162



>ref|XP_007009194.1| Disease resistance protein RPP8 [Theobroma cacao]
 gb|EOY18004.1| Disease resistance protein RPP8 [Theobroma cacao]
Length=921

 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 92/312 (29%), Positives = 159/312 (51%), Gaps = 10/312 (3%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEE-VV  759
            +A V L I ++   +      +LG+ ++VE L  EL    +  E A +  D+  L   +V
Sbjct  3    EAFVSLAIERISDLLIHEAVFLLGVREEVEGLKAELERMKSSLEDADSRQDQNKLNRTLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRG-RGVLMKWPEKVSYYN---KVNDAAKEMESIKKR  591
            ++I+ +  +AED ID  ++   + RG  G++ K+ E    +    KV     ++ESI K 
Sbjct  63   RQIRDLAYEAEDVIDDSILHAAHQRGFHGIIKKFTEPSHLHKIGVKVKGIQTKLESISKS  122

Query  590  AEKIRLDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRL-TEKLDDttvi  414
                          S+   Q        HV ++++V  ++  + +  +L TE+     V+
Sbjct  123  LPAYNRISGTEGSSSVFEMQQRFRRTYTHVEQEDVVSLEDTTKEVLAQLMTEEDRLHVVV  182

Query  413  aivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDII----SNFTKET  246
            +IVG  GIGKTTL K ++   +++  F    W ++S     +++  D++    S   +E 
Sbjct  183  SIVGMGGIGKTTLAKKVYKHDDVKRHFDCCAWAFISQQCMPREVLHDLLLKLLSPSKEER  242

Query  245  SGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVL  66
                 +KE +L +R+ D L E +Y +V+DD+WR+EDWD  + AFP  +KGS+IL TTR  
Sbjct  243  KLIDKLKEHELVKRLYDVLKEKRYLVVLDDIWRSEDWDNFKPAFPRGRKGSKILFTTRHK  302

Query  65   EVANHVDSKNAP  30
            ++A H D  N+P
Sbjct  303  DLALHADPCNSP  314



>emb|CDP12943.1| unnamed protein product [Coffea canephora]
Length=834

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 92/334 (28%), Positives = 167/334 (50%), Gaps = 38/334 (11%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVE---DLLCELRSFWALSEAAKNCNDKAVLEE  765
            + VV  V  ++   ++E  +L+ G+  +V+   D L  +++F  ++EA ++  D   L+E
Sbjct  3    ETVVSFVSNRLATLLQEEGSLLGGLRQEVQLIKDELGHMKAFLKVAEAKED--DDPRLQE  60

Query  764  VVQKIQKVVIDAEDAIDKYLVE---ERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKK  594
             ++++++   D ED +D++++     R+H   G L +  + +      +  A E++SIK 
Sbjct  61   WIKQVREAAYDIEDVLDEFVLRFAGYRHHGFCGSLQRILKAIKSSPARHQVASEIQSIKS  120

Query  593  RAEKIR-----------LDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYR  447
            R + I            +D  +    ++N+ +  + D    V E +LVG D+  Q +  +
Sbjct  121  RIKNISELRRRYQDEFGIDHRVTGSSTMNDSRRYSRDDALLVEEAKLVGIDQPKQHLISK  180

Query  446  LTEKLDDttvi-aivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDI  270
            L E  D    + ++VG AG+GKTTL+K +  D E+R  F  R W+ VS T +  ++  D+
Sbjct  181  LLEGHDHQLKVISVVGMAGLGKTTLVKKVHEDPEVRKNFPVRAWVTVSQTCDFPKLLRDL  240

Query  269  ISNFTKE-----TSGYKDMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWDYLRTAFPN  108
            I    K+         + M   +L E ++DFL   G+Y IV DD W  E W+ ++ A P 
Sbjct  241  IRQLNKDLDKSVPQSIESMTTAELKEFVKDFLRRAGRYAIVFDDAWDVEFWNEIKFALPE  300

Query  107  NQKGSRILVTTRVLEVANHVDSKNAPHKFPISCS  6
               G+R+++TTR  +VA            P SC+
Sbjct  301  GNYGNRVMLTTRNADVA------------PASCT  322



>ref|XP_010105407.1| Disease resistance protein RPM1 [Morus notabilis]
 gb|EXC04630.1| Disease resistance protein RPM1 [Morus notabilis]
Length=935

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 98/338 (29%), Positives = 170/338 (50%), Gaps = 35/338 (10%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEV--  762
            ++ V  ++ K+   +EE   L+ G  ++V  L  EL S  A    A    D+   EE+  
Sbjct  3    ESAVNFLLEKLSFLLEEEVKLLTGFREEVVSLKAELESMKAFLHVADAVEDED--EEIKV  60

Query  761  -VQKIQKVVIDAEDAIDKYLV-----EERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESI  600
             V+++++   DAED +D+Y        ++ H   G L K    +     ++  A E+ SI
Sbjct  61   WVKQVREASFDAEDILDEYFYRFAEQHQKRHGFYGHLFKIAHTIKTLKSLHRIASELRSI  120

Query  599  KKRAEKI-------RLDLELLQG-GSLNNPQLPAA------DLQAHVAEDELVGFDEDAQ  462
            K R   I       R +  +LQ  GS ++    +A      D    + E +LVG ++  Q
Sbjct  121  KSRVSDISSRHQRYRYNSNILQDEGSSSSAGRKSALYELRRDEALLLEEGQLVGIEKPKQ  180

Query  461  -TIKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQ  285
              + + L +++ +  V+A+VG  G+GKTTL+  ++ D E++  F  R WI VS + + ++
Sbjct  181  ELVSWLLKDEVSNVQVVAVVGMGGLGKTTLVYQVYRDDEVKQRFQHRAWITVSQSFDLRE  240

Query  284  IFMDIISNFTKETSG-------YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYL  126
            + + II    +  +        +KD+    L + +  FL + KY IV+DDLW    WD L
Sbjct  241  LLVQIIEQLLRGIAQPIPNETYFKDIL--SLKQDVICFLGDKKYLIVLDDLWSVGSWDDL  298

Query  125  RTAFPNNQKGSRILVTTRVLEVANHVDS-KNAPHKFPI  15
            + AFP N  GSR++VT+R++EVA+   + +   + FP+
Sbjct  299  KNAFPQNNHGSRLMVTSRIVEVASATTTDRFGGYTFPL  336



>emb|CDX84131.1| BnaC04g08930D [Brassica napus]
Length=755

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 86/321 (27%), Positives = 157/321 (49%), Gaps = 16/321 (5%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWAL-SEAAKNCNDKAVLEEVV  759
            + VV   + K+ + +      + G+ ++V+DL C++R   +L  +A    +   V+   +
Sbjct  3    EGVVSFGVQKLWELLGRESDRLQGVHEKVDDLKCQMRMLQSLLKDADAKKHGSEVVRNFL  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            + ++ +V DAED I+ +L++E +   +GV  +      +       + ++E I KR  K+
Sbjct  63   EDVKDIVFDAEDIIESFLLKELSGNQKGVKGRVKRLACFLVDRRGLSMDIEGITKRMSKV  122

Query  578  RLDLE-------LLQGGSLNNPQLPAADLQAHV--AEDELVGFDEDAQTIKYRLTEKLDD  426
               ++       + +  SL   Q P  + Q +   ++ +LVG ++    +   L E  D 
Sbjct  123  VAQMQGFGIQQIIYRSPSLQERQRPRENRQTYSKRSQKDLVGVEQSVNELVGHLVEN-DS  181

Query  425  ttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKET  246
              V++I G  GIGKTTL + +F+   +R  F    WI VS    +K I+  ++       
Sbjct  182  IQVVSISGMGGIGKTTLARQVFHHDIVRSHFDGFAWICVSQDFKKKDIWQKLLQELRPHD  241

Query  245  SGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVL  66
            +G + M E+ L  +I   L   KY IV+DD+W+ EDWD ++  FP  ++G ++++T+R  
Sbjct  242  TGIEQMNEDTLQAKIFHSLETSKYLIVMDDVWKNEDWDKIKDVFP-QERGWKMILTSRNE  300

Query  65   EVANHVDSKNAPHKFPISCSI  3
             V  H D    P  FP    I
Sbjct  301  GVGLHAD----PSCFPFRPKI  317



>ref|XP_007009190.1| Disease resistance protein RPP8 [Theobroma cacao]
 gb|EOY18000.1| Disease resistance protein RPP8 [Theobroma cacao]
Length=1759

 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 93/316 (29%), Positives = 164/316 (52%), Gaps = 18/316 (6%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEE-VV  759
            DA+V L I ++   +      + G+ ++VE L  EL    +  E A +  ++  L   +V
Sbjct  3    DAIVSLAIERISDLLIHEAVFLRGVREEVEGLKAELERMKSSLEDADSRQEQTKLNRTLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAK----EMESIKKR  591
            ++I+ +   AED ID ++++  +  G   +MK   K  + +K+    K    E+ESI K+
Sbjct  63   RQIRDLAYKAEDVIDDFVLQVAHEGGFDGIMKRFTKPFHLHKIGKKVKAIQTELESISKK  122

Query  590  AEKIRLDLELLQGG----SLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRL-TEKLDD  426
                      + GG    S++  Q        HV E+++V  ++  + +  +L TE+   
Sbjct  123  LPAY----NQISGGEGSRSISEMQQRLRRTYTHVEEEDVVSLEDTTKEVLAQLMTEEDRL  178

Query  425  ttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDII----SNF  258
              V++IVG  GIGKTT+ K ++   +++  F    W ++S     +++  D++    S  
Sbjct  179  HVVVSIVGMGGIGKTTVAKKVYKHDDVKRHFECCAWAFISQQCMPREVLHDLLLKLLSPS  238

Query  257  TKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVT  78
             +E      +KE +L +R+ D L E +Y +V+DD+WR+EDWD  + AFP  +KGS+IL T
Sbjct  239  KEERELIDKLKEHELVKRLYDVLKEKRYLVVLDDIWRSEDWDNFKPAFPRGRKGSKILFT  298

Query  77   TRVLEVANHVDSKNAP  30
            TR  E+A H D  ++P
Sbjct  299  TRHKELALHADPCSSP  314


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 86/302 (28%), Positives = 152/302 (50%), Gaps = 30/302 (10%)
 Frame = -2

Query  863   IEDQVEDLLCEL---RSFWALSEAAKNCNDKAVLEEVVQKIQKVVIDAEDAIDKYLVEER  693
             +  +VE L  EL   +SF    +  +  +D+  L   V++I+ +  DAED ID Y+++  
Sbjct  929   VRQEVESLKAELERMKSFLKDVDRKQGQDDR--LRTRVREIRDLAYDAEDVIDSYILKVA  986

Query  692   NHRGRGVLMKWPEKVSYY----------NKVNDAAKEMES--IKKRAEKIRLDLELLQGG  549
             N  G   ++K    +  +           K+ D +K + +  I    E     +E+ +  
Sbjct  987   NLGGFHRIIKRFSTLHTHKIGKQVKAIQTKLGDISKTLPAYGISGEGEGSNFSVEMQRRL  1046

Query  548   SLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMK  369
               + P         HV ED++V  +   + +  +L +K D   V+++VG  GIGKTTL K
Sbjct  1047  RRSYP---------HVEEDDVVSLEVSTRDVMDQLMKKEDRLRVVSLVGMGGIGKTTLAK  1097

Query  368   MIFNDRELRHEFFTRLWIYVSMTVNRKQIF----MDIISNFTKETSGYKDMKEEQLAERI  201
              ++N  +++  F    W+++S     +++F    + ++S   +E      +KE +L E +
Sbjct  1098  RVYNHNDVKRHFDCCAWVFISQQCMPREVFHGVLIKVLSPSREEREVIDRLKEHELVEML  1157

Query  200   QDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
              D L E +Y +++DD+WR EDWD L+ AFP   +GS++L TTR  EVA   D  + P + 
Sbjct  1158  YDILKEKQYLVILDDIWRCEDWDSLKPAFPKGNEGSKLLFTTRNKEVALLADPHSPPIEL  1217

Query  20    PI  15
             P+
Sbjct  1218  PL  1219



>gb|AAS93962.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=828

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 95/334 (28%), Positives = 153/334 (46%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++ + +++ +E+L  EL     +    K+   +   +EV 
Sbjct  2    VDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELT---CIHGYLKDVEAREREDEVS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  Y+ V+D    ++ 
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSVVDD----IKI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N R+++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   +E+L   +   L   KY +VVDD+W  E W+ L+
Sbjct  231  DILMRIIRSLGM-TSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  290  RALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>ref|XP_010647713.1| PREDICTED: putative disease resistance protein At1g50180 [Vitis 
vinifera]
Length=212

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 98/166 (59%), Gaps = 5/166 (3%)
 Frame = -2

Query  509  AHVAEDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEF-  333
              + +  +VG   D   +  RL  K    TV++IVG  GIGKTTL K ++NDR + + F 
Sbjct  10   PRIEDQGIVGLQNDTIQLVERLLRKDQRRTVVSIVGMGGIGKTTLAKKVYNDRRVVNHFQ  69

Query  332  FTRLWIYVSMTVNRKQIFMDIISNFT----KETSGYKDMKEEQLAERIQDFLMEGKYFIV  165
            + R W+YVS+    + IF  II+  +     E    + ++E++L + + D+L E +YF+V
Sbjct  70   YCRAWVYVSLDCKPRDIFQRIINQISLSSECEAERTEKLQEDELRDFLHDYLKEKRYFVV  129

Query  164  VDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
             DDLW++EDW Y+  AFP  + GSR+L+TTR  +VA H D  +  H
Sbjct  130  FDDLWKSEDWKYVPNAFPRERNGSRLLLTTRNKDVALHADPLSVQH  175



>gb|KHN32382.1| Disease resistance protein RPP13 [Glycine soja]
Length=923

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 171/326 (52%), Gaps = 27/326 (8%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVVQ  756
            D+VV  V+  + Q +     L+ G+ED++  L  EL         +K+   K + + VV 
Sbjct  3    DSVVSFVLDHLSQLLAREAKLLCGVEDRILSLQNELEMINEFLNTSKS--KKGIEKIVVS  60

Query  755  KIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKIR  576
            +I+ V   AED ID +L +   H+ R +L +    V +   ++D +++++ IK    +IR
Sbjct  61   QIRDVAHLAEDVIDTFLAKVVVHKRRSMLGRMLHGVDHAKLLHDLSEKIDKIKITLNEIR  120

Query  575  LD-LELLQGGSLNNPQLPAADLQA--------HVAEDELVGFDEDAQTIKYRLTEKLDDt  423
             + ++ ++    NN      + +A        +V E+++VGF  D++ +  +L E     
Sbjct  121  DNKIKYVEFQESNNQSTIKEEEKAESLHERRRNVEEEDVVGFVHDSKVVIKQLVEG-GSL  179

Query  422  tviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTK---  252
              ++I+G  G+GKTTL + ++N  +++  F  R W+YVS     +++ +D++        
Sbjct  180  RNVSIIGMGGLGKTTLARKVYNSSQVKQYFRCRAWVYVSNECRVRELLLDLLKQLMPNPE  239

Query  251  -----------ETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNN  105
                        T    ++ EE+L + +   L   +Y +V+DD+W+ +DWD ++ AFP+N
Sbjct  240  YEYGGKKKGKKHTQDVSNLSEEELKKLVWKRLERKRYLVVLDDMWKRQDWDKVQDAFPDN  299

Query  104  QKGSRILVTTRVLEVANHVDSKNAPH  27
             +GSRIL+T+R+ E+A+H  S + P+
Sbjct  300  NEGSRILITSRLKELASHT-SHHPPY  324



>ref|XP_007009191.1| Disease resistance protein RPP8 [Theobroma cacao]
 gb|EOY18001.1| Disease resistance protein RPP8 [Theobroma cacao]
Length=922

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 91/316 (29%), Positives = 162/316 (51%), Gaps = 19/316 (6%)
 Frame = -2

Query  932  AVVGLVIGKVVQSVEENETLILGIEDQVEDLLCEL-RSFWALSEAAKNCNDKAVLEE-VV  759
            A+V L I ++   +      +LG+ ++VEDL  EL R   +L +A     D+  L   +V
Sbjct  4    AIVSLAIERISDLLIHEAVFLLGVREEVEDLKAELERMKSSLKDADNKKQDQNELTRTLV  63

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRG-RGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEK  582
            ++I+ +  +AED ID +++   +  G  G++ ++ +    Y        ++++I+ + + 
Sbjct  64   RQIRDLAYEAEDVIDNFILRFAHQGGFHGIIKRFTKPFHLYK----IGVKVKAIQTKLDG  119

Query  581  IRLDLELLQGGSLNNPQLPAADLQA-------HVAEDELVGFDEDAQTIKYRL-TEKLDD  426
            +   L      S        A +Q        HV E++LV  +     +  +L TE+   
Sbjct  120  LSKGLPTYNQISSGEGSSSVAKMQQQLRRTYIHVEEEDLVSLERITNEVLAQLMTEEDRL  179

Query  425  ttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIF----MDIISNF  258
              V++IVG  GIGKTTL K+++   +++  F    W ++S     +Q+     + ++S  
Sbjct  180  HVVVSIVGMGGIGKTTLAKIVYKHIDVKRRFDCCAWAFISQQCMLRQVLQGLLIKLLSPS  239

Query  257  TKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVT  78
             +E      ++E +L E++ DFL E +Y +V DD+WR E W+ L+ AFP  ++GS+IL T
Sbjct  240  KEERELIDKLEENELMEKVYDFLKEKRYLVVFDDIWRKEHWNSLKHAFPRGKEGSKILFT  299

Query  77   TRVLEVANHVDSKNAP  30
            TR  EVA H D  N+P
Sbjct  300  TRNKEVALHADPCNSP  315



>gb|ACN56764.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=836

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 95/334 (28%), Positives = 153/334 (46%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++ + +++ +E+L  EL     +    K+   +   +EV 
Sbjct  2    VDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELT---CIHGYLKDVEAREREDEVS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  Y+ V+D    ++ 
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSVVDD----IKI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N R+++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   +E+L   +   L   KY +VVDD+W  E W+ L+
Sbjct  231  DILMRIIRSLGM-TSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  290  RALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>ref|XP_011028248.1| PREDICTED: uncharacterized protein LOC105128333 [Populus euphratica]
Length=1930

 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 97/329 (29%), Positives = 162/329 (49%), Gaps = 24/329 (7%)
 Frame = -2

Query  935   DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDK-AVLEEVV  759
             + VV  ++ K+   + E    + G+E +VE +  EL    A         D   VL  +V
Sbjct  985   EGVVTFLLTKLADFLVERGKNLAGVECEVEYISDELEFMTAFLRLGDTMEDSDPVLRCLV  1044

Query  758   QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDA----AKEMESIKKR  591
             +K++    D EDA+D + +   + RG G+   +  K++   K   A    A +++SIK R
Sbjct  1045  KKVRDAAYDTEDALDSFSLSHASDRGHGIFSCF-RKIARSIKDKRARRRIASKIQSIKSR  1103

Query  590   AEKIRLDLE--------LLQGGSLNN-PQLPAADLQAHVAEDELVGFDEDA-QTIKYRLT  441
                I             ++QG S N+ P++        + E +LVG ++   Q I++ L 
Sbjct  1104  VISISESHRRYCNKNNIMIQGSSSNSIPRMECQRDALLIEEADLVGIEKPKKQLIEWLLG  1163

Query  440   EKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISN  261
              K     VI++VG  G+GK+TL+K +++D  ++  F  R W+ VS +  R+ +  D+I  
Sbjct  1164  SK-PGREVISVVGMGGLGKSTLVKKVYDDSNMKKHFKFRAWVTVSQSFKREDLLKDMIQQ  1222

Query  260   FTK-----ETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKG  96
               +     +  G   M   +L   I +FL + KY IV+DD+W    W   + A P+N  G
Sbjct  1223  LFRAHRKPDPKGVNSMDYNKLRSVIHEFLQQKKYLIVLDDVWHPSAWHAFQHALPHNNCG  1282

Query  95    SRILVTTRVLEVANHVDSKNAPHK-FPIS  12
             SRILVTTR  EVA+     ++P K +P++
Sbjct  1283  SRILVTTRNTEVAS-TSCMDSPDKVYPLN  1310


 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 90/327 (28%), Positives = 158/327 (48%), Gaps = 22/327 (7%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDK-AVLEEVV  759
            +  V  ++ K+ Q +E+   L+ G+  + E +  EL    A    A    ++   LE +V
Sbjct  3    EGSVSFLLSKLAQILEDEGQLLTGVRTEAEYISDELEFMKAFLRVADAMEERDPSLEVLV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            +K++ +  + EDA+D + +   + RGR           Y+  VN  A+   + + RA K 
Sbjct  63   KKVRDIAYEMEDALDDFKLRLTHDRGRRFFAPLLRSFDYF--VNLRARHQIASRIRAIKS  120

Query  578  RL-------------DLELLQGGSLNN-PQLPAADLQAHVAEDELVGFDEDAQTIKYRLT  441
            R+             +  + QG + ++  +L +      + E +LVG ++  + +   L 
Sbjct  121  RVIGISEAHRRYLIRNNIMGQGSTFSSISRLESQGDGLLLEEADLVGIEKPKRQLIEWLL  180

Query  440  EKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISN  261
             K     V+++VG  G+GK+TL+K +++D +++ +F  R WI VS +  ++++  DII  
Sbjct  181  GKKSGREVVSVVGMGGLGKSTLVKKVYDDPDVKKQFKFRAWITVSQSFKKEELLKDIIQQ  240

Query  260  FTK-----ETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKG  96
              +        G   M  ++L   I  FL + KY IV+DD+W T  W   + A PNN  G
Sbjct  241  LFRVHRKPGPKGVDKMDYDKLRTEINKFLQQRKYLIVLDDVWHTSAWGAFQHALPNNNCG  300

Query  95   SRILVTTRVLEVANHVDSKNAPHKFPI  15
            SRI+VTTR  EVA+          FP+
Sbjct  301  SRIMVTTRNTEVASTACMDFPDRVFPL  327



>emb|CDP16900.1| unnamed protein product [Coffea canephora]
Length=922

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 97/329 (29%), Positives = 169/329 (51%), Gaps = 27/329 (8%)
 Frame = -2

Query  935  DAVVGLVIGKV----VQSVEENETLILGIEDQVE---DLLCELRSFWALSEAAKNCNDKA  777
            +A V LVI K+    +Q   +    +  +  Q+E    LL +++ F   ++  ++  D  
Sbjct  3    EAAVSLVIDKLSNLLIQQTIQQIVFLKNVPGQIERLKTLLIDIQCFLKFADEQQD--DNP  60

Query  776  VLEEVVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMK---WPEKVSYYNKVNDAAKEME  606
            ++   V K++    ++ED I+ ++V+ +  + +G L     +P+++    KV    K +E
Sbjct  61   MIGNWVSKLRDAAYESEDVIETFIVKMQALKKKGFLKNLSCFPKRLLCLCKV---GKNIE  117

Query  605  SIKKRA---EKIRL----DLELLQGGSLNNPQLPAADLQAHVAED-ELVGFDEDAQTIKY  450
            SI+K+    EK RL    D  L +G S    +L      +   ED +LVG +E   ++  
Sbjct  118  SIQKKMLDIEKSRLTFGIDQILGEGTSTRGEELRKLLRSSPFTEDKDLVGLEEKTNSLVA  177

Query  449  RLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDI  270
            +L  +     VI+IVG AG+GKTTL + ++N  ++   F  R W+YVS   + +++ + I
Sbjct  178  QLLVQDSSRRVISIVGMAGVGKTTLARKVYNHVDVIGYFNCRAWVYVSQKCSAQEVLVGI  237

Query  269  ISNFTKETSG----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQ  102
            I    K+T       + M+E  L   +Q+ L +  Y +V+DD+W  E WD L  AFPN  
Sbjct  238  IKQVEKQTKESLELLEGMQEADLERTVQEKLQDKCYLVVLDDIWEEEAWDSLAAAFPNVN  297

Query  101  KGSRILVTTRVLEVANHVDSKNAPHKFPI  15
             GSR+++T+R  +V  H D  + P+K  I
Sbjct  298  NGSRLVMTSRYEKVPQHADDLSKPYKLEI  326



>ref|XP_006446160.1| hypothetical protein CICLE_v10014222mg [Citrus clementina]
 gb|ESR59400.1| hypothetical protein CICLE_v10014222mg [Citrus clementina]
Length=880

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 99/341 (29%), Positives = 163/341 (48%), Gaps = 42/341 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAV----L  771
            +DAVV  V+ ++   + +    +  +  +V  L  EL   W L    K+  DK V    +
Sbjct  2    VDAVVSFVVQRLGDYLIQEAAFLGEVRTEVRSLKKELE--WMLC-FIKDAEDKQVDDPMI  58

Query  770  EEVVQKIQKVVIDAEDAIDKYL--------VEERNHR---------GRGVLMKWPEKVSY  642
             + V  I+ V  D ED +D +         +++R  +            VL +  EK+  
Sbjct  59   RQWVSDIRDVAHDIEDVLDNFTLRVGDSAAIDDRKRKPSFLGKMKICSCVLNQGKEKIDL  118

Query  641  YNKVNDAAKEMESIKKRAEKIRLDLELLQGGSLNNPQLPAA--DLQAHVAE---------  495
            YN      KE+E ++KR   I    E  +  S  N  L A   D+   V E         
Sbjct  119  YN----IGKEIEELRKRVSDISRRRESYRLESATNYYLEAKGRDVSRRVTELRRATSFSI  174

Query  494  -DELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLW  318
               +VGFD+D   +  +L  K     VI++ G  G+GKTTL + I+++ +++++F    W
Sbjct  175  EGNVVGFDDDVSKLLAKLLSKEPRRFVISVYGMGGLGKTTLARKIYHNNDVKNKFDRCAW  234

Query  317  IYVSMTVNRKQIFMDIISNFTKE--TSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRT  144
            + VS   + K + + II +F     T   ++M+EE L   + ++L    Y +VVDD+W+ 
Sbjct  235  VSVSQDYDTKDLLLRIIRSFKINVLTRELEEMREEDLERYLHNYLQGKSYLVVVDDVWQK  294

Query  143  EDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
            E W+ L+ AFP+N+ GSR+++TTR+ EVA   D     HK 
Sbjct  295  ETWESLKRAFPDNKNGSRVIITTRIKEVAERSDENAYAHKL  335



>gb|ABF00980.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=808

 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 95/334 (28%), Positives = 153/334 (46%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++ + +++ +E+L  EL     +    K+   +   +EV 
Sbjct  2    VDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELT---CIHGYLKDVEAREREDEVS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  Y+ V+D    ++ 
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSVVDD----IKI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N R+++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   +E+L   +   L   KY +VVDD+W  E W+ L+
Sbjct  231  DILMRIIRSLGM-TSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  290  RALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>ref|XP_010256293.1| PREDICTED: putative disease resistance protein At1g50180 [Nelumbo 
nucifera]
Length=941

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 99/329 (30%), Positives = 172/329 (52%), Gaps = 29/329 (9%)
 Frame = -2

Query  932  AVVGL--VIGKVVQSVEENETLILGIEDQVEDLLCELR---SFWALSEAAKNCNDKAVLE  768
            A+VGL  V+ K+   + E   L+  ++D VE +   L+   SF    +A +  +++  L 
Sbjct  10   AIVGLSFVVQKLGNLLTEEANLLSEVKDPVEQMQIMLKGINSFLRRMDATQEADEE--LC  67

Query  767  EVVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNK---VNDAAKEMESIK  597
             +   I+ +  DAED ID ++++  + R RGV         Y+N+   + +   E+E+IK
Sbjct  68   SLRADIRNIAYDAEDVIDSFILKVASIRRRGVQSVIKRYACYFNEWMLLCEVGLEIEAIK  127

Query  596  KRAEKIRLDLEL---LQGGSLNNP--QLPAADLQAHV---AEDELVGFDEDAQTIKYRLT  441
            +R   I     +   L+G     P  +LP +  ++      ED+++G +E+ + +  +L 
Sbjct  128  RRIICIWRTYGIGPPLEGEMSTQPPLRLPESRRRSDPDPNEEDDIIGMEEEVEALVEQLM  187

Query  440  EKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDII--  267
            +  +   VIAIVG  G+GKTTL K +++   ++  F    W+YVS     + I  +I+  
Sbjct  188  KPEERCCVIAIVGMGGLGKTTLAKRVYSHNTIKPRFECGAWVYVSEQHRTRDILKEILER  247

Query  266  --SNFTKETSGY-------KDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAF  114
              ++  +E   Y       ++M +E L  +I   L + +Y IV+DD+W  E WD L++AF
Sbjct  248  IDTSTKEEMESYDDDDDDDENMGDESLGLKIYQQLNDKRYLIVLDDIWTKEVWDDLKSAF  307

Query  113  PNNQKGSRILVTTRVLEVANHVDSKNAPH  27
            P+ + GS+ILVTTR + VA HVD +   H
Sbjct  308  PDGKNGSKILVTTRSINVAWHVDPQGRHH  336



>ref|XP_009608888.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Nicotiana tomentosiformis]
Length=538

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 89/315 (28%), Positives = 159/315 (50%), Gaps = 20/315 (6%)
 Frame = -2

Query  932  AVVGLVIGKVVQSVEENETLILG---IEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEE  765
            A +  ++  + Q ++ N+ L+ G    +  +E     L +    L EA K   D    + 
Sbjct  4    AALSSLMHTLQQLLQPNQRLVCGSCIPQQHIESTYQSLSALQVFLEEATKEAKDIETRKS  63

Query  764  VVQKIQKVVIDAEDAIDKYL-----VEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESI  600
            + ++I+ VV   E  +D  L      +  + R R          ++  ++ +  KE++S+
Sbjct  64   LEKRIRDVVYKVEYRVDSRLRSVIVADCGDDRERAC-------KAFNEELQEVEKEVDSL  116

Query  599  KKRAEKIRLDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDtt  420
            KK  E I+++       S       ++  +  + +  +VG ++D   I  RLT +  D T
Sbjct  117  KK--EVIQIEFNKHGSKSAELATTSSSSRRYAIEQYTVVGMEDDFINILDRLTAQTHDLT  174

Query  419  viaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETS-  243
            VI++VG  GIGKTTL +  ++D  +R+ F T  W+ VS   N +Q+ +D+I + +++ + 
Sbjct  175  VISVVGMGGIGKTTLARKAYDDSSIRYRFDTHAWVTVSENYNERQVLLDVIISISRDRTD  234

Query  242  -GYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVL  66
              Y+ M  +QLAE +   L   ++ I++DDLW TE WD ++  FPN+   SRIL+TTR+ 
Sbjct  235  ESYETMSTDQLAEIVYKGLKGRRFLIIIDDLWSTEAWDQMQRLFPNDNNKSRILLTTRLN  294

Query  65   EVANHVDSKNAPHKF  21
             VA++      PH  
Sbjct  295  YVADYASPDFPPHSM  309



>ref|XP_002877510.1| hypothetical protein ARALYDRAFT_905877 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53769.1| hypothetical protein ARALYDRAFT_905877 [Arabidopsis lyrata subsp. 
lyrata]
Length=749

 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 83/320 (26%), Positives = 153/320 (48%), Gaps = 16/320 (5%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEV  762
            +DA+ G ++GK+   + E  ++++ ++D +E L  EL      L +      +  V +E 
Sbjct  2    VDAIAGFLVGKIGNYIIEEASMLMAVKDDLEVLKTELTCIQGYLKDVQARDREDEVSKEW  61

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEK  582
             + +  +  D ED +D Y ++      R    +W  K+      +    ++ ++K R   
Sbjct  62   TKLVLDIAYDIEDVLDTYHMKLEERSQRQGFKRWANKLGRKMDSSSIVDDIRTLKGRILD  121

Query  581  IRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIKYRLTE-K  435
            +    +    G+LN P+    +L + V           E+ +VG ++DA+ +  ++ + K
Sbjct  122  VTRKRKTYGIGNLNEPRGGENNLSSWVRELPHARFVDQEELIVGLEDDAKILLEKILDYK  181

Query  434  LDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFT  255
             +   +I+I G  G+GKT L + + N  ++++ F  R W YVS     K + M IIS+  
Sbjct  182  ENKRYIISIFGMGGLGKTALARKLSNSCDVKNNFEYRAWTYVSQEYKTKDMLMGIISSLG  241

Query  254  ----KETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRI  87
                +E    +    E L   +   L   KY +VVDD+W  E W+ L+ A P N +GSR+
Sbjct  242  VISGEELEKIRMFAAEDLEVYLHSLLEGKKYLVVVDDIWEIEAWESLKRALPENHRGSRV  301

Query  86   LVTTRVLEVANHVDSKNAPH  27
            ++TTR+  VA  +D +   H
Sbjct  302  IITTRIKAVAEGMDERVYAH  321



>gb|AAS93960.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=836

 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 95/334 (28%), Positives = 153/334 (46%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++ + +++ +E+L  EL     +    K+   +   +EV 
Sbjct  2    VDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELT---CIHGYLKDVEAREREDEVS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  Y+ V+D    ++ 
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSVVDD----IKI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N R+++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   +E+L   +   L   KY +VVDD+W  E W+ L+
Sbjct  231  DILMRIIRSLGM-TSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  290  RALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>gb|ACN56769.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=832

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 95/334 (28%), Positives = 152/334 (46%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++ + +++ +E+L  EL     +    K+   +   +EV 
Sbjct  2    VDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELT---CIHGYLKDVEAREREDEVS  58

Query  758  QKIQKVVID----AEDAIDKYL--VEERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y   +EER+ R   R +  K   K+  Y+ V+D    +  
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHSKLEERSQRRGLRRLTNKIGRKMDAYSIVDD----IRI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N R+++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   +E+L   +   L   KY +VVDD+W  E W+ L+
Sbjct  231  DILMRIIRSLGM-TSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  290  RALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>gb|AAS93961.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=841

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 95/334 (28%), Positives = 153/334 (46%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++ + +++ +E+L  EL     +    K+   +   +EV 
Sbjct  2    VDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELT---CIHGYLKDVEAREREDEVS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  Y+ V+D    ++ 
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSVVDD----IKI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N R+++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   +E+L   +   L   KY +VVDD+W  E W+ L+
Sbjct  231  DILMRIIRSLGM-TSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  290  RALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>ref|XP_009136125.1| PREDICTED: probable disease resistance RPP8-like protein 4 [Brassica 
rapa]
 ref|XP_009136126.1| PREDICTED: probable disease resistance RPP8-like protein 4 [Brassica 
rapa]
 ref|XP_009136127.1| PREDICTED: probable disease resistance RPP8-like protein 4 [Brassica 
rapa]
 ref|XP_009136128.1| PREDICTED: probable disease resistance RPP8-like protein 4 [Brassica 
rapa]
 gb|ACP30570.1| disease resistance protein [Brassica rapa subsp. pekinensis]
Length=971

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 91/315 (29%), Positives = 163/315 (52%), Gaps = 25/315 (8%)
 Frame = -2

Query  908  KVVQSVEENETLILGIEDQVEDLLCE---LRSFWALSEAAKNCNDKAVLEEVVQKIQKVV  738
            K++  V      + G+ +QV+DL+ +   L+SF   ++A K   ++  L  +++ ++ V+
Sbjct  14   KLLGVVNRETKRLRGVHEQVDDLIRQKRALQSFLEDADAKKYGCER--LRNLLEDVKDVI  71

Query  737  IDAEDAIDKYLVEERNHRGRGVLMKWPEKVSY--YNKVNDAAKEMESIKKRAEKIRLDL-  567
             DAE   D YL++ER+   +G+ M   ++ S+  YN++   A  +E I KR  K+   + 
Sbjct  72   EDAEATEDSYLLKERSREEKGI-MTCVKRNSFFLYNRLK-FATHIEGINKRISKLIAQMC  129

Query  566  -----ELLQG-GSLNNPQLPAADLQAH-----VAEDELVGFDEDAQTIKYRLTEKLDDtt  420
                 +++ G  S+++ +      +        +E+ LVG ++  +T+   L +  DD  
Sbjct  130  DFRIHKIIDGDCSVSSQERQRVQRETQQTFRPSSENNLVGVEQSVKTLVGHLVDNNDDIQ  189

Query  419  viaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSG  240
            V++I G  GIGKTTL K +F   ++R  F    WIYVS    +K I+  ++ +       
Sbjct  190  VVSISGMGGIGKTTLAKQVFQHVDVRRHFKGFAWIYVSQEFTQKNIWQRVLQDLRPLDGD  249

Query  239  YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEV  60
             K M E  L  ++ + L   +Y IV+DD+W+ E WD ++ AFP  + GS++++T+R   V
Sbjct  250  VKQMDECTLQGKLCELLETSRYLIVLDDVWKDEAWDRIKAAFPLKRGGSKVILTSRNEGV  309

Query  59   ANHVDSKNAPHKFPI  15
              H D    P  FP 
Sbjct  310  GLHAD----PTCFPF  320



>gb|ABF81442.1| NBS-LRR type disease resistance protein [Populus trichocarpa]
Length=948

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 99/331 (30%), Positives = 165/331 (50%), Gaps = 28/331 (8%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDK-AVLEEVV  759
            + VV  ++ K+   + E    + G++ + E +  EL    A    A    D   VL+ ++
Sbjct  3    EGVVTFLLTKLGDFLAERGKQLAGVQGEAEYISDELEFMTAFLRLADAMEDGDPVLKCLI  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDA------AKEMESIK  597
            +K++    D EDA+D + +   +  G G    +  K+S    + DA      A +++SIK
Sbjct  63   KKVRDATYDTEDALDNFSLSLASDTGHGFFSCF-RKIS--RSIKDARARSRIASKIQSIK  119

Query  596  KRAEKIRLDLE--------LLQGGS-LNNPQLPAADLQAHVAEDELVGFDEDA-QTIKYR  447
             R   I             ++QG S +N P+L        + E +LVG ++   Q I++ 
Sbjct  120  SRVISISESHRRYCNKNNIMIQGSSSINIPRLECQKDALLLEEADLVGIEKPKKQLIEWL  179

Query  446  LTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDII  267
            L  K     VI++VG  G+GK+TL+K +++D +++  F  R WI VS +  R+ +  D+I
Sbjct  180  LGSK-SGREVISVVGMGGLGKSTLVKKVYDDSDVKKHFKFRAWITVSQSFKREDLLKDMI  238

Query  266  SNFTK-----ETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQ  102
                +     +  G  +M   +L   I +FL + KY IV+DD+W T  W   + A PNN 
Sbjct  239  QQLFRVHRKPDPKGVDNMNYNKLRSVIHEFLRQKKYLIVLDDVWHTSAWRAFQHALPNNI  298

Query  101  KGSRILVTTRVLEVANHVDSKNAPHK-FPIS  12
             GSRILVTTR  EVA+     ++P K +P++
Sbjct  299  CGSRILVTTRNTEVAS-TSCMDSPDKVYPLN  328



>gb|AAF42831.1|AF209731_1 RPP13 [Arabidopsis thaliana]
Length=831

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 95/334 (28%), Positives = 152/334 (46%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++ + +++ +E+L  EL     +    K+   +   +EV 
Sbjct  2    VDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELT---CIHGYLKDVEAREREDEVS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  Y+ V+D    +  
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSIVDD----IRI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N R+++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   +E+L   +   L   KY +VVDD+W  E W+ L+
Sbjct  231  DILMRIIRSLGM-TSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  290  RALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>ref|XP_008236596.1| PREDICTED: disease resistance protein RPP8-like [Prunus mume]
Length=838

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 90/312 (29%), Positives = 158/312 (51%), Gaps = 16/312 (5%)
 Frame = -2

Query  929  VVGLVIGKVVQSVEENETLILGIEDQVEDLLCELR---SFWALSEAAKNCNDKAVLEEVV  759
             V  V+ K+   + E   L+ G+  +VE L  ELR   SF   ++A +  N++      V
Sbjct  5    AVSAVVEKLTSCITEEALLLEGVGGKVEQLRNELRWMQSFLKDADAEQEKNER--FRNWV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
             +I++V +DAED I  Y+ E  +H    +  K         K+ +    +++I  + E  
Sbjct  63   SQIREVALDAEDVIATYIAEAASHSSWNIAAKLINLHQAGKKIREIKFTVQNISSQKEHF  122

Query  578  RLDLELLQGGSLNNPQLPAADLQ------AHVAEDELVGFDEDAQTIKYRLTEKLDDttv  417
             +     +G    +   P   L+       ++ ED+LV   ED + +  +L+       V
Sbjct  123  GITGTAREGRERTSAS-PNERLRWWRHTSPNIEEDDLVDLVEDTKALLTQLSSMDPHRRV  181

Query  416  iaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGY  237
            ++IVG  G+GKTTL K ++N  ++  +F  + ++YVS   +R+     II+  T      
Sbjct  182  VSIVGMGGLGKTTLAKKLYNHCDITKQFDCKAFVYVSNDYSRRDTLQGIIAA-TIPNCNM  240

Query  236  KDMK---EEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVL  66
            +D+    EE L  ++ + L E +Y +V+DD+W+TE WD +++AFP  + GS++++TTR  
Sbjct  241  EDLTKLAEEALVLKLYELLKERRYLVVLDDIWQTEVWDSMQSAFPRGKMGSKVMLTTRNK  300

Query  65   EVANHVDSKNAP  30
            EVA + D  N P
Sbjct  301  EVALYADPMNEP  312



>gb|AAS93953.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
 gb|ACN56772.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=825

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 95/334 (28%), Positives = 152/334 (46%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++ + +++ +E+L  EL     +    K+   +   +EV 
Sbjct  2    VDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELT---CIHGYLKDVEAREREDEVS  58

Query  758  QKIQKVVID----AEDAIDKYL--VEERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y   +EER+ R   R +  K   K+  Y+ V+D    +  
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHFKLEERSQRRGLRRLTNKIGRKMDAYSIVDD----IRI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N R+++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   +E+L   +   L   KY +VVDD+W  E W+ L+
Sbjct  231  DILMRIIRSLGM-TSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  290  RALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>ref|XP_008231039.1| PREDICTED: probable disease resistance RPP8-like protein 2 [Prunus 
mume]
Length=896

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 96/327 (29%), Positives = 161/327 (49%), Gaps = 32/327 (10%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELR---SFWALSEAAKNCNDKAVLEE  765
            +  V   + K+   + +   L+ G+ ++VE +  ELR   SF   ++ A   +       
Sbjct  3    ELAVATAVEKLTNLIIQEAILLDGVGEKVEQIRNELRWMQSFLKDADHAAEQDRNERFRN  62

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKR--  591
             V +I++V  DAED ++ YL E            W +KV     V+   + +E I+ R  
Sbjct  63   WVSQIREVAFDAEDVVETYLREA----AAASQSLW-KKVVMPIHVHKVKRGIEKIQTRID  117

Query  590  -----------AEKIRLDLELLQGGSLNNPQL-----PAADLQAHVAEDELVGFDEDAQT  459
                       A  I    E  +G    N +L     P      H+ ED+LV   +D + 
Sbjct  118  HISKQKDSFGIASMIASSREGGEGSISTNERLRWWRQPLP----HIEEDDLVDLVQDTEA  173

Query  458  IKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIF  279
            +  +L+       V++IVG  G+GKTTL K ++N  ELRH+F  + ++YVS    R++  
Sbjct  174  LLTQLSSMEPRRRVVSIVGMGGLGKTTLAKKLYNHIELRHQFNCKAFVYVSQEYRRRETL  233

Query  278  MDIISNFTKETSG-YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFP-NN  105
              II +      G  +++ EE++ +++ +FL   KY +V+DD+W  E WD L  AFP + 
Sbjct  234  RRIIKDVNVPYIGDSEEVDEEEMVKQLYEFLRGRKYLVVLDDVWEKEVWDSLEAAFPTSG  293

Query  104  QKGSRILVTTRVLEVANHVDSKNAPHK  24
              GS++++TTR  EVA H D+++ PH+
Sbjct  294  MAGSKVMLTTRNREVALHADARSTPHE  320



>ref|XP_009411155.1| PREDICTED: probable disease resistance RPP8-like protein 2 [Musa 
acuminata subsp. malaccensis]
Length=875

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 89/313 (28%), Positives = 157/313 (50%), Gaps = 17/313 (5%)
 Frame = -2

Query  920  LVIGKVVQSVEENETLILGIEDQVEDLLCELR---SFWALSEAAKNCNDKAVLEEVVQKI  750
            + +GK+ +      TLIL + D+VE     LR   SF    +         +++E V +I
Sbjct  1    MALGKMSEYTFREFTLILNVGDEVEVSRSTLRLLLSFLKDVDQKSRYEHSELIQEWVSQI  60

Query  749  QKVVIDAEDAIDKYLVEERNHRGRGVL---MKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            + +  D ED +D+Y +     R +  L      P ++    ++   AK ++ I +  ++ 
Sbjct  61   RSLAYDIEDVVDEYTLRVGRLRRKCSLKCIANLPTRILARYQL---AKSLQHINRNLQET  117

Query  578  R-----LDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTE-KLDDttv  417
                  L ++ +   SL+  +     L+  VA DE+ GFD D Q I  +L + ++    V
Sbjct  118  SKHASELGIQGIPSSSLSPIKDTNLTLRDDVA-DEVFGFDHDIQVITDQLRDLQVTRRAV  176

Query  416  iaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDII-SNFTKETSG  240
            I+IVG  G GKTTL K ++N + ++  F  R WI VS +     +  +I+      + S 
Sbjct  177  ISIVGMGGSGKTTLAKKVYNSQAVKDHFQCRAWIVVSQSYTATALLTNIMKQTMNIDNSQ  236

Query  239  YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEV  60
             ++M E ++  +I++ L + +Y +V+DDLW+  DW+ ++ AFP     SR+L+TTR ++V
Sbjct  237  IREMDEAEMKNKIREHLKQTRYLVVMDDLWKASDWETIKRAFPEEFTASRVLLTTRKMDV  296

Query  59   ANHVDSKNAPHKF  21
            A   D  + PH  
Sbjct  297  AETADPDSPPHHL  309



>ref|XP_006601748.1| PREDICTED: NBS-LRR disease-resistance protein scn3r1 isoform 
X1 [Glycine max]
Length=884

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 92/324 (28%), Positives = 163/324 (50%), Gaps = 20/324 (6%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSF-WALSEAAKNCNDKAVLEEVV  759
            D +V  +I K+ + + E   L+    D+V  L  ELR     L+ +     D  ++ E+V
Sbjct  3    DTIVVFLIEKLTRLLAEEAKLLGSAHDKVTSLRNELRFMNLFLNNSQGKRKDHNMVAELV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
             +I+ +  +AED ID Y+ +    R R +L K+   V +   + +   +++ IK     I
Sbjct  63   DQIRDIAHEAEDVIDNYISDMIKQRRRNMLEKFGRGVDHALMLRNLTVKIDRIKTTINDI  122

Query  578  RLDLELLQG--GSLNNPQLPAADLQAH---VAEDELVGFDEDAQTIKYRLTEKLDDttvi  414
              D ++  G      + +  A  ++     V E E+VGF  D++ +  +L        ++
Sbjct  123  -FDNKVKYGIEAGRRDSEEEAERIRKQRRDVEEQEVVGFAHDSKVVIEKLMASGSRLKLV  181

Query  413  aivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYK  234
            +IVG  G+GKTTL + I+N   +++ F  R W Y S     ++ F+ ++      TS Y 
Sbjct  182  SIVGMGGLGKTTLARKIYNSNRVKNTFPCRAWGYASNDYRPREFFLSLLKCLL-STSKYN  240

Query  233  DMKEEQ---------LAERIQDFLME--GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRI  87
            D+ +++         L  ++++ L    GKY +VVDD+W+++ WD ++ AFP++  GSRI
Sbjct  241  DLFKKREEASRSEEELKMKVRECLSRSGGKYLVVVDDVWQSQVWDEVKGAFPDDSNGSRI  300

Query  86   LVTTRVLEVANHVDSKNAPHKFPI  15
            L+TTR  EVA+H      P+  P 
Sbjct  301  LITTRHAEVASHAGPM-PPYFLPF  323



>gb|ACP30582.1| disease resistance protein [Brassica rapa subsp. pekinensis]
Length=882

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 86/318 (27%), Positives = 155/318 (49%), Gaps = 14/318 (4%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEV  762
            +DA+ G V+GK+   + +  ++++ + D +E+L  EL      L +      +  V +E 
Sbjct  2    VDAITGYVVGKMGDYLIKQASMLMTVRDDLEELKTELTCIHCYLRDVEAREREDEVSKEW  61

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEK  582
             + +  +  D ED +D Y ++ +    R  LM+   K+       +   ++ S+K++   
Sbjct  62   TKMVLDIAYDVEDVLDTYFLKFKERSQRKGLMRLANKIGEKKDAYNIGDDIRSLKRKLLD  121

Query  581  IRLDLELLQGG-------SLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDt  423
            I    +    G       S    QL  A    H  E+ +VGF++D + +  +L +   + 
Sbjct  122  ITRKRQAYGIGRRFKEVTSWRVRQLRRARPVDH--EELVVGFEDDVKLLLAKLLDDEGER  179

Query  422  tviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFT----  255
             +I+I G  G+GKT L + ++N  +++  F  R W YVS   N + + + II +      
Sbjct  180  YIISIFGMGGLGKTALARKLYNLGDVKRRFEYRAWTYVSQDYNTRDMLLRIIRSLGVASG  239

Query  254  KETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTT  75
            +E    K   EE+L   + D L   +Y +VVDD+W+ + W+ L+ A P N  GSR+++TT
Sbjct  240  EELERIKMFTEEELEAYLHDLLDGRRYLVVVDDIWKQDAWESLKRALPCNHGGSRVIITT  299

Query  74   RVLEVANHVDSKNAPHKF  21
            R+  VA  VD +   HK 
Sbjct  300  RIKAVAEGVDGRVYVHKL  317



>gb|KHN13874.1| Disease resistance protein RPP13 [Glycine soja]
Length=884

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 91/324 (28%), Positives = 162/324 (50%), Gaps = 20/324 (6%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSF-WALSEAAKNCNDKAVLEEVV  759
            D +V  +I K+ + + E   L+    D+V  L  ELR     L+ +     D  ++ E+V
Sbjct  3    DTIVVFLIEKLTRLLAEEAKLLGSAHDKVTSLRNELRFMNLFLNNSQGKRKDHNMVAELV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
             +I+ +  +AED ID Y+ +    R R +L K+   V +   + +   +++ IK     I
Sbjct  63   DQIRDIAHEAEDVIDNYISDMIKQRRRNMLEKFGRGVDHALMLRNLTVKIDRIKTTINDI  122

Query  578  RLDLELLQG--GSLNNPQLPAADLQAH---VAEDELVGFDEDAQTIKYRLTEKLDDttvi  414
              D ++  G      + +  A  ++     V E E+VGF  D++ +  +L        ++
Sbjct  123  -FDNKVKYGIEAGRRDSEEEAERIRKQRRDVEEQEVVGFAHDSKVVIEKLMASGSRLKLV  181

Query  413  aivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYK  234
            +IVG  G+G TTL + I+N   +++ F  R W Y S     ++ F+ ++      TS Y 
Sbjct  182  SIVGMGGLGNTTLARKIYNSNRVKNTFPCRAWGYASNDYRPREFFLSLLKCLL-STSKYN  240

Query  233  DMKEEQ---------LAERIQDFLME--GKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRI  87
            D+ +++         L  ++++ L    GKY +VVDD+W+++ WD ++ AFP++  GSRI
Sbjct  241  DLFKKREEASRSEEELKMKVRECLSRSGGKYLVVVDDVWQSQVWDEVKGAFPDDSNGSRI  300

Query  86   LVTTRVLEVANHVDSKNAPHKFPI  15
            L+TTR  EVA+H      P+  P 
Sbjct  301  LITTRHAEVASHAGPM-PPYFLPF  323



>ref|XP_010023627.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
Length=913

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 91/316 (29%), Positives = 156/316 (49%), Gaps = 25/316 (8%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDK-AVLEEVV  759
            D VV  V+ K+   +EE + L+ G  ++++ +  EL S  A    A    ++   L+  V
Sbjct  3    DGVVTFVLSKLSTVIEEEQYLLRGFREELKHIRDELESIRAFLRVADGMEERDPELKVWV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSY------------YNKVNDAAK  615
            ++++ V  D EDA+D+Y +       RGV   + +KV++            Y   N  A+
Sbjct  63   KQVRDVAFDIEDALDEYAISLVRPTERGV-RSYIQKVTFPLKTLRVRRQIAYRIFNIKAR  121

Query  614  EMESIKKRAEKIRLDLELLQ--GGSLNNPQLPAADLQAH---VAEDELVGFDEDAQTIKY  450
             + SI +R ++ R    +++  G SL +   P  D + +   + E ELVG ++    +  
Sbjct  122  VL-SISERHQRYRYKFSVIEHHGSSLVSRDDPWIDPRGNALLLEESELVGIEKPRNQLVE  180

Query  449  RLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDI  270
             L        V +IVG  G+GKT L K +F+   ++  F +  WI +S + + K +  D+
Sbjct  181  WLVGGDSKLEVTSIVGMGGLGKTALTKKVFDSAVVKSHFASHAWITISRSFDVKDLLRDM  240

Query  269  ISNFTKE-----TSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNN  105
            I    +E       G   M  ++L   I  FL + +Y IV+DDLW ++ W+ ++ A P N
Sbjct  241  IEQLFEEIKLPVPPGVSAMNGDRLKAFIHAFLQQRQYLIVLDDLWSSQAWELMQFALPRN  300

Query  104  QKGSRILVTTRVLEVA  57
              GSRI++TTR  +VA
Sbjct  301  FHGSRIMITTRAADVA  316



>gb|ABF00981.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=829

 Score =   101 bits (252),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 95/334 (28%), Positives = 152/334 (46%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++ + +++ +E+L  EL     +    K+   +   +EV 
Sbjct  2    VDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELT---CIHGYLKDVEAREREDEVS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  Y+ V+D    +  
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSIVDD----IRI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N R+++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   EE+L   +   L   KY +VVDD+W  E W+ L+
Sbjct  231  DILMRIIRSLGM-TSGEELEKIRKFAEEELEVYLYGLLEGKKYLVVVDDIWEREAWESLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++T+R+  VA  VD +   HK 
Sbjct  290  RALPCNHEGSRVIITSRIKAVAEGVDGRFYAHKL  323



>gb|AAS93954.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=825

 Score =   101 bits (252),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 95/334 (28%), Positives = 152/334 (46%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++ + +++ +E+L  EL     +    K+   +   +EV 
Sbjct  2    VDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELT---CIHGYLKDVEAREREDEVS  58

Query  758  QKIQKVVID----AEDAIDKYL--VEERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y   +EER+ R   R +  K   K+  Y+ V+D    +  
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHSKLEERSQRRGLRRLTNKIGRKMDAYSIVDD----IRI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSFRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N R+++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   +E+L   +   L   KY +VVDD+W  E W+ L+
Sbjct  231  DILMRIIRSLGM-TSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  290  RALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>ref|XP_010503265.1| PREDICTED: disease resistance protein RPP13-like [Camelina sativa]
Length=843

 Score =   101 bits (252),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 94/328 (29%), Positives = 161/328 (49%), Gaps = 27/328 (8%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEV  762
            +DA+ G V+GK+   + E  ++++ ++D +EDL  EL      L +      +  V +E 
Sbjct  2    VDAITGFVVGKIGNYLIEETSMLMVVKDDLEDLKTELTCIQGYLKDVEAREQEDEVSKEW  61

Query  761  VQKIQKVVIDAEDAIDKYLV--EERNHRGRGV---LMKWPEKVSYYNKVNDAAKEMESIK  597
             + +  +  D ED +D Y +  EER+ R RG+     K   K+  YN V+D    +  +K
Sbjct  62   TKLVLDIAYDVEDVLDTYFLKLEERSQR-RGLKRLTNKIGRKIDAYNIVDD----IRILK  116

Query  596  KRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIKYR  447
            +R   +    E    G+ +  +   ++L   V           E+ +VG ++DA+ +  +
Sbjct  117  RRILDVTRKRETYGIGNFSERRGGESNLSLRVRELRRARSIDQEELVVGLEDDAKILLEK  176

Query  446  LT-EKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDI  270
            L  E+  +  +I+I G  G+GKT L + ++N  E++  F  R W YVS       I M I
Sbjct  177  LLDEREYNRFIISIFGMGGLGKTALARKLYNSEEVKRRFEYRAWTYVSQEYKTGDILMRI  236

Query  269  ISNF----TKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFP-NN  105
            I +      KE    +   EE+L   +   L   KY +VVDD+W  E W+ L+ A P ++
Sbjct  237  IRSLGVASVKELEKIRKFTEEELEVYLHGILEGKKYLVVVDDIWEREAWESLKRALPCSH  296

Query  104  QKGSRILVTTRVLEVANHVDSKNAPHKF  21
            ++G  +++TTR+  VA  VD +   HK 
Sbjct  297  EEGCIVIITTRIRAVAEGVDGRFYAHKL  324



>ref|XP_009112364.1| PREDICTED: LOW QUALITY PROTEIN: putative disease resistance RPP13-like 
protein 3 [Brassica rapa]
Length=833

 Score =   101 bits (252),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 86/318 (27%), Positives = 155/318 (49%), Gaps = 14/318 (4%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEEV  762
            +DA+ G V+GK+   + +  ++++ + D +E+L  EL      L +      +  V +E 
Sbjct  2    VDAITGYVVGKMGDYLIKQASMLMTVRDDLEELKTELTCIHCYLRDVEAREREDEVSKEW  61

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEK  582
             + +  +  D ED +D Y ++ +    R  LM+   K+       +   ++ S+K++   
Sbjct  62   TKMVLDIAYDVEDVLDTYFLKFKERSQRKGLMRLANKIGEKKDAYNIGDDIRSLKRKLLD  121

Query  581  IRLDLELLQGG-------SLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDt  423
            I    +    G       S    QL  A    H  E+ +VGF++D + +  +L +   + 
Sbjct  122  ITRKRQAYGIGRRFKEVTSWRVRQLRRARPVDH--EELVVGFEDDVKLLLAKLLDDEGER  179

Query  422  tviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFT----  255
             +I+I G  G+GKT L + ++N  +++  F  R W YVS   N + + + II +      
Sbjct  180  YIISIFGMGGLGKTALARKLYNLGDVKRRFEYRAWTYVSQDYNTRDMLLRIIRSLGVASG  239

Query  254  KETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTT  75
            +E    K   EE+L   + D L   +Y +VVDD+W+ + W+ L+ A P N  GSR+++TT
Sbjct  240  EELERIKMFTEEELEAYLHDLLDGRRYLVVVDDIWKQDAWESLKRALPCNHGGSRVIITT  299

Query  74   RVLEVANHVDSKNAPHKF  21
            R+  VA  VD +   HK 
Sbjct  300  RIKAVAEGVDGRVYVHKL  317



>ref|XP_009761982.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=741

 Score =   101 bits (252),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 98/161 (61%), Gaps = 1/161 (1%)
 Frame = -2

Query  497  EDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLW  318
            E+ LVG ++D + I+ +L  +  +  V++IVG   IGK+TL K +FN   +   F    W
Sbjct  43   ENTLVGMEDDFKIIRDQLFGQTPELNVVSIVGMGSIGKSTLAKSLFNHPSVSRRFDISSW  102

Query  317  IYVSMTVNRKQIFMDIISNFTKETSG-YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTE  141
            + VS   + K++ +D++S  T      Y++M E++L +++   L   +Y IV+DD+W  E
Sbjct  103  VTVSQAYDAKEMLLDVLSFGTPGGKAMYRNMSEDELLDQVHRKLKRKRYLIVLDDMWTIE  162

Query  140  DWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKFP  18
             WD +R +FP+++ GSRI++TTR+LEVAN   +   PH  P
Sbjct  163  AWDQVRRSFPDDENGSRIMITTRLLEVANCAGNDFPPHHMP  203



>ref|XP_009608887.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=838

 Score =   101 bits (252),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 91/318 (29%), Positives = 160/318 (50%), Gaps = 26/318 (8%)
 Frame = -2

Query  932  AVVGLVIGKVVQSVEENETLILG-------IEDQVEDLLCELRSFWALSEAAKNCNDKAV  774
            A +  ++  + Q ++ N+ L+ G       IE   + L   L+ F  L EA K   D   
Sbjct  4    AALSSLMHTLQQLLQPNQRLVCGSCIPQQHIESTYQSL-SALQVF--LEEATKEAKDIET  60

Query  773  LEEVVQKIQKVVIDAEDAIDKYL-----VEERNHRGRGVLMKWPEKVSYYNKVNDAAKEM  609
             + + ++I+ VV   E  +D  L      +  + R R          ++  ++ +  KE+
Sbjct  61   RKSLEKRIRDVVYKVEYRVDSRLRSVIVADCGDDRERAC-------KAFNEELQEVEKEV  113

Query  608  ESIKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLD  429
            +S+KK   +I  +    +   L      ++  +  + +  +VG ++D   I  RLT +  
Sbjct  114  DSLKKEVIQIEFNKHGSKSAELATTS--SSSRRYAIEQYTVVGMEDDFINILDRLTAQTH  171

Query  428  DttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKE  249
            D TVI++VG  GIGKTTL +  ++D  +R+ F T  W+ VS   N +Q+ +D+I + +++
Sbjct  172  DLTVISVVGMGGIGKTTLARKAYDDSSIRYRFDTHAWVTVSENYNERQVLLDVIISISRD  231

Query  248  TS--GYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTT  75
             +   Y+ M  +QLAE +   L   ++ I++DDLW TE WD ++  FPN+   SRIL+TT
Sbjct  232  RTDESYETMSTDQLAEIVYKGLKGRRFLIIIDDLWSTEAWDQMQRLFPNDNNKSRILLTT  291

Query  74   RVLEVANHVDSKNAPHKF  21
            R+  VA++      PH  
Sbjct  292  RLNYVADYASPDFPPHSM  309



>ref|XP_004301647.1| PREDICTED: disease resistance protein RPM1-like [Fragaria vesca 
subsp. vesca]
Length=945

 Score =   101 bits (252),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 90/309 (29%), Positives = 155/309 (50%), Gaps = 16/309 (5%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEV-V  759
            ++ V  ++ K+   +EE   L+ GI+ QVE+++ EL    A  +AA    D+   ++V V
Sbjct  3    ESAVMFLVCKLKTLLEEEVNLLSGIKAQVEEMVDELERIQAFLKAADAKEDRDPQKKVWV  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDA----AKEMESIKKR  591
             +++ V  + ED +D +     +  GRG L     K+ Y  K   A    A ++E +K R
Sbjct  63   NQVRNVAHEMEDTLDIFRHSHSHDHGRGFLASL-HKLYYITKKWKARRQVAADIEGLKNR  121

Query  590  AEKIRLDLELLQGGSLNNPQLPAADLQAHVA---EDELVGFDEDAQTIKYRLTEKLDDtt  420
             + +  +  +   GS +  Q+P            E ELV   E  + +   L ++     
Sbjct  122  IKSLERNKFVDPTGSTSAHQVPYQFTPGDATLLEEAELVAIGEPKRKLFELLMKEESTRQ  181

Query  419  viaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIF-------MDIISN  261
            V+ IVG  G+GKTTL+K ++ D +++  F    WI VS + +  ++         ++I  
Sbjct  182  VVPIVGMGGLGKTTLVKQLYEDAKVQKHFKIHAWITVSRSCHMNKLLRRMIHEIFNVIRK  241

Query  260  FTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILV  81
               +    + M + +L ERI+  L   +Y IV+DDLW T DW+ +  A PNN  GSR+++
Sbjct  242  PVPQDEEIESMDDNKLRERIRKLLQHSRYLIVLDDLWNTADWNAINHAMPNNNHGSRVML  301

Query  80   TTRVLEVAN  54
            TTR ++VA+
Sbjct  302  TTRNVKVAS  310



>ref|XP_009773958.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009773959.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=884

 Score =   101 bits (252),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 88/315 (28%), Positives = 159/315 (50%), Gaps = 18/315 (6%)
 Frame = -2

Query  932  AVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKN-CNDKAVLEEVVQ  756
            AV+  ++  + Q  + N  LI    + ++ L   L       E   N  ND+  L+ + +
Sbjct  4    AVITSILTTIEQVFQFNPRLISESRESIDSLYGTLSILQDFLEDTGNWINDQDALKLLEK  63

Query  755  KIQKVVIDAEDAIDKYL----VEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRA  588
            KI+     AED ID  L    V + +H       K      +Y+++ +  + M+SI+   
Sbjct  64   KIRDAGYKAEDTIDCCLRRIHVADTDHEQNNARRK------FYDELQEIIEAMDSIQGDV  117

Query  587  EK---IRLDLELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttv  417
             K   +   ++ +   +   P+ P   L     E+ LVG ++    I+ +L  +     V
Sbjct  118  MKFKNVHKRIKDVPATTYLPPRSPGRVLDE---ENTLVGMEDVFNNIRDQLFGQTPALNV  174

Query  416  iaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIIS-NFTKETSG  240
            ++IVG  GIGK+TL + +FN   +   F    W+ VS   N K++ +D++S       + 
Sbjct  175  VSIVGMGGIGKSTLARSLFNHPSVSRRFDISSWVTVSQAYNAKEMLLDVLSFGILDGKAM  234

Query  239  YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEV  60
            Y++  E++L ++++  L   +Y IV+D++W  E WD +R +FP+++ GSRI++TTR+LEV
Sbjct  235  YRNTSEDELLDQVRRKLKRKRYLIVLDNIWTIEAWDEVRRSFPDDENGSRIMITTRLLEV  294

Query  59   ANHVDSKNAPHKFPI  15
            AN   +  +PH  P+
Sbjct  295  ANCASNDFSPHHMPL  309



>ref|XP_006300711.1| hypothetical protein CARUB_v10019761mg [Capsella rubella]
 gb|EOA33609.1| hypothetical protein CARUB_v10019761mg [Capsella rubella]
Length=621

 Score =   100 bits (250),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 86/282 (30%), Positives = 156/282 (55%), Gaps = 16/282 (6%)
 Frame = -2

Query  866  GIEDQVEDL---LCELRSFWALSEAAKNCNDKAVLEEVVQKIQKVVIDAEDAIDKYLVEE  696
            G+EDQV++L   L  L+SF   +EA K+ +  A +   V+ I++++ DAED ++ +++++
Sbjct  26   GVEDQVDELKTDLGRLKSFMEDAEAKKHTS--ARVRNCVEVIKEIIFDAEDILETFILKD  83

Query  695  RNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKIRLDLELLQG-----GSLNNPQ  531
            +  +  G+            +  + A E+ S+  R  K+  D+E  +G     G + +P+
Sbjct  84   QLQKSGGIKEHMRRLACIIPERREIALEIGSLSNRISKVIRDMET-KGVQKIIGDMRDPE  142

Query  530  -LPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFND  354
             LP     A   +  LVG +E+ + +   L E+ DD  ++ + G  G+GKTTL +  F+ 
Sbjct  143  PLPERKEFARQEKSNLVGLEENVEKLVGYLVEE-DDDPIVLMTGIGGLGKTTLARQAFHH  201

Query  353  RELRHEFFTRLWIYVSMTVNRKQIFMDIISNF-TK-ETSGYKDMKEEQLAERIQDFLMEG  180
             ++  +F    W+ VS   +RK ++ +I+ +F TK E +    MKEE+L + +   L   
Sbjct  202  DKVTEKFDRLAWVCVSQVCDRKIVWQNILQSFRTKAEENEIMQMKEERLQDELSRLLETS  261

Query  179  KYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVAN  54
            K  IV+DD+W+ EDW+ ++  FP+N KG ++L+T+R   VA 
Sbjct  262  KSLIVIDDIWKEEDWNLIKPIFPHN-KGWKVLLTSRNERVAG  302



>emb|CDP12404.1| unnamed protein product [Coffea canephora]
Length=882

 Score =   101 bits (251),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 99/324 (31%), Positives = 166/324 (51%), Gaps = 24/324 (7%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDL---LCELRSFWALSEAAKNCNDKAVLEE  765
            D V  LVI +    + +    + G+  QVE L   L  +R F  L +A +  ++ A +  
Sbjct  3    DPVTSLVIERTGDLLIQKIVFLKGVRRQVESLGDDLERMRCF--LKDADQRQDEDARIRN  60

Query  764  VVQKIQKVVIDAEDAIDKYLVE-ERNHRGRGVLMK---WPEKVSYYNKVNDAAKEMESIK  597
             V +I+    DAED I+ +  + E   + +G++ K   +P K+    K+    KE+ES++
Sbjct  61   WVSEIRAAAYDAEDIIEIFASKVEFFTKKKGLVTKLTYYPLKIVNLYKI---GKEIESLR  117

Query  596  KRAEKIRLDLE------LLQGGSLNNPQLPAADLQAHVAED-ELVGFDEDAQTIKYRLTE  438
             R ++I    E      L +G + +  +L      + ++ED ++VGF+E  +++   L +
Sbjct  118  MRLKEIADSREEYGIKDLGEGMTTHGEELQRIRRSSPLSEDKDIVGFEEMTKSLVAELLK  177

Query  437  KLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNF  258
            +  +  V +IVG  G GKTTL K ++N  ++R  F  R W+ VS + N K+    II   
Sbjct  178  EDRNRRVASIVGMGGAGKTTLAKKVYNHADVRARFNCRAWVCVSSSYNHKETLRTIIKQL  237

Query  257  TKETSGYKD----MKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYL-RTAFPNNQKGS  93
               T+   D    M+E+ L ER+   L +  Y  V+DD+W+   WD L R AFP+    S
Sbjct  238  NPITNELLDMLEKMQEQDLEERLYKDLEDKCYLAVLDDVWKEAAWDCLARKAFPDGSTSS  297

Query  92   RILVTTRVLEVANHVDSKNAPHKF  21
            R+L+T+R   VA H D+ + PH+ 
Sbjct  298  RLLLTSRNRNVAVHADALSIPHEL  321



>emb|CDP12429.1| unnamed protein product [Coffea canephora]
Length=555

 Score =   100 bits (249),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 96/323 (30%), Positives = 172/323 (53%), Gaps = 23/323 (7%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCEL---RSFWALSEAAKNCNDKAVLEE  765
            D+V+ LVIG++V   ++N   +  +E QVE L  +L   R F  L +A +  ++ A +  
Sbjct  3    DSVISLVIGRIVDLQKKNSVFLKDVERQVERLGNDLEWMRCF--LKDAEQRQDEDARIRN  60

Query  764  VVQKIQKVVIDAEDAIDKYLVE-ERNHRGRGVLMK---WPEKVSYYNKVNDAAKEMESIK  597
             V  ++    DAED I+ +  + E   + +G++ K   +P K+    K+    KE+ES++
Sbjct  61   WVSLVRAAAYDAEDVIEIFASKVEFFTKDKGLITKLTYYPLKIVNLYKI---GKEIESLR  117

Query  596  KRAEKIRLDLE------LLQGGSLNNPQLPAADLQAHVAED-ELVGFDEDAQTIKYRLTE  438
             R + I    E      L +G + +  +L      +  +ED ++VGF++  + +   L +
Sbjct  118  MRLKVIADSREEHGINNLGEGITTHGEELQRIRRSSPFSEDKDIVGFEKITKFLVAELMK  177

Query  437  KLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDII---  267
            +  +  V++IVG  G GKTTL K ++N  ++R  F  R W+ VS + + K++   II   
Sbjct  178  EDRNRRVVSIVGMGGAGKTTLAKKVYNHADVRARFNCRAWVCVSSSYDHKEVLRSIIKQL  237

Query  266  SNFTKET-SGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSR  90
            +  +KE     + M+E+ L +R+   L +  Y +V+DD+W+ E WD L  AFP+    SR
Sbjct  238  NTISKELLEVLEKMEEQDLEQRLYQDLQDKCYLVVLDDVWKEEAWDCLARAFPDVNTSSR  297

Query  89   ILVTTRVLEVANHVDSKNAPHKF  21
            +L+T+R   V  H D+ + P++ 
Sbjct  298  LLLTSRNRGVPLHADALSIPYEL  320



>ref|XP_010647271.1| PREDICTED: disease resistance protein RPP13-like isoform X1 [Vitis 
vinifera]
Length=913

 Score =   101 bits (251),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 89/319 (28%), Positives = 160/319 (50%), Gaps = 19/319 (6%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEA-AKNCNDKAVLEEV  762
            ++ V   + ++  ++ +    + G+ +QV+ +  EL+     L +A AK   D+ V    
Sbjct  3    ESAVSFAVERIGDALLQKAIFLKGVHEQVDRMQRELKRMQCFLKDADAKQQEDERV-RHW  61

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEK  582
            V +I+ V  DAEDAID ++    + R +    +  +K+    KV    KE+E+I+ + + 
Sbjct  62   VSEIRDVAYDAEDAIDAFIFNVESGRTKFFPCRMFKKLVSSCKV---GKEIEAIQIKIQD  118

Query  581  IRLDLELLQGGSLNNPQLPAAD-------LQAHVAEDELVGFDEDAQTIKYRLTEKLDDt  423
            I    E     S+      A         +   V E+ +VG  ED   +   L +  +  
Sbjct  119  ISKSRETYGINSIGEAISQAGQRLQKLRYISPLVKEEIIVGLKEDTDKLVEELVKGDERR  178

Query  422  tviaivggagigktTLMKMIFND-RELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKET  246
              +++VG  GIGKTTL K ++ND R + H  F R W YVS     + +F +I++      
Sbjct  179  RAVSMVGMGGIGKTTLAKKVYNDSRVMDHFRFCRAWAYVSQDCRPRDVFQNILNQIPYNP  238

Query  245  SG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILV  81
            +G      + M+E +  + + + L E ++ +V+DD+W ++DW+ L  AFP    GSR+L+
Sbjct  239  TGDEARKIEKMQEHEFGDFLHELLKEQRFLVVLDDVWESDDWERLAKAFPKESNGSRLLL  298

Query  80   TTRVLEVANHVDSKNAPHK  24
            TTR  +VA   D+++ P++
Sbjct  299  TTRKNDVALQADAQSVPYE  317



>emb|CAN72324.1| hypothetical protein VITISV_018384 [Vitis vinifera]
Length=599

 Score =   100 bits (249),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 89/318 (28%), Positives = 158/318 (50%), Gaps = 19/318 (6%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEA-AKNCNDKAVLEEV  762
            ++ V   + ++  ++ +    + G+ +QV+ +  EL+     L +A AK   D+ V    
Sbjct  3    ESAVSFAVERIGDALLQKAIFLKGVHEQVDRMQRELKRMQCFLKDADAKQQEDERV-RHW  61

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEK  582
            V +I  V  DAEDAID ++    + R +    +  +K+    KV    KE+E+I+ + + 
Sbjct  62   VSEIXDVAYDAEDAIDAFIFNVESGRTKFFPCRMFKKLVSSCKV---GKEIEAIQIKIQD  118

Query  581  IRLDLELLQGGSLNNPQLPAAD-------LQAHVAEDELVGFDEDAQTIKYRLTEKLDDt  423
            I    E     S+      A         +   V E+ +VG  ED   +   L +  +  
Sbjct  119  ISKSRETYGINSIGEAISQAGQRLQKLRYISPLVKEEIIVGLKEDTDKLVEELVKGDERR  178

Query  422  tviaivggagigktTLMKMIFND-RELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKET  246
              +++VG  GIGKTTL K ++ND R + H  F R W YVS     + +F +I++      
Sbjct  179  RAVSMVGMGGIGKTTLAKKVYNDSRVMDHFRFCRAWAYVSQDCRPRDVFQNILNQIPYNP  238

Query  245  SG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILV  81
            +G      + M+E +  + + + L E ++ +V+DD+W ++DW+ L  AFP    GSR+L+
Sbjct  239  TGDEARKIEKMQEHEFGDFLHELLKEQRFLVVLDDVWESDDWERLAKAFPKESNGSRLLL  298

Query  80   TTRVLEVANHVDSKNAPH  27
            TTR  +VA   D+++ P+
Sbjct  299  TTRKNDVALQADAQSVPY  316



>ref|XP_009761980.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=766

 Score =   100 bits (250),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 98/161 (61%), Gaps = 1/161 (1%)
 Frame = -2

Query  497  EDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLW  318
            E+ LVG ++D + I+ +L  +  +  V++IVG   IGK+TL K +FN   +   F    W
Sbjct  43   ENTLVGMEDDFKIIRDQLFGQTPELNVVSIVGMGSIGKSTLAKSLFNHPSVSRRFDISSW  102

Query  317  IYVSMTVNRKQIFMDIISNFTKETSG-YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTE  141
            + VS   + K++ +D++S  T      Y++M E++L +++   L   +Y IV+DD+W  E
Sbjct  103  VTVSQAYDAKEMLLDVLSFGTPGGKAMYRNMSEDELLDQVHRKLKRKRYLIVLDDMWTIE  162

Query  140  DWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKFP  18
             WD +R +FP+++ GSRI++TTR+LEVAN   +   PH  P
Sbjct  163  AWDQVRRSFPDDENGSRIMITTRLLEVANCAGNDFPPHHMP  203



>emb|CDP00589.1| unnamed protein product [Coffea canephora]
Length=907

 Score =   101 bits (251),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 89/341 (26%), Positives = 166/341 (49%), Gaps = 36/341 (11%)
 Frame = -2

Query  941  AMDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCNDKAVLEE  765
            A+   VG  +  ++Q ++EN  LI    +++ DL  ++R   A ++E      +   L E
Sbjct  4    AIQVSVGFALQNLLQLIDENRRLISDNYEKITDLQADVRLLKAFMAEYTAKYRNSKPLTE  63

Query  764  VVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAE  585
            +  +I+  V + ED ++ Y+ EE  ++ +    K      + + +    + ++ +  + +
Sbjct  64   LADEIRSRVFEVEDLMETYIAEEILYQSKNFFKKAVRAREHLSNLRILGETVQKLSAKVK  123

Query  584  K-------IRLDL----ELLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTE  438
            K       I L L    EL +  S ++          +   D ++GF++ A  +   L  
Sbjct  124  KTNEDNKEIGLHLVALEELSRESSRHSSMSEENQTGGNQEPDRIIGFEDAADNVLELLGG  183

Query  437  K----------------------LDDttviaivggagigktTLMKMIFNDRELRHEFFTR  324
            K                        +  + +I G  G+GKTTL + + ND  + + FFTR
Sbjct  184  KKLVQGKSEGEEQSNSDAEQHSESKELEMASIHGMLGLGKTTLARKVLNDLRIEYHFFTR  243

Query  323  LWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRT  144
            +++ VS   N+K++ + I+S F K     ++  EE+L   ++  L + KY IV+DD+W+ 
Sbjct  244  IFVTVSNEYNKKEVLLSILSAFIKNIRE-QNKTEEELVGMVRHEL-KYKYLIVMDDVWQN  301

Query  143  EDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
            + W+ ++T  P+N KGSR+LVTTR+  VAN+V +K  P+K 
Sbjct  302  DVWEDIKTFLPDNGKGSRVLVTTRIESVANYVATKTKPYKL  342



>ref|XP_010277702.1| PREDICTED: putative disease resistance protein At1g50180 [Nelumbo 
nucifera]
Length=948

 Score =   101 bits (251),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 90/319 (28%), Positives = 163/319 (51%), Gaps = 16/319 (5%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWA-LSEAAKNCN-DKAVLEEV  762
            D+V+  VI K+   + +   L+  ++DQVE L  ELR     L +A  N   D+  +   
Sbjct  15   DSVISCVISKLGDLLIQEAVLLSEVKDQVEGLQTELRRMKCFLKDADTNQEEDQRRIHNW  74

Query  761  VQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEK  582
            + +I+K  ++ E  +  Y+   +  + +  + +    V     +++  K++E I+++   
Sbjct  75   ITEIRKAAVEVETTVLDYIQAVKVAQKKSFVTRCLCIVKEGVDLHNFGKKVEKIQRKILN  134

Query  581  I---RLDLELLQ-GGSLNNPQLPAADLQ-------AHVAEDELVGFDEDAQTIKYRLTEK  435
            I   R +  +   G  L      +A++Q       +HV ++ ++G DED   I  +L  +
Sbjct  135  ISSSRKNYGIRNIGERLERAGTSSAEMQQQLRWSYSHVVDEYVIGLDEDTMEIVDQLVVE  194

Query  434  LDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNF-  258
                 VI+IVG  G+GKTTL K ++N  +++H F    W ++S   + + +   II    
Sbjct  195  ERRLRVISIVGMGGLGKTTLAKKVYNHNDVKHHFDCCAWAFISQQPSWRDVLQRIIKEVE  254

Query  257  --TKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRIL  84
              +K+    + M+E +L   +   L   +Y +V+DD+WR +DW+ L+ AFPN + GS+I+
Sbjct  255  RPSKKKISLETMQENELVVELHRTLGVKRYLVVLDDIWRKDDWNRLKPAFPNGRNGSKIM  314

Query  83   VTTRVLEVANHVDSKNAPH  27
            +TTR  EVA H D  + PH
Sbjct  315  LTTRNKEVALHADPFSIPH  333



>gb|ACN56770.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=830

 Score =   100 bits (250),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 95/334 (28%), Positives = 151/334 (45%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++ + +++ +E+L  EL     +    K+   +   +EV 
Sbjct  2    VDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELT---CIHGYLKDVEGREREDEVS  58

Query  758  QKIQKVVID----AEDAIDKYLV--EERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y +  EER+ R   R +  K   K+  Y+ V+D    +  
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHLKLEERSQRRGLRRLTNKIGRKMDAYSIVDD----IRI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N  +++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSGDVKERFEYRAWTYVSQEYKTG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   EE+L   +   L   KY +VVDD+W  E W+ L+
Sbjct  231  DILMRIIRSLGM-TSGEELEKIRKFAEEELEVYLHGLLEGKKYLVVVDDIWEREAWESLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++TTR+  VA  VD +   HK 
Sbjct  290  RALPCNHEGSRVIITTRIKAVAEGVDGRFYAHKL  323



>ref|XP_009799403.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=723

 Score =   100 bits (250),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 85/275 (31%), Positives = 145/275 (53%), Gaps = 23/275 (8%)
 Frame = -2

Query  788  NDKAVLEEVVQKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEM  609
            +D   L+ + + I+ +V + ED ID++L++ +  + + +           ++V D + ++
Sbjct  55   SDSKRLKNLEKVIRSIVYEIEDEIDEFLLQAKLQQEKNLFGIKCLDFDRGDRVQDLSSKI  114

Query  608  ESIKKR------------AEKIRL--------DLELLQGGSLNNPQLPAADLQAHVAEDE  489
            +SI  R            A+++ +        D+   + G    PQ    +    V  +E
Sbjct  115  DSILDRINRFIHGKNHPDAKRVLIEDMRREARDVLPRKDGPSVEPQDAWLENNEVVRNNE  174

Query  488  LVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYV  309
            +VG DE+A  + +RL E  ++  VI IVG  G+GKTTL   +++D  + +EFF  +WIYV
Sbjct  175  VVGLDEEANIVIHRLVEGTNELDVIPIVGMFGLGKTTLAMKVYHDSRILYEFFFVIWIYV  234

Query  308  SMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQDFLME-GKYFIVVDDLWRTEDWD  132
              + N K IF+ I+  F +    Y D    +LA+ I DF+ + G+  IV+DD+W ++  +
Sbjct  235  GQSYNLKDIFLKILRCFMRRLEDYHDKDVNELAQIIHDFVAKGGRCLIVLDDVWDSQVVN  294

Query  131  YLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPH  27
             L + FP N KG RI++TTR L VA    S+N PH
Sbjct  295  SLVSVFPKNNKGHRIMMTTRDLSVAKCC-SQN-PH  327



>gb|ABF00975.1| disease resistance protein RPP13 variant [Arabidopsis thaliana]
Length=825

 Score =   100 bits (250),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 94/334 (28%), Positives = 152/334 (46%), Gaps = 40/334 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAVLEEVV  759
            +DA+   V+GK+   + E  ++ + +++ +E+L  EL     +    K+   +   +EV 
Sbjct  2    VDAITEFVVGKIGNYLIEEASMFMAVKEDLEELKTELT---CIHGYLKDVEAREREDEVS  58

Query  758  QKIQKVVID----AEDAIDKYL--VEERNHRG--RGVLMKWPEKVSYYNKVNDAAKEMES  603
            ++  K+V+D     ED +D Y   +EER+ R   R +  K   K+  Y+ V+D    +  
Sbjct  59   KEWSKLVLDFAYDVEDVLDTYHFKLEERSQRRGLRRLTNKIGRKMDAYSIVDD----IRI  114

Query  602  IKKRAEKIRLDLELLQGGSLNNPQLPAADLQAHV----------AEDELVGFDEDAQTIK  453
            +K+R   I    E    G L  PQ         V           E+ +VG ++DA+   
Sbjct  115  LKRRILDITRKRETYGIGGLKEPQGGGNTSSLRVRQLRRARSVDQEEVVVGLEDDAKI--  172

Query  452  YRLTEKLDDttviaivggagigktTLMKM-----IFNDRELRHEFFTRLWIYVSMTVNRK  288
              L EKL D         +  G   L K      ++N R+++  F  R W YVS      
Sbjct  173  --LLEKLLDYEEKNRFIISIFGMGGLGKTALARKLYNSRDVKERFEYRAWTYVSQEYKTG  230

Query  287  QIFMDIISNFTKETSG-----YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLR  123
             I M II +    TSG      +   +E+L   +   L   KY +VVDD+W  E W+ L+
Sbjct  231  DILMRIIRSLGM-TSGEELEKIRKFADEELEVYLHGLLEGKKYLVVVDDIWEREAWESLK  289

Query  122  TAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             A P N +GSR+++TTR+  VA  +D +   HK 
Sbjct  290  RALPCNHEGSRVIITTRIKAVAEGLDGRFYAHKL  323



>ref|XP_006300720.1| hypothetical protein CARUB_v10019767mg [Capsella rubella]
 gb|EOA33618.1| hypothetical protein CARUB_v10019767mg [Capsella rubella]
Length=891

 Score =   100 bits (250),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 86/282 (30%), Positives = 157/282 (56%), Gaps = 16/282 (6%)
 Frame = -2

Query  866  GIEDQVEDL---LCELRSFWALSEAAKNCNDKAVLEEVVQKIQKVVIDAEDAIDKYLVEE  696
            G+EDQV++L   L  L+SF   +EA K+ +  A +   V+ I++++ DAED ++ +++++
Sbjct  26   GVEDQVDELKTDLGRLKSFMEDAEAKKHTS--ARVRNCVEVIKEIIFDAEDILETFILKD  83

Query  695  RNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKIRLDLELLQG-----GSLNNPQ  531
            +  +  G+  +         +  + A E+ S+  R  K+  D+E  QG     G + + Q
Sbjct  84   QLQKSGGIKERMRRLACIIPERREIALEIGSLSNRISKVIRDMET-QGVQKIIGDMRDQQ  142

Query  530  -LPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFND  354
             LP     A   +  LVG +E+ + +   L E+ D+  ++ + G  G+GKTTL +  F+ 
Sbjct  143  PLPERKEFARQEKSNLVGLEENVEKLVGYLVEE-DNDQIVLMTGMGGLGKTTLARQAFHH  201

Query  353  RELRHEFFTRLWIYVSMTVNRKQIFMDIISNF-TK-ETSGYKDMKEEQLAERIQDFLMEG  180
             ++R +F    W+ VS   +RK ++ +I+ +F TK E +    MKEE+L + +   L   
Sbjct  202  DKVREKFDRLAWVCVSQVCDRKNVWQNILQSFRTKAEENEIMQMKEERLQDELSRLLETS  261

Query  179  KYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVAN  54
            K  IV+DD+W+ EDW+ ++  FP ++KG ++L+T+R   VA 
Sbjct  262  KSLIVIDDIWKEEDWNLIKPIFP-HKKGWKVLLTSRNERVAG  302



>emb|CDP16502.1| unnamed protein product [Coffea canephora]
Length=594

 Score =   100 bits (249),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 65/253 (26%), Positives = 125/253 (49%), Gaps = 20/253 (8%)
 Frame = -2

Query  740  VIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKIRLDLE-  564
            V + ED ++ Y+VEE  +R +  + K    + + + +    K ++ + KR E+ R D   
Sbjct  3    VYEVEDVLETYIVEESLYRKKNFVRKVVGSIKHLSDLKSIGKTIQELSKRVEQTRSDNRG  62

Query  563  ----LLQGGSLNNPQLPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttviaivgga  396
                L++G   NN       L+ +   D ++GF++ A  +      KL D    +     
Sbjct  63   YVPVLVEGVKRNNAISKDNQLEGYPEADRIIGFEDAADHVL-----KLIDAAQQSESKLK  117

Query  395  gigktTLMKM--------IFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSG  240
             +    ++ +        +  D  +  +F TR+ + V+    +K++ + I+ +     S 
Sbjct  118  VVSIHGMLGLGKTTLANKVLTDPNIEFQFLTRILVSVTKKYEKKEVLLSILRSLKINISD  177

Query  239  YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEV  60
             ++M E  L  ++++ L + KY +VVDD+W  E+WD L+ AFP+N  GSR+++TTR + V
Sbjct  178  -QNMSEVDLVNKVREEL-KYKYLVVVDDVWDGENWDNLKGAFPDNNNGSRVIITTRDVRV  235

Query  59   ANHVDSKNAPHKF  21
            A +V  K  P++ 
Sbjct  236  AQYVSPKCEPYQL  248



>ref|XP_011018457.1| PREDICTED: disease resistance protein RPM1-like [Populus euphratica]
Length=948

 Score =   100 bits (250),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 99/331 (30%), Positives = 163/331 (49%), Gaps = 28/331 (8%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDK-AVLEEVV  759
            + VV  ++ K+   + E    + G++ + E +  EL    A    A    D   VL  ++
Sbjct  3    EGVVTFLLTKLGDFLAERGKQLAGVQGEAEYISDELEFMTAFLRLADAMEDGDPVLRCLI  62

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDA------AKEMESIK  597
            +K++    D EDA+D + +   +  G G    +  K+S    + DA      A +++SIK
Sbjct  63   KKVRDAAYDTEDALDNFSLSLASDTGHGFFSCF-RKIS--RSIKDARARRRIASKIQSIK  119

Query  596  KRAEKIRLDLE--------LLQGGS-LNNPQLPAADLQAHVAEDELVGFDEDA-QTIKYR  447
             R   I             ++QG S +N P+L        + E +LVG ++   Q I++ 
Sbjct  120  SRVISISESHRRYCNKNNIMIQGSSSINIPRLECQKDALLLEEADLVGIEKPKKQLIEWL  179

Query  446  LTEKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDII  267
            L  K     VI++VG  G+GK+TL+K +++D +++  F  R WI VS +  R+ +  D+I
Sbjct  180  LGSK-SGREVISVVGMGGLGKSTLVKKVYDDSDVKKHFKFRAWITVSQSFKREDLLKDMI  238

Query  266  SNFTK-----ETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQ  102
                +     +  G   M   +L   I +FL + KY IV+DD+W T  W   + A PNN 
Sbjct  239  QQLFRVHRKPDPKGVDSMNYNKLRSVIHEFLRQKKYLIVLDDVWHTSAWRAFQHALPNNI  298

Query  101  KGSRILVTTRVLEVANHVDSKNAPHK-FPIS  12
             GSRILVTTR  EVA+     ++P K +P++
Sbjct  299  CGSRILVTTRNTEVAS-TSCVDSPDKVYPLN  328



>emb|CDP19586.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   100 bits (248),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 95/324 (29%), Positives = 166/324 (51%), Gaps = 24/324 (7%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDL---LCELRSFWALSEAAKNCNDKAVLEE  765
            D V+ LV+ +    + +    + G+   VE L   L  +R F  L +A +  ++ A +  
Sbjct  3    DPVISLVVERTGDLLVQKIVFLKGVRGHVERLQNDLVRMRCF--LKDADQRQDEDARIRN  60

Query  764  VVQKIQKVVIDAEDAIDKYLVE-ERNHRGRGVLMK---WPEKVSYYNKVNDAAKEMESIK  597
             V +I+    DAED I+ +  + E   + +G++ K   +P K+    K+    KE+ES++
Sbjct  61   WVSEIRAAAYDAEDIIEIFASKLEFFTKDKGLVTKLTYYPLKIVNLYKI---GKEIESLR  117

Query  596  KRAEKIRLDLE------LLQGGSLNNPQLPAADLQAHVAED-ELVGFDEDAQTIKYRLTE  438
             R   I    E      L +G + +  +L      +  +E+ ++VGF E  +++   L +
Sbjct  118  MRLNDIADSREEYGINNLGEGMTTHGEELQRIRRSSPFSEEKDVVGFGEITKSLVAELLK  177

Query  437  KLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNF  258
            +  +  V++IVG  G GKTTL K ++N  ++R  F  R W+ VS + N K+    II   
Sbjct  178  EDKNRRVVSIVGMGGAGKTTLAKKVYNHADVRARFDCRAWVCVSSSYNHKETLRTIIKQL  237

Query  257  TKETSGYKDM----KEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPN-NQKGS  93
               T+   DM    +E+ L +R+   L +    +V+DD+W+ E WD L  AFP+ N   S
Sbjct  238  YPMTNELLDMLEKMQEQDLEQRLYQDLQDKCCLVVLDDVWKEEAWDCLAKAFPDVNTSSS  297

Query  92   RILVTTRVLEVANHVDSKNAPHKF  21
            R+L+T+R  +VA H D+++ PH+ 
Sbjct  298  RLLLTSRNRDVAQHADARSKPHEL  321



>ref|XP_006300712.1| hypothetical protein CARUB_v10019761mg [Capsella rubella]
 gb|EOA33610.1| hypothetical protein CARUB_v10019761mg [Capsella rubella]
Length=894

 Score =   100 bits (250),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 86/282 (30%), Positives = 156/282 (55%), Gaps = 16/282 (6%)
 Frame = -2

Query  866  GIEDQVEDL---LCELRSFWALSEAAKNCNDKAVLEEVVQKIQKVVIDAEDAIDKYLVEE  696
            G+EDQV++L   L  L+SF   +EA K+ +  A +   V+ I++++ DAED ++ +++++
Sbjct  26   GVEDQVDELKTDLGRLKSFMEDAEAKKHTS--ARVRNCVEVIKEIIFDAEDILETFILKD  83

Query  695  RNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKIRLDLELLQG-----GSLNNPQ  531
            +  +  G+            +  + A E+ S+  R  K+  D+E  +G     G + +P+
Sbjct  84   QLQKSGGIKEHMRRLACIIPERREIALEIGSLSNRISKVIRDMET-KGVQKIIGDMRDPE  142

Query  530  -LPAADLQAHVAEDELVGFDEDAQTIKYRLTEKLDDttviaivggagigktTLMKMIFND  354
             LP     A   +  LVG +E+ + +   L E+ DD  ++ + G  G+GKTTL +  F+ 
Sbjct  143  PLPERKEFARQEKSNLVGLEENVEKLVGYLVEE-DDDPIVLMTGIGGLGKTTLARQAFHH  201

Query  353  RELRHEFFTRLWIYVSMTVNRKQIFMDIISNF-TK-ETSGYKDMKEEQLAERIQDFLMEG  180
             ++  +F    W+ VS   +RK ++ +I+ +F TK E +    MKEE+L + +   L   
Sbjct  202  DKVTEKFDRLAWVCVSQVCDRKIVWQNILQSFRTKAEENEIMQMKEERLQDELSRLLETS  261

Query  179  KYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVAN  54
            K  IV+DD+W+ EDW+ ++  FP+N KG ++L+T+R   VA 
Sbjct  262  KSLIVIDDIWKEEDWNLIKPIFPHN-KGWKVLLTSRNERVAG  302



>gb|KDO61207.1| hypothetical protein CISIN_1g045150mg [Citrus sinensis]
Length=841

 Score =   100 bits (250),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 97/337 (29%), Positives = 162/337 (48%), Gaps = 40/337 (12%)
 Frame = -2

Query  938  MDAVVGLVIGKVVQSVEENETLILGIEDQVEDLLCEL---RSFWALSEAAKNCNDKAVLE  768
            +DAVV  V+ ++   + +    + G+ D+VE L  EL   + F   +EA +  ND  ++ 
Sbjct  2    VDAVVSFVVQRLGDYLIQEAKTLGGVRDEVESLKKELEWMQCFVKDAEAKQAGND--LIR  59

Query  767  EVVQKIQKVVIDAEDAIDKYLVE-ERNHRGR---------GVLMKWPEKVSYYNKVNDAA  618
            + V  I+ +  DAED +DKY++      R R          +  K  EKVS Y+      
Sbjct  60   QWVSDIRDIAYDAEDVLDKYMLSVTPKKRQRLFAYSIKELNLFSKGKEKVSLYS----IG  115

Query  617  KEMESIKKRAEKIRLDLELLQGGSLNN--PQLPAADLQAHV-----------AEDELVGF  477
            KE+E++ KR  ++    E      L N   +  A   + H+            E+  VGF
Sbjct  116  KEIETLNKRLGEVSRRCE---SYGLQNIIDKSEAEKHELHILKQLRRVSWFDVEENPVGF  172

Query  476  DEDAQTIKYRLTEKLDDttviaivggagig-ktTLMKMIFNDRELRHEFFTRLWIYVSMT  300
            ++D   +  +L    +   ++  + G G   KTTL K +++  +++++F    W+ VS  
Sbjct  173  EDDTDVLLSKLLAGDEPRRLVISIYGMGGLGKTTLAKKLYHSSDVKNKFECCAWVSVSQD  232

Query  299  VNRKQIFMDIISNF----TKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWD  132
               + + + II +F    + E  G ++  EE L   +   L    Y +V+DD+WR  DW+
Sbjct  233  YQFQYLLLRIIKSFNIISSAEEGGLENKSEEDLERCLYKSLQGKTYLMVLDDVWRKVDWE  292

Query  131  YLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKF  21
             LR AFP+N+ GSR+++TTR  EVA   D K   HK 
Sbjct  293  NLRRAFPDNKNGSRVIITTRNREVAERSDEKTYVHKL  329



>ref|XP_009372853.1| PREDICTED: disease resistance protein RPP8-like [Pyrus x bretschneideri]
Length=881

 Score =   100 bits (250),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 91/320 (28%), Positives = 155/320 (48%), Gaps = 25/320 (8%)
 Frame = -2

Query  935  DAVVGLVIGKV------VQSVEENETLILGIEDQVEDLLCELRSFWALSEAAKNCNDKAV  774
            +AVV  V+G+V      +Q  ++    IL + D+++ +LC L+      +A     D   
Sbjct  3    EAVVIFVLGRVADVLAEIQLPKDVRPEILRLRDELKRMLCFLK------DADAKQEDDLQ  56

Query  773  LEEVVQKIQKVVIDAEDAIDKYL--VEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESI  600
            +   V  ++ +  DAED ID Y+  VE   ++    + ++   +   +K+    K++  +
Sbjct  57   VRNWVSDVRNLAYDAEDLIDTYILKVESYKYKKWNFVKRYASTLKARSKI---GKDLVFL  113

Query  599  KKRAEKIRLDLELL------QGGSLNNPQLPAADLQAHVAED-ELVGFDEDAQTIKYRLT  441
            + R   I +  E        +G S  N  L          +D ++VG +ED  T+   L 
Sbjct  114  RTRISDISISHEAYGIRSTGEGTSHANEGLLKLRRSTPRGQDKDIVGLEEDIATLVALLV  173

Query  440  EKLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISN  261
             + D    I+IVG  GIGKTT  K ++N  +++  F  R W+Y+S     + +   II  
Sbjct  174  SE-DQWRAISIVGMGGIGKTTCAKEVYNHADIQTCFDCRAWVYISQQFRTRDVLQSIIKQ  232

Query  260  FTKETSGYKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILV  81
             +  T     + E++L E +   L   +Y IV+DD+W T  +D L  AFPNN  GS++ +
Sbjct  233  VSTRTEDTAKLGEDELEEMLYKLLEGRRYLIVLDDIWSTSAFDSLAKAFPNNHSGSKLFL  292

Query  80   TTRVLEVANHVDSKNAPHKF  21
            TTR   VA H D+++ PH+ 
Sbjct  293  TTRNNNVALHADAQSPPHEL  312



>emb|CDP12397.1| unnamed protein product [Coffea canephora]
Length=849

 Score =   100 bits (250),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 94/323 (29%), Positives = 166/323 (51%), Gaps = 23/323 (7%)
 Frame = -2

Query  935  DAVVGLVIGKVVQSVEENETLILGIEDQVEDL---LCELRSFWALSEAAKNCNDKAVLEE  765
            D V+ LVI +    + +N   + G+  QV+ L   L  +R F  L +A +  ++   +  
Sbjct  3    DPVISLVIKRTSDLLVQNVVFLKGVRRQVDSLKNDLVRMRCF--LKDADQRQDEDERIRN  60

Query  764  VVQKIQKVVIDAEDAIDKYLVE-ERNHRGRGVLMK---WPEKVSYYNKVNDAAKEMESIK  597
             V +I+    DAED I+ +  + E   + +G++ K   +P K+    K+    KE+ES++
Sbjct  61   WVSEIRAAAYDAEDIIEIFANKVEFFTKNKGLVTKLTYYPLKIVNRYKI---GKEIESLR  117

Query  596  KRAEKIRLDLE------LLQGGSLNNPQLPAADLQAHVAED-ELVGFDEDAQTIKYRLTE  438
             R ++I    E      L +G + +  +L        ++ED ++VGF E  +++   L +
Sbjct  118  MRLKEIADSREEYGIKNLGEGMTAHGEELQRIRRSFPLSEDKDVVGFGEITKSLVAELLK  177

Query  437  KLDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNF  258
            +  +  +++IVG  G GKTTL K ++N  ++R  F  R W+ VS + + K+    II   
Sbjct  178  EDKNRRLVSIVGMGGAGKTTLAKKVYNHADVRARFNCRAWVCVSSSYDHKETLRAIIKQL  237

Query  257  TKETSGYKDMKEEQ----LAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSR  90
               T+   DM E+     L ER+   L +  Y +V+DD+W+   WD L  AFP+    SR
Sbjct  238  NPITNELLDMLEKMQELDLEERLYQDLQDKCYLVVLDDVWKEAAWDCLARAFPDVNTSSR  297

Query  89   ILVTTRVLEVANHVDSKNAPHKF  21
            +++T+R  +VA H D+ + PH+ 
Sbjct  298  VVLTSRNRDVAQHADALSKPHEL  320



>ref|XP_009604795.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=817

 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 80/260 (31%), Positives = 133/260 (51%), Gaps = 23/260 (9%)
 Frame = -2

Query  758  QKIQKVVIDAEDAIDKYLVEERNHRGRGVLMKWPEKVSYYNKVNDAAKEMESIKKRAEKI  579
            +KI+     AED ID  L   R H      ++   +   Y+++    + M+SI+    K 
Sbjct  5    EKIRDAGYKAEDTID--LCLRRIHVADSEKVQNNARCKLYDELLQIIEVMDSIQGEVMKF  62

Query  578  RLDLELLQGGSLNNPQLPAADLQAHVA------------EDELVGFDEDAQTIKYRLTEK  435
            + D         +N Q    DL A  +            E+ LVG ++D   I+ +L  +
Sbjct  63   KNDR--------HNNQQDIKDLSAITSSPLRSSGRVWDEENSLVGMEDDFNIIRDQLFRQ  114

Query  434  LDDttviaivggagigktTLMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFT  255
              +  V++IVG  GIGK+TL + +FN   +   F    W+ VS   + K++ +D++S  T
Sbjct  115  TPELNVVSIVGMGGIGKSTLARSLFNHPSVSPRFDISSWVTVSQAYDAKEMLLDVLSFGT  174

Query  254  KETSG-YKDMKEEQLAERIQDFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVT  78
                  Y++M E++L +++   L   +Y IV+DD+W  E WD +R +FP+++ GSRI++T
Sbjct  175  PGGKAMYRNMSEDELLDQVHRKLKRKRYLIVLDDMWTIEAWDQVRRSFPDDENGSRIMIT  234

Query  77   TRVLEVANHVDSKNAPHKFP  18
            TR+LEVAN   +   PH  P
Sbjct  235  TRLLEVANCAGNDFPPHHIP  254



>gb|ACV85787.1| NBS-LRR resistance protein, partial [Hevea brasiliensis]
Length=174

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 71/121 (59%), Gaps = 0/121 (0%)
 Frame = -2

Query  377  LMKMIFNDRELRHEFFTRLWIYVSMTVNRKQIFMDIISNFTKETSGYKDMKEEQLAERIQ  198
            L K+++N  +++  F    W ++S   +   IF  I+     +      MKEE L   ++
Sbjct  7    LAKLVYNRFDVKRHFDCLSWAFISQQFSPGDIFSGILREVGAKWENMGSMKEEDLIRTLK  66

Query  197  DFLMEGKYFIVVDDLWRTEDWDYLRTAFPNNQKGSRILVTTRVLEVANHVDSKNAPHKFP  18
            D L E +Y +V+DD+W+ E WD L+ AFP  +KGS++L TTRV EVA++ D +++P + P
Sbjct  67   DVLKEKRYLVVLDDIWKEEAWDSLKRAFPKGKKGSKVLFTTRVKEVASYADPRSSPVEPP  126

Query  17   I  15
             
Sbjct  127  F  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2448657046752