BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18427_g1_i1 len=909 path=[25:0-73 99:74-99 125:100-115 141:116-142
8760:143-275 298:276-314 336:315-908]

Length=909
                                                                      Score     E

ref|XP_006347453.1|  PREDICTED: uncharacterized protein LOC102593470    164   2e-41   
ref|XP_009611921.1|  PREDICTED: uncharacterized protein LOC104105362    153   1e-37   
ref|XP_004241490.1|  PREDICTED: uncharacterized protein LOC101251994    149   3e-36   
ref|XP_009764377.1|  PREDICTED: uncharacterized protein LOC104216109    147   2e-35   
ref|XP_010663170.1|  PREDICTED: uncharacterized protein LOC104882283    144   2e-34   
emb|CBI15020.3|  unnamed protein product                                137   3e-32   
ref|XP_010027633.1|  PREDICTED: serine/threonine-protein kinase A...    133   7e-31   
ref|XP_011071869.1|  PREDICTED: uncharacterized protein LOC105157223    128   4e-29   
ref|XP_011001531.1|  PREDICTED: serine/threonine-protein kinase A...    126   2e-28   
ref|XP_010101219.1|  hypothetical protein L484_015024                   125   4e-28   
gb|KHG14743.1|  Serine/threonine-protein kinase ATM                     121   9e-27   
ref|XP_002511393.1|  hypothetical protein RCOM_1510520                  120   2e-26   Ricinus communis
ref|XP_007010525.1|  Ataxia-telangiectasia mutated, putative            120   3e-26   
gb|KDP31094.1|  hypothetical protein JCGZ_11470                         118   1e-25   
gb|KDO69625.1|  hypothetical protein CISIN_1g004484mg                   116   3e-25   
ref|XP_006476785.1|  PREDICTED: serine/threonine-protein kinase A...    116   3e-25   
ref|XP_008239794.1|  PREDICTED: serine/threonine-protein kinase ATM     117   3e-25   
gb|KDO69624.1|  hypothetical protein CISIN_1g004484mg                   115   4e-25   
ref|XP_008438442.1|  PREDICTED: serine/threonine-protein kinase A...    113   1e-24   
ref|XP_004152555.1|  PREDICTED: uncharacterized protein LOC101223078    114   1e-24   
ref|XP_006439827.1|  hypothetical protein CICLE_v10018990mg             114   1e-24   
ref|XP_008438434.1|  PREDICTED: serine/threonine-protein kinase A...    113   2e-24   
gb|KGN64312.1|  hypothetical protein Csa_1G046090                       114   2e-24   
ref|XP_006439826.1|  hypothetical protein CICLE_v10018990mg             114   2e-24   
ref|XP_004502088.1|  PREDICTED: serine/threonine-protein kinase A...    113   2e-24   
ref|XP_004502086.1|  PREDICTED: serine/threonine-protein kinase A...    112   3e-24   
ref|XP_009363009.1|  PREDICTED: serine/threonine-protein kinase A...    112   8e-24   
ref|XP_009363011.1|  PREDICTED: serine/threonine-protein kinase A...    112   8e-24   
ref|XP_009363010.1|  PREDICTED: serine/threonine-protein kinase A...    111   3e-23   
ref|XP_008356596.1|  PREDICTED: serine/threonine-protein kinase A...    108   2e-22   
ref|XP_008356597.1|  PREDICTED: serine/threonine-protein kinase A...    108   2e-22   
ref|XP_008393115.1|  PREDICTED: serine/threonine-protein kinase A...    108   2e-22   
ref|XP_002274197.1|  PREDICTED: uncharacterized protein LOC100267992    104   3e-21   Vitis vinifera
ref|XP_010243056.1|  PREDICTED: uncharacterized protein LOC104587226    103   8e-21   
ref|XP_010550678.1|  PREDICTED: serine/threonine-protein kinase ATM   97.4    7e-19   
ref|XP_006404288.1|  hypothetical protein EUTSA_v10010050mg           91.3    1e-16   
sp|Q9M3G7.1|ATM_ARATH  RecName: Full=Serine/threonine-protein kin...  89.7    3e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CAB86487.1|  ataxia-telangiectasia mutated protein (Atm)          89.7    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190402.6|  serine/threonine-protein kinase ATM                 89.7    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010412624.1|  PREDICTED: serine/threonine-protein kinase A...  89.4    4e-16   
ref|XP_007140959.1|  hypothetical protein PHAVU_008G155500g           88.6    5e-16   
ref|XP_010431100.1|  PREDICTED: serine/threonine-protein kinase ATM   89.0    5e-16   
ref|XP_002875882.1|  hypothetical protein ARALYDRAFT_323420           88.2    1e-15   
gb|KHN42764.1|  Serine/threonine-protein kinase ATM                   87.0    2e-15   
ref|XP_006604053.1|  PREDICTED: uncharacterized protein LOC102668...  87.0    2e-15   
ref|XP_010503440.1|  PREDICTED: serine/threonine-protein kinase A...  86.7    2e-15   
ref|XP_006603798.1|  PREDICTED: uncharacterized protein LOC102667...  86.3    3e-15   
ref|XP_010108784.1|  Serine/threonine-protein kinase ATM              85.9    4e-15   
ref|XP_006580692.1|  PREDICTED: uncharacterized protein LOC102666447  84.7    8e-15   
emb|CDY48152.1|  BnaA06g16810D                                        83.6    2e-14   
ref|XP_009149839.1|  PREDICTED: serine/threonine-protein kinase ATM   83.2    2e-14   
gb|KHN27528.1|  Serine/threonine-protein kinase ATM                   83.2    3e-14   
gb|KHN41337.1|  Serine/threonine-protein kinase ATM                   82.8    3e-14   
gb|KHN27440.1|  Serine/threonine-protein kinase ATM                   82.4    4e-14   
ref|XP_006599108.1|  PREDICTED: uncharacterized protein LOC102666...  82.4    4e-14   
ref|XP_009389741.1|  PREDICTED: uncharacterized protein LOC103976260  82.4    4e-14   
ref|XP_002305994.2|  PWWP domain-containing family protein            80.9    1e-13   Populus trichocarpa [western balsam poplar]
ref|XP_006293299.1|  hypothetical protein CARUB_v10019635mg           80.9    1e-13   
ref|XP_007151020.1|  hypothetical protein PHAVU_004G012100g           80.9    2e-13   
ref|XP_009618686.1|  PREDICTED: uncharacterized protein LOC104110833  80.5    2e-13   
ref|XP_010028828.1|  PREDICTED: uncharacterized protein LOC104419024  80.5    2e-13   
gb|KHN14842.1|  Serine/threonine-protein kinase ATM                   80.1    2e-13   
ref|XP_003556846.1|  PREDICTED: uncharacterized protein LOC100777...  80.1    2e-13   
ref|XP_011014432.1|  PREDICTED: uncharacterized protein LOC105118...  79.7    3e-13   
gb|KDP45328.1|  hypothetical protein JCGZ_09577                       79.0    6e-13   
gb|EPS69912.1|  hypothetical protein M569_04853                       78.6    7e-13   
ref|XP_007031489.1|  Tudor/PWWP/MBT superfamily protein, putative...  78.2    1e-12   
ref|XP_009768631.1|  PREDICTED: uncharacterized protein LOC104219632  75.5    8e-12   
gb|KDO55271.1|  hypothetical protein CISIN_1g001285mg                 75.1    1e-11   
ref|XP_011014431.1|  PREDICTED: uncharacterized protein LOC105118...  75.1    1e-11   
ref|XP_006428875.1|  hypothetical protein CICLE_v10010946mg           75.1    1e-11   
ref|XP_006480678.1|  PREDICTED: uncharacterized protein LOC102623...  75.1    1e-11   
emb|CDY39560.1|  BnaCnng09290D                                        75.1    1e-11   
ref|XP_011077382.1|  PREDICTED: uncharacterized protein LOC105161407  74.7    1e-11   
ref|XP_011014430.1|  PREDICTED: uncharacterized protein LOC105118...  74.7    2e-11   
ref|XP_010107594.1|  Serine/threonine-protein kinase ATM              73.9    3e-11   
ref|XP_010691465.1|  PREDICTED: uncharacterized protein LOC104904...  73.6    3e-11   
ref|XP_010244984.1|  PREDICTED: uncharacterized protein LOC104588661  73.9    3e-11   
ref|XP_010691464.1|  PREDICTED: uncharacterized protein LOC104904...  73.6    3e-11   
ref|XP_011097431.1|  PREDICTED: uncharacterized protein LOC105176358  73.6    4e-11   
ref|XP_002524654.1|  conserved hypothetical protein                   73.2    5e-11   Ricinus communis
ref|XP_011098460.1|  PREDICTED: uncharacterized protein LOC105177120  72.8    6e-11   
ref|XP_010936710.1|  PREDICTED: uncharacterized protein LOC105056271  72.0    1e-10   
ref|XP_008233375.1|  PREDICTED: uncharacterized protein LOC103332415  70.9    3e-10   
ref|XP_007218899.1|  hypothetical protein PRUPE_ppa000448mg           70.9    3e-10   
ref|XP_006446521.1|  hypothetical protein CICLE_v10014124mg           69.3    9e-10   
ref|XP_010244981.1|  PREDICTED: uncharacterized protein LOC104588...  69.3    1e-09   
ref|XP_007217668.1|  hypothetical protein PRUPE_ppa1027165mg          69.3    1e-09   
ref|XP_009770150.1|  PREDICTED: uncharacterized protein LOC104220881  69.3    1e-09   
ref|XP_010244983.1|  PREDICTED: uncharacterized protein LOC104588...  69.3    1e-09   
ref|XP_006470311.1|  PREDICTED: biorientation of chromosomes in c...  68.9    1e-09   
ref|XP_008230588.1|  PREDICTED: serine/threonine-protein kinase ATM   68.9    1e-09   
ref|XP_008445854.1|  PREDICTED: uncharacterized protein LOC103488...  68.6    2e-09   
ref|XP_008445855.1|  PREDICTED: uncharacterized protein LOC103488...  68.6    2e-09   
ref|XP_004143691.1|  PREDICTED: uncharacterized protein LOC101204371  68.6    2e-09   
gb|KGN50467.1|  hypothetical protein Csa_5G175900                     68.6    2e-09   
ref|XP_009626439.1|  PREDICTED: uncharacterized protein LOC104117141  68.2    3e-09   
emb|CDP02101.1|  unnamed protein product                              67.8    3e-09   
ref|XP_010922513.1|  PREDICTED: uncharacterized protein LOC105045809  67.4    3e-09   
emb|CBI32687.3|  unnamed protein product                              67.4    4e-09   
ref|XP_006340456.1|  PREDICTED: dentin sialophosphoprotein-like       67.4    5e-09   
ref|XP_004304398.1|  PREDICTED: uncharacterized protein LOC101301224  67.0    5e-09   
ref|XP_008782569.1|  PREDICTED: uncharacterized protein LOC103702061  67.0    5e-09   
ref|XP_004308807.1|  PREDICTED: uncharacterized protein LOC101303077  66.6    8e-09   
ref|XP_010653513.1|  PREDICTED: uncharacterized protein LOC104880050  66.2    9e-09   
ref|XP_008447578.1|  PREDICTED: uncharacterized protein LOC103489995  65.9    1e-08   
ref|XP_004154809.1|  PREDICTED: uncharacterized protein LOC101228...  65.9    1e-08   
ref|XP_009398938.1|  PREDICTED: uncharacterized protein LOC103983451  65.9    1e-08   
ref|XP_004146836.1|  PREDICTED: uncharacterized protein LOC101208...  65.9    1e-08   
ref|XP_006381494.1|  PWWP domain-containing family protein            65.9    1e-08   
ref|XP_004237664.1|  PREDICTED: uncharacterized protein LOC101249817  65.9    1e-08   
ref|XP_004489260.1|  PREDICTED: histone-lysine N-methyltransferas...  65.9    1e-08   
gb|EPS58866.1|  hypothetical protein M569_15946                       65.5    2e-08   
ref|XP_007009720.1|  Tudor/PWWP/MBT superfamily protein isoform 3     65.5    2e-08   
ref|XP_008795920.1|  PREDICTED: uncharacterized protein LOC103711526  65.1    3e-08   
ref|XP_009334089.1|  PREDICTED: uncharacterized protein LOC103926...  65.1    3e-08   
ref|XP_009334091.1|  PREDICTED: uncharacterized protein LOC103926...  65.1    3e-08   
ref|XP_009334090.1|  PREDICTED: uncharacterized protein LOC103926...  64.7    3e-08   
ref|XP_006595360.1|  PREDICTED: uncharacterized protein LOC102661771  64.7    3e-08   
gb|KHN48326.1|  Serine/threonine-protein kinase ATM                   64.7    3e-08   
ref|XP_008368948.1|  PREDICTED: uncharacterized protein LOC103432529  64.3    4e-08   
ref|XP_007009718.1|  Tudor/PWWP/MBT superfamily protein isoform 1     64.3    4e-08   
ref|XP_007009723.1|  Tudor/PWWP/MBT superfamily protein isoform 6     64.3    4e-08   
ref|XP_007009722.1|  Tudor/PWWP/MBT superfamily protein isoform 5     64.3    4e-08   
ref|XP_007145450.1|  hypothetical protein PHAVU_007G240300g           64.3    4e-08   
ref|XP_008379239.1|  PREDICTED: uncharacterized protein LOC103442246  64.3    5e-08   
ref|XP_003518622.2|  PREDICTED: uncharacterized protein LOC100813734  63.9    5e-08   
gb|KHN47220.1|  Putative oxidoreductase GLYR1-like protein            63.9    5e-08   
ref|XP_010108444.1|  hypothetical protein L484_014115                 63.9    6e-08   
ref|XP_008789045.1|  PREDICTED: uncharacterized protein LOC103706650  63.9    7e-08   
ref|XP_010920927.1|  PREDICTED: uncharacterized protein LOC105044657  63.5    7e-08   
ref|XP_008792208.1|  PREDICTED: uncharacterized protein LOC103708880  63.5    7e-08   
ref|XP_009375117.1|  PREDICTED: uncharacterized protein LOC103963962  63.5    8e-08   
ref|XP_009125469.1|  PREDICTED: uncharacterized protein LOC103850466  63.2    9e-08   
emb|CDY04873.1|  BnaAnng00550D                                        63.2    9e-08   
ref|XP_004299968.1|  PREDICTED: uncharacterized protein LOC101294948  63.2    1e-07   
ref|XP_010909545.1|  PREDICTED: uncharacterized protein LOC105035...  63.2    1e-07   
ref|XP_006338569.1|  PREDICTED: uncharacterized protein LOC102594150  63.2    1e-07   
ref|XP_010909549.1|  PREDICTED: uncharacterized protein LOC105035...  63.2    1e-07   
ref|XP_010452156.1|  PREDICTED: uncharacterized protein LOC104734309  63.2    1e-07   
ref|XP_010940066.1|  PREDICTED: uncharacterized protein LOC105058741  62.8    1e-07   
gb|KEH35199.1|  hypothetical protein MTR_3g081560                     62.8    1e-07   
gb|KEH35198.1|  hypothetical protein MTR_3g081560                     62.8    1e-07   
ref|NP_195915.1|  PWWP domain-containing protein                      62.4    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|KEH35197.1|  hypothetical protein MTR_3g081560                     62.8    1e-07   
gb|ABA99605.2|  expressed protein                                     62.4    2e-07   Oryza sativa Japonica Group [Japonica rice]
gb|KDP29073.1|  hypothetical protein JCGZ_16462                       62.4    2e-07   
ref|XP_009333744.1|  PREDICTED: uncharacterized protein LOC103926653  62.4    2e-07   
ref|XP_002871003.1|  PWWP domain-containing protein                   62.4    2e-07   
ref|XP_010907525.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  62.4    2e-07   
ref|XP_008783703.1|  PREDICTED: uncharacterized protein LOC103702...  62.4    2e-07   
ref|XP_008783706.1|  PREDICTED: uncharacterized protein LOC103702...  62.4    2e-07   
ref|XP_008376297.1|  PREDICTED: uncharacterized protein LOC103439518  62.4    2e-07   
ref|XP_006287103.1|  hypothetical protein CARUB_v10000267mg           62.4    2e-07   
ref|XP_006287104.1|  hypothetical protein CARUB_v10000267mg           62.0    2e-07   
ref|XP_006287105.1|  hypothetical protein CARUB_v10000267mg           62.0    2e-07   
ref|XP_007041274.1|  Tudor/PWWP/MBT superfamily protein               62.0    2e-07   
ref|XP_004514381.1|  PREDICTED: uncharacterized protein LOC101505...  62.0    2e-07   
ref|XP_008341452.1|  PREDICTED: uncharacterized protein LOC103404331  62.0    3e-07   
ref|NP_001177080.1|  Os12g0638500                                     61.6    3e-07   
gb|KEH42283.1|  PWWP domain protein                                   61.6    3e-07   
ref|XP_009378128.1|  PREDICTED: uncharacterized protein LOC103966657  61.6    3e-07   
ref|XP_006843248.1|  hypothetical protein AMTR_s00080p00099010        61.6    3e-07   
emb|CDY55692.1|  BnaC02g03440D                                        61.2    3e-07   
ref|XP_006588756.1|  PREDICTED: uncharacterized protein LOC102668...  61.2    4e-07   
ref|XP_008805032.1|  PREDICTED: uncharacterized protein LOC103718...  61.6    4e-07   
ref|XP_008805033.1|  PREDICTED: uncharacterized protein LOC103718...  61.6    4e-07   
ref|XP_008805031.1|  PREDICTED: uncharacterized protein LOC103718...  61.6    4e-07   
gb|KHG05776.1|  Serine/threonine-protein kinase ATM                   61.2    4e-07   
ref|XP_008805030.1|  PREDICTED: uncharacterized protein LOC103718...  61.6    4e-07   
ref|XP_010423790.1|  PREDICTED: uncharacterized protein LOC104708...  61.2    5e-07   
emb|CAN75603.1|  hypothetical protein VITISV_016382                   61.2    5e-07   Vitis vinifera
ref|XP_010658450.1|  PREDICTED: uncharacterized protein LOC100852...  61.2    5e-07   
ref|XP_010423789.1|  PREDICTED: uncharacterized protein LOC104708...  61.2    5e-07   
ref|XP_003633464.2|  PREDICTED: uncharacterized protein LOC100852...  61.2    5e-07   
ref|XP_010558277.1|  PREDICTED: uncharacterized protein LOC104826984  61.2    5e-07   
ref|XP_009797650.1|  PREDICTED: uncharacterized protein LOC104244049  60.5    8e-07   
ref|XP_009412529.1|  PREDICTED: uncharacterized protein LOC103994003  60.5    8e-07   
ref|XP_006664785.1|  PREDICTED: uncharacterized protein LOC102706435  60.1    9e-07   
gb|EYU39558.1|  hypothetical protein MIMGU_mgv1a000539mg              60.1    1e-06   
dbj|BAC84060.1|  PWWP domain protein-like                             59.7    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007144530.1|  hypothetical protein PHAVU_007G163600g           60.1    1e-06   
ref|XP_004497463.1|  PREDICTED: uncharacterized protein LOC101489416  59.7    1e-06   
ref|XP_009609374.1|  PREDICTED: uncharacterized protein LOC104103193  59.7    1e-06   
ref|XP_003535180.1|  PREDICTED: uncharacterized protein LOC100784...  59.7    1e-06   
ref|XP_010555830.1|  PREDICTED: uncharacterized protein LOC104825...  59.3    2e-06   
ref|XP_010555832.1|  PREDICTED: protein starmaker isoform X2          59.3    2e-06   
ref|XP_009416273.1|  PREDICTED: uncharacterized protein LOC103996931  59.3    2e-06   
ref|XP_011077037.1|  PREDICTED: uncharacterized protein LOC105161140  59.7    2e-06   
ref|XP_011004163.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  59.3    2e-06   
ref|XP_008353472.1|  PREDICTED: uncharacterized protein DDB_G0284...  58.5    3e-06   
ref|XP_010490766.1|  PREDICTED: uncharacterized protein LOC104768466  58.5    3e-06   
gb|KHF99550.1|  Serine/threonine-protein kinase ATM                   58.5    4e-06   
ref|XP_010667237.1|  PREDICTED: uncharacterized protein LOC104884308  58.2    4e-06   
ref|XP_003597929.1|  DNA (cytosine-5)-methyltransferase 3B            58.2    4e-06   
gb|KHF99551.1|  Serine/threonine-protein kinase ATM                   58.5    4e-06   
ref|XP_004246694.1|  PREDICTED: uncharacterized protein LOC101257296  58.2    4e-06   
ref|XP_006361776.1|  PREDICTED: uncharacterized protein LOC102582027  58.2    4e-06   
ref|XP_008670690.1|  PREDICTED: uncharacterized protein LOC103647958  57.8    5e-06   
ref|XP_004958807.1|  PREDICTED: uncharacterized protein LOC101756159  57.8    5e-06   
ref|XP_008239184.1|  PREDICTED: uncharacterized protein LOC103337797  57.8    6e-06   
gb|EMT20341.1|  hypothetical protein F775_27609                       57.4    6e-06   
gb|EMS55544.1|  hypothetical protein TRIUR3_18554                     57.4    7e-06   
gb|EYU42580.1|  hypothetical protein MIMGU_mgv1a002574mg              57.4    7e-06   
ref|XP_007207227.1|  hypothetical protein PRUPE_ppa001037mg           57.0    1e-05   
ref|XP_006398750.1|  hypothetical protein EUTSA_v10015666mg           57.0    1e-05   
ref|NP_001152302.1|  LOC100285941                                     56.6    1e-05   Zea mays [maize]
tpg|DAA64263.1|  TPA: hypothetical protein ZEAMMB73_813518            56.6    1e-05   
gb|KEH37804.1|  dentin sialophosphoprotein-like protein, putative     56.2    2e-05   
ref|XP_002877998.1|  hypothetical protein ARALYDRAFT_348567           56.2    2e-05   
ref|XP_010232920.1|  PREDICTED: serine/threonine-protein kinase ATM   56.6    2e-05   
ref|XP_009402237.1|  PREDICTED: uncharacterized protein LOC103986084  56.2    2e-05   
gb|EYU38511.1|  hypothetical protein MIMGU_mgv1a002322mg              55.8    2e-05   
ref|XP_006436203.1|  hypothetical protein CICLE_v10030525mg           56.2    2e-05   
ref|XP_006485937.1|  PREDICTED: uncharacterized protein LOC102624...  55.8    2e-05   
ref|XP_006485935.1|  PREDICTED: uncharacterized protein LOC102624...  55.8    3e-05   
ref|XP_006485936.1|  PREDICTED: uncharacterized protein LOC102624...  55.8    3e-05   
ref|XP_006436204.1|  hypothetical protein CICLE_v10030525mg           55.8    3e-05   
gb|KDO44586.1|  hypothetical protein CISIN_1g0465681mg                55.8    3e-05   
ref|XP_007027247.1|  Tudor/PWWP/MBT superfamily protein, putative...  55.5    4e-05   
emb|CBI34908.3|  unnamed protein product                              55.1    4e-05   
ref|XP_007145981.1|  hypothetical protein PHAVU_006G003100g           54.3    4e-05   
gb|EAZ05249.1|  hypothetical protein OsI_27451                        54.7    5e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_004960949.1|  PREDICTED: uncharacterized protein LOC101772251  54.3    6e-05   
ref|XP_006292354.1|  hypothetical protein CARUB_v10018567mg           54.3    7e-05   
ref|XP_011029709.1|  PREDICTED: uncharacterized protein LOC105129...  54.3    8e-05   
ref|XP_009342411.1|  PREDICTED: uncharacterized protein LOC103934392  54.3    8e-05   
ref|XP_011030845.1|  PREDICTED: uncharacterized protein LOC105129...  54.3    8e-05   
ref|XP_010672904.1|  PREDICTED: uncharacterized protein LOC104889395  54.3    9e-05   
ref|XP_009125134.1|  PREDICTED: uncharacterized protein LOC103850169  53.9    9e-05   
gb|KEH41352.1|  PWWP domain protein                                   53.9    1e-04   
ref|XP_002312039.2|  hypothetical protein POPTR_0008s04420g           54.3    1e-04   Populus trichocarpa [western balsam poplar]
gb|KHG16636.1|  Serine/threonine-protein kinase ATM                   53.9    1e-04   
gb|KHN01009.1|  Serine/threonine-protein kinase ATM                   53.5    1e-04   
ref|NP_189424.1|  PWWP domain-containing protein                      53.5    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403539.1|  hypothetical protein EUTSA_v10010166mg           53.5    1e-04   
gb|EYU39555.1|  hypothetical protein MIMGU_mgv1a004961mg              53.1    1e-04   
ref|XP_006403540.1|  hypothetical protein EUTSA_v10010125mg           53.5    1e-04   
gb|EPS66971.1|  hypothetical protein M569_07806                       51.2    1e-04   
emb|CDP04304.1|  unnamed protein product                              53.5    2e-04   
ref|XP_006403541.1|  hypothetical protein EUTSA_v10010125mg           53.5    2e-04   
ref|XP_010559062.1|  PREDICTED: uncharacterized protein LOC104827...  53.1    2e-04   
ref|XP_006658178.1|  PREDICTED: uncharacterized protein LOC102702674  53.1    2e-04   
ref|XP_010559140.1|  PREDICTED: uncharacterized protein LOC104827...  53.1    2e-04   
ref|XP_010067263.1|  PREDICTED: uncharacterized protein LOC104454184  53.5    2e-04   
ref|XP_010559212.1|  PREDICTED: uncharacterized protein LOC104827...  53.1    2e-04   
ref|XP_010559004.1|  PREDICTED: uncharacterized protein LOC104827...  53.1    2e-04   
ref|XP_011027012.1|  PREDICTED: uncharacterized protein LOC105127...  53.1    2e-04   
ref|XP_011027011.1|  PREDICTED: uncharacterized protein LOC105127...  53.1    2e-04   
ref|XP_002315275.2|  dentin sialophosphoprotein                       53.1    2e-04   Populus trichocarpa [western balsam poplar]
ref|NP_001060739.1|  Os07g0694500                                     52.8    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006845020.1|  hypothetical protein AMTR_s00058p00210830        53.1    2e-04   
gb|AES60956.2|  PWWP domain protein                                   52.8    3e-04   
ref|XP_003590705.1|  Serine/threonine protein kinase ATM              52.8    3e-04   
ref|XP_004232301.1|  PREDICTED: uncharacterized protein LOC101252451  52.4    3e-04   
ref|XP_010676648.1|  PREDICTED: uncharacterized protein LOC104892420  52.4    3e-04   
ref|XP_002457524.1|  hypothetical protein SORBIDRAFT_03g008710        52.4    3e-04   Sorghum bicolor [broomcorn]
ref|XP_004495241.1|  PREDICTED: uncharacterized protein LOC101489065  52.4    4e-04   
ref|XP_008387636.1|  PREDICTED: uncharacterized protein LOC103450090  52.4    4e-04   
ref|XP_002523905.1|  hypothetical protein RCOM_1068550                52.4    4e-04   Ricinus communis
emb|CDX67452.1|  BnaA07g14920D                                        51.6    5e-04   
ref|XP_007145980.1|  hypothetical protein PHAVU_006G003000g           51.6    6e-04   
ref|XP_009139214.1|  PREDICTED: uncharacterized protein LOC103863207  51.2    7e-04   
gb|KDP37396.1|  hypothetical protein JCGZ_08407                       51.2    8e-04   
ref|XP_008656837.1|  PREDICTED: uncharacterized protein LOC103636254  51.2    8e-04   
gb|AFW82255.1|  putative PWWP domain family protein                   50.8    0.001   
ref|XP_003628350.1|  hypothetical protein MTR_8g054270                48.1    0.001   
emb|CDY64697.1|  BnaA04g27700D                                        50.8    0.001   
ref|XP_009139211.1|  PREDICTED: uncharacterized protein LOC103863205  50.8    0.001   



>ref|XP_006347453.1| PREDICTED: uncharacterized protein LOC102593470 [Solanum tuberosum]
Length=1145

 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 112/160 (70%), Gaps = 3/160 (2%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETTAQIVFAQSSDAEVACQSLGKS  300
             L+L FTPG P+PS E +  TF  FGP+ E++T + +++TAQ+VF + SDA  A QSL   
Sbjct  985   LLLYFTPGSPVPSKEYITATFASFGPLEESKTLYLNDSTAQVVFEKESDAMEALQSLQSR  1044

Query  301   SPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIKQ  480
             +PFGP+ L SY L +     ++N +     LP DA + P + SG  P NGE PDL+ IKQ
Sbjct  1045  NPFGPS-LVSYRLRHVS--TSNNTQTSHPSLPADALQSPAVLSGAVPSNGEGPDLVVIKQ  1101

Query  481   NLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMVG  600
             NLE M+ MLEKAGDNISP+MKAKLE EVKGFL+KVS MVG
Sbjct  1102  NLESMTTMLEKAGDNISPEMKAKLESEVKGFLEKVSNMVG  1141



>ref|XP_009611921.1| PREDICTED: uncharacterized protein LOC104105362 [Nicotiana tomentosiformis]
Length=1054

 Score =   153 bits (387),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 105/154 (68%), Gaps = 3/154 (2%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETTAQIVFAQSSDAEVACQSLGKS  300
             L+LNF  G  +PS E +  TF +FG +VE++T+F  ++TAQ+VF    DA  A Q+L   
Sbjct  894   LLLNFGSGSSVPSKEYITATFSRFGSLVESKTQFLDDSTAQVVFVNDCDAIEALQNLQSR  953

Query  301   SPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIKQ  480
             +PFGP AL SY L  R    ++N +   ++LP D  K P   SG  P NGE PDL+ IKQ
Sbjct  954   NPFGP-ALVSYRL--RHVSTSNNTQTSHSLLPADVLKPPAALSGAVPSNGEGPDLVVIKQ  1010

Query  481   NLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKK  582
             NLE M++MLEKAGDNISP+M+AKLE EVKGFLKK
Sbjct  1011  NLEAMTSMLEKAGDNISPEMRAKLENEVKGFLKK  1044



>ref|XP_004241490.1| PREDICTED: uncharacterized protein LOC101251994 [Solanum lycopersicum]
Length=1135

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 106/162 (65%), Gaps = 22/162 (14%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETTAQIVFAQSSDAEVACQSLGKS  300
             L+L FTPG P+PS E +  TF  FGP+ E++T + +++TAQ+VFA+ SDA  A QSL   
Sbjct  990   LLLYFTPGSPVPSKEYICATFASFGPLEESKTLYLNDSTAQVVFAKDSDAMEALQSLQSR  1049

Query  301   SPFGPTALASYHLHY--RPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHI  474
             +PFGP+ L SY L +     PAA                   L SG  P NGE PDL+ I
Sbjct  1050  NPFGPS-LVSYRLRHVSTSQPAA-------------------LLSGAVPSNGEGPDLVVI  1089

Query  475   KQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMVG  600
             KQNLE M+ MLEKAGDNISP++KAKLE EVKGFL+KVS MVG
Sbjct  1090  KQNLESMTTMLEKAGDNISPEIKAKLESEVKGFLEKVSTMVG  1131



>ref|XP_009764377.1| PREDICTED: uncharacterized protein LOC104216109 [Nicotiana sylvestris]
Length=1046

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 102/154 (66%), Gaps = 5/154 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETTAQIVFAQSSDAEVACQSLGKS  300
             L+LNF  G P+PS E +  TF +FG +VE++T+F  ++TAQ+VF    DA  A Q+L   
Sbjct  888   LLLNFGLGSPVPSKEYITATFSRFGSLVESKTQFLDDSTAQVVFVNDCDAIEALQNLQSR  947

Query  301   SPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIKQ  480
             + FGP AL SY L +     + +    T++LP D  K P   SG  P NGE PDL+ IKQ
Sbjct  948   NLFGP-ALVSYRLRH----VSTSNNTQTSLLPADVLKPPAALSGAVPSNGEGPDLVVIKQ  1002

Query  481   NLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKK  582
             NLE M+ MLEKAGDNISP+M+AKLE EVK FLKK
Sbjct  1003  NLEAMTTMLEKAGDNISPEMRAKLESEVKSFLKK  1036



>ref|XP_010663170.1| PREDICTED: uncharacterized protein LOC104882283 [Vitis vinifera]
Length=1236

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 109/166 (66%), Gaps = 7/166 (4%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
             L L F  G P+PS E+L + F KFGP+ E+ET+   ++  AQ+VF + SDA  A QSL K
Sbjct  1067  LTLTFAQGSPMPSKEALVEAFFKFGPLKESETEVLKDSPGAQVVFIRYSDAREAFQSLEK  1126

Query  298   SSPFGPTALASYHLHYRPGPA---ADNFKMPTTVL--PMDAFKFPMLPSGKAPLNGEAPD  462
              SPFGP AL +Y L++    +     +   P  +   P+++ K P   SG  P  GEA  
Sbjct  1127  CSPFGP-ALVNYQLNHSSAASMALEQDRNQPAALASQPVESLKTPARSSGSKPPIGEARP  1185

Query  463   LMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMVG  600
             L  I+QNLEMM++MLEK+GDN+SP+M+AKLEGE+KG LKKVS MVG
Sbjct  1186  LFFIRQNLEMMTSMLEKSGDNLSPEMRAKLEGEIKGLLKKVSTMVG  1231



>emb|CBI15020.3| unnamed protein product [Vitis vinifera]
Length=1185

 Score =   137 bits (346),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 102/164 (62%), Gaps = 24/164 (15%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
             L L F  G P+PS E+L + F KFGP+ E+ET+   ++  AQ+VF + SDA  A QSL K
Sbjct  1029  LTLTFAQGSPMPSKEALVEAFFKFGPLKESETEVLKDSPGAQVVFIRYSDAREAFQSLEK  1088

Query  298   SSPFGPT---ALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLM  468
              SPFGP    ALAS                     P+++ K P   SG  P  GEA  L 
Sbjct  1089  CSPFGPALPAALASQ--------------------PVESLKTPARSSGSKPPIGEARPLF  1128

Query  469   HIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMVG  600
              I+QNLEMM++MLEK+GDN+SP+M+AKLEGE+KG LKKVS MVG
Sbjct  1129  FIRQNLEMMTSMLEKSGDNLSPEMRAKLEGEIKGLLKKVSTMVG  1172



>ref|XP_010027633.1| PREDICTED: serine/threonine-protein kinase ATM-like [Eucalyptus 
grandis]
 gb|KCW83372.1| hypothetical protein EUGRSUZ_B00304 [Eucalyptus grandis]
Length=1101

 Score =   133 bits (335),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 101/161 (63%), Gaps = 22/161 (14%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LIL F  G P+P+ + L DTF +FGP+ E ET+   ++  AQ+VFA+S+DA  AC+SL K
Sbjct  958   LILTFAVGSPVPTRDVLIDTFSRFGPLKEFETQLLKDSNIAQVVFAKSTDANEACRSLEK  1017

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
             S+PFG +AL  Y +H                     F  P +PSG + L GEAP L  IK
Sbjct  1018  SNPFG-SALTKYQVH--------------------CFDPPSVPSGSSTLPGEAPPLNFIK  1056

Query  478   QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMVG  600
              NLEMM++MLE +GDN+SP+ KAKLE ++K  L KVS MVG
Sbjct  1057  HNLEMMTSMLENSGDNLSPETKAKLEVDIKSLLSKVSNMVG  1097



>ref|XP_011071869.1| PREDICTED: uncharacterized protein LOC105157223 [Sesamum indicum]
Length=1130

 Score =   128 bits (322),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 102/160 (64%), Gaps = 11/160 (7%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETTAQIVFAQSSDAEVACQSLGKS  300
             L+LNF PG  LPS E+L  TF +FG + E+E +  +++T QIV+ +SSDA  A +SL KS
Sbjct  968   LLLNFAPGSTLPSRETLVATFSRFGLLKESEIQVLNDSTVQIVYERSSDARFAFRSLEKS  1027

Query  301   SPFGPTALASYHLHYRPG-----PAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDL  465
              PFG + LAS+ LH  P         +  +MP   LP++A K P  P        E PD+
Sbjct  1028  KPFGES-LASFKLHCTPDAPKTTAKRNRLQMPQPFLPVNACKIPAKPGA-----AETPDI  1081

Query  466   MHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKV  585
               I+QN+EMM + L+KAG+++S +M+AKLE E+K FL+K+
Sbjct  1082  ALIRQNVEMMKSTLQKAGNSLSSEMRAKLENEIKAFLEKL  1121



>ref|XP_011001531.1| PREDICTED: serine/threonine-protein kinase ATM-like [Populus 
euphratica]
Length=1097

 Score =   126 bits (316),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 100/156 (64%), Gaps = 10/156 (6%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
             L+L F PG+ +PS E L  TF +FGP+ +++T+     +TAQ+VF +S+DA  A +SL K
Sbjct  943   LLLTFAPGYSMPSKEILVATFCRFGPLKKSQTQVMKDSSTAQVVFMKSTDAVEAARSLEK  1002

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
             ++PFG T L +Y LH  P  ++                 P+  SG  P   EAP +  I+
Sbjct  1003  ANPFGAT-LVNYDLHLIPAASSSQC--------TKGLGTPVKTSGSMPKLAEAPPIDFIR  1053

Query  478   QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKV  585
             QNLEMM++MLEK+GDN+SP+M+AKLE E+KG LKKV
Sbjct  1054  QNLEMMTSMLEKSGDNLSPEMRAKLEIEIKGLLKKV  1089



>ref|XP_010101219.1| hypothetical protein L484_015024 [Morus notabilis]
 gb|EXB87893.1| hypothetical protein L484_015024 [Morus notabilis]
Length=1105

 Score =   125 bits (314),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 102/161 (63%), Gaps = 12/161 (7%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
             L+L F PG P+PS E L  TF KFG + E+ET+F  +  +AQIVF +S+DA  A +S+ K
Sbjct  953   LLLTFAPGVPMPSGEDLVSTFSKFGTLKESETRFLKDPGSAQIVFTKSADATEALKSIEK  1012

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
             ++PFG  AL +Y LH+ P        +  T+         +  S + P    AP L  I+
Sbjct  1013  NNPFG-AALVNYRLHHLP-------SVSRTLETNRNSGATLASSTQVPA---APPLDFIR  1061

Query  478   QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMVG  600
             QNL+MM++MLE +GDN+SP+M+AKLE EVKG L KVS+M G
Sbjct  1062  QNLQMMTSMLETSGDNLSPEMRAKLEAEVKGLLSKVSSMAG  1102



>gb|KHG14743.1| Serine/threonine-protein kinase ATM [Gossypium arboreum]
Length=1059

 Score =   121 bits (304),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 98/151 (65%), Gaps = 10/151 (7%)
 Frame = +1

Query  139   PGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGKSSPFGP  315
             PG  +PS E L  TF +FGP+ E+E +   +++ A++VF ++ DA  A +SL +S+PFG 
Sbjct  911   PGASMPSKEVLVATFSRFGPLKESEVQILKDSSNARVVFMRNEDAAKALRSLEESNPFGA  970

Query  316   TALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIKQNLEMM  495
               L +Y L         N  + TT   M+ F+ P   +G  P  G+AP +  IK+NLEMM
Sbjct  971   N-LTNYQLQ--------NNNILTTHQHMEGFRLPAKLTGTMPRLGDAPPIDVIKKNLEMM  1021

Query  496   SAMLEKAGDNISPDMKAKLEGEVKGFLKKVS  588
             ++MLEK+GDN+SP+MKAKLE E+KG LKKVS
Sbjct  1022  TSMLEKSGDNLSPEMKAKLESEIKGLLKKVS  1052



>ref|XP_002511393.1| hypothetical protein RCOM_1510520 [Ricinus communis]
 gb|EEF51995.1| hypothetical protein RCOM_1510520 [Ricinus communis]
Length=1097

 Score =   120 bits (301),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 94/155 (61%), Gaps = 13/155 (8%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
             LIL F  G  LPS E L  TF +FGP+ E+E     ++ TAQ+VF +S+DA  A +SL  
Sbjct  909   LILTFAQGVSLPSKEVLVATFCRFGPLKESEIHLMKDSNTAQVVFLKSTDAAEAARSLEN  968

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
              SPFG T L +Y LH      +   K  TT         P +  G  P   EAP +  I+
Sbjct  969   CSPFGAT-LVNYRLHLLSAAGS---KEGTTA--------PAMSYGSMPSPAEAPPIDFIR  1016

Query  478   QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKK  582
             QNLEMM++MLEKAGDN+SP+M+AKLE E+KG LKK
Sbjct  1017  QNLEMMTSMLEKAGDNLSPEMRAKLETEIKGLLKK  1051



>ref|XP_007010525.1| Ataxia-telangiectasia mutated, putative [Theobroma cacao]
 gb|EOY19335.1| Ataxia-telangiectasia mutated, putative [Theobroma cacao]
Length=1076

 Score =   120 bits (300),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 96/149 (64%), Gaps = 17/149 (11%)
 Frame = +1

Query  151   LPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGKSSPFGPTALA  327
             +PS E+L  TF +FGP+ E+E     ++ +AQ+VF +S DA  A +S  KS+PFG T L 
Sbjct  932   MPSKEALVATFCRFGPLKESEILIMKDSNSAQVVFMRSEDAGNAVKSFEKSNPFGAT-LM  990

Query  328   SYHLHYRPGPAADNFKMPTTVL---PMDAFKFPMLPSGKAPLNGEAPDLMHIKQNLEMMS  498
             +YHL               ++L   PM+  + P  PSG  P  G+AP +  I+QNLEMM+
Sbjct  991   NYHLQ------------NDSILNSQPMEVLRTPAKPSGLTPHLGDAPPIDFIRQNLEMMT  1038

Query  499   AMLEKAGDNISPDMKAKLEGEVKGFLKKV  585
             +MLE++GDN+SP+MKAKLE E+KG LKKV
Sbjct  1039  SMLERSGDNLSPEMKAKLESEIKGLLKKV  1067



>gb|KDP31094.1| hypothetical protein JCGZ_11470 [Jatropha curcas]
Length=1096

 Score =   118 bits (296),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 92/156 (59%), Gaps = 17/156 (11%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
             L+L F PG  LPS E L  TF +FGP+ E+E +   ++ TAQ+VF  S+DA  A +SL  
Sbjct  948   LLLTFAPGVSLPSKEVLVATFSRFGPLKESEIQLLKDSGTAQVVFVSSTDAAEAVRSLEN  1007

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
             S PFG T L  Y L                +L    F     P G  P   EAP +  I+
Sbjct  1008  SHPFGAT-LVKYQLR---------------LLQAAGFWSTAKPHGTMPNPAEAPPIDFIR  1051

Query  478   QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKV  585
             QNLE+M++MLEK+GDN+SP+M+AKLE E+KG LKKV
Sbjct  1052  QNLEIMTSMLEKSGDNLSPEMRAKLESEIKGLLKKV  1087



>gb|KDO69625.1| hypothetical protein CISIN_1g004484mg [Citrus sinensis]
 gb|KDO69626.1| hypothetical protein CISIN_1g004484mg [Citrus sinensis]
 gb|KDO69627.1| hypothetical protein CISIN_1g004484mg [Citrus sinensis]
 gb|KDO69628.1| hypothetical protein CISIN_1g004484mg [Citrus sinensis]
Length=702

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 96/156 (62%), Gaps = 19/156 (12%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            LIL F PG  +PS E L  TF +FGP+ E+ET+ S+++  A++VF + +DA  A +SL  
Sbjct  556  LILTFAPGVSMPSKEFLVATFSRFGPLKESETQLSNDSGIAEVVFMRGADAGEAIRSLET  615

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
            ++ FGPT L SY L                  P++  + P  P+      GEAP L  I+
Sbjct  616  NNCFGPT-LVSYTLR-----------------PVEGSRTPAKPADSVSQPGEAPPLDFIR  657

Query  478  QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKV  585
            QNLEMM++ML+ +GD +SP+MKAKLE E+KG LK+V
Sbjct  658  QNLEMMTSMLKNSGDKLSPEMKAKLESEIKGLLKRV  693



>ref|XP_006476785.1| PREDICTED: serine/threonine-protein kinase ATM-like [Citrus sinensis]
Length=702

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 96/156 (62%), Gaps = 19/156 (12%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            LIL F PG  +PS E L  TF +FGP+ E+ET+ S+++  A++VF + +DA  A +SL  
Sbjct  556  LILTFAPGVSMPSKEFLVATFSRFGPLKESETQLSNDSGIAEVVFMRGADAGEAIRSLET  615

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
            ++ FGPT L SY L                  P++  + P  P+      GEAP L  I+
Sbjct  616  NNCFGPT-LVSYTLR-----------------PVEGSRTPAKPADSVSQPGEAPPLDFIR  657

Query  478  QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKV  585
            QNLEMM++ML+ +GD +SP+MKAKLE E+KG LK+V
Sbjct  658  QNLEMMTSMLKNSGDKLSPEMKAKLESEIKGLLKRV  693



>ref|XP_008239794.1| PREDICTED: serine/threonine-protein kinase ATM [Prunus mume]
Length=4149

 Score =   117 bits (294),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 65/158 (41%), Positives = 100/158 (63%), Gaps = 18/158 (11%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
             L+L F+PG P+PS + L  TF +FGP+ E+ET+   +  +AQ+VF +++DA  A +SL K
Sbjct  977   LLLTFSPGVPMPSKDDLISTFCRFGPLKESETQLLKDPGSAQVVFMENADAGEAFRSLEK  1036

Query  298   SSPFGPTALASYHLHYRPGPA---ADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLM  468
             ++PFG   L SY L + P  +      + +PT++        P +P       G+AP L 
Sbjct  1037  NNPFGAN-LDSYKLFHLPSVSRVLETGWSLPTSL------SSPTMP-------GKAPRLD  1082

Query  469   HIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKK  582
              I+QNL+MM++MLE +GDN+SP+M+A LE E+K  L+K
Sbjct  1083  FIRQNLQMMTSMLETSGDNLSPEMRANLECEIKSLLQK  1120



>gb|KDO69624.1| hypothetical protein CISIN_1g004484mg [Citrus sinensis]
Length=749

 Score =   115 bits (289),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 97/156 (62%), Gaps = 19/156 (12%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            LIL F PG  +PS E L  TF +FGP+ E+ET+ S+++  A++VF + +DA  A +SL  
Sbjct  556  LILTFAPGVSMPSKEFLVATFSRFGPLKESETQLSNDSGIAEVVFMRGADAGEAIRSLET  615

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
            ++ FGPT L SY                 T+ P++  + P  P+      GEAP L  I+
Sbjct  616  NNCFGPT-LVSY-----------------TLRPVEGSRTPAKPADSVSQPGEAPPLDFIR  657

Query  478  QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKV  585
            QNLEMM++ML+ +GD +SP+MKAKLE E+KG LK++
Sbjct  658  QNLEMMTSMLKNSGDKLSPEMKAKLESEIKGLLKRI  693



>ref|XP_008438442.1| PREDICTED: serine/threonine-protein kinase ATM-like isoform X2 
[Cucumis melo]
Length=570

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 97/160 (61%), Gaps = 4/160 (3%)
 Frame = +1

Query  133  FTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETTAQIVFAQSSDAEVACQSLGKSSPFG  312
            F+   PLP  E +  TF +FG + E+E +   ++T +IVF +S DA  A +SL K++ FG
Sbjct  409  FSSEAPLPPREQVITTFSQFGSLKESEIQLK-DSTVEIVFLRSVDAMEAVRSLKKNNIFG  467

Query  313  PTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLN---GEAPDLMHIKQN  483
            PT L     H    P   +     T L   A +  + PS  A      G+AP +  I++N
Sbjct  468  PTLLKYQLYHLSAPPKTSDSDRACTALAYPASEGTLNPSKSAESGNQAGDAPPIEFIRKN  527

Query  484  LEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMVGP  603
            L+MM++MLEK+GDN+SPDM+AKLE +++G LKKVS+M GP
Sbjct  528  LQMMTSMLEKSGDNLSPDMRAKLECDIEGLLKKVSSMAGP  567



>ref|XP_004152555.1| PREDICTED: uncharacterized protein LOC101223078 [Cucumis sativus]
Length=723

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 98/160 (61%), Gaps = 4/160 (3%)
 Frame = +1

Query  133  FTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETTAQIVFAQSSDAEVACQSLGKSSPFG  312
            F+   PLP  E +  TF +FG + E+E +   ++T +IVF +S+DA  A +SL K++ FG
Sbjct  562  FSSEAPLPPREQVITTFSQFGSLKESEIQLK-DSTVEIVFLRSADAMEAVRSLKKNNIFG  620

Query  313  PTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLN---GEAPDLMHIKQN  483
            PT L     H    P   +     T L   A +  + PS  A      G+AP +  I++N
Sbjct  621  PTLLKYQLYHLSAPPKTSDSDRACTALAYPASEGTLNPSKSAESGNQAGDAPPIEFIRKN  680

Query  484  LEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMVGP  603
            L+MM++MLEK+GDN+SPDM+AKLE +++G LKKVS+M GP
Sbjct  681  LQMMTSMLEKSGDNLSPDMRAKLECDIEGLLKKVSSMAGP  720



>ref|XP_006439827.1| hypothetical protein CICLE_v10018990mg [Citrus clementina]
 ref|XP_006439828.1| hypothetical protein CICLE_v10018990mg [Citrus clementina]
 gb|ESR53067.1| hypothetical protein CICLE_v10018990mg [Citrus clementina]
 gb|ESR53068.1| hypothetical protein CICLE_v10018990mg [Citrus clementina]
Length=702

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 95/156 (61%), Gaps = 19/156 (12%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            LIL F PG  +PS E L  TF +FGP+ E+ET+ S+++  A++VF + +DA  A +SL  
Sbjct  556  LILTFAPGVSMPSKEFLVATFSRFGPLKESETQLSNDSGIAEVVFMRGADAGEAIRSLET  615

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
            ++ FGP  L SY L                  P++  + P  P+      GEAP L  I+
Sbjct  616  NNCFGPI-LVSYTLR-----------------PVEGSRTPAKPADSVSQPGEAPPLDFIR  657

Query  478  QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKV  585
            QNLEMM++ML+ +GD +SP+MKAKLE E+KG LK+V
Sbjct  658  QNLEMMTSMLKNSGDKLSPEMKAKLESEIKGLLKRV  693



>ref|XP_008438434.1| PREDICTED: serine/threonine-protein kinase ATM-like isoform X1 
[Cucumis melo]
Length=597

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 97/160 (61%), Gaps = 4/160 (3%)
 Frame = +1

Query  133  FTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETTAQIVFAQSSDAEVACQSLGKSSPFG  312
            F+   PLP  E +  TF +FG + E+E +   ++T +IVF +S DA  A +SL K++ FG
Sbjct  436  FSSEAPLPPREQVITTFSQFGSLKESEIQLK-DSTVEIVFLRSVDAMEAVRSLKKNNIFG  494

Query  313  PTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLN---GEAPDLMHIKQN  483
            PT L     H    P   +     T L   A +  + PS  A      G+AP +  I++N
Sbjct  495  PTLLKYQLYHLSAPPKTSDSDRACTALAYPASEGTLNPSKSAESGNQAGDAPPIEFIRKN  554

Query  484  LEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMVGP  603
            L+MM++MLEK+GDN+SPDM+AKLE +++G LKKVS+M GP
Sbjct  555  LQMMTSMLEKSGDNLSPDMRAKLECDIEGLLKKVSSMAGP  594



>gb|KGN64312.1| hypothetical protein Csa_1G046090 [Cucumis sativus]
Length=809

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 98/160 (61%), Gaps = 4/160 (3%)
 Frame = +1

Query  133  FTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETTAQIVFAQSSDAEVACQSLGKSSPFG  312
            F+   PLP  E +  TF +FG + E+E +   ++T +IVF +S+DA  A +SL K++ FG
Sbjct  648  FSSEAPLPPREQVITTFSQFGSLKESEIQLK-DSTVEIVFLRSADAMEAVRSLKKNNIFG  706

Query  313  PTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLN---GEAPDLMHIKQN  483
            PT L     H    P   +     T L   A +  + PS  A      G+AP +  I++N
Sbjct  707  PTLLKYQLYHLSAPPKTSDSDRACTALAYPASEGTLNPSKSAESGNQAGDAPPIEFIRKN  766

Query  484  LEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMVGP  603
            L+MM++MLEK+GDN+SPDM+AKLE +++G LKKVS+M GP
Sbjct  767  LQMMTSMLEKSGDNLSPDMRAKLECDIEGLLKKVSSMAGP  806



>ref|XP_006439826.1| hypothetical protein CICLE_v10018990mg [Citrus clementina]
 gb|ESR53066.1| hypothetical protein CICLE_v10018990mg [Citrus clementina]
Length=749

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 96/156 (62%), Gaps = 19/156 (12%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            LIL F PG  +PS E L  TF +FGP+ E+ET+ S+++  A++VF + +DA  A +SL  
Sbjct  556  LILTFAPGVSMPSKEFLVATFSRFGPLKESETQLSNDSGIAEVVFMRGADAGEAIRSLET  615

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
            ++ FGP  L SY                 T+ P++  + P  P+      GEAP L  I+
Sbjct  616  NNCFGPI-LVSY-----------------TLRPVEGSRTPAKPADSVSQPGEAPPLDFIR  657

Query  478  QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKV  585
            QNLEMM++ML+ +GD +SP+MKAKLE E+KG LK++
Sbjct  658  QNLEMMTSMLKNSGDKLSPEMKAKLESEIKGLLKRI  693



>ref|XP_004502088.1| PREDICTED: serine/threonine-protein kinase ATM-like isoform X3 
[Cicer arietinum]
Length=640

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 97/159 (61%), Gaps = 13/159 (8%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            L L FTPG    S + L  TF +FGP+  AET+   +T +AQ+VF + +DA  AC++L  
Sbjct  489  LFLQFTPGVDFLSKDDLLRTFCRFGPLKAAETQLMKDTGSAQVVFVRGTDAAEACRTLEH  548

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPD-LMHI  474
            ++PFG T L  Y LH+ P  A           P+  F  P  P+    + GEAP  L  I
Sbjct  549  NNPFGAT-LVGYRLHHPPVAAP----------PLAHFLTPTQPTRSMSMPGEAPPPLQFI  597

Query  475  KQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSA  591
            KQNL+MM++MLE +G+++SP M+AKL+ E+K  L+KV++
Sbjct  598  KQNLQMMTSMLENSGNSLSPQMRAKLDTEIKNLLRKVNS  636



>ref|XP_004502086.1| PREDICTED: serine/threonine-protein kinase ATM-like isoform X1 
[Cicer arietinum]
 ref|XP_004502087.1| PREDICTED: serine/threonine-protein kinase ATM-like isoform X2 
[Cicer arietinum]
Length=670

 Score =   112 bits (281),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 97/159 (61%), Gaps = 13/159 (8%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            L L FTPG    S + L  TF +FGP+  AET+   +T +AQ+VF + +DA  AC++L  
Sbjct  519  LFLQFTPGVDFLSKDDLLRTFCRFGPLKAAETQLMKDTGSAQVVFVRGTDAAEACRTLEH  578

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPD-LMHI  474
            ++PFG T L  Y LH+ P  A           P+  F  P  P+    + GEAP  L  I
Sbjct  579  NNPFGAT-LVGYRLHHPPVAAP----------PLAHFLTPTQPTRSMSMPGEAPPPLQFI  627

Query  475  KQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSA  591
            KQNL+MM++MLE +G+++SP M+AKL+ E+K  L+KV++
Sbjct  628  KQNLQMMTSMLENSGNSLSPQMRAKLDTEIKNLLRKVNS  666



>ref|XP_009363009.1| PREDICTED: serine/threonine-protein kinase ATM-like isoform X1 
[Pyrus x bretschneideri]
Length=1273

 Score =   112 bits (281),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 97/156 (62%), Gaps = 12/156 (8%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
             L+LNF+PG  +PS + L  TF +FGP+ E+ET+   +  +AQ+VF +++DA  A +SL K
Sbjct  1116  LMLNFSPGVAMPSKDDLISTFCRFGPLKESETQMLKDPGSAQVVFMENADAGEALRSLEK  1175

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
              +PFG   L SY L + P  +      P   LP      P LP        +AP L  I+
Sbjct  1176  DNPFGGN-LVSYKLFHLP--SVSRVLEPGWSLPT-GLASPSLPE-------KAPRLDFIR  1224

Query  478   QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKV  585
             QNL+MM++MLE +GDN+SP+M+AKLE E+K  L+KV
Sbjct  1225  QNLQMMTSMLENSGDNLSPEMRAKLECEIKALLQKV  1260



>ref|XP_009363011.1| PREDICTED: serine/threonine-protein kinase ATM-like isoform X3 
[Pyrus x bretschneideri]
Length=1232

 Score =   112 bits (281),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 97/156 (62%), Gaps = 12/156 (8%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
             L+LNF+PG  +PS + L  TF +FGP+ E+ET+   +  +AQ+VF +++DA  A +SL K
Sbjct  1075  LMLNFSPGVAMPSKDDLISTFCRFGPLKESETQMLKDPGSAQVVFMENADAGEALRSLEK  1134

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
              +PFG   L SY L + P  +      P   LP      P LP        +AP L  I+
Sbjct  1135  DNPFGGN-LVSYKLFHLP--SVSRVLEPGWSLPT-GLASPSLPE-------KAPRLDFIR  1183

Query  478   QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKV  585
             QNL+MM++MLE +GDN+SP+M+AKLE E+K  L+KV
Sbjct  1184  QNLQMMTSMLENSGDNLSPEMRAKLECEIKALLQKV  1219



>ref|XP_009363010.1| PREDICTED: serine/threonine-protein kinase ATM-like isoform X2 
[Pyrus x bretschneideri]
Length=1269

 Score =   111 bits (277),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 96/155 (62%), Gaps = 12/155 (8%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
             L+LNF+PG  +PS + L  TF +FGP+ E+ET+   +  +AQ+VF +++DA  A +SL K
Sbjct  1116  LMLNFSPGVAMPSKDDLISTFCRFGPLKESETQMLKDPGSAQVVFMENADAGEALRSLEK  1175

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
              +PFG   L SY L + P  +      P   LP      P LP        +AP L  I+
Sbjct  1176  DNPFGGN-LVSYKLFHLP--SVSRVLEPGWSLPT-GLASPSLPE-------KAPRLDFIR  1224

Query  478   QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKK  582
             QNL+MM++MLE +GDN+SP+M+AKLE E+K  L+K
Sbjct  1225  QNLQMMTSMLENSGDNLSPEMRAKLECEIKALLQK  1259



>ref|XP_008356596.1| PREDICTED: serine/threonine-protein kinase ATM-like isoform X1 
[Malus domestica]
Length=1228

 Score =   108 bits (270),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 96/156 (62%), Gaps = 12/156 (8%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
             L+LNF+PG  +PS + L  TF +FGP+ E+ET+   +  +AQ+VF +++DA  A +SL K
Sbjct  1074  LMLNFSPGVSMPSKDDLISTFCRFGPLKESETQLLKDPGSAQVVFMENADAGEALRSLEK  1133

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
              +PF    L SY L + P  +      P    P      P LP        +AP L  I+
Sbjct  1134  DNPFCGN-LVSYKLFHLP--SVSRVLEPGWSFPT-GLASPSLPE-------KAPCLDFIR  1182

Query  478   QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKV  585
             QNL+MM++MLEK+GDN+SP+M+AKLE E+K  L+KV
Sbjct  1183  QNLQMMTSMLEKSGDNLSPEMRAKLECEIKALLEKV  1218



>ref|XP_008356597.1| PREDICTED: serine/threonine-protein kinase ATM-like isoform X2 
[Malus domestica]
Length=1188

 Score =   108 bits (270),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 96/156 (62%), Gaps = 12/156 (8%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
             L+LNF+PG  +PS + L  TF +FGP+ E+ET+   +  +AQ+VF +++DA  A +SL K
Sbjct  1034  LMLNFSPGVSMPSKDDLISTFCRFGPLKESETQLLKDPGSAQVVFMENADAGEALRSLEK  1093

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
              +PF    L SY L + P  +      P    P      P LP        +AP L  I+
Sbjct  1094  DNPFCGN-LVSYKLFHLP--SVSRVLEPGWSFPT-GLASPSLPE-------KAPCLDFIR  1142

Query  478   QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKV  585
             QNL+MM++MLEK+GDN+SP+M+AKLE E+K  L+KV
Sbjct  1143  QNLQMMTSMLEKSGDNLSPEMRAKLECEIKALLEKV  1178



>ref|XP_008393115.1| PREDICTED: serine/threonine-protein kinase ATM-like [Malus domestica]
Length=1268

 Score =   108 bits (270),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 95/155 (61%), Gaps = 12/155 (8%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
             L+LNF+PG  +PS + L  TF +FGP+ E+ET+   +  +AQ+VF +++DA  A +SL K
Sbjct  1115  LMLNFSPGVAMPSKDDLISTFCRFGPLKESETQMLKDPGSAQVVFMENADAGEALRSLEK  1174

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
              +PFG   L SY L + P  +      P   LP      P LP        +A  L  I+
Sbjct  1175  DNPFGGN-LVSYKLFHLP--SVSRVLEPGWSLPT-GLASPSLPE-------KASRLDFIR  1223

Query  478   QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKK  582
             QNL+MM++MLE +GDN+SP+M+AKLE E+K  L+K
Sbjct  1224  QNLQMMTSMLENSGDNLSPEMRAKLECEIKALLQK  1258



>ref|XP_002274197.1| PREDICTED: uncharacterized protein LOC100267992 [Vitis vinifera]
Length=976

 Score =   104 bits (260),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 95/164 (58%), Gaps = 13/164 (8%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            L+L+F PG  LPS + L   F KFG + E+ET+   ++  A++VF++SSDAE A     K
Sbjct  816  LLLSFGPGISLPSKDDLIKIFSKFGTLNESETEILYDSFCARVVFSRSSDAEEAFNGSQK  875

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLN----GEAPDL  465
            +SPFG   + +Y L Y   P++   +      P      P   +GKAP N    GE   L
Sbjct  876  ASPFGAEQV-TYRLRY---PSSSTSRR----TPDKKHHPPNKKAGKAPANPSAGGEKSQL  927

Query  466  MHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
              IKQ LEMM+ MLEK+   +S +MK+ LEGE+KG L+KVS M 
Sbjct  928  NFIKQKLEMMTCMLEKSSGKMSGEMKSNLEGEMKGLLEKVSTMA  971



>ref|XP_010243056.1| PREDICTED: uncharacterized protein LOC104587226 [Nelumbo nucifera]
Length=1034

 Score =   103 bits (257),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 100/161 (62%), Gaps = 6/161 (4%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L+L F PG  LPS + L   F +FG + E+ET+   +++ A++VF +S+DA+ A  S  K
Sbjct  867   LLLTFAPGFSLPSKDDLITMFSRFGALNESETEVLRDSSCARVVFLKSTDAKEAFSSSEK  926

Query  298   SSPFGPTALASYHLHYRPGPAA-DNFKMPTTVLPM--DAFKFPMLPSGKAPLN-GEAPDL  465
             +SPFG  A+ +Y L +  G +  D       +LP+     +   + SG  P + GE   L
Sbjct  927   ASPFG-NAVVNYRLRHLSGASEHDGSSSQYQLLPLTTSGSETKTVASGSRPSSLGEGTPL  985

Query  466   MHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVS  588
               IKQNLE+M+++LEK+G+ +SP++K+ LEGE+KG L K++
Sbjct  986   QFIKQNLELMTSVLEKSGEKLSPEVKSNLEGEIKGLLNKLN  1026



>ref|XP_010550678.1| PREDICTED: serine/threonine-protein kinase ATM [Tarenaya hassleriana]
Length=875

 Score = 97.4 bits (241),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 93/161 (58%), Gaps = 15/161 (9%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            L++ F  G  LPS + L   F  FGP+   ET  S+++ +AQ+ F  S DA  A +SL K
Sbjct  726  LVMKFISGDSLPSKDDLTSKFAGFGPLDATETHVSTDSGSAQVAFMSSGDAIEAVKSLEK  785

Query  298  SSPFGPTALASYHLHYRPGPAADNF--KMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMH  471
            ++PFG T L S+ L  +P         +MP  V+ + +   P  P    P++ E      
Sbjct  786  TNPFGET-LTSFRLQQKPAATCKKVAPRMP--VISVSSGSRPREP----PMSVEM-----  833

Query  472  IKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAM  594
            I+QNL MM++MLE++GD++S +M+ KL  E+ G L+KVS+M
Sbjct  834  IRQNLMMMTSMLERSGDSLSEEMRVKLRREITGLLEKVSSM  874



>ref|XP_006404288.1| hypothetical protein EUTSA_v10010050mg [Eutrema salsugineum]
 gb|ESQ45741.1| hypothetical protein EUTSA_v10010050mg [Eutrema salsugineum]
Length=3800

 Score = 91.3 bits (225),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 57/155 (37%), Positives = 85/155 (55%), Gaps = 10/155 (6%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            L L F+    +PS + L   F  FGP+  +ET  S E+  AQ+ F  S DA  A +SL K
Sbjct  670  LFLKFSSRVSMPSRDDLTSRFSAFGPLDSSETHVSEESIGAQVAFVSSGDAVEAVKSLEK  729

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
            ++PFG T L S+ L  +      N       +P+ +   P+L     PL  ++     ++
Sbjct  730  ANPFGET-LVSFRLQQKLISVQRNI---APRMPVISHVSPILKMNSTPLTVDS-----MR  780

Query  478  QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKK  582
            QNL MM++MLEK+GD +S + KAKL+ E+ G L+K
Sbjct  781  QNLMMMTSMLEKSGDRVSRETKAKLKSEIAGLLEK  815



>sp|Q9M3G7.1|ATM_ARATH RecName: Full=Serine/threonine-protein kinase ATM; AltName: Full=Ataxia 
telangiectasia mutated homolog; Short=AtATM [Arabidopsis 
thaliana]
 emb|CAB92122.1| AtATM [Arabidopsis thaliana]
Length=3856

 Score = 89.7 bits (221),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 57/160 (36%), Positives = 88/160 (55%), Gaps = 20/160 (13%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            L L F+    +PS + L  TF  FGP+  +ET  S E + AQ+ F  S+DA  A +SL K
Sbjct  691  LFLKFSSQVSMPSRDDLTSTFSAFGPLDSSETHVSEEFSGAQVAFVSSADAIEAVKSLEK  750

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLP--SGKAPL---NGEAPD  462
            ++PFG T +              NF++   ++ +     P +P  S  +P+   N     
Sbjct  751  ANPFGETLV--------------NFRLQQKLITVQRNIAPRMPVISHVSPVPKPNNIPTS  796

Query  463  LMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKK  582
            +  ++QNL MM+AMLEK+GD++S + KAKL+ E+ G L+K
Sbjct  797  MDAMRQNLLMMTAMLEKSGDSLSRETKAKLKSEITGLLEK  836



>emb|CAB86487.1| ataxia-telangiectasia mutated protein (Atm) [Arabidopsis thaliana]
Length=3856

 Score = 89.7 bits (221),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 57/160 (36%), Positives = 88/160 (55%), Gaps = 20/160 (13%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            L L F+    +PS + L  TF  FGP+  +ET  S E + AQ+ F  S+DA  A +SL K
Sbjct  691  LFLKFSSQVSMPSRDDLTSTFSAFGPLDSSETHVSEEFSGAQVAFVSSADAIEAVKSLEK  750

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLP--SGKAPL---NGEAPD  462
            ++PFG T +              NF++   ++ +     P +P  S  +P+   N     
Sbjct  751  ANPFGETLV--------------NFRLQQKLITVQRNIAPRMPVISHVSPVPKPNNIPTS  796

Query  463  LMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKK  582
            +  ++QNL MM+AMLEK+GD++S + KAKL+ E+ G L+K
Sbjct  797  MDAMRQNLLMMTAMLEKSGDSLSRETKAKLKSEITGLLEK  836



>ref|NP_190402.6| serine/threonine-protein kinase ATM [Arabidopsis thaliana]
 gb|AEE78379.1| serine/threonine-protein kinase ATM [Arabidopsis thaliana]
Length=3845

 Score = 89.7 bits (221),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 57/160 (36%), Positives = 88/160 (55%), Gaps = 20/160 (13%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            L L F+    +PS + L  TF  FGP+  +ET  S E + AQ+ F  S+DA  A +SL K
Sbjct  691  LFLKFSSQVSMPSRDDLTSTFSAFGPLDSSETHVSEEFSGAQVAFVSSADAIEAVKSLEK  750

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLP--SGKAPL---NGEAPD  462
            ++PFG T +              NF++   ++ +     P +P  S  +P+   N     
Sbjct  751  ANPFGETLV--------------NFRLQQKLITVQRNIAPRMPVISHVSPVPKPNNIPTS  796

Query  463  LMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKK  582
            +  ++QNL MM+AMLEK+GD++S + KAKL+ E+ G L+K
Sbjct  797  MDAMRQNLLMMTAMLEKSGDSLSRETKAKLKSEITGLLEK  836



>ref|XP_010412624.1| PREDICTED: serine/threonine-protein kinase ATM-like [Camelina 
sativa]
Length=3934

 Score = 89.4 bits (220),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 57/155 (37%), Positives = 88/155 (57%), Gaps = 10/155 (6%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            L LNF+    +PS + L   F  FGP+  +ET  S E + AQ+ F  SSDA  A +SL K
Sbjct  675  LFLNFSSRVSMPSRDDLTSRFSAFGPLDSSETHVSEEFSGAQVAFVSSSDAIEAVKSLEK  734

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
            ++P+G T L S+ L  +      N       +P+ +   P+  +   P + E+     ++
Sbjct  735  ANPYGET-LVSFRLQQKLITVQRNI---APRMPVISHVSPIPIANNIPTSVES-----MR  785

Query  478  QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKK  582
            QNL +M+AMLEK+GD++S + KAKL+ E+ G L+K
Sbjct  786  QNLLIMTAMLEKSGDSLSRETKAKLKSEITGLLEK  820



>ref|XP_007140959.1| hypothetical protein PHAVU_008G155500g [Phaseolus vulgaris]
 ref|XP_007140960.1| hypothetical protein PHAVU_008G155500g [Phaseolus vulgaris]
 gb|ESW12953.1| hypothetical protein PHAVU_008G155500g [Phaseolus vulgaris]
 gb|ESW12954.1| hypothetical protein PHAVU_008G155500g [Phaseolus vulgaris]
Length=931

 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 85/160 (53%), Gaps = 3/160 (2%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L  +F PG  LPS   L   + KFG + E+ET  FSS+  AQ+ F ++SDAE A      
Sbjct  770  LFASFEPGSSLPSKSDLITLYSKFGTLNESETAMFSSDYAAQVFFLKASDAEKALSDSQN  829

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
             +PFG ++ A++ L Y    +     +  T  P    K P  PS       EA  L +IK
Sbjct  830  MNPFG-SSKATFRLQYLSSGSKSEKSISKTSSPKKKDKTPAKPSTSLSPGSEAYKLNYIK  888

Query  478  QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
            Q L+ ++ +LE A D  S D+K KLE E+KG L+ V+ MV
Sbjct  889  QKLQGLTLILE-ASDAKSSDIKKKLESEMKGLLEDVNKMV  927



>ref|XP_010431100.1| PREDICTED: serine/threonine-protein kinase ATM [Camelina sativa]
Length=3762

 Score = 89.0 bits (219),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 58/155 (37%), Positives = 86/155 (55%), Gaps = 10/155 (6%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            L L F+    +PS + L   F  FGP+  +ET  S E + AQ+ F  SSDA  A +SL K
Sbjct  671  LFLKFSSRVSMPSRDDLTSRFSAFGPLDSSETHVSEEFSGAQVAFVSSSDAIEAVKSLEK  730

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
            ++PFG T L S+ L  +      N       +P+ +   P+      P + E+     ++
Sbjct  731  ANPFGET-LVSFRLQQKLITVQRNI---APRMPVISHVSPIPIPNNIPTSVES-----MR  781

Query  478  QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKK  582
            QNL MM+AMLEK+GD++S + KAKL+ E+ G L+K
Sbjct  782  QNLLMMTAMLEKSGDSLSRETKAKLKSEITGLLEK  816



>ref|XP_002875882.1| hypothetical protein ARALYDRAFT_323420 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52141.1| hypothetical protein ARALYDRAFT_323420 [Arabidopsis lyrata subsp. 
lyrata]
Length=3832

 Score = 88.2 bits (217),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 57/160 (36%), Positives = 87/160 (54%), Gaps = 20/160 (13%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            L L F+    +PS + L  TF  FGP+  +ET  S E + AQ+ F  S+DA  A +SL K
Sbjct  669  LFLKFSSQVSMPSRDDLTSTFSAFGPLDSSETHVSEEFSGAQVAFVSSADAIEAVKSLEK  728

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLP--SGKAPL---NGEAPD  462
            ++PFG T +              NF++   ++ +     P  P  S  +P+   N     
Sbjct  729  ANPFGETLV--------------NFRLQQKLITVQRNIAPRRPVISHVSPIPKPNNIPTS  774

Query  463  LMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKK  582
            +  ++QNL MM+AMLEK+GD++S + KAKL+ E+ G L+K
Sbjct  775  VDSMRQNLLMMTAMLEKSGDSLSRETKAKLKSEITGLLEK  814



>gb|KHN42764.1| Serine/threonine-protein kinase ATM [Glycine soja]
Length=927

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 61/161 (38%), Positives = 87/161 (54%), Gaps = 5/161 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L ++F PG  LPS   L   + KFG + E+ET   SS+ TA++ F ++SDAE A      
Sbjct  766  LFISFGPGSSLPSNSDLTTLYGKFGALNESETSMLSSDCTARVFFLKASDAEKALSHSQN  825

Query  298  SSPFGPTALASYHLHY-RPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHI  474
             +PFG +  AS+ L Y   G  ++  K   +       K P  PS      GEA  L +I
Sbjct  826  MNPFGSSE-ASFRLEYLSAGSKSEKSKFKASSTKKKD-KTPAKPSASLSPGGEASKLNYI  883

Query  475  KQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
            K+ L+ +++MLE A D   PD+K KLE E+K  L+ V+ MV
Sbjct  884  KEKLQGLTSMLE-ASDAKLPDIKTKLESEMKQLLEDVNRMV  923



>ref|XP_006604053.1| PREDICTED: uncharacterized protein LOC102668257 isoform X1 [Glycine 
max]
 ref|XP_006604054.1| PREDICTED: uncharacterized protein LOC102668257 isoform X2 [Glycine 
max]
Length=927

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 61/161 (38%), Positives = 87/161 (54%), Gaps = 5/161 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L ++F PG  LPS   L   + KFG + E+ET   SS+ TA++ F ++SDAE A      
Sbjct  766  LFISFGPGSSLPSNSDLTTLYGKFGALNESETSMLSSDCTARVFFLKASDAEKALSHSQN  825

Query  298  SSPFGPTALASYHLHY-RPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHI  474
             +PFG +  AS+ L Y   G  ++  K   +       K P  PS      GEA  L +I
Sbjct  826  MNPFGSSE-ASFRLEYLSAGSKSEKSKFKASSTKKKD-KTPAKPSASLSPGGEASKLNYI  883

Query  475  KQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
            K+ L+ +++MLE A D   PD+K KLE E+K  L+ V+ MV
Sbjct  884  KEKLQGLTSMLE-ASDAKLPDIKTKLESEMKQLLEDVNRMV  923



>ref|XP_010503440.1| PREDICTED: serine/threonine-protein kinase ATM-like [Camelina 
sativa]
Length=819

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 87/156 (56%), Gaps = 10/156 (6%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            L L F+    +PS + L   F  FGP+  +ET  S E + AQ+ F  SSDA  A +SL K
Sbjct  664  LFLKFSSRVSMPSRDDLTSRFSAFGPLDSSETHVSEEFSGAQVAFVSSSDAIEAVKSLEK  723

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
            ++PFG T L S+ L  +      N       +P+ +   P+      P + E+     ++
Sbjct  724  ANPFGET-LVSFRLQQKLITVQRNI---APRMPVISHVSPIPKPNNIPTSVES-----MR  774

Query  478  QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKV  585
            QNL MM+AMLEK+GD++S + KAKL+ E+ G L+KV
Sbjct  775  QNLLMMTAMLEKSGDSLSRETKAKLKSEITGLLEKV  810



>ref|XP_006603798.1| PREDICTED: uncharacterized protein LOC102667448 isoform X1 [Glycine 
max]
 ref|XP_006603799.1| PREDICTED: uncharacterized protein LOC102667448 isoform X2 [Glycine 
max]
 ref|XP_006603800.1| PREDICTED: uncharacterized protein LOC102667448 isoform X3 [Glycine 
max]
Length=1097

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 59/165 (36%), Positives = 87/165 (53%), Gaps = 10/165 (6%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
             L ++F PG  +PS   L   + KFG + EAET  F +  TA++ F ++SDAE A      
Sbjct  932   LFVSFWPGSSMPSRSDLVSVYSKFGALNEAETDMFRTNYTARVSFLRTSDAEKAYNHSQN  991

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPL----NGEAPDL  465
             ++PFG     ++ L Y    ++D  K         +   P+  +  AP+      EA  L
Sbjct  992   NNPFGSPTDVTFQLQY----SSDGSKSGVQQQGERSNNKPLPAAATAPVAFSQGTEASKL  1047

Query  466   MHIKQNLEMMSAMLEKA-GDNISPDMKAKLEGEVKGFLKKVSAMV  597
             + I+Q L+ M+ MLE+A G   SPDM AKLE E+K  L+ V+ MV
Sbjct  1048  IFIQQKLQGMTLMLEEASGGGKSPDMMAKLESEMKALLEDVNKMV  1092



>ref|XP_010108784.1| Serine/threonine-protein kinase ATM [Morus notabilis]
 gb|EXC20299.1| Serine/threonine-protein kinase ATM [Morus notabilis]
Length=894

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 85/164 (52%), Gaps = 10/164 (6%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L   F  G  LP+   L   + K+G + E ET  F     A++ F +SSDA+VA     +
Sbjct  734  LFATFGLGSALPTKADLIRIYSKYGKLDEKETDMFYDNFFARVCFVKSSDADVAYNDSKE  793

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMP--TTVLPMDAFKFPMLPSGKAPLNGEA-PDLM  468
              PF  +A  S+ L Y  G     +K P  + +      K    PS K P NG    DL 
Sbjct  794  DCPF-VSADVSFRLQYHSG----EYKSPELSNISSQSNVKTRKKPS-KLPANGSGQSDLG  847

Query  469  HIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMVG  600
             +KQ LEM+S+MLE     ++P +K+KL+ E+KG  KKVSAMVG
Sbjct  848  FVKQKLEMISSMLEDTEGEVTPTIKSKLQKEIKGLSKKVSAMVG  891



>ref|XP_006580692.1| PREDICTED: uncharacterized protein LOC102666447 [Glycine max]
Length=1053

 Score = 84.7 bits (208),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 59/164 (36%), Positives = 87/164 (53%), Gaps = 13/164 (8%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
             L ++F PG  +PS   L   + KFG + EAET  F +  TA++ F ++SDAE A      
Sbjct  893   LFVSFWPGSSMPSRSDLVSVYSKFGALNEAETDMFCTNYTARVSFLRTSDAEKAYNHSQN  952

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPL----NGEAPDL  465
             ++PFG     ++ L Y    ++D  K        +  K   LP+  AP+      EA  L
Sbjct  953   NNPFGSPTDVTFQLQY----SSDGSKSGQQ---GERSKNKSLPAATAPVAFSQGTEASKL  1005

Query  466   MHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
             + I+Q L+ M+ MLE +G   SPDM AK+E E+K  L+ V+ MV
Sbjct  1006  IFIQQKLQGMTLMLEASGGK-SPDMMAKVESEMKALLEDVNKMV  1048



>emb|CDY48152.1| BnaA06g16810D [Brassica napus]
Length=890

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 88/156 (56%), Gaps = 10/156 (6%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            L+L F+    +PS + L  TF  FGP+  +ET    E + A++ F  S DA  A +SL K
Sbjct  734  LVLKFSSKESMPSKDDLTSTFSAFGPLDASETHVYEELSGAEVAFVSSGDAVEAVKSLDK  793

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
            ++PFG   L S+ L  +     + ++     +P  +   P+     AP++ E+     +K
Sbjct  794  ANPFGEN-LVSFRLQQK---LINVYRNIAPRMPEISHVSPLQKPKNAPISVES-----MK  844

Query  478  QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKV  585
            QNL MM++ML+K+GD++S D KAKL+ ++   L+K+
Sbjct  845  QNLMMMTSMLDKSGDHLSRDTKAKLKSDISALLEKI  880



>ref|XP_009149839.1| PREDICTED: serine/threonine-protein kinase ATM [Brassica rapa]
Length=833

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 88/156 (56%), Gaps = 10/156 (6%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            L+L F+    +PS + L  TF  FGP+  +ET    E + A++ F  S DA  A +SL K
Sbjct  677  LVLKFSSKESMPSKDDLTSTFSAFGPLDASETHVYEELSGAEVAFVSSGDAVEAVKSLDK  736

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
            ++PFG   L S+ L  +     + ++     +P  +   P+     AP++ E+     +K
Sbjct  737  ANPFGEN-LVSFRLQQK---LINVYRNIAPRMPEISHVSPLQKPKNAPISVES-----MK  787

Query  478  QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKV  585
            QNL MM++ML+K+GD++S D KAKL+ ++   L+K+
Sbjct  788  QNLMMMTSMLDKSGDHLSRDTKAKLKSDISALLEKI  823



>gb|KHN27528.1| Serine/threonine-protein kinase ATM [Glycine soja]
Length=857

 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 84/160 (53%), Gaps = 3/160 (2%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L ++F PG  LPS   L   + KFG + E+ET  F+S+ TA++ F ++S+AE A      
Sbjct  696  LFVSFEPGSSLPSKSDLITLYGKFGALNESETAMFASDYTARVFFLKASNAEKALSHSQN  755

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
             +PF  +  AS+ L Y    +      P         K P  PS       EA  L +IK
Sbjct  756  LNPFDSSG-ASFRLEYLSAGSKSEKSKPKASSTKKKDKTPAKPSASLSPGTEASKLNYIK  814

Query  478  QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
            Q L+ +++MLE A D   PD+KAKLE E+K  L+ V+ MV
Sbjct  815  QKLQCLTSMLE-ASDAKLPDIKAKLESEMKRLLEDVNKMV  853



>gb|KHN41337.1| Serine/threonine-protein kinase ATM [Glycine soja]
Length=746

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 95/207 (46%), Gaps = 50/207 (24%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            L+L F+P   +PS E L  TF +FGP+  +ET+   +  +AQ+VF +S+DA VA  S+ +
Sbjct  536  LLLKFSPVAYIPSKEDLMTTFCRFGPLKASETQLLRDNGSAQVVFVRSADAAVAFHSIEQ  595

Query  298  SSPFG-PTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPML-----------------  423
            ++ F     L  + LH+         ++ TT  P      P L                 
Sbjct  596  NNKFAFGCTLVDFKLHHLSAACPPVEQLVTTAQPTGFMAMPGLMTSTRPTMSMAMPGVTP  655

Query  424  ------------------------------PSGKAPLNGEAP-DLMHIKQNLEMMSAMLE  510
                                          P+G   + GE P  L  IKQNL+MM++ LE
Sbjct  656  TQPIGSITIPGVMPTQPTGSMAVPGVTPTPPTGSMAMPGETPPSLQFIKQNLQMMTSTLE  715

Query  511  KAGDNISPDMKAKLEGEVKGFLKKVSA  591
             +G ++SP M+AKL+ E+K  L+KV++
Sbjct  716  NSGSSLSPRMRAKLDSEIKNLLRKVNS  742



>gb|KHN27440.1| Serine/threonine-protein kinase ATM [Glycine soja]
Length=714

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 88/164 (54%), Gaps = 13/164 (8%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L ++F PG  +PS   L   + KFG + EAET  F +  TA++ F ++SDAE A      
Sbjct  554  LFVSFWPGSSMPSRSDLVSVYSKFGALNEAETDMFCTNYTARVSFLRTSDAEKAYNHSQN  613

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPL----NGEAPDL  465
            ++PFG     ++ L Y    ++D  K   +    +  K   LP+  AP+      EA  L
Sbjct  614  NNPFGSPTDVTFQLQY----SSDGSK---SGQQGERSKNKSLPAATAPVAFSQGTEASKL  666

Query  466  MHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
            + I+Q L+ M+ MLE +G   SPDM AK+E E+K  L+ V+ MV
Sbjct  667  IFIQQKLQGMTLMLEASGGK-SPDMMAKVESEMKALLEDVNKMV  709



>ref|XP_006599108.1| PREDICTED: uncharacterized protein LOC102666492 isoform X1 [Glycine 
max]
 ref|XP_006599109.1| PREDICTED: uncharacterized protein LOC102666492 isoform X2 [Glycine 
max]
 ref|XP_006599110.1| PREDICTED: uncharacterized protein LOC102666492 isoform X3 [Glycine 
max]
Length=937

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 84/160 (53%), Gaps = 3/160 (2%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L ++F PG  LPS   L   + KFG + E+ET  F+S+ TA++ F ++S+AE A      
Sbjct  776  LFVSFEPGSSLPSKSDLITLYGKFGALNESETAMFASDYTARVFFLKASNAEKALSHSQN  835

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
             +PF  +  AS+ L Y    +      P         K P  PS       EA  L +IK
Sbjct  836  LNPFDSSG-ASFRLEYLSAGSKSEKSKPKASSTKKKDKTPAKPSASLSPGTEASKLNYIK  894

Query  478  QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
            Q L+ +++MLE A D   PD+KAKLE E+K  L+ V+ MV
Sbjct  895  QKLQCLTSMLE-ASDAKLPDIKAKLESEMKRLLEDVNKMV  933



>ref|XP_009389741.1| PREDICTED: uncharacterized protein LOC103976260 [Musa acuminata 
subsp. malaccensis]
Length=702

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 85/168 (51%), Gaps = 36/168 (21%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            L+L F  G PLPS   L  TF K+G V+E+ET+   ET +A++VFA+S+DAE A  S  K
Sbjct  555  LLLTFASGVPLPSQSELISTFRKYGVVIESETELLKETSSARVVFAKSTDAEKAFNSSDK  614

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
            +  FGP   A+YHLHY P              P+     P+            P L +I+
Sbjct  615  TGVFGP-PFANYHLHYLP--------------PIACSPHPI------------PPLPYIR  647

Query  478  QNLEMMSAMLEKA--------GDNISPDMKAKLEGEVKGFLKKVSAMV  597
            ++LE M + L            D + P  +  L G+++G LKKV+ M+
Sbjct  648  ESLERMISTLTTTTSVKETGPSDGMKPAARENLVGDMEGLLKKVNTML  695



>ref|XP_002305994.2| PWWP domain-containing family protein [Populus trichocarpa]
 gb|EEE86505.2| PWWP domain-containing family protein [Populus trichocarpa]
Length=1010

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 62/168 (37%), Positives = 88/168 (52%), Gaps = 18/168 (11%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
             L   F+PG  LPS   L   + KFGP+ + ET+ F +   A+IVF +S +AE A      
Sbjct  846   LYATFSPGSSLPSKNDLIMIYEKFGPLNQEETEVFYNNGCARIVFLRSPEAEKAFNDSQI  905

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGE--------  453
             +SPFG  A  ++ L Y    ++   K P  +  + + K   L   K  L+ E        
Sbjct  906   ASPFG-AASVTFQLQYL---SSAETKTPE-LRGIPSLKSSPLAKDKTNLDKELASQSSAN  960

Query  454   -APDLMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAM  594
                 L +IKQ LEMMS++L+ +      DMK+KLEGE+KG L+KVS M
Sbjct  961   DVSQLNYIKQKLEMMSSILKMSDGT---DMKSKLEGEIKGLLEKVSTM  1005



>ref|XP_006293299.1| hypothetical protein CARUB_v10019635mg [Capsella rubella]
 gb|EOA26197.1| hypothetical protein CARUB_v10019635mg [Capsella rubella]
Length=824

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 86/161 (53%), Gaps = 20/161 (12%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            L L F+    +PS + L  TF  FGP+  +ET  S     AQ+ F  S+DA  A +SL K
Sbjct  669  LFLKFSSQVSMPSRDDLTSTFSAFGPLDSSETHVSEGLNGAQVAFVSSADAIEAVKSLEK  728

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLP--SGKAPL---NGEAPD  462
            ++P+G T L+              FK+   ++ +     P +P  S  +P+   N     
Sbjct  729  ANPYGETLLS--------------FKLQQKLITVQRNIAPRMPVISHVSPIPKPNSIPTS  774

Query  463  LMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKV  585
            +  ++QNL MM+AMLE +GD++S + KAKL+ E+ G L+KV
Sbjct  775  VESMRQNLLMMTAMLENSGDSLSRETKAKLKSEITGLLEKV  815



>ref|XP_007151020.1| hypothetical protein PHAVU_004G012100g [Phaseolus vulgaris]
 gb|ESW23014.1| hypothetical protein PHAVU_004G012100g [Phaseolus vulgaris]
Length=1282

 Score = 80.9 bits (198),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 56/161 (35%), Positives = 89/161 (55%), Gaps = 7/161 (4%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
             L+++F  G   PS   L   + KFG + EAET  F++  TA++ F ++SDAE A      
Sbjct  1122  LVVSFWQGTSTPSRSELISVYSKFGALNEAETDVFNNNYTARVSFLRTSDAENALNHSKN  1181

Query  298   SSPFGPTALASYHLHYRP-GPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHI  474
             ++PFG +A A++ L Y   G  ++     +   P+ A      PS      GEA  L+ I
Sbjct  1182  NNPFG-SADATFQLQYHSEGSKSEEHGERSKNKPLVA---ATSPSVSVSQGGEASRLIFI  1237

Query  475   KQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
             ++ L+ ++ +LE +GD  SPD+ A+L+ EVK  L+ V+ MV
Sbjct  1238  QKKLQGLTLILEASGDK-SPDLMAELQREVKALLEDVNQMV  1277



>ref|XP_009618686.1| PREDICTED: uncharacterized protein LOC104110833 [Nicotiana tomentosiformis]
Length=821

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 86/162 (53%), Gaps = 26/162 (16%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L++ F+ G  LPS + +   + KFG + E ETK      + Q+V+ + SDAE A Q   K
Sbjct  679  LMVTFSAGFSLPSDDEVIQIYNKFGDLNEKETKVLHDSNSVQVVYMRGSDAEEAFQESVK  738

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPM--LPSGKAPLNGEAPDLMH  471
             SPFG T +              NF++   + P ++ + P+  L S K         +  
Sbjct  739  QSPFGATQV--------------NFRI---IYPSNS-EIPLSSLRSAKGK-----SQVQL  775

Query  472  IKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
            IKQ L+ MS++LEK    I+ + KA+LEGE+KG L+KVSA+ 
Sbjct  776  IKQKLKGMSSILEKCNGKITTEEKAELEGEIKGLLEKVSAVT  817



>ref|XP_010028828.1| PREDICTED: uncharacterized protein LOC104419024 [Eucalyptus grandis]
 ref|XP_010028829.1| PREDICTED: uncharacterized protein LOC104419024 [Eucalyptus grandis]
 gb|KCW55657.1| hypothetical protein EUGRSUZ_I01513 [Eucalyptus grandis]
Length=972

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 57/168 (34%), Positives = 90/168 (54%), Gaps = 16/168 (10%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFS-SETTAQIVFAQSSDAEVACQSLGK  297
            L++ F+PG  LP+ + L   + KFG + E ET    +   A +VF ++S+AE A +S  K
Sbjct  806  LLVTFSPGASLPTKDDLIKIYSKFGVLNETETDMCYNNLYALVVFQKNSNAEEALKSSQK  865

Query  298  SSPFGPTALASYHLH----------YRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLN  447
             +PF  +A AS+ L           +  G +A++  +P     M     P   S      
Sbjct  866  ENPF-QSANASFKLQCDSTTPKTHGHGGGASAEDSPLPKQHSNMA----PKKQSASQSST  920

Query  448  GEAPDLMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSA  591
            GEA +L +IK  LE M++M++K+   +S  MK+ LEGE+K  L+KVS+
Sbjct  921  GEASELQYIKLKLEKMTSMVDKSHGKLSKKMKSGLEGEIKDLLEKVSS  968



>gb|KHN14842.1| Serine/threonine-protein kinase ATM [Glycine soja]
Length=770

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 95/208 (46%), Gaps = 51/208 (25%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            +IL F P   +PS E L  TF +FGP+  +ET+   +T +AQ+VF +S DA  A  S+ +
Sbjct  559  VILKFAPVAYIPSKEDLMTTFCRFGPLKASETQLLKDTGSAQVVFVRSEDAAAAFHSIEQ  618

Query  298  SSPFG-PTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFP-------------------  417
            ++ F    +L    LH+         ++ TT  P      P                   
Sbjct  619  NNKFAFGCSLVDCKLHHLSATCPPVEQLVTTAQPTGFMAIPGVMTPTRPTMSMEMPGVTP  678

Query  418  -----------------------------MLPSGKAPLNGEAPDLMH-IKQNLEMMSAML  507
                                         +LP+G   + GE P  +H IKQNL+MM+++L
Sbjct  679  TQPAGSIATPGVTPTQQPTGSKAVPGVTPILPTGSMTMPGETPPSLHFIKQNLQMMTSIL  738

Query  508  EKAGDNISPDMKAKLEGEVKGFLKKVSA  591
            E +G ++SP  +AKL+ E+K  ++KV++
Sbjct  739  ENSGSSLSPKTRAKLDSEIKNLMRKVNS  766



>ref|XP_003556846.1| PREDICTED: uncharacterized protein LOC100777798 isoform X1 [Glycine 
max]
 ref|XP_006605676.1| PREDICTED: uncharacterized protein LOC100777798 isoform X2 [Glycine 
max]
 ref|XP_006605677.1| PREDICTED: uncharacterized protein LOC100777798 isoform X3 [Glycine 
max]
Length=770

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 95/208 (46%), Gaps = 51/208 (25%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            +IL F P   +PS E L  TF +FGP+  +ET+   +T +AQ+VF +S DA  A  S+ +
Sbjct  559  VILKFAPVAYIPSKEDLMTTFCRFGPLKASETQLLKDTGSAQVVFVRSEDAAAAFHSIEQ  618

Query  298  SSPFG-PTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFP-------------------  417
            ++ F    +L    LH+         ++ TT  P      P                   
Sbjct  619  NNKFAFGCSLVDCKLHHLSATCPPVEQLVTTAQPTGFMAIPGVMTPTRPTMSMEMPGVTP  678

Query  418  -----------------------------MLPSGKAPLNGEAPDLMH-IKQNLEMMSAML  507
                                         +LP+G   + GE P  +H IKQNL+MM+++L
Sbjct  679  TQPAGSIATPGVTPTQQPTGSKAVPGVTPILPTGSMTMPGETPPSLHFIKQNLQMMTSIL  738

Query  508  EKAGDNISPDMKAKLEGEVKGFLKKVSA  591
            E +G ++SP  +AKL+ E+K  ++KV++
Sbjct  739  ENSGSSLSPKTRAKLDSEIKNLMRKVNS  766



>ref|XP_011014432.1| PREDICTED: uncharacterized protein LOC105118231 isoform X3 [Populus 
euphratica]
Length=1001

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 61/168 (36%), Positives = 88/168 (52%), Gaps = 18/168 (11%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L   F+PG  LPS   L   + KFGP+ + ET+ F +   A+IVF +S +AE A      
Sbjct  837  LYATFSPGSSLPSKNDLIMIYEKFGPLNQEETEVFYNNGCARIVFLRSPEAEKAFNDSQI  896

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGE--------  453
            +SPFG  A  ++ L Y    ++   K P  +  + + K   L   K  L+ E        
Sbjct  897  ASPFG-AASVTFQLQYL---SSAETKTPE-LREIPSLKSSPLAKDKTNLDKELASQSSAN  951

Query  454  -APDLMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAM  594
                L +IKQ LE+MS++L+ +      DMK+KLEGE+KG L+KVS M
Sbjct  952  DVSQLNYIKQKLEVMSSILKMSDGT---DMKSKLEGEIKGLLEKVSTM  996



>gb|KDP45328.1| hypothetical protein JCGZ_09577 [Jatropha curcas]
Length=1039

 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 85/174 (49%), Gaps = 29/174 (17%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
             L + F PG  LPS   L   + KFG + E +T+ + +   A++VF +SS+AE A      
Sbjct  876   LYVTFGPGSTLPSKNDLIKLYSKFGALNEEQTEMYYTNYCARVVFLKSSEAEEAFNDSQL  935

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPD-----  462
             SSPF   A A++ L Y                     +   + S K+ L  +APD     
Sbjct  936   SSPF-KAANATFRLRYLSAETK-------------TRELRDISSTKSKLGTKAPDMSFVL  981

Query  463   ---------LMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
                      L +IKQ LEM+ ++LE +   ISPD+K+ LEGE+K  L+KVS M 
Sbjct  982   ESTDNDVSPLNYIKQKLEMIKSLLETSDGKISPDLKSILEGEIKVLLEKVSIMA  1035



>gb|EPS69912.1| hypothetical protein M569_04853 [Genlisea aurea]
Length=650

 Score = 78.6 bits (192),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 89/158 (56%), Gaps = 18/158 (11%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETTAQIVFAQSSDAEVACQSLGKS  300
            ++L F     LP  ++L  TF +FG + E+E +   E+T +I + + ++A  A QSL KS
Sbjct  510  IVLVFASNDTLPPRDTLITTFSRFGLLRESEIEAVDESTVRIPYERITEARFAFQSLEKS  569

Query  301  SPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIKQ  480
             PFG  ALAS+ L         +   P  V+   ++      + + P+   AP+LM  K+
Sbjct  570  RPFG-EALASFRL---------SVSTPPPVMRRRSYDS---KNREPPI---APELM--KR  611

Query  481  NLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAM  594
            N+E M + LEKAG ++S +M+ KLE E+  FL K+S+M
Sbjct  612  NVEAMKSTLEKAGASLSVEMRTKLEKEINLFLDKLSSM  649



>ref|XP_007031489.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007031490.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY02415.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY02416.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=1013

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 52/172 (30%), Positives = 91/172 (53%), Gaps = 14/172 (8%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPV-VEAETKFSSETTAQIVFAQSSDAEVACQSLGK  297
             L + F PG  LP+ + L   + ++G + VE    F +   A++VF +SS+A+ A  S   
Sbjct  839   LFVTFGPGSSLPTKDDLIRIYSRYGALNVEDTDMFYNNFCARVVFIRSSEAKQAFNSSQY  898

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPD-----  462
             +SPFG + + S+ L   P  +A + +   +  P    K     S K+  + ++ D     
Sbjct  899   ASPFGASNV-SFRLRIHPAASAHDHREKPSAKPSPLAKERAKSSKKSLASQKSADQASQN  957

Query  463   -------LMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
                    L  I+  LEM+++MLEK+ + +S ++K+K+  E+KG L+KV+ MV
Sbjct  958   SADQASQLNFIRHKLEMLTSMLEKSDEKMSSEIKSKVHSEIKGLLEKVNTMV  1009



>ref|XP_009768631.1| PREDICTED: uncharacterized protein LOC104219632 [Nicotiana sylvestris]
Length=817

 Score = 75.5 bits (184),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 86/160 (54%), Gaps = 22/160 (14%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETTA-QIVFAQSSDAEVACQSLGK  297
            L++ F+ G  LPS + +   + KFG + E ETK   ++ + Q+V+ + SDAE A Q   K
Sbjct  675  LMVTFSAGFSLPSDDEVIQIYNKFGDLNEKETKVLHDSNSLQVVYIRDSDAEEAFQESVK  734

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
             SPFG  A  ++ L Y   P           +P+ + K          + G++  +  IK
Sbjct  735  QSPFGD-AEVNFRLIYPSNPE----------IPLSSLK---------SVKGKS-QVQLIK  773

Query  478  QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
            + L+ MS++LEK    I+ + KA+L GE+KG L+KVSA+ 
Sbjct  774  KKLKGMSSILEKCNGKITTEEKAELLGEIKGLLEKVSAVT  813



>gb|KDO55271.1| hypothetical protein CISIN_1g001285mg [Citrus sinensis]
Length=1107

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 52/83 (63%), Gaps = 1/83 (1%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETTAQIVFAQSSDAEVACQSLGKS  300
             LILNFT    +PS ++LN+ F +FGPV E ET+      A++VF + +DAE A  S GK 
Sbjct  1006  LILNFTDMDSVPSKDNLNEIFSRFGPVNELETEVKKSKRAKVVFKRRADAETAFSSAGKY  1065

Query  301   SPFGPTALASYHLHYRPGPAADN  369
             S FGP+ L SY L Y P  A+ N
Sbjct  1066  SIFGPS-LVSYCLKYMPSMASKN  1087



>ref|XP_011014431.1| PREDICTED: uncharacterized protein LOC105118231 isoform X2 [Populus 
euphratica]
Length=1015

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 58/164 (35%), Positives = 85/164 (52%), Gaps = 18/164 (11%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L   F+PG  LPS   L   + KFGP+ + ET+ F +   A+IVF +S +AE A      
Sbjct  837  LYATFSPGSSLPSKNDLIMIYEKFGPLNQEETEVFYNNGCARIVFLRSPEAEKAFNDSQI  896

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGE--------  453
            +SPFG  A  ++ L Y    ++   K P  +  + + K   L   K  L+ E        
Sbjct  897  ASPFG-AASVTFQLQYL---SSAETKTPE-LREIPSLKSSPLAKDKTNLDKELASQSSAN  951

Query  454  -APDLMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKK  582
                L +IKQ LE+MS++L+ +      DMK+KLEGE+KG L+K
Sbjct  952  DVSQLNYIKQKLEVMSSILKMSDGT---DMKSKLEGEIKGLLEK  992



>ref|XP_006428875.1| hypothetical protein CICLE_v10010946mg [Citrus clementina]
 ref|XP_006428876.1| hypothetical protein CICLE_v10010946mg [Citrus clementina]
 gb|ESR42115.1| hypothetical protein CICLE_v10010946mg [Citrus clementina]
 gb|ESR42116.1| hypothetical protein CICLE_v10010946mg [Citrus clementina]
Length=1107

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 52/83 (63%), Gaps = 1/83 (1%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETTAQIVFAQSSDAEVACQSLGKS  300
             LILNFT    +PS ++LN+ F +FGPV E ET+      A++VF + +DAE A  S GK 
Sbjct  1006  LILNFTDMDSVPSKDNLNEIFSRFGPVNELETEVKKSKRAKVVFKRRADAETAFSSAGKY  1065

Query  301   SPFGPTALASYHLHYRPGPAADN  369
             S FGP+ L SY L Y P  A+ N
Sbjct  1066  SIFGPS-LVSYCLKYMPSMASKN  1087



>ref|XP_006480678.1| PREDICTED: uncharacterized protein LOC102623259 isoform X1 [Citrus 
sinensis]
 ref|XP_006480679.1| PREDICTED: uncharacterized protein LOC102623259 isoform X2 [Citrus 
sinensis]
Length=1107

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 52/83 (63%), Gaps = 1/83 (1%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETTAQIVFAQSSDAEVACQSLGKS  300
             LILNFT    +PS ++LN+ F +FGPV E ET+      A++VF + +DAE A  S GK 
Sbjct  1006  LILNFTDMDSVPSKDNLNEIFSRFGPVNELETEVKKSKRAKVVFKRRADAETAFSSAGKY  1065

Query  301   SPFGPTALASYHLHYRPGPAADN  369
             S FGP+ L SY L Y P  A+ N
Sbjct  1066  SIFGPS-LVSYCLKYMPSMASKN  1087



>emb|CDY39560.1| BnaCnng09290D [Brassica napus]
Length=843

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 85/157 (54%), Gaps = 12/157 (8%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            L+L F+    +PS + L   F  FGP+  +E     E + A++ F  S DA  A +SL K
Sbjct  686  LVLKFSSKESMPSKDDLTSIFSAFGPLDASEIHVYEELSGAEVAFVSSGDAVEAVKSLDK  745

Query  298  SSPFGPTALASYHLHYRPGPAADN-FKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHI  474
            ++PFG   L S+ L     P   N ++     +P  +   P+      P++ E+     +
Sbjct  746  ANPFGEN-LVSFRLQ----PKLINVYRNIAPSMPAISHVSPLQKPKNPPISVES-----M  795

Query  475  KQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKV  585
            KQNL MM+AML+K+GD++S + KAKL+ ++   L+K+
Sbjct  796  KQNLLMMTAMLDKSGDHLSRETKAKLKSDISALLEKI  832



>ref|XP_011077382.1| PREDICTED: uncharacterized protein LOC105161407 [Sesamum indicum]
Length=784

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 52/80 (65%), Gaps = 2/80 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            LILNFT    +PS  +LN+ F  +GP+ E+ET+ FS    A+++F + +DAE A  S GK
Sbjct  691  LILNFTNLEAIPSIVNLNEIFSHYGPLKESETEIFSKSKRAKVIFKRRADAETAFSSTGK  750

Query  298  SSPFGPTALASYHLHYRPGP  357
             S FGP+ L SY LHY P P
Sbjct  751  YSTFGPS-LVSYRLHYAPSP  769



>ref|XP_011014430.1| PREDICTED: uncharacterized protein LOC105118231 isoform X1 [Populus 
euphratica]
Length=1020

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 58/164 (35%), Positives = 85/164 (52%), Gaps = 18/164 (11%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L   F+PG  LPS   L   + KFGP+ + ET+ F +   A+IVF +S +AE A      
Sbjct  837  LYATFSPGSSLPSKNDLIMIYEKFGPLNQEETEVFYNNGCARIVFLRSPEAEKAFNDSQI  896

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGE--------  453
            +SPFG  A  ++ L Y    ++   K P  +  + + K   L   K  L+ E        
Sbjct  897  ASPFG-AASVTFQLQYL---SSAETKTPE-LREIPSLKSSPLAKDKTNLDKELASQSSAN  951

Query  454  -APDLMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKK  582
                L +IKQ LE+MS++L+ +      DMK+KLEGE+KG L+K
Sbjct  952  DVSQLNYIKQKLEVMSSILKMSDGT---DMKSKLEGEIKGLLEK  992



>ref|XP_010107594.1| Serine/threonine-protein kinase ATM [Morus notabilis]
 gb|EXC16276.1| Serine/threonine-protein kinase ATM [Morus notabilis]
Length=905

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 55/89 (62%), Gaps = 5/89 (6%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            LILNFT    +PS   LN  F ++GP+ E+ET+ F   + A++VF + SDAE A  S GK
Sbjct  802  LILNFTDFDSVPSETILNKIFSRYGPLNESETEVFKKSSRAKVVFKRRSDAETAFSSAGK  861

Query  298  SSPFGPTALASYHLHY---RPGPAADNFK  375
             S FGP+ L SY L Y   RPG A+ N K
Sbjct  862  YSTFGPS-LLSYRLKYLSSRPGKASPNSK  889



>ref|XP_010691465.1| PREDICTED: uncharacterized protein LOC104904783 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=811

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 67/114 (59%), Gaps = 11/114 (10%)
 Frame = +1

Query  271  EVACQSLGKSSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFK----FPMLPSGKA  438
            EV  +++G  SP  PTA A  +       +A+N ++ T    M   K     P L     
Sbjct  703  EVCLRNVGPHSPIPPTAAAYLN-------SANNNQVSTPQKSMQPAKGNNNSPSLLKTPG  755

Query  439  PLNGEAPDLMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMVG  600
               GEAP +  I+++LE+M+AMLEK+GD +S DMKAKLE E+KG LKKVS++ G
Sbjct  756  TPAGEAPSMDQIRKDLELMTAMLEKSGDTLSTDMKAKLENEIKGLLKKVSSIPG  809



>ref|XP_010244984.1| PREDICTED: uncharacterized protein LOC104588661 [Nelumbo nucifera]
 ref|XP_010244985.1| PREDICTED: uncharacterized protein LOC104588661 [Nelumbo nucifera]
Length=1179

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LILNFT    +PS  SLN  F +FGP+ E+ET+   ET+ AQ+VF + +DAEVAC S GK
Sbjct  1077  LILNFTEVDSIPSEMSLNKIFKRFGPLKESETEVLRETSCAQVVFKRCADAEVACSSAGK  1136

Query  298   SSPFGPTALASYHLHY  345
                FGP    SY L Y
Sbjct  1137  FGIFGP-VFVSYQLRY  1151



>ref|XP_010691464.1| PREDICTED: uncharacterized protein LOC104904783 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=844

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 67/114 (59%), Gaps = 11/114 (10%)
 Frame = +1

Query  271  EVACQSLGKSSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFK----FPMLPSGKA  438
            EV  +++G  SP  PTA A  +       +A+N ++ T    M   K     P L     
Sbjct  736  EVCLRNVGPHSPIPPTAAAYLN-------SANNNQVSTPQKSMQPAKGNNNSPSLLKTPG  788

Query  439  PLNGEAPDLMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMVG  600
               GEAP +  I+++LE+M+AMLEK+GD +S DMKAKLE E+KG LKKVS++ G
Sbjct  789  TPAGEAPSMDQIRKDLELMTAMLEKSGDTLSTDMKAKLENEIKGLLKKVSSIPG  842



>ref|XP_011097431.1| PREDICTED: uncharacterized protein LOC105176358 [Sesamum indicum]
 ref|XP_011097433.1| PREDICTED: uncharacterized protein LOC105176358 [Sesamum indicum]
 ref|XP_011097434.1| PREDICTED: uncharacterized protein LOC105176358 [Sesamum indicum]
 ref|XP_011097435.1| PREDICTED: uncharacterized protein LOC105176358 [Sesamum indicum]
Length=902

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 83/160 (52%), Gaps = 6/160 (4%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            LIL FT G PLPS E +   F KFG +   ETK  +++ + QIV+ + SDAE A +S   
Sbjct  734  LILEFTSGFPLPSKEDIVKLFSKFGSLNRKETKVVTDSHSVQIVYVKDSDAEAAFKSSLS  793

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKA-PLNGEAPDLMHI  474
             SPFG   + +Y L  R    + + +  T V P    K  +     + P +    D   I
Sbjct  794  QSPFGLENV-NYRLQ-RSSAGSRSTRSHTKVSP--PLKRAIEKRNSSHPADDLISDASII  849

Query  475  KQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAM  594
            +Q LE+M+A+LE      SP  K+ L+ E+K  +++V  +
Sbjct  850  RQKLEIMTAILENYHSKFSPKDKSNLKDEMKHLMEEVETI  889



>ref|XP_002524654.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37673.1| conserved hypothetical protein [Ricinus communis]
Length=1072

 Score = 73.2 bits (178),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 53/160 (33%), Positives = 79/160 (49%), Gaps = 7/160 (4%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
             L + F PG  LP+   L   + K+G + E ET+ F +   A+++F ++S+AE A      
Sbjct  880   LYVTFGPGSSLPTKNDLIQIYRKYGALNENETEMFYANYCARVLFLKTSEAEEAFNDSQL  939

Query  298   SSPFGPTALASYHLHYRPGPAA-----DNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPD  462
             SSPF   A  ++ L Y           D        L  +  K P  PS      G   +
Sbjct  940   SSPF-KAANVTFRLRYLSAETKTRELRDIPSKKRASLAKEGAKTPGAPSASQSSGGNLSE  998

Query  463   LMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKK  582
             L  IKQ LEM++++LE +   ISP+ K+ LEGE+K  L+K
Sbjct  999   LNFIKQKLEMITSLLETSIGKISPNTKSILEGEIKVLLEK  1038



>ref|XP_011098460.1| PREDICTED: uncharacterized protein LOC105177120 [Sesamum indicum]
 ref|XP_011098461.1| PREDICTED: uncharacterized protein LOC105177120 [Sesamum indicum]
Length=867

 Score = 72.8 bits (177),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 81/157 (52%), Gaps = 5/157 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            L L F PG PLPS E +   F +FG + E ETK  ++T + QIV+ +++DAE A +S   
Sbjct  700  LSLTFRPGFPLPSKEEIVRLFGEFGSLNEKETKLVTDTRSVQIVYMKAADAEAAFRSSVS  759

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAP-DLMHI  474
             SPFG   +  Y L +    +  +   P   L  D  + P       P  G+   D+  I
Sbjct  760  RSPFGVETV-DYQLQHPSSDSKSHESHPKLSLSTD--RAPHRQDISTPPTGDVMLDVRVI  816

Query  475  KQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKV  585
             + LE+M+A+LE      SP+ K+ L+ E+K  ++ V
Sbjct  817  MRKLEIMTAILENYHSKFSPEEKSSLKDEMKRLMESV  853



>ref|XP_010936710.1| PREDICTED: uncharacterized protein LOC105056271 [Elaeis guineensis]
 ref|XP_010936711.1| PREDICTED: uncharacterized protein LOC105056271 [Elaeis guineensis]
Length=843

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 87/172 (51%), Gaps = 33/172 (19%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            L +NF PG  LPS + L  TF K+G ++E+ET+   ET +A++VF +S+DAE A  SL K
Sbjct  688  LHMNFAPGITLPSRDDLISTFSKYGVLIESETELLQETGSARVVFVKSTDAEKAFNSLDK  747

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
            +  FGP   A+Y L Y P  ++          P   +                     I+
Sbjct  748  TGVFGP-PYATYRLRYLPAISSPPSSPIPVPKPPLPY---------------------IR  785

Query  478  QNLEMM-------SAMLEKAG--DNISPDMKAKLEGEVKGFLKKVSAMV-GP  603
            ++LE M       S  +++ G  D + P+ +  L GE++G LKKV+ M+ GP
Sbjct  786  KSLERMISSLAGSSTSVKETGCSDGLKPEARDNLVGEMQGLLKKVNKMLNGP  837



>ref|XP_008233375.1| PREDICTED: uncharacterized protein LOC103332415 [Prunus mume]
Length=1335

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 37/76 (49%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L+LNF+  + +PS   LN  F +FGP+ E+ET+   E++ A++VF +SSDAEVAC S GK
Sbjct  1173  LVLNFSEVNSVPSETKLNKMFRRFGPLRESETEVDRESSRARVVFKRSSDAEVACNSAGK  1232

Query  298   SSPFGPTALASYHLHY  345
              + FGP  L +Y L+Y
Sbjct  1233  FNIFGPI-LVNYQLNY  1247



>ref|XP_007218899.1| hypothetical protein PRUPE_ppa000448mg [Prunus persica]
 gb|EMJ20098.1| hypothetical protein PRUPE_ppa000448mg [Prunus persica]
Length=1170

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 37/76 (49%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L+LNF+  + +PS   LN  F +FGP+ E+ET+   E++ A++VF +SSDAEVAC S GK
Sbjct  998   LVLNFSEVNSVPSETKLNKMFRRFGPLRESETEVDRESSRARVVFKRSSDAEVACNSAGK  1057

Query  298   SSPFGPTALASYHLHY  345
              + FGP  L +Y L+Y
Sbjct  1058  FNIFGPI-LVNYQLNY  1072



>ref|XP_006446521.1| hypothetical protein CICLE_v10014124mg [Citrus clementina]
 gb|ESR59761.1| hypothetical protein CICLE_v10014124mg [Citrus clementina]
Length=1025

 Score = 69.3 bits (168),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 53/169 (31%), Positives = 86/169 (51%), Gaps = 14/169 (8%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
             L + F P   LPS + L   + KFG + + ET+ F +   A++VF +S DAE A +S   
Sbjct  858   LYVTFGPTSSLPSKKDLIKFYSKFGSLNKEETEMFYNNHCARVVFLRSYDAEEALKSSQL  917

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLN--------GE  453
             +SPF      + +  +    ++   K+       +A   P    GKA            E
Sbjct  918   ASPF-----EASNCKFELRNSSSTSKVQKRKEISNARSSPAKEGGKALKKEPGSKSSIAE  972

Query  454   APDLMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMVG  600
             A    ++KQ LEM+S++L  +   ++P++K+KLE EVK  L+KV+ +VG
Sbjct  973   ASSFNYVKQKLEMVSSVLADSDGKMTPELKSKLEHEVKDLLEKVNTVVG  1021



>ref|XP_010244981.1| PREDICTED: uncharacterized protein LOC104588660 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010244982.1| PREDICTED: uncharacterized protein LOC104588660 isoform X1 [Nelumbo 
nucifera]
Length=1415

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
             LILNF     +PS  +LN  F +FGP+ E ET+   ET +A++VF + +DAEVAC S GK
Sbjct  1315  LILNFAEVDSVPSEMNLNKIFKRFGPLKELETEVLKETNSAKVVFKRRADAEVACSSAGK  1374

Query  298   SSPFGPTALASYHLHYRPGP  357
              S FG +A  SY L Y   P
Sbjct  1375  FSIFG-SAFVSYQLRYLSSP  1393



>ref|XP_007217668.1| hypothetical protein PRUPE_ppa1027165mg [Prunus persica]
 gb|EMJ18867.1| hypothetical protein PRUPE_ppa1027165mg [Prunus persica]
Length=944

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 81/173 (47%), Gaps = 23/173 (13%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L + F PG  LP+   L   + KFG + E ET+ F +   A++ F + SDAE A      
Sbjct  777  LFVTFGPGSSLPTKADLIKIYSKFGELNEMETEMFYNNFCARVSFLRISDAEEAFNHSQN  836

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKF--PMLPSGKA-----------  438
             SPFG + + ++ LH        N    + V  +       P    GK            
Sbjct  837  DSPFGASNV-NFRLH--------NLSTASKVRELSEISNSPPAKSRGKTRSQPVGTNSQP  887

Query  439  PLNGEAPDLMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
            P++GEA  L  I+  LE +++ML+ +   +S   K+KLE E+K  L+ VS MV
Sbjct  888  PVDGEASQLDFIRHKLEKLTSMLDNSDGKVSAVTKSKLESEIKELLETVSTMV  940



>ref|XP_009770150.1| PREDICTED: uncharacterized protein LOC104220881 [Nicotiana sylvestris]
Length=1635

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LILNF  G PLPS  +LN  F +FGP+ E ET+   E++ A++VF + SDAEVA  S+GK
Sbjct  1540  LILNFAEGGPLPSEMNLNKMFRRFGPLKELETEVYQESSRARVVFKRGSDAEVAHSSVGK  1599

Query  298   SSPFGPTALASYHLHYRP  351
              + FG   + +Y L Y P
Sbjct  1600  FNIFGSRQV-TYELSYTP  1616



>ref|XP_010244983.1| PREDICTED: uncharacterized protein LOC104588660 isoform X2 [Nelumbo 
nucifera]
Length=1386

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
             LILNF     +PS  +LN  F +FGP+ E ET+   ET +A++VF + +DAEVAC S GK
Sbjct  1286  LILNFAEVDSVPSEMNLNKIFKRFGPLKELETEVLKETNSAKVVFKRRADAEVACSSAGK  1345

Query  298   SSPFGPTALASYHLHYRPGP  357
              S FG +A  SY L Y   P
Sbjct  1346  FSIFG-SAFVSYQLRYLSSP  1364



>ref|XP_006470311.1| PREDICTED: biorientation of chromosomes in cell division protein 
1-like 1-like [Citrus sinensis]
Length=1025

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 53/169 (31%), Positives = 85/169 (50%), Gaps = 14/169 (8%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
             L + F P   LPS   L   + KFG + + ET+ F +   A++VF +S DAE A +S   
Sbjct  858   LYVTFGPTSSLPSKNDLIKFYSKFGSLNKEETEMFYNNHCARVVFLRSYDAEEALKSSQL  917

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLN--------GE  453
             +SPF      + +  +    ++   K+       +A   P    GKA            E
Sbjct  918   ASPF-----EASNCKFELRNSSSTSKVQKRKEISNARSSPAKEGGKALKKEPGSKSSIAE  972

Query  454   APDLMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMVG  600
             A    ++KQ LEM+S++L  +   ++P++K+KLE EVK  L+KV+ +VG
Sbjct  973   ASSFNYVKQKLEMVSSVLADSDGKMTPELKSKLEHEVKDLLEKVNTVVG  1021



>ref|XP_008230588.1| PREDICTED: serine/threonine-protein kinase ATM [Prunus mume]
Length=968

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 81/173 (47%), Gaps = 23/173 (13%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L + F PG  LP+   L   + KFG + E ET+ F +   A++ F + SDAE A      
Sbjct  801  LFVTFGPGSSLPTKADLIKIYSKFGELNEMETEMFYNNFCARVSFLRISDAEEAFNHSQN  860

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKF--PMLPSGKA-----------  438
             SPFG + + ++ LH        N    + V  +       P    GK            
Sbjct  861  DSPFGASNV-NFRLH--------NLSAASKVRELSEISNSPPAKSRGKTKSQPVGTNSQP  911

Query  439  PLNGEAPDLMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
            P++GEA  L  I+  LE +++ML+ +   +S   K+KLE E+K  L+ VS MV
Sbjct  912  PVDGEASQLDFIRHKLEKLTSMLDNSDGKVSAVTKSKLESEIKELLETVSTMV  964



>ref|XP_008445854.1| PREDICTED: uncharacterized protein LOC103488747 isoform X1 [Cucumis 
melo]
Length=1996

 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 52/78 (67%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
             L++NF+    +PS ++LN+ F +FGP+ E+ET+   E   A++VF +SSDAE+A  S G+
Sbjct  1093  LVMNFSEVDSVPSEKTLNNMFRRFGPLRESETEVDREGGRARVVFKKSSDAEIAYSSAGR  1152

Query  298   SSPFGPTALASYHLHYRP  351
              S FGP  L +Y L Y P
Sbjct  1153  FSIFGP-RLVNYQLSYTP  1169



>ref|XP_008445855.1| PREDICTED: uncharacterized protein LOC103488747 isoform X2 [Cucumis 
melo]
Length=1985

 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 52/78 (67%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
             L++NF+    +PS ++LN+ F +FGP+ E+ET+   E   A++VF +SSDAE+A  S G+
Sbjct  1093  LVMNFSEVDSVPSEKTLNNMFRRFGPLRESETEVDREGGRARVVFKKSSDAEIAYSSAGR  1152

Query  298   SSPFGPTALASYHLHYRP  351
              S FGP  L +Y L Y P
Sbjct  1153  FSIFGP-RLVNYQLSYTP  1169



>ref|XP_004143691.1| PREDICTED: uncharacterized protein LOC101204371 [Cucumis sativus]
Length=1936

 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 52/78 (67%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
             L++NF+    +PS ++LN+ F +FGP+ E+ET+   E   A++VF +SSDAE+A  S G+
Sbjct  1091  LVMNFSEVDSVPSEKTLNNMFRRFGPLRESETEVDREGGRARVVFKKSSDAEIAYSSAGR  1150

Query  298   SSPFGPTALASYHLHYRP  351
              S FGP  L +Y L Y P
Sbjct  1151  FSIFGPR-LVNYQLSYTP  1167



>gb|KGN50467.1| hypothetical protein Csa_5G175900 [Cucumis sativus]
Length=2067

 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 52/78 (67%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
             L++NF+    +PS ++LN+ F +FGP+ E+ET+   E   A++VF +SSDAE+A  S G+
Sbjct  1091  LVMNFSEVDSVPSEKTLNNMFRRFGPLRESETEVDREGGRARVVFKKSSDAEIAYSSAGR  1150

Query  298   SSPFGPTALASYHLHYRP  351
              S FGP  L +Y L Y P
Sbjct  1151  FSIFGP-RLVNYQLSYTP  1167



>ref|XP_009626439.1| PREDICTED: uncharacterized protein LOC104117141 [Nicotiana tomentosiformis]
Length=1560

 Score = 68.2 bits (165),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LILNF  G PLPS  +LN  F +FGP+ E ET+   E++ A++VF + SDAEVA  S GK
Sbjct  1465  LILNFAEGGPLPSEMNLNKMFRRFGPLKELETEVYQESSRARVVFKRGSDAEVAHSSAGK  1524

Query  298   SSPFGPTALASYHLHYRP  351
              + FG   + +Y L Y P
Sbjct  1525  FNIFGSRQV-TYELSYTP  1541



>emb|CDP02101.1| unnamed protein product [Coffea canephora]
Length=815

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 80/161 (50%), Gaps = 14/161 (9%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L++ F PG  LPS + +   F KFG + E ET  F    + QI ++    AE A +   K
Sbjct  660  LVVTFAPGFSLPSKDDVIRIFSKFGVLNEKETVVFPESASVQIAYSSPGGAEEALRESLK  719

Query  298  SSPFGPTALASYHLHYRPGP--AADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMH  471
             SPFG  ++ +Y + +      A ++    ++  P+ ++          P  GE   L+ 
Sbjct  720  QSPFGSRSV-NYKVRHSSASSMAVESSHNTSSDNPVASW----------PAAGEKSQLVS  768

Query  472  IKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAM  594
            I+Q LE+M++MLEK    IS +    L+ E+K  L+KV  M
Sbjct  769  IRQKLEIMTSMLEKCDGKISTEEVYHLDAEIKPLLEKVRKM  809



>ref|XP_010922513.1| PREDICTED: uncharacterized protein LOC105045809 [Elaeis guineensis]
Length=467

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            LIL+F    PLPS   L  TF ++GP+ EAET+  S+T   ++VF + +DAE+A  S GK
Sbjct  97   LILSFNGASPLPSQTDLIRTFSRYGPLKEAETEVQSKTNRVKVVFKKRADAEIAFSSAGK  156

Query  298  SSPFGPTALASYHLHYRP  351
             S FGP AL SY L Y P
Sbjct  157  YSIFGP-ALLSYCLRYLP  173



>emb|CBI32687.3| unnamed protein product [Vitis vinifera]
Length=888

 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 70/132 (53%), Gaps = 16/132 (12%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            LILNF   + +PS  +LN  F ++GP+ E+ET+       A++VF +SSDAE A  S GK
Sbjct  531  LILNFADLNSVPSETNLNRIFSRYGPLNESETEVLKKSIRAKVVFKRSSDAETAFSSSGK  590

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFP-MLPSGKAPLNGEAPDLMHI  474
             S FGP+ L SY L Y          +P  +     F+FP  + + KA    ++ D++  
Sbjct  591  FSIFGPS-LISYRLKY----------LPARLHKASIFEFPDAVDASKAE---DSADIVDQ  636

Query  475  KQNLEMMSAMLE  510
            +  +  +S  LE
Sbjct  637  RDQVSQLSESLE  648



>ref|XP_006340456.1| PREDICTED: dentin sialophosphoprotein-like [Solanum tuberosum]
Length=1656

 Score = 67.4 bits (163),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LIL F  G PLPS  +LN  F +FGP+ E ET+   ET+ A++VF + SDAEVA  S+GK
Sbjct  1561  LILIFAEGSPLPSEMNLNKMFRRFGPLKELETEVHQETSRARVVFKRGSDAEVAHSSVGK  1620

Query  298   SSPFGPTALASYHLHYRP  351
              + FG   + +Y L Y P
Sbjct  1621  FNIFGSRQV-TYELSYTP  1637



>ref|XP_004304398.1| PREDICTED: uncharacterized protein LOC101301224 [Fragaria vesca 
subsp. vesca]
Length=1096

 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LILNF+    LPS E LN  F  FGP+ E++T+   +T  A++VF + SDA+ A  S GK
Sbjct  991   LILNFSDSESLPSEEYLNKIFSGFGPLNESQTELLKKTNRAKVVFKRRSDAQKAFSSAGK  1050

Query  298   SSPFGPTALASYHLHY  345
              S FGP+ L SY L Y
Sbjct  1051  YSTFGPS-LESYRLKY  1065



>ref|XP_008782569.1| PREDICTED: uncharacterized protein LOC103702061 [Phoenix dactylifera]
Length=824

 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 85/172 (49%), Gaps = 33/172 (19%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            L +NF PG  LPS + L  TF K+G ++E ET+   ET +A++VF +S+DAE A  SL K
Sbjct  669  LHMNFAPGVTLPSRDDLISTFSKYGVLIETETELLQETGSARVVFVKSTDAEKAFSSLDK  728

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
            +  FG    A+Y L Y P  ++          P   +                     I+
Sbjct  729  TGVFG-APYATYCLRYLPAVSSPPSSPVPVPKPPLPY---------------------IR  766

Query  478  QNLEMM-------SAMLEKAG--DNISPDMKAKLEGEVKGFLKKVSAMV-GP  603
            ++LE M       S  +++ G  D + P+ +  L GE++G LKKV+ M+ GP
Sbjct  767  KSLERMITSLTGSSTSVKETGCSDGLKPEARDNLVGEMQGLLKKVNKMLNGP  818



>ref|XP_004308807.1| PREDICTED: uncharacterized protein LOC101303077 [Fragaria vesca 
subsp. vesca]
Length=1135

 Score = 66.6 bits (161),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L+++F+    +PS  +LN  F +FGP+ E ET+   E++ A++VF + SDAEVAC S GK
Sbjct  972   LVMSFSEVSSIPSETNLNKMFKRFGPLKEYETEVDRESSRARVVFKRCSDAEVACNSAGK  1031

Query  298   SSPFGPTALASYHLHYRP  351
              + FG   + SY L+Y P
Sbjct  1032  FNIFGQITV-SYQLNYTP  1048



>ref|XP_010653513.1| PREDICTED: uncharacterized protein LOC104880050 [Vitis vinifera]
 ref|XP_010653514.1| PREDICTED: uncharacterized protein LOC104880050 [Vitis vinifera]
Length=888

 Score = 66.2 bits (160),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            LILNF   + +PS  +LN  F ++GP+ E+ET+       A++VF +SSDAE A  S GK
Sbjct  786  LILNFADLNSVPSETNLNRIFSRYGPLNESETEVLKKSIRAKVVFKRSSDAETAFSSSGK  845

Query  298  SSPFGPTALASYHLHYRP  351
             S FGP+ L SY L Y P
Sbjct  846  FSIFGPS-LISYRLKYLP  862



>ref|XP_008447578.1| PREDICTED: uncharacterized protein LOC103489995 [Cucumis melo]
 ref|XP_008447579.1| PREDICTED: uncharacterized protein LOC103489995 [Cucumis melo]
Length=644

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            LIL FT    +PS  +LND F K+GP+ E++T+   ++  A++VF ++SDAE A  + GK
Sbjct  542  LILTFTDLDSVPSETNLNDIFRKYGPLYESKTEVMKKSRRAKVVFKRTSDAETAFSNTGK  601

Query  298  SSPFGPTALASYHLHYRP  351
             S FG TAL SY L + P
Sbjct  602  CSIFG-TALVSYRLKFLP  618



>ref|XP_004154809.1| PREDICTED: uncharacterized protein LOC101228455 isoform 1 [Cucumis 
sativus]
 ref|XP_004154810.1| PREDICTED: uncharacterized protein LOC101228455 isoform 2 [Cucumis 
sativus]
Length=672

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            LIL FT    +PS  +LND F K+GP+ E++T+   ++  A++VF ++SDAE A  + GK
Sbjct  570  LILTFTDLDSVPSEANLNDIFRKYGPLYESKTEVMKKSRRAKVVFKRTSDAETAFSNTGK  629

Query  298  SSPFGPTALASYHLHYRP  351
             S FG TAL SY L + P
Sbjct  630  CSIFG-TALVSYRLKFLP  646



>ref|XP_009398938.1| PREDICTED: uncharacterized protein LOC103983451 [Musa acuminata 
subsp. malaccensis]
Length=794

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 82/168 (49%), Gaps = 36/168 (21%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            L+L F  G PLPS   L   F K+G V+E+ET+   ET +A+IVFA+S+DAE A  S  K
Sbjct  647  LLLTFAHGVPLPSQNELTSAFRKYGVVIESETELLKETNSARIVFAKSTDAEKAFNSSDK  706

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
            +  F P   ASY L   P  A      P  V                      P L +I+
Sbjct  707  TGYFRP-PYASYCLCCLPAIACS----PHPV----------------------PPLPYIR  739

Query  478  QNLEMM------SAMLEKAG--DNISPDMKAKLEGEVKGFLKKVSAMV  597
            + LE M      ++ L++ G  D +  D +  L G+++G LKKV+ M+
Sbjct  740  EGLERMISTLTATSSLKETGTSDGMKHDARENLVGDMEGLLKKVNTML  787



>ref|XP_004146836.1| PREDICTED: uncharacterized protein LOC101208734 isoform 1 [Cucumis 
sativus]
 ref|XP_004146837.1| PREDICTED: uncharacterized protein LOC101208734 isoform 2 [Cucumis 
sativus]
 gb|KGN59850.1| hypothetical protein Csa_3G850550 [Cucumis sativus]
Length=672

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            LIL FT    +PS  +LND F K+GP+ E++T+   ++  A++VF ++SDAE A  + GK
Sbjct  570  LILTFTDLDSVPSEANLNDIFRKYGPLYESKTEVMKKSRRAKVVFKRTSDAETAFSNTGK  629

Query  298  SSPFGPTALASYHLHYRP  351
             S FG TAL SY L + P
Sbjct  630  CSIFG-TALVSYRLKFLP  646



>ref|XP_006381494.1| PWWP domain-containing family protein [Populus trichocarpa]
 gb|ERP59291.1| PWWP domain-containing family protein [Populus trichocarpa]
Length=918

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            LILNFT    +PS  +LN  F  FGP+ E ET+   +T  A++VF +S+DAE A  S GK
Sbjct  803  LILNFTDLDAVPSETNLNRIFSHFGPLKETETQVLKKTKRAKVVFCRSADAETAFSSAGK  862

Query  298  SSPFGPTALASYHLHY  345
             S FGP+ L SY L Y
Sbjct  863  YSVFGPS-LVSYRLKY  877



>ref|XP_004237664.1| PREDICTED: uncharacterized protein LOC101249817 [Solanum lycopersicum]
Length=1654

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LIL F  G PLPS  +LN  F +FGP+ E ET+   E++ A++VF + SDAEVA  S+GK
Sbjct  1559  LILIFAEGSPLPSEMNLNKMFRRFGPLKELETEVHQESSRARVVFKRGSDAEVAHSSVGK  1618

Query  298   SSPFGPTALASYHLHYRP  351
              + FG   + +Y L Y P
Sbjct  1619  FNIFGSRQV-TYELSYTP  1635



>ref|XP_004489260.1| PREDICTED: histone-lysine N-methyltransferase NSD2-like isoform 
X1 [Cicer arietinum]
Length=967

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 51/166 (31%), Positives = 76/166 (46%), Gaps = 10/166 (6%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L ++F PG  LPS   L   + KFG + E ET  F +  TA++ F ++ DAE A      
Sbjct  798  LFVSFWPGSTLPSKSDLITMYSKFGALNELETDMFRTNYTARVSFLRTHDAEKALNHSQN  857

Query  298  SSPFGPTALASYHLHYRP-------GPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEA  456
             +PF  ++  ++ L Y         G  ++  K   +       + P  PS       E 
Sbjct  858  KNPF-ESSEVTFQLQYASSDGSKSVGEHSERSKSKASQYNKQKSETPTTPSVSPSQGSEK  916

Query  457  PDLMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAM  594
              L  IK  L+ + +MLE + D  SP+ K KLE  VK  L+ V+ M
Sbjct  917  TKLSFIKGKLQGLVSMLESS-DEKSPEFKTKLEINVKSLLEDVNKM  961



>gb|EPS58866.1| hypothetical protein M569_15946 [Genlisea aurea]
Length=916

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 53/159 (33%), Positives = 81/159 (51%), Gaps = 6/159 (4%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            LIL F     LP  E+L  T  +FG V E+E + + + TT +I + + ++A  A QSL K
Sbjct  761  LILEFDS---LPPRETLIATLSRFGLVRESEIEAADDGTTVRIPYERIAEARFAFQSLEK  817

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
            + PFG  AL S  L   P P   + +             P +            D+  +K
Sbjct  818  NKPFG-DALKSSKLD-SPTPQDHHQQQQQQQHFTKTRNRPSISISTPGKVVNPDDVGSMK  875

Query  478  QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAM  594
            +N+E M + LEKAG  +S +M++KLE ++  FL+KV +M
Sbjct  876  RNVEKMRSTLEKAGAGVSVEMRSKLENDINSFLEKVRSM  914



>ref|XP_007009720.1| Tudor/PWWP/MBT superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY18530.1| Tudor/PWWP/MBT superfamily protein isoform 3 [Theobroma cacao]
Length=1345

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L++NF+  + +PS   LN  F  FGP+ E+ET+   ET+ A++VF +SSDAEVA  S GK
Sbjct  1053  LVMNFSEINSVPSETKLNKMFKHFGPLKESETEVDRETSRARVVFRRSSDAEVAYNSAGK  1112

Query  298   SSPFGPTALASYHLHY  345
              + FG  A+ +Y L+Y
Sbjct  1113  FNIFGSVAV-NYQLNY  1127



>ref|XP_008795920.1| PREDICTED: uncharacterized protein LOC103711526 [Phoenix dactylifera]
Length=848

 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 84/172 (49%), Gaps = 33/172 (19%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            L +NF PG  LPS + L  TF K+G ++E+ET+    T  A++VFA+S+DAE A  SL K
Sbjct  693  LHMNFAPGITLPSKDDLVSTFSKYGVLIESETELLQGTGGARVVFAKSTDAEKAFNSLDK  752

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
            +  FG    A+Y L Y          + +      +   P LP              +I+
Sbjct  753  TGVFG-APYATYSLRYL-------PAISSPPSSPISVPKPPLP--------------YIR  790

Query  478  QNLEMMSAMLEK---------AGDNISPDMKAKLEGEVKGFLKKVSAMV-GP  603
            ++LE M   L           + D + P+ +  L GE++G LKKV+ M+ GP
Sbjct  791  KSLERMIYSLTGSSTPVKETVSSDGLKPEARDNLVGEMQGLLKKVNKMLNGP  842



>ref|XP_009334089.1| PREDICTED: uncharacterized protein LOC103926935 isoform X1 [Pyrus 
x bretschneideri]
Length=952

 Score = 65.1 bits (157),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 54/174 (31%), Positives = 80/174 (46%), Gaps = 25/174 (14%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L + F PG  LP+   L   + KFG + E ET+ F +   A++ FA+ +DAE A      
Sbjct  789  LFVTFGPGSNLPTKADLIKIYSKFGELNEMETEMFYTNFCARVSFARLADAEEAFNHSQN  848

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKA-------------  438
             SPFG + + ++ LH        N    + V  +        P+ K+             
Sbjct  849  DSPFGASNV-NFRLH--------NLAAASKVRELSEISNSA-PAKKSRGKTKTQALASQA  898

Query  439  -PLNGEAPDLMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
                GEA  +  IKQ LE M++ML+ +   +S   K+KLE E+K  L  VS MV
Sbjct  899  PAAAGEASQIDLIKQKLEKMTSMLDDSNGQVSDVTKSKLESEIKELLGTVSTMV  952



>ref|XP_009334091.1| PREDICTED: uncharacterized protein LOC103926935 isoform X3 [Pyrus 
x bretschneideri]
Length=942

 Score = 65.1 bits (157),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 55/173 (32%), Positives = 79/173 (46%), Gaps = 23/173 (13%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L + F PG  LP+   L   + KFG + E ET+ F +   A++ FA+ +DAE A      
Sbjct  779  LFVTFGPGSNLPTKADLIKIYSKFGELNEMETEMFYTNFCARVSFARLADAEEAFNHSQN  838

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAF-------------KFPMLPSGKA  438
             SPFG + + ++ LH        N    + V  +                K   L S   
Sbjct  839  DSPFGASNV-NFRLH--------NLAAASKVRELSEISNSAPAKKSRGKTKTQALASQAP  889

Query  439  PLNGEAPDLMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
               GEA  +  IKQ LE M++ML+ +   +S   K+KLE E+K  L  VS MV
Sbjct  890  AAAGEASQIDLIKQKLEKMTSMLDDSNGQVSDVTKSKLESEIKELLGTVSTMV  942



>ref|XP_009334090.1| PREDICTED: uncharacterized protein LOC103926935 isoform X2 [Pyrus 
x bretschneideri]
Length=942

 Score = 64.7 bits (156),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 55/173 (32%), Positives = 79/173 (46%), Gaps = 23/173 (13%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L + F PG  LP+   L   + KFG + E ET+ F +   A++ FA+ +DAE A      
Sbjct  779  LFVTFGPGSNLPTKADLIKIYSKFGELNEMETEMFYTNFCARVSFARLADAEEAFNHSQN  838

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAF-------------KFPMLPSGKA  438
             SPFG + + ++ LH        N    + V  +                K   L S   
Sbjct  839  DSPFGASNV-NFRLH--------NLAAASKVRELSEISNSAPAKKSRGKTKTQALASQAP  889

Query  439  PLNGEAPDLMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
               GEA  +  IKQ LE M++ML+ +   +S   K+KLE E+K  L  VS MV
Sbjct  890  AAAGEASQIDLIKQKLEKMTSMLDDSNGQVSDVTKSKLESEIKELLGTVSTMV  942



>ref|XP_006595360.1| PREDICTED: uncharacterized protein LOC102661771 [Glycine max]
Length=864

 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            L L FT    +PST  LN+ F +FGP++E++T+    T  A++VF + SDAE A  S GK
Sbjct  762  LTLKFTNFDSVPSTTDLNNIFGRFGPLIESKTELLERTNRARVVFQRRSDAETAFSSAGK  821

Query  298  SSPFGPTALASYHLHYRP  351
             S FGP+ L SY L   P
Sbjct  822  YSIFGPS-LVSYRLKILP  838



>gb|KHN48326.1| Serine/threonine-protein kinase ATM [Glycine soja]
Length=781

 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            L L FT    +PST  LN+ F +FGP++E++T+    T  A++VF + SDAE A  S GK
Sbjct  679  LTLKFTNFDSVPSTTDLNNIFGRFGPLIESKTELLERTNRARVVFQRRSDAETAFSSAGK  738

Query  298  SSPFGPTALASYHLHYRP  351
             S FGP +L SY L   P
Sbjct  739  YSIFGP-SLVSYRLKILP  755



>ref|XP_008368948.1| PREDICTED: uncharacterized protein LOC103432529 [Malus domestica]
Length=1244

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L++NFT  + +PS   LN  F +FGP+ EAET+   E++ A++VF + SDAEVA  S GK
Sbjct  1089  LVMNFTEVNSVPSEIKLNRMFRRFGPLKEAETEVDRESSRARVVFKKCSDAEVAIDSAGK  1148

Query  298   SSPFGPTALASYHLHYRP  351
                FG   + +Y L+Y P
Sbjct  1149  FKIFGSIPV-NYQLNYTP  1165



>ref|XP_007009718.1| Tudor/PWWP/MBT superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007009719.1| Tudor/PWWP/MBT superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007009721.1| Tudor/PWWP/MBT superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY18528.1| Tudor/PWWP/MBT superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY18529.1| Tudor/PWWP/MBT superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY18531.1| Tudor/PWWP/MBT superfamily protein isoform 1 [Theobroma cacao]
Length=1619

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L++NF+  + +PS   LN  F  FGP+ E+ET+   ET+ A++VF +SSDAEVA  S GK
Sbjct  1053  LVMNFSEINSVPSETKLNKMFKHFGPLKESETEVDRETSRARVVFRRSSDAEVAYNSAGK  1112

Query  298   SSPFGPTALASYHLHY  345
              + FG  A+ +Y L+Y
Sbjct  1113  FNIFGSVAV-NYQLNY  1127



>ref|XP_007009723.1| Tudor/PWWP/MBT superfamily protein isoform 6, partial [Theobroma 
cacao]
 gb|EOY18533.1| Tudor/PWWP/MBT superfamily protein isoform 6, partial [Theobroma 
cacao]
Length=1622

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L++NF+  + +PS   LN  F  FGP+ E+ET+   ET+ A++VF +SSDAEVA  S GK
Sbjct  1053  LVMNFSEINSVPSETKLNKMFKHFGPLKESETEVDRETSRARVVFRRSSDAEVAYNSAGK  1112

Query  298   SSPFGPTALASYHLHY  345
              + FG  A+ +Y L+Y
Sbjct  1113  FNIFGSVAV-NYQLNY  1127



>ref|XP_007009722.1| Tudor/PWWP/MBT superfamily protein isoform 5 [Theobroma cacao]
 gb|EOY18532.1| Tudor/PWWP/MBT superfamily protein isoform 5 [Theobroma cacao]
Length=1618

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L++NF+  + +PS   LN  F  FGP+ E+ET+   ET+ A++VF +SSDAEVA  S GK
Sbjct  1053  LVMNFSEINSVPSETKLNKMFKHFGPLKESETEVDRETSRARVVFRRSSDAEVAYNSAGK  1112

Query  298   SSPFGPTALASYHLHY  345
              + FG  A+ +Y L+Y
Sbjct  1113  FNIFGSVAV-NYQLNY  1127



>ref|XP_007145450.1| hypothetical protein PHAVU_007G240300g [Phaseolus vulgaris]
 gb|ESW17444.1| hypothetical protein PHAVU_007G240300g [Phaseolus vulgaris]
Length=1139

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L++NF     +PS  +LN  F +FGP+ EAET+  + ++ A++VF + SDAEVAC S  K
Sbjct  1022  LVMNFAELGSVPSETNLNRMFRRFGPLKEAETEVDTVSSRARVVFKKCSDAEVACSSAQK  1081

Query  298   SSPFGPTALASYHLHY  345
              + FGP  L +Y L+Y
Sbjct  1082  FNIFGPI-LVNYQLNY  1096



>ref|XP_008379239.1| PREDICTED: uncharacterized protein LOC103442246 [Malus domestica]
 ref|XP_008357738.1| PREDICTED: uncharacterized protein LOC103421476 [Malus domestica]
Length=942

 Score = 64.3 bits (155),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 53/174 (30%), Positives = 80/174 (46%), Gaps = 25/174 (14%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L + F PG  LP+   L   + KFG + E ET+ F +   A++ FA+ +DA+ A      
Sbjct  779  LFVTFGPGSNLPTKADLIKIYSKFGELNETETEMFYTNFCARVSFARLADAQEAFNHSQN  838

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKA-------------  438
             SPFG + + ++ LH        N    + V  +        P+ K+             
Sbjct  839  DSPFGASNV-NFRLH--------NLAAASKVRELSEISNSA-PAKKSRGKTKTQALASQA  888

Query  439  -PLNGEAPDLMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
                GEA  +  IKQ LE M++ML+ +   +S   K+KLE E+K  L  VS MV
Sbjct  889  PAAAGEASQIDLIKQKLEKMTSMLDDSNGQVSDVTKSKLESEIKELLGXVSTMV  942



>ref|XP_003518622.2| PREDICTED: uncharacterized protein LOC100813734 [Glycine max]
Length=1015

 Score = 63.9 bits (154),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            L++NF     +PS  +LN  F +FGP+ EAET+  + ++ A++VF +  DAEVAC S  K
Sbjct  898  LVMNFAELGSVPSETNLNKMFRRFGPLKEAETEVDTVSSRARVVFKKCVDAEVACSSAQK  957

Query  298  SSPFGPTALASYHLHYRP  351
             + FGP  L +Y L+Y P
Sbjct  958  FNIFGPI-LVNYQLNYTP  974



>gb|KHN47220.1| Putative oxidoreductase GLYR1-like protein [Glycine soja]
Length=1018

 Score = 63.9 bits (154),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            L++NF     +PS  +LN  F +FGP+ EAET+  + ++ A++VF +  DAEVAC S  K
Sbjct  901  LVMNFAELGSVPSETNLNKMFRRFGPLKEAETEVDTVSSRARVVFKKCVDAEVACSSAQK  960

Query  298  SSPFGPTALASYHLHYRP  351
             + FGP  L +Y L+Y P
Sbjct  961  FNIFGPI-LVNYQLNYTP  977



>ref|XP_010108444.1| hypothetical protein L484_014115 [Morus notabilis]
 gb|EXC19485.1| hypothetical protein L484_014115 [Morus notabilis]
Length=1347

 Score = 63.9 bits (154),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
             L++NF+    +PS  +LN  F +FGP+ EA+T+   E + A++VF + SDAE+A  S  K
Sbjct  1206  LVMNFSEVRSVPSEATLNKMFRRFGPLKEADTEVDREFSRARVVFKKGSDAEIAYSSAAK  1265

Query  298   SSPFGPTALASYHLHYRP  351
              + FGPT L +Y L Y P
Sbjct  1266  FNIFGPT-LVNYELSYDP  1282



>ref|XP_008789045.1| PREDICTED: uncharacterized protein LOC103706650 [Phoenix dactylifera]
 ref|XP_008789046.1| PREDICTED: uncharacterized protein LOC103706650 [Phoenix dactylifera]
Length=961

 Score = 63.9 bits (154),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L+LNF   + LPS   L   F ++GP+ EAE +       A++VF + +DAEVA  S GK
Sbjct  874  LVLNFNESNVLPSESDLISIFGRYGPLREAEIEVLKKANCAKVVFKRRADAEVAFNSAGK  933

Query  298  SSPFGPTALASYHLHYRP  351
            SS FGP A  SY L Y P
Sbjct  934  SSIFGP-AHVSYRLRYLP  950



>ref|XP_010920927.1| PREDICTED: uncharacterized protein LOC105044657 [Elaeis guineensis]
Length=1004

 Score = 63.5 bits (153),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            LIL+FT    LPS   L   F ++G + EAET+       A++VF + +DAEVA  S GK
Sbjct  878  LILSFTESDALPSESDLISIFGRYGSLREAETEVLKKANRAKVVFKRRADAEVAFSSAGK  937

Query  298  SSPFGPTALASYHLHYRP  351
             S FGP AL SY L Y P
Sbjct  938  YSIFGP-ALVSYRLRYLP  954



>ref|XP_008792208.1| PREDICTED: uncharacterized protein LOC103708880 [Phoenix dactylifera]
Length=733

 Score = 63.5 bits (153),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            LIL+FT    LPS   L   F ++G + EAET+  ++   A++VF + +DAEVA  S GK
Sbjct  607  LILSFTESDALPSESDLISIFGRYGSLREAETEVLTTANRAKVVFKRRADAEVAFSSAGK  666

Query  298  SSPFGPTALASYHLHY  345
             S FGP AL SY L Y
Sbjct  667  YSIFGP-ALVSYRLRY  681



>ref|XP_009375117.1| PREDICTED: uncharacterized protein LOC103963962 [Pyrus x bretschneideri]
 ref|XP_009375119.1| PREDICTED: uncharacterized protein LOC103963962 [Pyrus x bretschneideri]
 ref|XP_009375120.1| PREDICTED: uncharacterized protein LOC103963962 [Pyrus x bretschneideri]
 ref|XP_009377207.1| PREDICTED: uncharacterized protein LOC103965842 [Pyrus x bretschneideri]
 ref|XP_009377208.1| PREDICTED: uncharacterized protein LOC103965842 [Pyrus x bretschneideri]
 ref|XP_009377209.1| PREDICTED: uncharacterized protein LOC103965842 [Pyrus x bretschneideri]
Length=943

 Score = 63.5 bits (153),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 53/173 (31%), Positives = 76/173 (44%), Gaps = 23/173 (13%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L + F PG  LP+   L   + KFG + E ET+ F +   A++ F + +DA+ A      
Sbjct  780  LFVTFGPGSSLPTKSDLIKIYGKFGELDETETEMFYTNFCARVSFVKFADAQEAFNHSQN  839

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAF-------------KFPMLPSGKA  438
             SPFG  A  ++ LH        N    + V  +                +   L S   
Sbjct  840  DSPFG-AANVTFRLH--------NLAAASKVRELSEISNSAPAKKSRGKTRTQALASQPP  890

Query  439  PLNGEAPDLMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
               GEA  +  IKQ LE M++ML  +   +S   K+KLE E+K  L  VS MV
Sbjct  891  AAVGEASQVDLIKQKLERMTSMLGDSNGQVSDVTKSKLESEIKELLGTVSTMV  943



>ref|XP_009125469.1| PREDICTED: uncharacterized protein LOC103850466 [Brassica rapa]
Length=441

 Score = 63.2 bits (152),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 49/87 (56%), Gaps = 3/87 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            LIL F     +PS E LN  F ++GP+ E+ET+   +   A++VF +  DAE A  S GK
Sbjct  356  LILKFASSGSVPSEEKLNSIFNRYGPLRESETRVMKKGKKARVVFRRGEDAETAFSSSGK  415

Query  298  SSPFGPTALASYHLHYRPGPAADNFKM  378
             S FGP+ L SY L Y  GP A    M
Sbjct  416  YSIFGPS-LLSYSLKY-VGPKAKESNM  440



>emb|CDY04873.1| BnaAnng00550D [Brassica napus]
Length=460

 Score = 63.2 bits (152),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 49/87 (56%), Gaps = 3/87 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            LIL F     +PS E LN  F ++GP+ E+ET+   +   A++VF +  DAE A  S GK
Sbjct  375  LILKFASSGSVPSEEKLNSIFNRYGPLRESETRVMKKGKKARVVFRRGEDAETAFSSSGK  434

Query  298  SSPFGPTALASYHLHYRPGPAADNFKM  378
             S FGP+ L SY L Y  GP A    M
Sbjct  435  YSIFGPS-LLSYSLKY-VGPKAKESNM  459



>ref|XP_004299968.1| PREDICTED: uncharacterized protein LOC101294948 [Fragaria vesca 
subsp. vesca]
Length=841

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            L+L F PG P+PS + L  TF +FGP+ E+ET    E ++AQ+VF + +DA  A QSL K
Sbjct  762  LLLTFAPGIPMPSKDDLISTFCRFGPLKESETLLLKESSSAQVVFMEGADAGEAFQSLEK  821

Query  298  SSPFGPTALASY  333
             +PFG T L  Y
Sbjct  822  DNPFG-TNLVGY  832



>ref|XP_010909545.1| PREDICTED: uncharacterized protein LOC105035631 isoform X1 [Elaeis 
guineensis]
 ref|XP_010909546.1| PREDICTED: uncharacterized protein LOC105035631 isoform X1 [Elaeis 
guineensis]
 ref|XP_010909547.1| PREDICTED: uncharacterized protein LOC105035631 isoform X1 [Elaeis 
guineensis]
 ref|XP_010909548.1| PREDICTED: uncharacterized protein LOC105035631 isoform X1 [Elaeis 
guineensis]
Length=1930

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LIL+F     LPS   L   F ++GP+ EAET+   +T   ++VF + +DAE+A +S GK
Sbjct  1574  LILSFNGSSSLPSEMDLIRIFSRYGPLKEAETEVQRKTNHVKVVFKKRADAEIAFRSAGK  1633

Query  298   SSPFGPTALASYHLHYRP  351
              S FGP AL SY L Y P
Sbjct  1634  YSIFGP-ALLSYRLRYLP  1650



>ref|XP_006338569.1| PREDICTED: uncharacterized protein LOC102594150 [Solanum tuberosum]
Length=833

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 75/160 (47%), Gaps = 22/160 (14%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L++ F  G  LPS + +   + KFG + E ETK      + +IV+ + SDA  A +   +
Sbjct  691  LLVTFLTGFSLPSEDEIIRIYNKFGELNEEETKVLCDSNSVRIVYRRGSDAAQAFKESVR  750

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
             SPFG   +              NF +  +              GK+ +         IK
Sbjct  751  QSPFGAANV--------------NFTLSYSSKSESPLSSLKARKGKSQV-------QLIK  789

Query  478  QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
            Q L+ MS++L K    I+ + K++LE E+KG L+KVSA++
Sbjct  790  QKLKGMSSILGKCKGKITSEEKSELENEIKGLLEKVSAVI  829



>ref|XP_010909549.1| PREDICTED: uncharacterized protein LOC105035631 isoform X2 [Elaeis 
guineensis]
Length=1927

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LIL+F     LPS   L   F ++GP+ EAET+   +T   ++VF + +DAE+A +S GK
Sbjct  1574  LILSFNGSSSLPSEMDLIRIFSRYGPLKEAETEVQRKTNHVKVVFKKRADAEIAFRSAGK  1633

Query  298   SSPFGPTALASYHLHYRP  351
              S FGP AL SY L Y P
Sbjct  1634  YSIFGP-ALLSYRLRYLP  1650



>ref|XP_010452156.1| PREDICTED: uncharacterized protein LOC104734309 [Camelina sativa]
Length=742

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            LIL F     +PS E LN+ F ++GP+ E++TK + +   A+++F +S DA+ A  S GK
Sbjct  655  LILKFADSGSVPSVEKLNEIFNRYGPLYESKTKVTKKGKRARVLFKKSEDAKTAFSSAGK  714

Query  298  SSPFGPTALASYHLHY  345
             S FGP+ L SY L Y
Sbjct  715  YSIFGPS-LLSYRLEY  729



>ref|XP_010940066.1| PREDICTED: uncharacterized protein LOC105058741 [Elaeis guineensis]
Length=837

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 83/172 (48%), Gaps = 33/172 (19%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            L + F PG  LPS + L  TF ++G ++E+ET+   ET +A++VFA+S++AE A  SL K
Sbjct  682  LQMKFAPGITLPSRDELVSTFSQYGVLIESETELLQETGSARVVFAKSTEAEKAFNSLDK  741

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
            +  FG    A+Y L Y P  ++          P   +                     I+
Sbjct  742  TGIFG-APYATYSLRYLPAISSPPSSPIPVPKPPLPY---------------------IR  779

Query  478  QNLEMMSAML---------EKAGDNISPDMKAKLEGEVKGFLKKVSAMV-GP  603
            ++LE M   L           + D + P+ +  L GE++G LKKV+ M+ GP
Sbjct  780  KSLERMIYSLTGSSTPAKETGSSDGLKPEARDNLVGEMQGLLKKVNKMLNGP  831



>gb|KEH35199.1| hypothetical protein MTR_3g081560 [Medicago truncatula]
Length=956

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +1

Query  415  PMLPSGKAPLNGEAPDLMHI-KQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVS  588
            P  P+   P+ GE P  + I KQNL+MM++ LEK+G+N+SP MKAKLEGE+K  L K++
Sbjct  894  PTQPTRSMPMPGETPPPLEIMKQNLQMMTSALEKSGNNLSPQMKAKLEGEIKNLLTKMN  952


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            L L F PG  +PS E L  TF +FGP+  +ET+   +  +AQIVF +S DA  A ++L +
Sbjct  727  LFLQFAPGVDIPSKEDLLKTFCRFGPLKASETQMMKDNGSAQIVFVRSIDAAEALRNLEQ  786

Query  298  SSPFGPTALASYHLH  342
            ++PFG  AL  Y LH
Sbjct  787  NNPFG-AALVGYRLH  800



>gb|KEH35198.1| hypothetical protein MTR_3g081560 [Medicago truncatula]
Length=1012

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +1

Query  415   PMLPSGKAPLNGEAPDLMHI-KQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVS  588
             P  P+   P+ GE P  + I KQNL+MM++ LEK+G+N+SP MKAKLEGE+K  L K++
Sbjct  950   PTQPTRSMPMPGETPPPLEIMKQNLQMMTSALEKSGNNLSPQMKAKLEGEIKNLLTKMN  1008


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            L L F PG  +PS E L  TF +FGP+  +ET+   +  +AQIVF +S DA  A ++L +
Sbjct  783  LFLQFAPGVDIPSKEDLLKTFCRFGPLKASETQMMKDNGSAQIVFVRSIDAAEALRNLEQ  842

Query  298  SSPFGPTALASYHLH  342
            ++PFG  AL  Y LH
Sbjct  843  NNPFG-AALVGYRLH  856



>ref|NP_195915.1| PWWP domain-containing protein [Arabidopsis thaliana]
 emb|CAB86049.1| putative protein [Arabidopsis thaliana]
 dbj|BAH30570.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED90539.1| PWWP domain-containing protein [Arabidopsis thaliana]
Length=632

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            L+LNF     +PS E LN+ F ++GP+ E++TK + +   A++VF +  DA+ A  S GK
Sbjct  549  LVLNFADSGSVPSEEKLNEIFKRYGPLHESKTKVTMKGKRAKVVFKRGEDAKTAFSSAGK  608

Query  298  SSPFGPTALASYHLHY  345
             S FGP+ L SY L Y
Sbjct  609  YSIFGPS-LLSYRLEY  623



>gb|KEH35197.1| hypothetical protein MTR_3g081560 [Medicago truncatula]
Length=990

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = +1

Query  397  MDAFKFPMLPSGKAPLNGEAPDLMHI-KQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGF  573
            ++    P  P+   P+ GE P  + I KQNL+MM++ LEK+G+N+SP MKAKLEGE+K  
Sbjct  922  LEQLMTPTQPTRSMPMPGETPPPLEIMKQNLQMMTSALEKSGNNLSPQMKAKLEGEIKNL  981

Query  574  LKKVS  588
            L K++
Sbjct  982  LTKMN  986


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            L L F PG  +PS E L  TF +FGP+  +ET+   +  +AQIVF +S DA  A ++L +
Sbjct  761  LFLQFAPGVDIPSKEDLLKTFCRFGPLKASETQMMKDNGSAQIVFVRSIDAAEALRNLEQ  820

Query  298  SSPFGPTALASYHLH  342
            ++PFG  AL  Y LH
Sbjct  821  NNPFG-AALVGYRLH  834



>gb|ABA99605.2| expressed protein [Oryza sativa Japonica Group]
Length=826

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 78/163 (48%), Gaps = 19/163 (12%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            L+L+F  G  LPS E L   F KFG V+E+ET    +T +A++VF +S++AE A  S   
Sbjct  673  LLLDFAKGVVLPSKEELLSAFGKFGLVIESETDIVKDTHSARVVFGKSAEAEAAYNSAET  732

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
               FGP   A+  LHY               LP      P  P+ K PL     +L  + 
Sbjct  733  LGMFGP-PFATPRLHY---------------LPPIKLSVPS-PASKPPLTDIRKNLERMI  775

Query  478  QNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV-GP  603
             +L   S++ +    + S  M   L GE++G L KV  M+ GP
Sbjct  776  SSLAGHSSVKKATPSDGSKQMPENLLGEMQGLLAKVDKMLTGP  818



>gb|KDP29073.1| hypothetical protein JCGZ_16462 [Jatropha curcas]
Length=866

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            LILNFT    +P   +LN  F +FG V E++T+    +  A++VF +  DAE A  S GK
Sbjct  783  LILNFTHSASIPPESNLNKIFSRFGRVKESQTEVLKKKNRAKVVFYRRDDAEAAFSSAGK  842

Query  298  SSPFGPTALASYHLHYRP  351
             S FGP+ L SY L Y P
Sbjct  843  YSIFGPS-LVSYRLKYMP  859



>ref|XP_009333744.1| PREDICTED: uncharacterized protein LOC103926653 [Pyrus x bretschneideri]
Length=1281

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L++NF+  + +PS   LN  F +FGP+ EAET+   E++ A++VF + SDAEVA  S GK
Sbjct  1126  LVMNFSEVNSVPSEAKLNRMFRRFGPLKEAETEVDRESSRARVVFKKCSDAEVAIDSAGK  1185

Query  298   SSPFGPTALASYHLHYRP  351
                FG   + +Y L+Y P
Sbjct  1186  FKIFGSIPV-NYQLNYTP  1202



>ref|XP_002871003.1| PWWP domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47262.1| PWWP domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=628

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            L+LNF     +PS E LN+ F ++GP+ E++TK + +   A++VF +  DA+ A  S GK
Sbjct  541  LVLNFADSGLVPSEEKLNEIFNRYGPLHESKTKVTKKGKRAKVVFKRGEDAKTAFSSAGK  600

Query  298  SSPFGPTALASYHLHY  345
             S FGP+ L SY L Y
Sbjct  601  YSIFGPS-LLSYRLEY  615



>ref|XP_010907525.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105034172 
[Elaeis guineensis]
Length=987

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            L+L+F   + LPS   L   F ++GP+ EAE +   +   A++VF + +DAEVA  S GK
Sbjct  861  LLLSFNESNALPSESDLIRIFGRYGPLREAEIEVLEKANHAKVVFKRRADAEVAFSSAGK  920

Query  298  SSPFGPTALASYHLHY  345
            SS FGP AL SY L Y
Sbjct  921  SSIFGP-ALVSYQLRY  935



>ref|XP_008783703.1| PREDICTED: uncharacterized protein LOC103702865 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008783704.1| PREDICTED: uncharacterized protein LOC103702865 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008783705.1| PREDICTED: uncharacterized protein LOC103702865 isoform X1 [Phoenix 
dactylifera]
Length=1925

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L+L+F     LPS   L   F ++GP+ EAET+  S+T   ++VF + +DAE+A  S GK
Sbjct  1538  LVLSFNGSSSLPSQTDLIRIFSRYGPLKEAETEVQSKTNRVKVVFKKRADAEIAFSSAGK  1597

Query  298   SSPFGPTALASYHLHYRP  351
              S FGP AL SY L Y P
Sbjct  1598  YSIFGP-ALLSYCLRYLP  1614



>ref|XP_008783706.1| PREDICTED: uncharacterized protein LOC103702865 isoform X2 [Phoenix 
dactylifera]
Length=1922

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L+L+F     LPS   L   F ++GP+ EAET+  S+T   ++VF + +DAE+A  S GK
Sbjct  1538  LVLSFNGSSSLPSQTDLIRIFSRYGPLKEAETEVQSKTNRVKVVFKKRADAEIAFSSAGK  1597

Query  298   SSPFGPTALASYHLHYRP  351
              S FGP AL SY L Y P
Sbjct  1598  YSIFGP-ALLSYCLRYLP  1614



>ref|XP_008376297.1| PREDICTED: uncharacterized protein LOC103439518 [Malus domestica]
Length=1281

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L++NF+  + +PS   LN  F +FGP+ EAET+   E++ A++VF + SDAEVA  S GK
Sbjct  1126  LVMNFSEVNSVPSETKLNRMFRRFGPLKEAETEVDRESSRARVVFKKCSDAEVAIDSAGK  1185

Query  298   SSPFGPTALASYHLHYRP  351
                FG   + +Y L+Y P
Sbjct  1186  FKIFGSIPV-NYQLNYTP  1202



>ref|XP_006287103.1| hypothetical protein CARUB_v10000267mg [Capsella rubella]
 gb|EOA20001.1| hypothetical protein CARUB_v10000267mg [Capsella rubella]
Length=754

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            LILNF     +PS E LN+ F ++GP+ E++TK + +   A+++F +  DA+ A  S GK
Sbjct  667  LILNFADSGSVPSEEKLNEIFNRYGPLHESKTKVTKKGKRAKVLFKRGEDAKTAFSSAGK  726

Query  298  SSPFGPTALASYHLHY  345
             S FGP+ L SY L Y
Sbjct  727  YSIFGPS-LLSYKLEY  741



>ref|XP_006287104.1| hypothetical protein CARUB_v10000267mg [Capsella rubella]
 gb|EOA20002.1| hypothetical protein CARUB_v10000267mg [Capsella rubella]
Length=761

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            LILNF     +PS E LN+ F ++GP+ E++TK + +   A+++F +  DA+ A  S GK
Sbjct  674  LILNFADSGSVPSEEKLNEIFNRYGPLHESKTKVTKKGKRAKVLFKRGEDAKTAFSSAGK  733

Query  298  SSPFGPTALASYHLHY  345
             S FGP+ L SY L Y
Sbjct  734  YSIFGPS-LLSYKLEY  748



>ref|XP_006287105.1| hypothetical protein CARUB_v10000267mg [Capsella rubella]
 gb|EOA20003.1| hypothetical protein CARUB_v10000267mg [Capsella rubella]
Length=782

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            LILNF     +PS E LN+ F ++GP+ E++TK + +   A+++F +  DA+ A  S GK
Sbjct  695  LILNFADSGSVPSEEKLNEIFNRYGPLHESKTKVTKKGKRAKVLFKRGEDAKTAFSSAGK  754

Query  298  SSPFGPTALASYHLHY  345
             S FGP+ L SY L Y
Sbjct  755  YSIFGPS-LLSYKLEY  769



>ref|XP_007041274.1| Tudor/PWWP/MBT superfamily protein [Theobroma cacao]
 gb|EOX97105.1| Tudor/PWWP/MBT superfamily protein [Theobroma cacao]
Length=712

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            L++NF+    +PS   LN  F  FGP+ E+ET+   ET  A++VF +SSDAEVA  S GK
Sbjct  631  LVMNFSEITSVPSETKLNKMFKHFGPLKESETEVDRETCCARVVFRRSSDAEVAYNSAGK  690

Query  298  SSPFGPTALASYHLHY  345
             + FG  A+ +Y L Y
Sbjct  691  FNIFGSVAV-NYQLTY  705



>ref|XP_004514381.1| PREDICTED: uncharacterized protein LOC101505515 isoform X1 [Cicer 
arietinum]
 ref|XP_004514382.1| PREDICTED: uncharacterized protein LOC101505515 isoform X2 [Cicer 
arietinum]
Length=1080

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 5/89 (6%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L++NF   + +PS  +LN  F +FGP+ E+ET+    ++ A++VF +  DAEVAC S  K
Sbjct  974   LVMNFAELNSVPSETNLNKMFRRFGPLKESETEVDRVSSRARVVFKKCMDAEVACSSAKK  1033

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPT  384
              + FG + L +Y L+Y P      FK P+
Sbjct  1034  FNIFG-SVLVNYQLNYTPSAL---FKAPS  1058



>ref|XP_008341452.1| PREDICTED: uncharacterized protein LOC103404331 [Malus domestica]
Length=948

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 51/165 (31%), Positives = 76/165 (46%), Gaps = 7/165 (4%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L + F PG  LP+   L   + KFG + E ET+ F +   A++ F + +DA+ A      
Sbjct  785  LFVTFGPGSSLPTKSDLIKIYGKFGELNETETEMFYTNFCARVSFVKFADAQEAFBHSQN  844

Query  298  SSPFGPTALASYHLHYRPGPAA-DNFKMPTTVLPMDA----FKFPMLPSGKAPLNGEAPD  462
             SPFG  A  ++ LH     +        +   P        +   L S      GEA  
Sbjct  845  DSPFG-XANVTFRLHNLAAASKLRELXEISNSAPAKKSRGKTRTQALASQPPAAVGEASQ  903

Query  463  LMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
            +  IK+ LE M++ML+ +   +S   K+KLE E+K  L  VS MV
Sbjct  904  VDLIKRKLEXMTSMLDDSTGQVSEVTKSKLESEIKELLGTVSTMV  948



>ref|NP_001177080.1| Os12g0638500 [Oryza sativa Japonica Group]
 gb|EEE53677.1| hypothetical protein OsJ_37012 [Oryza sativa Japonica Group]
 dbj|BAH95808.1| Os12g0638500 [Oryza sativa Japonica Group]
Length=614

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 80/170 (47%), Gaps = 33/170 (19%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            L+L+F  G  LPS E L   F KFG V+E+ET    +T +A++VF +S++AE A  S   
Sbjct  461  LLLDFAKGVVLPSKEELLSAFGKFGLVIESETDIVKDTHSARVVFGKSAEAEAAYNSAET  520

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
               FGP   A+  LHY               LP      P  P+ K P       L  I+
Sbjct  521  LGMFGP-PFATPRLHY---------------LPPIKLSVPS-PASKPP-------LTDIR  556

Query  478  QNLEMM-------SAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV-GP  603
            +NLE M       S++ +    + S  M   L GE++G L KV  M+ GP
Sbjct  557  KNLERMISSLAGHSSVKKATPSDGSKQMPENLLGEMQGLLAKVDKMLTGP  606



>gb|KEH42283.1| PWWP domain protein [Medicago truncatula]
Length=928

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            L L FT    +PST  LN  F +FGP+VE++T+    T  A++VF +  DAE A  S GK
Sbjct  826  LTLKFTNLDSVPSTADLNKIFGRFGPLVESKTELLERTNRARVVFKRRCDAETAFSSAGK  885

Query  298  SSPFGPTALASYHLHYRP  351
             S FGP+ L SY L   P
Sbjct  886  YSIFGPS-LQSYRLRILP  902



>ref|XP_009378128.1| PREDICTED: uncharacterized protein LOC103966657 [Pyrus x bretschneideri]
Length=1245

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L++NF+  + +PS   LN  F +FGP+ EAET+   E++ A++VF + SDAEVA  S GK
Sbjct  1090  LVMNFSEVNSVPSEIKLNRMFRRFGPLKEAETEVDRESSRARVVFKKCSDAEVAIDSAGK  1149

Query  298   SSPFGPTALASYHLHYRP  351
                FG   + +Y L+Y P
Sbjct  1150  FKIFGSIPV-NYQLNYTP  1166



>ref|XP_006843248.1| hypothetical protein AMTR_s00080p00099010 [Amborella trichopoda]
 gb|ERN04923.1| hypothetical protein AMTR_s00080p00099010 [Amborella trichopoda]
Length=1188

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = +1

Query  121   LILNFTPG-HPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLG  294
             LIL+FT G + LPS   LN  F KFGP+ E+ET+       +++VF + +DAE A  S G
Sbjct  1108  LILSFTQGDNALPSEAELNQIFGKFGPLKESETEVLQKSCRSRVVFKRRADAEAAFSSAG  1167

Query  295   KSSPFGPTALASYHLHY  345
             K S FGP AL SY L Y
Sbjct  1168  KFSIFGP-ALVSYRLKY  1183



>emb|CDY55692.1| BnaC02g03440D [Brassica napus]
Length=453

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 44/76 (58%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            LIL F     +PS E LN  F  +GP+ EAET+   +   A++VF +  DAE A  S GK
Sbjct  365  LILKFASSGSVPSEEKLNSIFNSYGPLREAETRVMKKGKKARVVFKRGEDAETAFSSSGK  424

Query  298  SSPFGPTALASYHLHY  345
             S FGP+ L SY L Y
Sbjct  425  YSIFGPS-LLSYSLKY  439



>ref|XP_006588756.1| PREDICTED: uncharacterized protein LOC102668677 isoform X1 [Glycine 
max]
 ref|XP_006588757.1| PREDICTED: uncharacterized protein LOC102668677 isoform X2 [Glycine 
max]
 ref|XP_006588758.1| PREDICTED: uncharacterized protein LOC102668677 isoform X3 [Glycine 
max]
 gb|KHN39109.1| Serine/threonine-protein kinase ATM [Glycine soja]
Length=671

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            L L FT    +PST  LN  F +FG ++E++T+    T  A++VF + SDAE A  S GK
Sbjct  569  LTLKFTNLDSVPSTTDLNKIFARFGSLIESKTELLERTNRARVVFQRRSDAEAAFSSAGK  628

Query  298  SSPFGPTALASYHLHYRP  351
             S FGP+ L SY L   P
Sbjct  629  YSIFGPS-LVSYRLKILP  645



>ref|XP_008805032.1| PREDICTED: uncharacterized protein LOC103718133 isoform X3 [Phoenix 
dactylifera]
Length=1852

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LIL+F     LPS   L   F  +GP+ EAET+   +T   ++VF + +DAE+A +S GK
Sbjct  1563  LILSFNGSSSLPSEMDLIRIFSCYGPLKEAETEVQRKTNHVKVVFKKRADAEIAFRSAGK  1622

Query  298   SSPFGPTALASYHLHYRP  351
              S FGP AL SY L Y P
Sbjct  1623  YSIFGP-ALVSYRLRYLP  1639



>ref|XP_008805033.1| PREDICTED: uncharacterized protein LOC103718133 isoform X4 [Phoenix 
dactylifera]
Length=1825

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LIL+F     LPS   L   F  +GP+ EAET+   +T   ++VF + +DAE+A +S GK
Sbjct  1517  LILSFNGSSSLPSEMDLIRIFSCYGPLKEAETEVQRKTNHVKVVFKKRADAEIAFRSAGK  1576

Query  298   SSPFGPTALASYHLHYRP  351
              S FGP AL SY L Y P
Sbjct  1577  YSIFGP-ALVSYRLRYLP  1593



>ref|XP_008805031.1| PREDICTED: uncharacterized protein LOC103718133 isoform X2 [Phoenix 
dactylifera]
Length=1854

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LIL+F     LPS   L   F  +GP+ EAET+   +T   ++VF + +DAE+A +S GK
Sbjct  1563  LILSFNGSSSLPSEMDLIRIFSCYGPLKEAETEVQRKTNHVKVVFKKRADAEIAFRSAGK  1622

Query  298   SSPFGPTALASYHLHYRP  351
              S FGP AL SY L Y P
Sbjct  1623  YSIFGP-ALVSYRLRYLP  1639



>gb|KHG05776.1| Serine/threonine-protein kinase ATM [Gossypium arboreum]
 gb|KHG07187.1| Serine/threonine-protein kinase ATM [Gossypium arboreum]
Length=826

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 47/75 (63%), Gaps = 4/75 (5%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVE--AETKFSSETTAQIVFAQSSDAEVACQSLG  294
            LILNF+    +PS E LN TF  +GP+V   AE  F   T A++VF + +DAE+A  S G
Sbjct  724  LILNFSDIDSVPSVEDLNKTFSHYGPLVSPGAEV-FKKSTRAKVVFKRRADAEMAFSSSG  782

Query  295  KSSPFGPTALASYHL  339
            K S FGP+ L SY L
Sbjct  783  KYSIFGPS-LVSYRL  796



>ref|XP_008805030.1| PREDICTED: uncharacterized protein LOC103718133 isoform X1 [Phoenix 
dactylifera]
Length=1871

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LIL+F     LPS   L   F  +GP+ EAET+   +T   ++VF + +DAE+A +S GK
Sbjct  1563  LILSFNGSSSLPSEMDLIRIFSCYGPLKEAETEVQRKTNHVKVVFKKRADAEIAFRSAGK  1622

Query  298   SSPFGPTALASYHLHYRP  351
              S FGP AL SY L Y P
Sbjct  1623  YSIFGP-ALVSYRLRYLP  1639



>ref|XP_010423790.1| PREDICTED: uncharacterized protein LOC104708846 isoform X2 [Camelina 
sativa]
Length=713

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            LIL F     +PS E LN+ F ++GP+ E++T  + +   A+++F +S DAE A  S GK
Sbjct  626  LILKFADSGSVPSVEKLNEIFNRYGPLHESKTTVTKKGKRAKVLFKRSEDAETAFSSAGK  685

Query  298  SSPFGPTALASYHLHY  345
             S FGP+ L SY L Y
Sbjct  686  YSIFGPS-LLSYRLEY  700



>emb|CAN75603.1| hypothetical protein VITISV_016382 [Vitis vinifera]
Length=1887

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LILNF     +PS   LN  F +FGP+ E+ET+    T+ A++VF + SDAEVA  S G 
Sbjct  1792  LILNFPEVDSVPSEMILNKMFRRFGPLKESETEVDRVTSRARVVFKRCSDAEVAFSSAGM  1851

Query  298   SSPFGPTALASYHLHYRP  351
              + FGPT + +Y L+Y P
Sbjct  1852  INIFGPTHV-NYQLNYSP  1868



>ref|XP_010658450.1| PREDICTED: uncharacterized protein LOC100852955 isoform X1 [Vitis 
vinifera]
 ref|XP_010658451.1| PREDICTED: uncharacterized protein LOC100852955 isoform X1 [Vitis 
vinifera]
 ref|XP_010658452.1| PREDICTED: uncharacterized protein LOC100852955 isoform X1 [Vitis 
vinifera]
Length=1877

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LILNF     +PS   LN  F +FGP+ E+ET+    T+ A++VF + SDAEVA  S G 
Sbjct  1782  LILNFPEVDSVPSEMILNKMFRRFGPLKESETEVDRVTSRARVVFKRCSDAEVAFSSAGM  1841

Query  298   SSPFGPTALASYHLHYRP  351
              + FGPT + +Y L+Y P
Sbjct  1842  INIFGPTHV-NYQLNYSP  1858



>ref|XP_010423789.1| PREDICTED: uncharacterized protein LOC104708846 isoform X1 [Camelina 
sativa]
Length=739

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            LIL F     +PS E LN+ F ++GP+ E++T  + +   A+++F +S DAE A  S GK
Sbjct  652  LILKFADSGSVPSVEKLNEIFNRYGPLHESKTTVTKKGKRAKVLFKRSEDAETAFSSAGK  711

Query  298  SSPFGPTALASYHLHY  345
             S FGP+ L SY L Y
Sbjct  712  YSIFGPS-LLSYRLEY  726



>ref|XP_003633464.2| PREDICTED: uncharacterized protein LOC100852955 isoform X2 [Vitis 
vinifera]
Length=1850

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LILNF     +PS   LN  F +FGP+ E+ET+    T+ A++VF + SDAEVA  S G 
Sbjct  1755  LILNFPEVDSVPSEMILNKMFRRFGPLKESETEVDRVTSRARVVFKRCSDAEVAFSSAGM  1814

Query  298   SSPFGPTALASYHLHYRP  351
              + FGPT + +Y L+Y P
Sbjct  1815  INIFGPTHV-NYQLNYSP  1831



>ref|XP_010558277.1| PREDICTED: uncharacterized protein LOC104826984 [Tarenaya hassleriana]
 ref|XP_010558278.1| PREDICTED: uncharacterized protein LOC104826984 [Tarenaya hassleriana]
 ref|XP_010558280.1| PREDICTED: uncharacterized protein LOC104826984 [Tarenaya hassleriana]
Length=783

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            LILNFT    +PS E LN  F ++G + E+ET+   ++  A++VF +  DAE A  S GK
Sbjct  689  LILNFTDLDSVPSVEKLNKIFSRYGALRESETEVMKKSKKAKVVFKRGEDAETAFSSAGK  748

Query  298  SSPFGPTALASYHLHY  345
             S FGP+ L SY L +
Sbjct  749  YSIFGPS-LLSYRLKH  763



>ref|XP_009797650.1| PREDICTED: uncharacterized protein LOC104244049 [Nicotiana sylvestris]
Length=836

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L+LNF+    +P    LN  F ++GP+ E+ET+        ++VF + +DAE A    GK
Sbjct  736  LVLNFSDLESIPPIADLNRIFSQYGPLCESETEVIDKSKRGKVVFKRRADAETAFSKSGK  795

Query  298  SSPFGPTALASYHLHYRPGP  357
             S FGP+ L SY L Y P P
Sbjct  796  FSIFGPS-LISYRLQYSPSP  814



>ref|XP_009412529.1| PREDICTED: uncharacterized protein LOC103994003 [Musa acuminata 
subsp. malaccensis]
Length=1399

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 38/93 (41%), Positives = 50/93 (54%), Gaps = 5/93 (5%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LILNF+    LPS   L   F ++GP+ EA T+        ++VF + +DAE+A  S GK
Sbjct  1243  LILNFSGSKSLPSETDLIRVFSRYGPLKEAATEVQRRNNRVKVVFKRRADAEIAFSSAGK  1302

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVLP  396
              S FGP+ L SY L Y P     +   P T LP
Sbjct  1303  YSIFGPS-LLSYRLRYLPSTPDTS---PATKLP  1331



>ref|XP_006664785.1| PREDICTED: uncharacterized protein LOC102706435 [Oryza brachyantha]
Length=773

 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 79/169 (47%), Gaps = 32/169 (19%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            L+L+F  G  LPS E L   F KFG V+E+ET+   +  +A++VF +S++AE A  S   
Sbjct  623  LLLDFAKGVVLPSKEELLSAFGKFGLVIESETEIIKDNHSARVVFGKSAEAEAAYNSAET  682

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
               FGP   A+  LHY               LP      P  P+ K PL         I+
Sbjct  683  LGMFGPP-FATPRLHY---------------LPPIKLSVPS-PASKPPLT-------DIR  718

Query  478  QNLEMMSAML------EKAGDNISPDMKAKLEGEVKGFLKKVSAMV-GP  603
            +NLE M + L      +KA        +  L GE++G L KV  M+ GP
Sbjct  719  KNLERMISSLGGHSSVKKAATPSDGSKQENLLGEMQGLLAKVDKMLSGP  767



>gb|EYU39558.1| hypothetical protein MIMGU_mgv1a000539mg [Erythranthe guttata]
Length=1087

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
             LILNF     +PS  +LN  F +FGP++E+ET+   ET  A+++F + SDAEVA  S  K
Sbjct  989   LILNFAERKCVPSEINLNKMFRRFGPLMESETEVDHETGCAKVIFKRGSDAEVARNSSEK  1048

Query  298   SSPFGPTALASYHLHYRP  351
                FGP  L +Y + Y P
Sbjct  1049  FGIFGPV-LVNYQIGYSP  1065



>dbj|BAC84060.1| PWWP domain protein-like [Oryza sativa Japonica Group]
 dbj|BAG92822.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95995.1| unnamed protein product [Oryza sativa Japonica Group]
Length=564

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            LIL+F+    +PS + +N  F   GP++E  T+ + ++  A++VF++S+DAE A  S GK
Sbjct  482  LILHFSNAEAIPSVDDINSIFRMHGPIMEGATEINKKSKIARVVFSKSADAEQAYSSSGK  541

Query  298  SSPFGPTALASYHLHYRP  351
             + FGP AL  Y L Y P
Sbjct  542  YNAFGP-ALLRYDLKYLP  558



>ref|XP_007144530.1| hypothetical protein PHAVU_007G163600g [Phaseolus vulgaris]
 gb|ESW16524.1| hypothetical protein PHAVU_007G163600g [Phaseolus vulgaris]
Length=1017

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            L L F+    +PST  LN+ F +FGP++ ++T+   +T  A++VF + SDAE A  S GK
Sbjct  916  LTLKFSSLDSVPSTTDLNNIFGRFGPLILSKTELLEKTNRARVVFLKRSDAEAAFSSAGK  975

Query  298  SSPFGPTALASYHLHYRP  351
             S FGP+ L SY L   P
Sbjct  976  YSIFGPS-LVSYRLKILP  992



>ref|XP_004497463.1| PREDICTED: uncharacterized protein LOC101489416 [Cicer arietinum]
Length=881

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            L L FT    +PST +LN  F +FGP++E++T+    T  A++VF +  DAE A  S GK
Sbjct  779  LTLKFTNLDSVPSTTNLNKIFGRFGPLIESKTELLPNTNRARVVFKRRLDAETAFSSAGK  838

Query  298  SSPFGPTALASYHLHYRPGP  357
             S FGP+ L SY L   P P
Sbjct  839  YSIFGPS-LVSYRLKILPPP  857



>ref|XP_009609374.1| PREDICTED: uncharacterized protein LOC104103193 [Nicotiana tomentosiformis]
Length=802

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L+LNF+    +P    LN  F ++GP+ E+ET+        ++VF   +DAE A    GK
Sbjct  707  LVLNFSDLESIPPIADLNRIFSQYGPLCESETEVIDKSKRGKVVFKSRTDAETAFSKSGK  766

Query  298  SSPFGPTALASYHLHYRPGP  357
             S FGP+ L SY L Y P P
Sbjct  767  FSIFGPS-LISYRLQYSPSP  785



>ref|XP_003535180.1| PREDICTED: uncharacterized protein LOC100784689 isoform X1 [Glycine 
max]
 ref|XP_006589021.1| PREDICTED: uncharacterized protein LOC100784689 isoform X2 [Glycine 
max]
Length=1019

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSS-ETTAQIVFAQSSDAEVACQSLGK  297
            L++NF     +PS  +LN  F  FGP+ EAET+  +  + A++VF +  DAEVAC S  K
Sbjct  902  LVMNFAELGSVPSETNLNKMFRHFGPLKEAETEVDTVSSRARVVFKKCVDAEVACSSAQK  961

Query  298  SSPFGPTALASYHLHYRP  351
             + FG + L +Y L+Y P
Sbjct  962  FNIFG-SILVNYQLNYTP  978



>ref|XP_010555830.1| PREDICTED: uncharacterized protein LOC104825235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010555831.1| PREDICTED: uncharacterized protein LOC104825235 isoform X1 [Tarenaya 
hassleriana]
Length=887

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            LI+NF+    LPS  SLN  F  FGP+ E++T+   +T+ A++VF + +DAEVA  S G+
Sbjct  785  LIMNFSEMDTLPSEISLNKMFRHFGPIRESKTEVDRDTSRARVVFKKCADAEVAYNSAGR  844

Query  298  SSPFGPTALASYHLHY  345
             + FG T + +Y L Y
Sbjct  845  FNIFG-TKVVNYGLSY  859



>ref|XP_010555832.1| PREDICTED: protein starmaker isoform X2 [Tarenaya hassleriana]
Length=856

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            LI+NF+    LPS  SLN  F  FGP+ E++T+   +T+ A++VF + +DAEVA  S G+
Sbjct  754  LIMNFSEMDTLPSEISLNKMFRHFGPIRESKTEVDRDTSRARVVFKKCADAEVAYNSAGR  813

Query  298  SSPFGPTALASYHLHY  345
             + FG T + +Y L Y
Sbjct  814  FNIFG-TKVVNYGLSY  828



>ref|XP_009416273.1| PREDICTED: uncharacterized protein LOC103996931 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416274.1| PREDICTED: uncharacterized protein LOC103996931 [Musa acuminata 
subsp. malaccensis]
Length=904

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFS-SETTAQIVFAQSSDAEVACQSLGK  297
            L+L F+    +P+   L   F ++GP+VEAET+ + S+  A+IVF + SDAEVA  + GK
Sbjct  807  LVLTFSEASSIPAEADLIKLFGRYGPLVEAETEVTKSKNHAKIVFKRRSDAEVALSNAGK  866

Query  298  SSPFGPTALASYHLH  342
             S FG T L SY L 
Sbjct  867  YSIFGHT-LVSYRLR  880



>ref|XP_011077037.1| PREDICTED: uncharacterized protein LOC105161140 [Sesamum indicum]
Length=1393

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
             LILNF   + +PS  +LN  F +FGP++E+ET+   ++  A+++F + SDAEVA  S  K
Sbjct  1295  LILNFAERNNVPSEINLNKMFRRFGPLMESETEVDHDSGRAKVIFKRGSDAEVARNSAEK  1354

Query  298   SSPFGPTALASYHLHYRP  351
              + FGP  L +Y + Y P
Sbjct  1355  FNIFGPV-LVNYQIGYSP  1371



>ref|XP_011004163.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105110721 
[Populus euphratica]
Length=927

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            LILNF     +P   +LN  F  FGP+ E ET+   E+  A++VF +S+DAE A  S G 
Sbjct  803  LILNFRDLDAVPCETNLNRIFSHFGPLKETETQVLKESKRAKVVFCRSADAETAFSSAGN  862

Query  298  SSPFGPTALASYHLHY  345
             S FGP+ L SY L Y
Sbjct  863  YSFFGPS-LVSYRLKY  877



>ref|XP_008353472.1| PREDICTED: uncharacterized protein DDB_G0284459-like [Malus domestica]
Length=500

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 79/167 (47%), Gaps = 11/167 (7%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            L + F PG  LP+   L   + KFG + E ET+ F +   A++ F + +DA+ A      
Sbjct  337  LFVTFGPGSSLPTKSDLIKIYGKFGELNETETEMFYTNFCARVSFVKFADAQEAFDHSQN  396

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTV-------LPMDAFKFPMLPSGKAPLNGEA  456
             SPFG +A  ++ LH     AA   +  + +             +   L S      GEA
Sbjct  397  DSPFG-SANVTFRLHNLA--AASKLRELSEISNSAPAKKSRGKTRTQALASQPPAAVGEA  453

Query  457  PDLMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
              +  IK+ LE M++ML+ +   +S   K+KLE E+K  L  VS MV
Sbjct  454  SQVDLIKRKLEXMTSMLDDSTGQVSEVTKSKLESEIKELLGTVSTMV  500



>ref|XP_010490766.1| PREDICTED: uncharacterized protein LOC104768466 [Camelina sativa]
Length=723

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            LIL F     +PS   LN+ F ++GP+ E++TK + +   A+++F +S DA+ A  S GK
Sbjct  636  LILKFADSGSVPSEAKLNEIFNRYGPLHESKTKVTKKGKRAKVLFKRSEDAKTAFSSTGK  695

Query  298  SSPFGPTALASYHLHY  345
             S FGP+ L SY L Y
Sbjct  696  YSIFGPS-LLSYKLEY  710



>gb|KHF99550.1| Serine/threonine-protein kinase ATM [Gossypium arboreum]
Length=1912

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             ++++F   + +PS   LN  F  FGP+ E+ET+   ET  A++VF +SSDAE+A  S GK
Sbjct  1070  IVMSFPEINSVPSETKLNKMFKHFGPLKESETEVDRETRRARVVFRRSSDAEIAYNSAGK  1129

Query  298   SSPFGPTALASYHLHY  345
              + FGP  + +Y L+Y
Sbjct  1130  FNIFGPVPV-TYQLNY  1144



>ref|XP_010667237.1| PREDICTED: uncharacterized protein LOC104884308 [Beta vulgaris 
subsp. vulgaris]
Length=875

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 2/80 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            + L F+    +P+   LN+ F  FGP+ E+ET+  + +  A++VF + SDAE A  S GK
Sbjct  780  ITLKFSDVDSIPTEGKLNNIFGHFGPLKESETEVLAKKICARVVFKRRSDAETAFSSSGK  839

Query  298  SSPFGPTALASYHLHYRPGP  357
               FGP+ L  Y L+Y P P
Sbjct  840  FEIFGPS-LVCYRLNYTPSP  858



>ref|XP_003597929.1| DNA (cytosine-5)-methyltransferase 3B [Medicago truncatula]
 gb|AES68180.1| PWWP domain protein [Medicago truncatula]
Length=854

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            L L FT    +P+T  LN  F +FG ++E++TK   +T  A++VF +  DAE A  S GK
Sbjct  750  LTLKFTNLDSVPTTTDLNKIFGRFGTLIESKTKLLEKTNRAKVVFERYCDAETAFSSAGK  809

Query  298  SSPFGPTALASYHLHYRP  351
             S FGP +L SY L   P
Sbjct  810  YSIFGP-SLQSYRLKILP  826



>gb|KHF99551.1| Serine/threonine-protein kinase ATM [Gossypium arboreum]
Length=1886

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             ++++F   + +PS   LN  F  FGP+ E+ET+   ET  A++VF +SSDAE+A  S GK
Sbjct  1070  IVMSFPEINSVPSETKLNKMFKHFGPLKESETEVDRETRRARVVFRRSSDAEIAYNSAGK  1129

Query  298   SSPFGPTALASYHLHY  345
              + FGP  + +Y L+Y
Sbjct  1130  FNIFGPVPV-TYQLNY  1144



>ref|XP_004246694.1| PREDICTED: uncharacterized protein LOC101257296 [Solanum lycopersicum]
Length=770

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKF-SSETTAQIVFAQSSDAEVACQSLGK  297
            LIL F+    +P    LN  F ++GP+ E+ETK        ++VF + +DAE A    GK
Sbjct  668  LILKFSDLESVPPVVDLNIIFSQYGPLCESETKLIHKRKQVKVVFKRRADAETAFSKSGK  727

Query  298  SSPFGPTALASYHLHYRPGP  357
             S FGP+ L SY L Y P P
Sbjct  728  FSIFGPS-LISYRLQYSPSP  746



>ref|XP_006361776.1| PREDICTED: uncharacterized protein LOC102582027 [Solanum tuberosum]
Length=771

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKF-SSETTAQIVFAQSSDAEVACQSLGK  297
            LIL F+    +P    LN  F ++GP+ E+ETK        ++VF + +DAE A    GK
Sbjct  669  LILKFSDLESVPPIADLNIIFSQYGPLCESETKLIHKRKQVRVVFKRRADAETAFSKSGK  728

Query  298  SSPFGPTALASYHLHYRPGP  357
             S FGP+ L SY L Y P P
Sbjct  729  FSIFGPS-LISYRLQYSPSP  747



>ref|XP_008670690.1| PREDICTED: uncharacterized protein LOC103647958 [Zea mays]
 tpg|DAA41851.1| TPA: putative PWWP domain family protein isoform 1 [Zea mays]
 tpg|DAA41852.1| TPA: putative PWWP domain family protein isoform 2 [Zea mays]
Length=569

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            LIL+F+    +PS + +N  F   GP+VE ET  + ++  A++VF++S+DAE A  S GK
Sbjct  487  LILHFSSPEAIPSVDDINSIFRIHGPIVERETVITKKSKIAKVVFSKSADAESAYHSSGK  546

Query  298  SSPFGPTALASYHLHYRP  351
             + FGP+ L S  + Y P
Sbjct  547  HNAFGPSLLTS-EIKYLP  563



>ref|XP_004958807.1| PREDICTED: uncharacterized protein LOC101756159 [Setaria italica]
Length=563

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            LIL+F+    +PS + +N  F   GP+VE ET+ + ++  A++VF++ +DAE A  S GK
Sbjct  481  LILHFSSPEAIPSVDDINSIFRIHGPIVEGETEITKKSKIAKVVFSKRADAERAFSSPGK  540

Query  298  SSPFGPTALASYHLHYRP  351
             S FGP+ L +Y +   P
Sbjct  541  YSAFGPS-LVTYEIQCMP  557



>ref|XP_008239184.1| PREDICTED: uncharacterized protein LOC103337797 [Prunus mume]
Length=967

 Score = 57.8 bits (138),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 43/77 (56%), Gaps = 4/77 (5%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETTAQIVFAQSSDAEVACQSLGKS  300
            LIL FT    +PS  +LN  F  FGP+ E   K S    A +VF + SDAE A  S GK 
Sbjct  866  LILKFTDLESVPSEANLNKIFSCFGPLTEVLRKSS---RATVVFMRRSDAETAFSSTGKY  922

Query  301  SPFGPTALASYHLHYRP  351
            S FGP+ L SY L + P
Sbjct  923  STFGPS-LVSYRLKFLP  938



>gb|EMT20341.1| hypothetical protein F775_27609 [Aegilops tauschii]
Length=555

 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            LIL F     +PS + +N+ F   G ++E +T+ + ++ TA++VF+  +DAE A  + GK
Sbjct  473  LILYFGSAESIPSVDRINNVFRAHGAIIEGQTEITKKSKTAKVVFSNHADAEQAYSTSGK  532

Query  298  SSPFGPTALASYHLHYRP  351
             + FGP AL +Y + Y P
Sbjct  533  YNAFGP-ALLTYEIKYLP  549



>gb|EMS55544.1| hypothetical protein TRIUR3_18554 [Triticum urartu]
Length=562

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            LIL F     +PS + +N+ F   G ++E +T+ + ++ TA++VF+  +DAE A  + GK
Sbjct  480  LILYFGSAESIPSVDRINNVFRAHGAIIEGQTEITKKSKTAKVVFSNHADAEQAYSTSGK  539

Query  298  SSPFGPTALASYHLHYRP  351
             + FGP AL +Y + Y P
Sbjct  540  YNAFGP-ALLTYEIKYLP  556



>gb|EYU42580.1| hypothetical protein MIMGU_mgv1a002574mg [Erythranthe guttata]
Length=657

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 68/139 (49%), Gaps = 24/139 (17%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            L+LNF  G PLPS E L  TF +FG + E+E K + + +  +IV+ +SS+A  A +SL K
Sbjct  523  LVLNFAQGIPLPSKEMLVATFSRFGLLKESEIKVADDNSNVEIVYERSSEARFAFRSLEK  582

Query  298  SSP--FGPTALASYHLHYRP-------GPAADNFKMPTTV----LPMDAFKFPMLPSGKA  438
             S   FG  +L  + L+  P           +    P  V    +PM+A +   LP    
Sbjct  583  KSNDVFGE-SLVGFKLNCVPVVPPAGHSRTKEKRNRPKAVKTPHVPMNACQIKNLP----  637

Query  439  PLNGEAPDLMHIKQNLEMM  495
                  PD+  I QN+E M
Sbjct  638  -----LPDMTFIGQNVEKM  651



>ref|XP_007207227.1| hypothetical protein PRUPE_ppa001037mg [Prunus persica]
 gb|EMJ08426.1| hypothetical protein PRUPE_ppa001037mg [Prunus persica]
Length=927

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 43/77 (56%), Gaps = 4/77 (5%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETTAQIVFAQSSDAEVACQSLGKS  300
            LIL FT    +PS  +LN  F  +GP+ E   K S    A +VF + SDAE A  S GK 
Sbjct  826  LILKFTDLESVPSEANLNKIFSCYGPLTEVLRKSS---RATVVFRRRSDAETAFSSTGKY  882

Query  301  SPFGPTALASYHLHYRP  351
            S FGP+ L SY L + P
Sbjct  883  STFGPS-LVSYRLKFLP  898



>ref|XP_006398750.1| hypothetical protein EUTSA_v10015666mg [Eutrema salsugineum]
 gb|ESQ40203.1| hypothetical protein EUTSA_v10015666mg [Eutrema salsugineum]
Length=551

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 44/76 (58%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            LIL F     +PS E LN  F ++GP+ E+ET+   +   A++VF    DA+ A  S GK
Sbjct  464  LILKFADSGKIPSEEKLNSIFNRYGPLRESETQIMKKGKRAKVVFESGEDAKTAFSSSGK  523

Query  298  SSPFGPTALASYHLHY  345
             S FGP+ L SY L +
Sbjct  524  YSIFGPS-LLSYSLKF  538



>ref|NP_001152302.1| LOC100285941 [Zea mays]
 gb|ACG46896.1| PWWP domain containing protein [Zea mays]
Length=552

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            LIL+F+    +PS + +N  F   GP+VE ET  + ++  A++VF++S DAE A  S GK
Sbjct  470  LILHFSSPEAIPSVDDINSIFRIHGPIVERETVITKKSKIAKVVFSKSVDAEQAHHSSGK  529

Query  298  SSPFGPTALASYHLHYRP  351
             + FGP+ L S  + Y P
Sbjct  530  RNAFGPSLLTS-EIKYLP  546



>tpg|DAA64263.1| TPA: hypothetical protein ZEAMMB73_813518 [Zea mays]
Length=552

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            LIL+F+    +PS + +N  F   GP+VE ET  + ++  A++VF++S DAE A  S GK
Sbjct  470  LILHFSSPEAIPSVDDINSIFRIHGPIVERETVITKKSKIAKVVFSKSVDAEQAHHSSGK  529

Query  298  SSPFGPTALASYHLHYRP  351
             + FGP+ L S  + Y P
Sbjct  530  RNAFGPSLLTS-EIKYLP  546



>gb|KEH37804.1| dentin sialophosphoprotein-like protein, putative [Medicago truncatula]
Length=678

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSS-ETTAQIVFAQSSDAEVACQSLGK  297
            L++NFT    +PS  +LN  F +FG + E+ET+     + A++VF +  DAEVA  S  K
Sbjct  593  LVMNFTEFKSVPSETNLNKMFRRFGRLNESETEVDRVSSRARVVFKKRVDAEVALGSAKK  652

Query  298  SSPFGPTALASYHLHYRP  351
               FG + L +Y L+Y P
Sbjct  653  FKIFG-SVLVNYQLNYTP  669



>ref|XP_002877998.1| hypothetical protein ARALYDRAFT_348567 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54257.1| hypothetical protein ARALYDRAFT_348567 [Arabidopsis lyrata subsp. 
lyrata]
Length=836

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 53/93 (57%), Gaps = 6/93 (6%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            L++NF+    +P  +SL+  F  FGP+ E++T+   E   A++V+ + +DAEVA  S G+
Sbjct  738  LVMNFSEADTIPPEKSLSKMFRHFGPIKESQTEVDKENNRARVVYKKGADAEVAYNSAGR  797

Query  298  SSPFGPTALASYHLHY----RPGPAADNFKMPT  384
             S FG  A A    HY    R   A+D F++ T
Sbjct  798  FSIFGAKA-ARRMQHYVFQPRNSFASDMFQVKT  829



>ref|XP_010232920.1| PREDICTED: serine/threonine-protein kinase ATM [Brachypodium 
distachyon]
Length=4646

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 80/164 (49%), Gaps = 32/164 (20%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVAC---QS  288
            ++L FTPG  LPS E L   F KFG ++E+ET    +  +A++VF +S++AE A    ++
Sbjct  833  ILLEFTPGVILPSKEELISAFSKFGSLIESETDILKDAFSARVVFGKSAEAEAAYNKREA  892

Query  289  LGKSSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLM  468
            +G    FGP       L Y          +P T L         +P  ++P     P L+
Sbjct  893  VGVFGQFGPPFATLKRLTY----------LPATKLS--------IPPPRSP-AASKPSLL  933

Query  469  HIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMVG  600
             +K+NLE    M+   G N  P++ ++++    G L +V  MV 
Sbjct  934  DMKKNLE---NMISSHGTN--PNLLSQMQ----GLLSQVEKMVA  968



>ref|XP_009402237.1| PREDICTED: uncharacterized protein LOC103986084 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402238.1| PREDICTED: uncharacterized protein LOC103986084 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402239.1| PREDICTED: uncharacterized protein LOC103986084 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402240.1| PREDICTED: uncharacterized protein LOC103986084 [Musa acuminata 
subsp. malaccensis]
Length=2023

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 44/78 (56%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L+LNF     LPS   L   F ++GP+ EA T+   +     +VF + +DAE+A  + GK
Sbjct  1482  LVLNFNGSSSLPSETDLIRIFSRYGPLKEAATEVQQKNNRVVVVFKRRADAEIAFSNAGK  1541

Query  298   SSPFGPTALASYHLHYRP  351
              S FGP+ L SY L Y P
Sbjct  1542  YSIFGPS-LLSYRLRYFP  1558



>gb|EYU38511.1| hypothetical protein MIMGU_mgv1a002322mg [Erythranthe guttata]
Length=688

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 45/76 (59%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            LILNF   + +P  E+LN  F  +GP+ E+ET+  S    A+++F +  DA+ A  + GK
Sbjct  593  LILNFNNLNSIPPIENLNRIFSPYGPLRESETRVLSKSKRAKVIFKRREDADSAFSAPGK  652

Query  298  SSPFGPTALASYHLHY  345
               FGP+ L SY L Y
Sbjct  653  YEVFGPS-LISYSLKY  667



>ref|XP_006436203.1| hypothetical protein CICLE_v10030525mg [Citrus clementina]
 ref|XP_006436206.1| hypothetical protein CICLE_v10030525mg [Citrus clementina]
 gb|ESR49443.1| hypothetical protein CICLE_v10030525mg [Citrus clementina]
 gb|ESR49446.1| hypothetical protein CICLE_v10030525mg [Citrus clementina]
Length=1372

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LI+NF+    +PS  +L+  F  FGP+ E+ET+   E++ A++VF + SDAEVA  S  K
Sbjct  1277  LIINFSEMDTIPSETNLSKMFRCFGPLKESETEVDRESSRARVVFKKCSDAEVAHSSATK  1336

Query  298   SSPFGPTALASYHLHY  345
              + FGP  + +Y L Y
Sbjct  1337  FNIFGPK-VVNYQLSY  1351



>ref|XP_006485937.1| PREDICTED: uncharacterized protein LOC102624524 isoform X3 [Citrus 
sinensis]
Length=1372

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LI+NF+    +PS  +L+  F  FGP+ E+ET+   E++ A++VF + SDAEVA  S  K
Sbjct  1277  LIINFSEMDTIPSETNLSKMFRCFGPLKESETEVDRESSRARVVFKKCSDAEVAHSSATK  1336

Query  298   SSPFGPTALASYHLHY  345
              + FGP  + +Y L Y
Sbjct  1337  FNIFGPK-VVNYQLSY  1351



>ref|XP_006485935.1| PREDICTED: uncharacterized protein LOC102624524 isoform X1 [Citrus 
sinensis]
Length=1409

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LI+NF+    +PS  +L+  F  FGP+ E+ET+   E++ A++VF + SDAEVA  S  K
Sbjct  1314  LIINFSEMDTIPSETNLSKMFRCFGPLKESETEVDRESSRARVVFKKCSDAEVAHSSATK  1373

Query  298   SSPFGPTALASYHLHY  345
              + FGP  + +Y L Y
Sbjct  1374  FNIFGPK-VVNYQLSY  1388



>ref|XP_006485936.1| PREDICTED: uncharacterized protein LOC102624524 isoform X2 [Citrus 
sinensis]
Length=1390

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LI+NF+    +PS  +L+  F  FGP+ E+ET+   E++ A++VF + SDAEVA  S  K
Sbjct  1295  LIINFSEMDTIPSETNLSKMFRCFGPLKESETEVDRESSRARVVFKKCSDAEVAHSSATK  1354

Query  298   SSPFGPTALASYHLHY  345
              + FGP  + +Y L Y
Sbjct  1355  FNIFGP-KVVNYQLSY  1369



>ref|XP_006436204.1| hypothetical protein CICLE_v10030525mg [Citrus clementina]
 ref|XP_006436205.1| hypothetical protein CICLE_v10030525mg [Citrus clementina]
 gb|ESR49444.1| hypothetical protein CICLE_v10030525mg [Citrus clementina]
 gb|ESR49445.1| hypothetical protein CICLE_v10030525mg [Citrus clementina]
Length=1409

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LI+NF+    +PS  +L+  F  FGP+ E+ET+   E++ A++VF + SDAEVA  S  K
Sbjct  1314  LIINFSEMDTIPSETNLSKMFRCFGPLKESETEVDRESSRARVVFKKCSDAEVAHSSATK  1373

Query  298   SSPFGPTALASYHLHY  345
              + FGP  + +Y L Y
Sbjct  1374  FNIFGPK-VVNYQLSY  1388



>gb|KDO44586.1| hypothetical protein CISIN_1g0465681mg, partial [Citrus sinensis]
Length=1370

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             LI+NF+    +PS  +L+  F  FGP+ E+ET+   E++ A++VF + SDAEVA  S  K
Sbjct  1275  LIINFSEMDTIPSETNLSKMFRCFGPLKESETEVDRESSRARVVFKKCSDAEVAHSSATK  1334

Query  298   SSPFGPTALASYHLHY  345
              + FGP  + +Y L Y
Sbjct  1335  FNIFGP-KVVNYQLSY  1349



>ref|XP_007027247.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007027248.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007027249.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY07749.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY07750.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY07751.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=954

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETK-FSSETTAQIVFAQSSDAEVACQSLGK  297
            LILNF+    +PS E LN  F ++GP+V    +       A++VF + +DAE A  S GK
Sbjct  852  LILNFSDLESVPSVEDLNKIFSRYGPLVAPGAEVLKKSVRARVVFKRHADAETAFSSSGK  911

Query  298  SSPFGPTALASYHL  339
             S FGP+ L SY L
Sbjct  912  YSIFGPS-LVSYRL  924



>emb|CBI34908.3| unnamed protein product [Vitis vinifera]
Length=533

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            L+L+F PG  LPS + L   F KFG + E+ET+   ++  A++VF++SSDAE A     K
Sbjct  441  LLLSFGPGISLPSKDDLIKIFSKFGTLNESETEILYDSFCARVVFSRSSDAEEAFNGSQK  500

Query  298  SSPFGPTALAS  330
            +SPFG   + S
Sbjct  501  ASPFGAEQMKS  511



>ref|XP_007145981.1| hypothetical protein PHAVU_006G003100g [Phaseolus vulgaris]
 ref|XP_007145982.1| hypothetical protein PHAVU_006G003100g [Phaseolus vulgaris]
 gb|ESW17975.1| hypothetical protein PHAVU_006G003100g [Phaseolus vulgaris]
 gb|ESW17976.1| hypothetical protein PHAVU_006G003100g [Phaseolus vulgaris]
Length=292

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  457  PDLMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSA  591
            P L  +K+NLEMMS++LE +G+ +SP M+AKL+ E+K  L++V++
Sbjct  243  PSLEFMKKNLEMMSSILENSGNTLSPHMRAKLDAEIKNLLRRVNS  287



>gb|EAZ05249.1| hypothetical protein OsI_27451 [Oryza sativa Indica Group]
 gb|EAZ41200.1| hypothetical protein OsJ_25702 [Oryza sativa Japonica Group]
Length=559

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            LIL+F+    +PS + +N  F   GP++E  T+ + ++  A++VF++S+DAE A  S GK
Sbjct  482  LILHFSNAEAIPSVDDINSIFRMHGPIMEGATEINKKSKIARVVFSKSADAEQAYSSSGK  541

Query  298  SSPFGPTAL  324
             + FGP  L
Sbjct  542  YNAFGPALL  550



>ref|XP_004960949.1| PREDICTED: uncharacterized protein LOC101772251 [Setaria italica]
Length=389

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 73/158 (46%), Gaps = 28/158 (18%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            L+L++  G PLPS E L  TF +FG V+++ET  + +  +A++ FA  ++AE A    G 
Sbjct  242  LVLDYAAGAPLPSREHLVSTFRRFGLVIDSETAVAQDKRSARVAFATRAEAEAAFSCAG-  300

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIK  477
                   AL +             F  P+ V  +     P +  G  P       L  I+
Sbjct  301  -------ALGAA------------FAPPSAVPSLQ--DLPPIARGAPPPPLPKLPLTDIR  339

Query  478  QNLEMMSAMLEKAGDNI--SPDMKAKLEGEVKGFLKKV  585
             NLEMM A L+   +    SPD    L GE++G L KV
Sbjct  340  SNLEMMIASLKATAEAAANSPD---NLVGEMQGLLAKV  374



>ref|XP_006292354.1| hypothetical protein CARUB_v10018567mg [Capsella rubella]
 gb|EOA25252.1| hypothetical protein CARUB_v10018567mg [Capsella rubella]
Length=674

 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 69/155 (45%), Gaps = 21/155 (14%)
 Frame = +1

Query  142  GHPLPSTESLNDTFIKFGPVVEAET-KFSSETTAQIVFAQSSDAEVACQSLGKSSPFGPT  318
            G  LPS + L  T+ KFG + +  +  F++ ++A I F   SD E A     +  PF  T
Sbjct  534  GSTLPSKDDLIKTYKKFGALEKKRSYTFNNNSSALIAFLNVSDGEEAFNKSLEKCPFATT  593

Query  319  ALASYHLHY--RPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIKQNLEM  492
            +  ++ L Y     P   N K  T                         ++  +K+ LE 
Sbjct  594  STITFKLKYPSSASPENTNEKTETETRQC------------------VTEIESLKEKLED  635

Query  493  MSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
            + ++L+++   I+ ++K KLE E +  L KVS M+
Sbjct  636  IRSLLDQSEGMITKELKMKLEDESRNLLDKVSKMI  670



>ref|XP_011029709.1| PREDICTED: uncharacterized protein LOC105129100 isoform X1 [Populus 
euphratica]
Length=1427

 Score = 54.3 bits (129),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 35/92 (38%), Positives = 53/92 (58%), Gaps = 5/92 (5%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L+++F     +PS  SLN  F +FGP+ E+ET+   +T  A+++F + SDAE A  S  K
Sbjct  1329  LVMHFPVVDSVPSEISLNKMFRRFGPLKESETEVDRDTNRARVIFKRCSDAEAAYGSAPK  1388

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVL  393
              + FGP  L +Y L+Y     +  FK P  +L
Sbjct  1389  FNIFGPI-LVNYQLNY---TISVPFKTPPPIL  1416



>ref|XP_009342411.1| PREDICTED: uncharacterized protein LOC103934392 [Pyrus x bretschneideri]
Length=938

 Score = 54.3 bits (129),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 42/77 (55%), Gaps = 4/77 (5%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETTAQIVFAQSSDAEVACQSLGKS  300
            LIL F+    +PS ++L   F ++GP+ E      +   A +VF + SDAE A  S GK 
Sbjct  837  LILKFSDLESVPSEKNLKKIFSRYGPLTEV---MRNNRRATVVFEKRSDAETAFSSTGKY  893

Query  301  SPFGPTALASYHLHYRP  351
            S FGP+ L  Y L Y P
Sbjct  894  STFGPS-LVGYSLKYLP  909



>ref|XP_011030845.1| PREDICTED: uncharacterized protein LOC105129100 isoform X2 [Populus 
euphratica]
Length=1390

 Score = 54.3 bits (129),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 35/92 (38%), Positives = 53/92 (58%), Gaps = 5/92 (5%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L+++F     +PS  SLN  F +FGP+ E+ET+   +T  A+++F + SDAE A  S  K
Sbjct  1292  LVMHFPVVDSVPSEISLNKMFRRFGPLKESETEVDRDTNRARVIFKRCSDAEAAYGSAPK  1351

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVL  393
              + FGP  L +Y L+Y     +  FK P  +L
Sbjct  1352  FNIFGPI-LVNYQLNY---TISVPFKTPPPIL  1379



>ref|XP_010672904.1| PREDICTED: uncharacterized protein LOC104889395 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010672905.1| PREDICTED: uncharacterized protein LOC104889395 [Beta vulgaris 
subsp. vulgaris]
Length=1815

 Score = 54.3 bits (129),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L++NF     +PS  +LN  F +FGP+ E+ET    +++ A++VF + SDAEVA  S   
Sbjct  1721  LMMNFGEMGSIPSEVNLNKIFRRFGPLKESETGVDMQSSRARVVFKKRSDAEVAYSSAAM  1780

Query  298   SSPFGPTALASYHLHYRP  351
              + FG T + +Y L+Y P
Sbjct  1781  FNIFGSTPV-NYQLNYTP  1797



>ref|XP_009125134.1| PREDICTED: uncharacterized protein LOC103850169 [Brassica rapa]
Length=889

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 74/164 (45%), Gaps = 29/164 (18%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFS-SETTAQIVFAQSSDAEVACQSLGK  297
            L + F PG  LP  E+L + + KFG + E  +  S S   A++ F    D E A +S  +
Sbjct  746  LFVTFGPGSTLPKKEALIEIYGKFGALDEERSYVSDSNLCARVAFLNVDDGEKAFESSQE  805

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPD-----  462
            +SPF   +   + L                       K+P   +G+     EA +     
Sbjct  806  NSPFASASTIKFRL-----------------------KYPNERAGEKKGEAEAAETKTVE  842

Query  463  LMHIKQNLEMMSAMLEKAGDNISPDMKAKLEGEVKGFLKKVSAM  594
            + H+K+  E M ++++K+   ++ +++ KLE E+   L++V  M
Sbjct  843  MEHLKKKFEEMISLVDKSQGGMTEEVRVKLEEEMVNLLEEVRKM  886



>gb|KEH41352.1| PWWP domain protein [Medicago truncatula]
Length=938

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSS-ETTAQIVFAQSSDAEVACQSLGK  297
            L++NF   + +P   +LN  F +FGP+ E+ET+     + A++VF +  DAEVA  S  K
Sbjct  833  LVMNFAELNSVPLEANLNKMFKRFGPLKESETEVDRVSSRARVVFKKCVDAEVAFNSAKK  892

Query  298  SSPFGPTALASYHLHYRP  351
             + FG + L +Y L+Y P
Sbjct  893  FNIFG-SVLVNYQLNYTP  909



>ref|XP_002312039.2| hypothetical protein POPTR_0008s04420g [Populus trichocarpa]
 gb|EEE89406.2| hypothetical protein POPTR_0008s04420g [Populus trichocarpa]
Length=1360

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 35/92 (38%), Positives = 53/92 (58%), Gaps = 5/92 (5%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L+++F     +PS  SLN  F +FGP+ E+ET+   +T  A+++F + SDAE A  S  K
Sbjct  1262  LVMHFPVVDSVPSEISLNKMFRRFGPLKESETEVDRDTNRARVIFKRCSDAEAAYGSAPK  1321

Query  298   SSPFGPTALASYHLHYRPGPAADNFKMPTTVL  393
              + FGP  L +Y L+Y     +  FK P  +L
Sbjct  1322  FNIFGPI-LVNYQLNY---TISVPFKTPPPIL  1349



>gb|KHG16636.1| Serine/threonine-protein kinase ATM [Gossypium arboreum]
Length=1652

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             ++++F   + +PS   LN  F  FGP+ E+ET+   ET+ A++VF +SSDAEVA  S  K
Sbjct  1083  IVMSFPEINSVPSETKLNKMFKHFGPLKESETEVDCETSRARVVFRRSSDAEVAYNSARK  1142

Query  298   SSPFGPTALASYHLHY  345
              + FG  ++ +Y L+Y
Sbjct  1143  FNIFGLVSV-TYQLNY  1157



>gb|KHN01009.1| Serine/threonine-protein kinase ATM [Glycine soja]
Length=893

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 51/90 (57%), Gaps = 2/90 (2%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            L+LNF     +PS   LN  F +FGP+ E+ET+    ++ A++VF +  DAEVA  S  K
Sbjct  796  LVLNFAELDSVPSEMRLNKIFRRFGPLNESETEVDRGSSRARVVFKKCVDAEVAFSSAKK  855

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTT  387
             + FG + L +Y L++ P   +    + TT
Sbjct  856  FNIFG-SVLVNYKLNHTPSTLSKASSLATT  884



>ref|NP_189424.1| PWWP domain-containing protein [Arabidopsis thaliana]
 dbj|BAB02532.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77373.1| PWWP domain-containing protein [Arabidopsis thaliana]
Length=652

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 69/153 (45%), Gaps = 21/153 (14%)
 Frame = +1

Query  142  GHPLPSTESLNDTFIKFGPV-VEAETKFSSETTAQIVFAQSSDAEVACQSLGKSSPFGPT  318
            G  LPS + L  T+ KFG +  E    F++ + + + F  +SD E A     +  PF  T
Sbjct  519  GSTLPSKDDLIKTYEKFGALDKERSYMFNNNSCSCVAFVNASDGEEAFNRSLEKCPFATT  578

Query  319  ALASYHLHYRPGPAADNFKMPTTVLPMDAFKFPMLPSGKAPLNGEAPDLMHIKQNLEMMS  498
            +  ++ L Y P  A+   K                   +A       ++  +K+ LE + 
Sbjct  579  STVTFKLEY-PSSASSEKK-------------------EAETRKGVTEIECLKEKLEGIR  618

Query  499  AMLEKAGDNISPDMKAKLEGEVKGFLKKVSAMV  597
            A+L+++   I+ ++K KLE E +  L KV  M+
Sbjct  619  ALLDQSEGKITEELKMKLEDESRNLLDKVRKMI  651



>ref|XP_006403539.1| hypothetical protein EUTSA_v10010166mg [Eutrema salsugineum]
 gb|ESQ44992.1| hypothetical protein EUTSA_v10010166mg [Eutrema salsugineum]
Length=699

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            LI+NF+    +P  +SL+  F  FGP+ E++T+   E   A++V+ +S DA+VA  S G+
Sbjct  599  LIMNFSETDTIPPEKSLSKMFRCFGPIRESQTEVDKENNRARVVYRKSRDAQVAYNSAGR  658

Query  298  SSPFGPTALASYHLHY  345
             S FG  A+ +Y L +
Sbjct  659  FSIFGTKAV-NYELSF  673



>gb|EYU39555.1| hypothetical protein MIMGU_mgv1a004961mg [Erythranthe guttata]
Length=502

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSE-TTAQIVFAQSSDAEVACQSLGK  297
            LILNF     +PS  +LN  F +FG ++E+ET+   +   A+++F + +DA +A  S  K
Sbjct  404  LILNFADKKCVPSEINLNKIFRRFGTLMESETEVDRDLGRAKVIFKRGADAVIAHDSSEK  463

Query  298  SSPFGPTALASYHLHYRPGPAADNFKMPTTVLPMDAFKFP  417
             + FGP  + +Y + Y P        +   VLP++  +FP
Sbjct  464  FNIFGP-VIVTYEIGYSP-------LISVKVLPLEIPQFP  495



>ref|XP_006403540.1| hypothetical protein EUTSA_v10010125mg [Eutrema salsugineum]
 gb|ESQ44993.1| hypothetical protein EUTSA_v10010125mg [Eutrema salsugineum]
Length=790

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            LI+NF+    +P  +SL+  F  FGP+ E++T+   E   A++V+ + +DAEVA  S G+
Sbjct  690  LIMNFSETDTIPPEKSLSKMFRHFGPIRESQTEVDKENNRARVVYRKGADAEVAYNSAGR  749

Query  298  SSPFGPTALASYHLHY  345
             + FG  A+ +Y L +
Sbjct  750  FNIFGTKAV-NYELSF  764



>gb|EPS66971.1| hypothetical protein M569_07806, partial [Genlisea aurea]
Length=181

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 2/78 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFS-SETTAQIVFAQSSDAEVACQSLGK  297
            +I   T    +PS  SLN  F +FG ++E+ET    +   A+++F +  DA+VAC S  K
Sbjct  88   VIFRKTTNCVIPSEISLNKIFRRFGGLLESETLLDHTSGRARVIFKRGFDAQVACDSCKK  147

Query  298  SSPFGPTALASYHLHYRP  351
                G  A+ SYH+ Y P
Sbjct  148  IKVLGGAAV-SYHVGYSP  164



>emb|CDP04304.1| unnamed protein product [Coffea canephora]
Length=1010

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/65 (42%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            LIL F+ G  LPS  +LN+ F +FG + E ET+   ++  A+++F + +DAE AC S G+
Sbjct  915  LILTFSEGDRLPSEINLNNMFRRFGALKEYETEVDRDSHRARVIFKRGADAEAACSSAGR  974

Query  298  SSPFG  312
             + FG
Sbjct  975  INIFG  979



>ref|XP_006403541.1| hypothetical protein EUTSA_v10010125mg [Eutrema salsugineum]
 gb|ESQ44994.1| hypothetical protein EUTSA_v10010125mg [Eutrema salsugineum]
Length=821

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
            LI+NF+    +P  +SL+  F  FGP+ E++T+   E   A++V+ + +DAEVA  S G+
Sbjct  721  LIMNFSETDTIPPEKSLSKMFRHFGPIRESQTEVDKENNRARVVYRKGADAEVAYNSAGR  780

Query  298  SSPFGPTALASYHLHY  345
             + FG  A+ +Y L +
Sbjct  781  FNIFGTKAV-NYELSF  795



>ref|XP_010559062.1| PREDICTED: uncharacterized protein LOC104827500 isoform X2 [Tarenaya 
hassleriana]
Length=862

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            LI+NF+    +PS  SLN  F  FGP+ E +T+   +T  A++VF + +DAEVA  S+G+
Sbjct  751  LIMNFSEMDIMPSEISLNKMFRHFGPIREFQTEVDRDTGRARVVFKKCADAEVAYNSVGR  810

Query  298  SSPFGPTALASYHLHY  345
             + FG   + +Y L +
Sbjct  811  FNIFG-AKVVNYELSH  825



>ref|XP_006658178.1| PREDICTED: uncharacterized protein LOC102702674 [Oryza brachyantha]
Length=476

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 43/68 (63%), Gaps = 2/68 (3%)
 Frame = +1

Query  151  LPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGKSSPFGPTALA  327
            +PS + +N  F   GP++E  T+ + ++  A++VF++S+DAE A  S GK + FGP AL 
Sbjct  404  IPSVDDINSIFRIHGPIMEGATEITKKSKIARVVFSKSADAERAYSSSGKYNAFGP-ALL  462

Query  328  SYHLHYRP  351
             Y L Y P
Sbjct  463  RYDLKYLP  470



>ref|XP_010559140.1| PREDICTED: uncharacterized protein LOC104827500 isoform X3 [Tarenaya 
hassleriana]
Length=852

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            LI+NF+    +PS  SLN  F  FGP+ E +T+   +T  A++VF + +DAEVA  S+G+
Sbjct  751  LIMNFSEMDIMPSEISLNKMFRHFGPIREFQTEVDRDTGRARVVFKKCADAEVAYNSVGR  810

Query  298  SSPFGPTALASYHLHY  345
             + FG   + +Y L +
Sbjct  811  FNIFG-AKVVNYELSH  825



>ref|XP_010067263.1| PREDICTED: uncharacterized protein LOC104454184 [Eucalyptus grandis]
 gb|KCW65361.1| hypothetical protein EUGRSUZ_G02799 [Eucalyptus grandis]
 gb|KCW65362.1| hypothetical protein EUGRSUZ_G02799 [Eucalyptus grandis]
Length=1216

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L+L F     +PS  SLN  F +FGP+ E+ET+   +   A++VF + SDAEVA  S  K
Sbjct  1119  LVLMFPLSASVPSVYSLNKMFKRFGPLKESETELDRDANRARLVFKKCSDAEVAFNSAQK  1178

Query  298   SSPFGPTALASYHLHY  345
              + FG + L +Y L+Y
Sbjct  1179  FNIFG-SMLVNYQLNY  1193



>ref|XP_010559212.1| PREDICTED: uncharacterized protein LOC104827500 isoform X4 [Tarenaya 
hassleriana]
Length=835

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            LI+NF+    +PS  SLN  F  FGP+ E +T+   +T  A++VF + +DAEVA  S+G+
Sbjct  720  LIMNFSEMDIMPSEISLNKMFRHFGPIREFQTEVDRDTGRARVVFKKCADAEVAYNSVGR  779

Query  298  SSPFGPTALASYHLHY  345
             + FG   + +Y L +
Sbjct  780  FNIFG-AKVVNYELSH  794



>ref|XP_010559004.1| PREDICTED: uncharacterized protein LOC104827500 isoform X1 [Tarenaya 
hassleriana]
Length=866

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +1

Query  121  LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSET-TAQIVFAQSSDAEVACQSLGK  297
            LI+NF+    +PS  SLN  F  FGP+ E +T+   +T  A++VF + +DAEVA  S+G+
Sbjct  751  LIMNFSEMDIMPSEISLNKMFRHFGPIREFQTEVDRDTGRARVVFKKCADAEVAYNSVGR  810

Query  298  SSPFGPTALASYHLHY  345
             + FG   + +Y L +
Sbjct  811  FNIFG-AKVVNYELSH  825



>ref|XP_011027012.1| PREDICTED: uncharacterized protein LOC105127429 isoform X2 [Populus 
euphratica]
Length=1365

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L+++F     +PS  SLN  F +FGP+ E+ET+   +T  A+++F + SDAE A  S  K
Sbjct  1267  LVMHFPVVDSVPSEISLNKMFRRFGPLKESETEVDRDTNRARVIFKRCSDAEAAYGSAPK  1326

Query  298   SSPFGPTALASYHLHY  345
              + FGP  L +Y L+Y
Sbjct  1327  FNIFGPI-LVNYQLNY  1341



>ref|XP_011027011.1| PREDICTED: uncharacterized protein LOC105127429 isoform X1 [Populus 
euphratica]
Length=1402

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L+++F     +PS  SLN  F +FGP+ E+ET+   +T  A+++F + SDAE A  S  K
Sbjct  1304  LVMHFPVVDSVPSEISLNKMFRRFGPLKESETEVDRDTNRARVIFKRCSDAEAAYGSAPK  1363

Query  298   SSPFGPTALASYHLHY  345
              + FGP  L +Y L+Y
Sbjct  1364  FNIFGPI-LVNYQLNY  1378



>ref|XP_002315275.2| dentin sialophosphoprotein [Populus trichocarpa]
 gb|EEF01446.2| dentin sialophosphoprotein [Populus trichocarpa]
Length=1404

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +1

Query  121   LILNFTPGHPLPSTESLNDTFIKFGPVVEAETKFSSETT-AQIVFAQSSDAEVACQSLGK  297
             L+++F     +PS  SLN  F +FGP+ E+ET+   +T  A+++F + SDAE A  S  K
Sbjct  1306  LVMHFPVVDSVPSEISLNKMFRRFGPLKESETEVDRDTNRARVIFKRCSDAEAAYGSAPK  1365

Query  298   SSPFGPTALASYHLHY  345
              + FGP  L +Y L+Y
Sbjct  1366  FNIFGPI-LVNYQLNY  1380



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1887598073020