BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18415_g1_i1 len=2817 path=[1:0-184 @186@!:185-643 645:644-2816]

Length=2817
                                                                      Score     E

ref|XP_006343106.1|  PREDICTED: uncharacterized protein LOC102577589    489   2e-156   
ref|XP_004235698.1|  PREDICTED: uncharacterized protein LOC543949...    484   3e-154   
ref|XP_010318558.1|  PREDICTED: uncharacterized protein LOC543949...    480   8e-153   
ref|NP_001289447.1|  uncharacterized LOC104095863                       449   5e-141   
dbj|BAI48084.1|  centromere protein C homologue                         448   1e-140   Nicotiana tabacum [American tobacco]
ref|NP_001289528.1|  uncharacterized LOC104228251                       433   6e-135   
gb|AAU04618.1|  CENP-C                                                  313   7e-94    Solanum tuberosum [potatoes]
ref|XP_007217291.1|  hypothetical protein PRUPE_ppa018132mg             308   2e-88    
ref|XP_008228592.1|  PREDICTED: uncharacterized protein LOC103327982    299   1e-84    
emb|CDO98077.1|  unnamed protein product                                293   4e-83    
ref|XP_006385477.1|  hypothetical protein POPTR_0003s05530g             294   1e-82    
emb|CBI36186.3|  unnamed protein product                                280   2e-76    
ref|XP_010654918.1|  PREDICTED: uncharacterized protein LOC100244530    276   6e-75    
gb|EYU21562.1|  hypothetical protein MIMGU_mgv1a004387mg                260   1e-72    
ref|XP_002303277.2|  hypothetical protein POPTR_0003s05530g             259   1e-70    Populus trichocarpa [western balsam poplar]
ref|XP_011072288.1|  PREDICTED: uncharacterized protein LOC105157...    253   4e-69    
ref|XP_011072287.1|  PREDICTED: uncharacterized protein LOC105157...    247   3e-67    
ref|XP_010249870.1|  PREDICTED: uncharacterized protein LOC104592...    231   4e-61    
ref|XP_010249869.1|  PREDICTED: uncharacterized protein LOC104592...    231   4e-61    
gb|KDO58182.1|  hypothetical protein CISIN_1g043062mg                   225   3e-58    
ref|XP_006465448.1|  PREDICTED: uncharacterized protein LOC102609...    225   3e-58    
ref|XP_006465447.1|  PREDICTED: uncharacterized protein LOC102609...    225   3e-58    
ref|XP_007024046.1|  Centromere protein C, putative isoform 2           221   2e-57    
ref|XP_007024045.1|  Centromere protein C, putative isoform 1           221   2e-57    
ref|XP_006465449.1|  PREDICTED: uncharacterized protein LOC102609...    222   3e-57    
ref|XP_008461044.1|  PREDICTED: uncharacterized protein LOC103499...    216   5e-56    
ref|XP_008461045.1|  PREDICTED: uncharacterized protein LOC103499...    216   6e-56    
ref|XP_011000820.1|  PREDICTED: uncharacterized protein LOC105108...    216   1e-55    
ref|XP_008461046.1|  PREDICTED: uncharacterized protein LOC103499...    215   1e-55    
ref|XP_006427091.1|  hypothetical protein CICLE_v10024870mg             215   6e-55    
gb|KHG12472.1|  Mannose-1-phosphate guanyltransferase                   213   6e-55    
ref|XP_011000819.1|  PREDICTED: uncharacterized protein LOC105108...    213   1e-54    
gb|KGN45338.1|  hypothetical protein Csa_7G440590                       202   3e-51    
ref|XP_011013528.1|  PREDICTED: uncharacterized protein LOC105117...    196   7e-50    
ref|XP_011013527.1|  PREDICTED: uncharacterized protein LOC105117...    196   4e-49    
ref|XP_011002717.1|  PREDICTED: uncharacterized protein LOC105109...    192   1e-48    
ref|XP_004136069.1|  PREDICTED: uncharacterized protein LOC101218908    194   1e-48    
ref|XP_011002716.1|  PREDICTED: uncharacterized protein LOC105109...    192   5e-48    
ref|XP_010062445.1|  PREDICTED: uncharacterized protein LOC104449...    183   4e-45    
ref|XP_010062443.1|  PREDICTED: uncharacterized protein LOC104449...    182   9e-45    
ref|XP_010062444.1|  PREDICTED: uncharacterized protein LOC104449...    182   1e-44    
gb|KDP37184.1|  hypothetical protein JCGZ_06240                         178   4e-43    
gb|ABO07412.1|  centromere protein C1                                   164   9e-43    Solanum lycopersicum
ref|XP_002517519.1|  hypothetical protein RCOM_0894640                  176   7e-42    Ricinus communis
ref|XP_006597140.1|  PREDICTED: uncharacterized protein LOC100778037    174   1e-41    
gb|KHM98777.1|  hypothetical protein glysoja_030830                     174   1e-41    
ref|XP_010110298.1|  hypothetical protein L484_019452                   171   2e-40    
ref|XP_002298134.2|  hypothetical protein POPTR_0001s17850g             167   2e-40    Populus trichocarpa [western balsam poplar]
ref|XP_006595147.1|  PREDICTED: uncharacterized protein LOC547764...    169   4e-40    
ref|XP_006595146.1|  PREDICTED: uncharacterized protein LOC547764...    169   4e-40    
ref|XP_003542108.1|  PREDICTED: uncharacterized protein LOC547764...    169   4e-40    
gb|KHN44134.1|  hypothetical protein glysoja_031795                     169   5e-40    
ref|XP_006595145.1|  PREDICTED: uncharacterized protein LOC547764...    169   5e-40    
gb|AAU04630.1|  CENP-C                                                  150   3e-38    Solanum lycopersicum
gb|AAU04617.1|  CENP-C                                                  162   5e-38    Medicago truncatula
ref|XP_004511206.1|  PREDICTED: uncharacterized protein LOC101510656    159   3e-37    
ref|XP_010691264.1|  PREDICTED: uncharacterized protein LOC104904...    158   1e-36    
ref|XP_010691265.1|  PREDICTED: uncharacterized protein LOC104904...    158   1e-36    
ref|XP_007150679.1|  hypothetical protein PHAVU_005G1725000g            157   3e-36    
ref|XP_004302929.1|  PREDICTED: uncharacterized protein LOC101300739    155   5e-36    
gb|AAU04614.1|  CENP-C                                                  154   3e-35    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007160179.1|  hypothetical protein PHAVU_002G299500g             151   4e-35    
ref|XP_010537934.1|  PREDICTED: uncharacterized protein LOC104812471    145   2e-32    
ref|XP_010925103.1|  PREDICTED: uncharacterized protein LOC105047743    144   3e-32    
ref|XP_008809133.1|  PREDICTED: uncharacterized protein LOC103720936    139   1e-30    
gb|KFK43814.1|  hypothetical protein AALP_AA1G176700                    137   9e-30    
ref|XP_003619785.1|  CENP-C                                             133   1e-28    
gb|AES76003.2|  centromere C-like protein                               127   7e-27    
ref|XP_010912509.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    124   6e-26    
ref|XP_006416891.1|  hypothetical protein EUTSA_v10006918mg             121   6e-25    
ref|XP_006416890.1|  hypothetical protein EUTSA_v10006918mg             121   7e-25    
ref|XP_008792976.1|  PREDICTED: uncharacterized protein LOC103709431    121   8e-25    
gb|EPS59112.1|  hypothetical protein M569_15699                         106   1e-22    
ref|XP_009407451.1|  PREDICTED: uncharacterized protein LOC103990...    114   1e-22    
ref|XP_009407450.1|  PREDICTED: uncharacterized protein LOC103990...    114   2e-22    
ref|XP_009407449.1|  PREDICTED: uncharacterized protein LOC103990...    113   3e-22    
gb|AAU04611.1|  CENP-C                                                  112   4e-22    Arabidopsis arenosa
dbj|BAD42454.1|  centromere protein C homolog                           108   8e-22    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009358207.1|  PREDICTED: uncharacterized protein LOC103948854    110   1e-21    
ref|XP_009349661.1|  PREDICTED: uncharacterized protein LOC103941...    110   1e-21    
ref|XP_009338999.1|  PREDICTED: uncharacterized protein LOC103931...    108   7e-21    
ref|XP_009338996.1|  PREDICTED: uncharacterized protein LOC103931...    108   8e-21    
ref|XP_009338997.1|  PREDICTED: uncharacterized protein LOC103931...    108   8e-21    
ref|XP_009339000.1|  PREDICTED: uncharacterized protein LOC103931...    108   9e-21    
ref|XP_006306866.1|  hypothetical protein CARUB_v10008413mg             107   1e-20    
ref|XP_006306865.1|  hypothetical protein CARUB_v10008413mg             107   1e-20    
gb|AAU04625.1|  CENP-C                                                  101   1e-20    Glycine max [soybeans]
gb|AAF71990.1|AC013453_15  Hypothetical protein                         107   2e-20    Arabidopsis thaliana [mouse-ear cress]
ref|NP_173018.2|  centromere protein C                                  107   2e-20    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008342750.1|  PREDICTED: uncharacterized protein LOC103405517    106   3e-20    
ref|XP_010497282.1|  PREDICTED: uncharacterized protein LOC104774...    106   4e-20    
ref|XP_010459101.1|  PREDICTED: uncharacterized protein LOC104740...    106   4e-20    
ref|XP_010497274.1|  PREDICTED: uncharacterized protein LOC104774...    106   4e-20    
ref|XP_010459103.1|  PREDICTED: uncharacterized protein LOC104740...    106   4e-20    
ref|XP_010476653.1|  PREDICTED: transcription factor IRO1-like is...    106   5e-20    
ref|XP_010497290.1|  PREDICTED: uncharacterized protein LOC104774...    106   5e-20    
ref|XP_010476654.1|  PREDICTED: uncharacterized protein LOC104755...    106   5e-20    
ref|XP_006844397.1|  hypothetical protein AMTR_s00142p00096890          105   8e-20    
ref|XP_007150678.1|  hypothetical protein PHAVU_005G1725001g          97.1    2e-19    
emb|CDY36578.1|  BnaA06g10310D                                          102   7e-19    
ref|XP_009148956.1|  PREDICTED: uncharacterized protein LOC103872...    102   9e-19    
ref|XP_009148957.1|  PREDICTED: uncharacterized protein LOC103872...    101   1e-18    
emb|CDY58029.1|  BnaC05g49770D                                          101   1e-18    
ref|XP_009416686.1|  PREDICTED: uncharacterized protein LOC103997241  89.4    1e-16    
ref|XP_009416096.1|  PREDICTED: uncharacterized protein LOC103996811  91.7    3e-16    
dbj|BAF63162.1|  kinetochore protein                                  93.6    4e-16    Capsella rubella
dbj|BAD42453.1|  centromere protein C homolog                         92.4    6e-16    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007024047.1|  Centromere protein C, putative isoform 3         92.0    7e-16    
ref|XP_008373737.1|  PREDICTED: uncharacterized protein LOC103437051  85.9    1e-14    
ref|XP_008373746.1|  PREDICTED: uncharacterized protein LOC103437058  85.1    2e-14    
ref|XP_002890116.1|  CENP-C                                           87.8    2e-14    
gb|KHG03078.1|  Chromosomal replication initiator DnaA                86.7    4e-14    
gb|EEC71093.1|  hypothetical protein OsI_02875                        87.0    5e-14    Oryza sativa Indica Group [Indian rice]
gb|AAU04616.1|  CENP-C                                                85.9    6e-14    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004969175.1|  PREDICTED: uncharacterized protein LOC101770...  86.3    7e-14    
ref|XP_004969174.1|  PREDICTED: uncharacterized protein LOC101770...  86.3    7e-14    
dbj|BAD61293.1|  CENPCA protein-like                                  85.5    1e-13    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043584.1|  Os01g0617700                                     85.9    1e-13    Oryza sativa Japonica Group [Japonica rice]
gb|AAU04631.1|  CENP-C                                                82.0    1e-13    Triticum aestivum [Canadian hard winter wheat]
ref|XP_006646103.1|  PREDICTED: uncharacterized protein LOC102711938  85.1    2e-13    
gb|AAU04622.1|  CENP-C                                                78.6    3e-13    Oryza sativa Japonica Group [Japonica rice]
emb|CDM83393.1|  unnamed protein product                              84.0    4e-13    
gb|ABL64046.1|  CENP-C                                                74.7    2e-11    Arabidopsis halleri subsp. halleri
gb|ABL64045.1|  CENP-C                                                74.7    2e-11    Arabidopsis halleri subsp. gemmifera
gb|ABL64048.1|  CENP-C                                                74.3    3e-11    Arabidopsis lyrata subsp. lyrata
gb|EMS60377.1|  hypothetical protein TRIUR3_35356                     77.0    4e-11    
ref|XP_010232028.1|  PREDICTED: uncharacterized protein LOC100845...  77.0    7e-11    
ref|XP_002988563.1|  hypothetical protein SELMODRAFT_427188           74.7    9e-11    
ref|XP_010232029.1|  PREDICTED: uncharacterized protein LOC100845...  76.3    1e-10    
ref|XP_010232030.1|  PREDICTED: uncharacterized protein LOC100845...  76.3    1e-10    
ref|XP_003566889.1|  PREDICTED: uncharacterized protein LOC100845...  75.9    1e-10    
ref|XP_001781488.1|  predicted protein                                76.3    1e-10    
gb|ABL64047.1|  CENP-C                                                70.5    6e-10    Arabidopsis lyrata subsp. petraea
ref|XP_002979260.1|  hypothetical protein SELMODRAFT_110537           68.2    7e-10    
ref|NP_001104933.1|  CENPCA protein                                   71.6    2e-09    Zea mays [maize]
gb|EPS63000.1|  hypothetical protein M569_11788                       67.0    5e-09    
gb|AAU04626.1|  CENP-C1                                               70.1    7e-09    Saccharum officinarum [noble cane]
tpg|DAA43238.1|  TPA: hypothetical protein ZEAMMB73_222077            65.9    9e-09    
gb|EMT11913.1|  hypothetical protein F775_31264                       68.9    2e-08    
gb|AAU04623.1|  CENP-C                                                67.4    5e-08    Sorghum bicolor [broomcorn]
gb|AAU04627.1|  CENP-C2                                               66.2    1e-07    Saccharum officinarum [noble cane]
gb|AAU04624.1|  CENP-C                                                65.9    2e-07    Sorghum propinquum
gb|AAD39435.1|AF129858_1  CENPCB protein                              60.5    4e-06    Zea mays [maize]
ref|XP_008656649.1|  PREDICTED: uncharacterized protein LOC541778     59.3    1e-05    
gb|AFW83278.1|  hypothetical protein ZEAMMB73_130673                  54.3    4e-05    
gb|AFW83277.1|  hypothetical protein ZEAMMB73_130673                  53.9    5e-05    
tpg|DAA58575.1|  TPA: CENPCC protein                                  57.4    6e-05    
ref|XP_003083681.1|  CENP-C (ISS)                                     57.0    7e-05    
emb|CEG00421.1|  unnamed product                                      57.0    7e-05    
tpg|DAA43237.1|  TPA: hypothetical protein ZEAMMB73_222077            53.9    5e-04    
tpg|DAA43236.1|  TPA: hypothetical protein ZEAMMB73_222077            53.9    5e-04    



>ref|XP_006343106.1| PREDICTED: uncharacterized protein LOC102577589 [Solanum tuberosum]
Length=709

 Score =   489 bits (1259),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 331/765 (43%), Positives = 447/765 (58%), Gaps = 85/765 (11%)
 Frame = +3

Query  282   MTTEPLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKL  461
             M  E L  DP DPL + AGL LLP T+RV ++ S+   P +L SIH  MKSM  ++   L
Sbjct  1     MVNEALISDPVDPLHSLAGLSLLPTTVRVSTDASVSVNPKDLESIHNFMKSMETKSP-GL  59

Query  462   LEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPD  641
             LEE++ IVDNG+E+LN  F  F  S  +D  +A K  KE  +ERRPGLGRKRARFS+KP 
Sbjct  60    LEEAREIVDNGAELLNTKFTSFILSKGIDGDLAMK-GKEKLQERRPGLGRKRARFSLKPS  118

Query  642   TSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRR  821
             TSQP +S+   LD+D+L DP E+F   EKLE+A++E+ RQ G    D ++NN P  ARRR
Sbjct  119   TSQPTVSVAPRLDIDQLSDPVEFFSVAEKLEDAEKEIERQKGSSIHDPDVNNPPANARRR  178

Query  822   RPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKE-NSNDVeleele  998
             RPGILGKSV+YKHRFSS  P+++D  +SSQET + D L    S L +E +  +VEL+E E
Sbjct  179   RPGILGKSVKYKHRFSSTQPENDDAFISSQETLEDDILVEHGSQLPEELHGLNVELQEAE  238

Query  999   ltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFP-DAR  1175
             LTG I + E R+N IL ELLS   +DLD D  +S LQE+ Q+KP +L  LC+PEFP   +
Sbjct  239   LTGSIKKTENRINKILGELLSCSDEDLDRDMAVSKLQERLQIKPIELGTLCIPEFPVTGK  298

Query  1176  TDYMTLGERIPKARKSVLGL-----PNSDKRTSGKRQWEESPQSNLtsptppkspfssLA  1340
              D    GERI K RK  L +       ++   S  +Q EESP S L SPTPPKSPF SL+
Sbjct  299   LDGKAFGERIQKPRKFSLEVRELVKSATEGTPSSHKQHEESPASKLASPTPPKSPFGSLS  358

Query  1341  LLRKQVLKSNPLRDPFSPLNIDLNDINKNSDQVGLVKDFSKSGNLHGESNIKGMNVSDHQ  1520
             LL+K++++SNPLRDPFSPLNIDL                                 S+H 
Sbjct  359   LLKKKLMQSNPLRDPFSPLNIDLQ--------------------------------SEH-  385

Query  1521  ADRSAETNAQSSNIDISHSGSHAQMGDCDGHTDAGHMVTRGLEQLNNEQSLEKNSGGETI  1700
              D S +  +Q  N ++  + S        G  +   MV      L +EQ +EKN G +++
Sbjct  386   PDWSVKKKSQCVNNNVGPTESR-------GCENTNIMVPLRGSDLVHEQLMEKNPGRDSV  438

Query  1701  AAGQGDSHGSMERCNGWNHMDIRTADENSGMQNRDTEVQPSGHD----------------  1832
               G  +S   ME+ NG++ +D+ T + N  M+N D+  +  G D                
Sbjct  439   RTGPNESRSGMEQHNGYDDIDVNT-NVNLNMRNVDSRHESDGLDKVKDDSAINNVLKDLQ  497

Query  1833  ------ITDKEKMHDTCIFIQGLSPAQVQVeaddetntsnetetdIQNNVSCRTDEHVED  1994
                     + +K+ D+ +  + L   Q Q         +   ET +++  S   D+ V++
Sbjct  498   SLETKSYINCQKLQDSEVLAETLPSLQAQ--GKAVDTANYTIETVVEDFGSTEIDQLVDN  555

Query  1995  MPSMSAFPEEQEHNGNDAHTSENWSGNQNPSDQSNSAAVQNHSVDMQSALPDINPEQHIM  2174
             M   +A   EQ+H   D+    N       SDQ NS AV+  S D++S  P+++P+ H  
Sbjct  556   MLPETAPSVEQDHYFEDSVKDLN-------SDQLNSVAVEVPSRDVRSKFPEMSPQHHTQ  608

Query  2175  KQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGER  2354
              +     KQ +      G RERK L  RPSLADAGT FE+GVRRSKR+K+RPLE+WKGER
Sbjct  609   TKD----KQQKAKKLAVGRRERKHLSSRPSLADAGTSFESGVRRSKRMKTRPLEYWKGER  664

Query  2355  LLFGRVNESMKLVGVKYVSPSLGNMKVKSYISDEYKEVVDLAARY  2489
             LL+GRV+E +KLVG+KY+SP  G+ KVKSYI D+YK++VDLAARY
Sbjct  665   LLYGRVDEGLKLVGLKYISPGKGSFKVKSYIPDDYKDLVDLAARY  709



>ref|XP_004235698.1| PREDICTED: uncharacterized protein LOC543949 isoform X2 [Solanum 
lycopersicum]
Length=709

 Score =   484 bits (1245),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 332/765 (43%), Positives = 440/765 (58%), Gaps = 85/765 (11%)
 Frame = +3

Query  282   MTTEPLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKL  461
             M  E L  DP DPL + AGL LLP T+RV +  S+  +  +L SIH  MKSM  +    L
Sbjct  1     MVNEALISDPVDPLHSLAGLSLLPTTVRVSTGASVSVDSKDLESIHNFMKSMETKGP-GL  59

Query  462   LEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPD  641
             LEE++ IVDNG+E+LN  F  F  S  +D  +A K  KE  +ERRPGLGRKRARFS+KP 
Sbjct  60    LEEAREIVDNGAELLNTKFTSFIRSKGIDGDLAIK-GKEKVQERRPGLGRKRARFSLKPS  118

Query  642   TSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRR  821
             TSQP +S+   LD+D+L DP E+F   EKLE A++E+ RQ G    D ++NN P  ARRR
Sbjct  119   TSQPTVSIAPRLDIDQLSDPVEFFSVAEKLEVAEKEIERQKGGSIHDPDVNNPPANARRR  178

Query  822   RPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKE-NSNDVeleele  998
             RPGILGKSV+YKHRFSS  P+++D  +SSQET + D L    S L +E +  +VEL+E E
Sbjct  179   RPGILGKSVKYKHRFSSSQPENDDAFISSQETLEDDILVEHGSQLPEELHGLNVELQEAE  238

Query  999   ltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFP-DAR  1175
             LTG I + E R+N ILDELLS   +DLD D  +S LQEQ ++KP +L  LC+PEFP   +
Sbjct  239   LTGPIKKSENRINKILDELLSGSGEDLDRDMAVSKLQEQLKIKPIELGTLCIPEFPVTGK  298

Query  1176  TDYMTLGERIPKARKSVLGLPN-----SDKRTSGKRQWEESPQSNLtsptppkspfssLA  1340
              D   LGERI K  K  L +       ++   S  +Q EESP S L SPTPPKSPF SL+
Sbjct  299   FDGKALGERIQKPSKFFLEIAELVKSATEGTPSSHKQHEESPASKLASPTPPKSPFGSLS  358

Query  1341  LLRKQVLKSNPLRDPFSPLNIDLNDINKNSDQVGLVKDFSKSGNLHGESNIKGMNVSDHQ  1520
             LL+K++++SNPLRDPFSPLNIDL                                 S+H 
Sbjct  359   LLKKKLMQSNPLRDPFSPLNIDLQ--------------------------------SEH-  385

Query  1521  ADRSAETNAQSSNIDISHSGSHAQMGDCDGHTDAGHMVTRGLEQLNNEQSLEKNSGGETI  1700
              D SA+  +Q  N ++    S        G  +   MV      L +EQ +EKN G +++
Sbjct  386   PDWSAKKKSQCVNNNVGPIESR-------GCENTNIMVPLRGSDLVHEQPIEKNPGRDSV  438

Query  1701  AAGQGDSHGSMERCNGWNHMDIRTADENSGMQNRDTEVQPSGHD----------------  1832
               G   S   ME+ NG++ +D  T D N  M+N D+  +  G D                
Sbjct  439   KTGPNGSRSGMEQHNGYDDIDANTND-NLNMRNVDSHHESDGLDKVKDDSVIKNVLKALQ  497

Query  1833  ------ITDKEKMHDTCIFIQGLSPAQVQVeaddetntsnetetdIQNNVSCRTDEHVED  1994
                     D +K+ D+ +  + L   Q Q         +   ET +++  S   D  V++
Sbjct  498   GLETKSYIDCQKLQDSEVLAETLPSLQAQ--GKAVDTANYTIETAVEDFGSTEIDPLVDN  555

Query  1995  MPSMSAFPEEQEHNGNDAHTSENWSGNQNPSDQSNSAAVQNHSVDMQSALPDINPEQHIM  2174
             M   +A   EQ+H   D+    N       SDQ NS  V+  S D++   P+++P+ H  
Sbjct  556   MLPETAPSAEQDHYFEDSVKDLN-------SDQLNSVGVEVPSRDVRPKFPEMSPQHHKQ  608

Query  2175  KQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGER  2354
              +     KQ +      G RERK L  RPSLADAGT FE+GVRRSKR+K+RPLE+WKGER
Sbjct  609   AKD----KQQKAKELAVGRRERKHLSSRPSLADAGTSFESGVRRSKRMKTRPLEYWKGER  664

Query  2355  LLFGRVNESMKLVGVKYVSPSLGNMKVKSYISDEYKEVVDLAARY  2489
             LL+GRV+E +KLVG+KY+SP  G+ KVKSYI D+YK++VDLAARY
Sbjct  665   LLYGRVDEGLKLVGLKYISPGKGSFKVKSYIPDDYKDLVDLAARY  709



>ref|XP_010318558.1| PREDICTED: uncharacterized protein LOC543949 isoform X1 [Solanum 
lycopersicum]
Length=710

 Score =   480 bits (1235),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 332/766 (43%), Positives = 440/766 (57%), Gaps = 86/766 (11%)
 Frame = +3

Query  282   MTTEPLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKL  461
             M  E L  DP DPL + AGL LLP T+RV +  S+  +  +L SIH  MKSM  +    L
Sbjct  1     MVNEALISDPVDPLHSLAGLSLLPTTVRVSTGASVSVDSKDLESIHNFMKSMETKGP-GL  59

Query  462   LEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPD  641
             LEE++ IVDNG+E+LN  F  F  S  +D  +A K  KE  +ERRPGLGRKRARFS+KP 
Sbjct  60    LEEAREIVDNGAELLNTKFTSFIRSKGIDGDLAIK-GKEKVQERRPGLGRKRARFSLKPS  118

Query  642   TSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRR  821
             TSQP +S+   LD+D+L DP E+F   EKLE A++E+ RQ G    D ++NN P  ARRR
Sbjct  119   TSQPTVSIAPRLDIDQLSDPVEFFSVAEKLEVAEKEIERQKGGSIHDPDVNNPPANARRR  178

Query  822   RPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKE-NSNDVeleele  998
             RPGILGKSV+YKHRFSS  P+++D  +SSQET + D L    S L +E +  +VEL+E E
Sbjct  179   RPGILGKSVKYKHRFSSSQPENDDAFISSQETLEDDILVEHGSQLPEELHGLNVELQEAE  238

Query  999   ltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFP-DAR  1175
             LTG I + E R+N ILDELLS   +DLD D  +S LQEQ ++KP +L  LC+PEFP   +
Sbjct  239   LTGPIKKSENRINKILDELLSGSGEDLDRDMAVSKLQEQLKIKPIELGTLCIPEFPVTGK  298

Query  1176  TDYMTLGERIPKARKSVLGLPN-----SDKRTSGKRQWEESPQSNLtsptppkspfssLA  1340
              D   LGERI K  K  L +       ++   S  +Q EESP S L SPTPPKSPF SL+
Sbjct  299   FDGKALGERIQKPSKFFLEIAELVKSATEGTPSSHKQHEESPASKLASPTPPKSPFGSLS  358

Query  1341  LLRKQVLKSNPLRDPFSPLNIDLNDINKNSDQVGLVKDFSKSGNLHGESNIKGMNVSDHQ  1520
             LL+K++++SNPLRDPFSPLNIDL                                 S+H 
Sbjct  359   LLKKKLMQSNPLRDPFSPLNIDLQ--------------------------------SEH-  385

Query  1521  ADRSAETNAQSSNIDISHSGSHAQMGDCDGHTDAGHMVTRGLEQLNNEQSLEKNSGGETI  1700
              D SA+  +Q  N ++    S        G  +   MV      L +EQ +EKN G +++
Sbjct  386   PDWSAKKKSQCVNNNVGPIESR-------GCENTNIMVPLRGSDLVHEQPIEKNPGRDSV  438

Query  1701  AAGQGDSHGSMERCNGWNHMDIRTADENSGMQNRDTEVQPSGHD----------------  1832
               G   S   ME+ NG++ +D  T D N  M+N D+  +  G D                
Sbjct  439   KTGPNGSRSGMEQHNGYDDIDANTND-NLNMRNVDSHHESDGLDKVKDDSVIKNVLKALQ  497

Query  1833  ------ITDKEKMHDTCIFIQGLSPAQVQVeaddetntsnetetdIQNNVSCRTDE-HVE  1991
                     D +K+ D+ +  + L   Q Q         +   ET +++  S   D   V+
Sbjct  498   GLETKSYIDCQKLQDSEVLAETLPSLQAQ--GKAVDTANYTIETAVEDFGSTEIDPLQVD  555

Query  1992  DMPSMSAFPEEQEHNGNDAHTSENWSGNQNPSDQSNSAAVQNHSVDMQSALPDINPEQHI  2171
             +M   +A   EQ+H   D+    N       SDQ NS  V+  S D++   P+++P+ H 
Sbjct  556   NMLPETAPSAEQDHYFEDSVKDLN-------SDQLNSVGVEVPSRDVRPKFPEMSPQHHK  608

Query  2172  MKQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGE  2351
               +     KQ +      G RERK L  RPSLADAGT FE+GVRRSKR+K+RPLE+WKGE
Sbjct  609   QAKD----KQQKAKELAVGRRERKHLSSRPSLADAGTSFESGVRRSKRMKTRPLEYWKGE  664

Query  2352  RLLFGRVNESMKLVGVKYVSPSLGNMKVKSYISDEYKEVVDLAARY  2489
             RLL+GRV+E +KLVG+KY+SP  G+ KVKSYI D+YK++VDLAARY
Sbjct  665   RLLYGRVDEGLKLVGLKYISPGKGSFKVKSYIPDDYKDLVDLAARY  710



>ref|NP_001289447.1| uncharacterized LOC104095863 [Nicotiana tomentosiformis]
 dbj|BAI48085.1| centromere protein C [Nicotiana tomentosiformis]
Length=714

 Score =   449 bits (1155),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 317/770 (41%), Positives = 441/770 (57%), Gaps = 90/770 (12%)
 Frame = +3

Query  282   MTTEPLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKL  461
             M  E LT DP DPLR   GL L P+TIRV ++ S+  +P +L S+H  MKS+  +   KL
Sbjct  1     MANEALTSDPVDPLRGLVGLSLFPKTIRVCTDVSV--DPKDLESVHNFMKSLETKMPAKL  58

Query  462   LEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPD  641
              EE++AIVDN +E+LN         + +D  +A K  KE P+ERRPGLGR++ RFS KP 
Sbjct  59    FEEARAIVDNAAELLNTK------CMGIDGDLAMK-GKEKPKERRPGLGRRKPRFSFKPS  111

Query  642   TSQPNISLQS---SLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTA  812
             T +P + L S   SLD+D+L+DP E+F A E+ E A++E+ R  G+  ++ ++N+ P  A
Sbjct  112   TCKPPVILGSTLESLDMDQLEDPVEFFAAAERWEEAEKEMKRLKGISINE-DVNDPPANA  170

Query  813   RRRRPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVelee  992
             RRRRPGIL KSVRYKHRFSS+  +++D  +SSQET   D      S L +E    + +E 
Sbjct  171   RRRRPGILNKSVRYKHRFSSIESENDDAFISSQETLGSDIRAGQNSQLPEEPPG-LNVEL  229

Query  993   leltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFP-D  1169
              E     + ++   N IL+ELLS +  DL+    LS LQE  Q+KP +L  LC PEFP  
Sbjct  230   QEADSPGSVEKTENNGILNELLSSNGGDLNGGMALSKLQEWLQIKPIELGPLCFPEFPMT  289

Query  1170  ARTDYMTLGERIPKARKSVLGLPN-----SDKRTSGKRQWEESPQSNLtsptppkspfss  1334
              + D    GERI K RK  L + +     ++  TS +RQ EESP +NL SPTPPKSP +S
Sbjct  290   GKVDGKAFGERIRKPRKFSLEIRDLVKSATEGTTSTRRQHEESPTNNLASPTPPKSPHAS  349

Query  1335  LALLRKQVLKSNPLRDPFSPLNIDLNDINKNSDQVGLVKDFSKSGNLHGESNIKGMNVSD  1514
             L+LLR+++ +SNPLRDPFSPLNIDL+    NSD                       + SD
Sbjct  350   LSLLRQKISQSNPLRDPFSPLNIDLD----NSD-----------------------SQSD  382

Query  1515  HQADRSAETNAQSSNIDISHSGSHAQMGDCDGHTDAGHMVTRGLEQLNNEQSLEKNSGGE  1694
             H    S + N Q  +     + SH +  +  G  +A  M+       ++EQ +  +SG +
Sbjct  383   HPPGWSMKMNPQCISNSAGPTESHGETENIAGSDNANIMLPLSGSNFSHEQLMINDSGKD  442

Query  1695  TIAAGQGDSHGSMERCNGWNHMDIRTADENSGMQNRDTEVQPSGHDITDK----------  1844
              +  G   S    E  NG++ +DI T D N  M+  D+  +    D+ DK          
Sbjct  443   NVKTGPNGSQSGEELENGYD-IDINT-DINLTMRIMDSHYE---SDVLDKVKDVSVVNDV  497

Query  1845  ---------------EKMHDTCIFIQGLSPAQVQVeaddetntsnetetdIQNNVSCRTD  1979
                            +KM D  +  + LS  Q Q   + +   +   ET   +  S   D
Sbjct  498   LKDQQGLETESYISCQKMQDGEVLAETLSSPQAQ--GEADDTHNCSVETVAVDFGSSEID  555

Query  1980  EHVEDMPSMSAFPEEQEHNGNDAHTSENWSGNQNPSDQSNSAAVQNHSVDMQSALPDINP  2159
               V+DMP   A   EQ+H+  D+            SDQ +S AV+ HS +++S LPD++P
Sbjct  556   GQVDDMPPQRAHSAEQDHHFEDSVKGVT-------SDQLSSVAVEVHSTEVRSKLPDMSP  608

Query  2160  EQHIMKQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEF  2339
             + H   +     KQP+      G RE KAL+ RPSLADAGT F++GVRRSKR+K+RPLE+
Sbjct  609   QHHAKAKD----KQPKAKRPAGGRRESKALRSRPSLADAGTSFQDGVRRSKRMKTRPLEY  664

Query  2340  WKGERLLFGRVNESMKLVGVKYVSPSLGNMKVKSYISDEYKEVVDLAARY  2489
             WKGERLLFGRVN+S+KLVGVKY+SP  G++KV+S+ISD+YK++V+LAARY
Sbjct  665   WKGERLLFGRVNDSLKLVGVKYISPGKGSVKVESFISDDYKDLVELAARY  714



>dbj|BAI48084.1| centromere protein C homologue [Nicotiana tabacum]
Length=714

 Score =   448 bits (1153),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 317/770 (41%), Positives = 442/770 (57%), Gaps = 90/770 (12%)
 Frame = +3

Query  282   MTTEPLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKL  461
             M  E LT DP DPLR   GL L P+TIRV ++ S+  +P +L S+H  MKS+  +   KL
Sbjct  1     MANEALTSDPVDPLRGLVGLSLFPKTIRVCTDVSV--DPKDLESVHNFMKSLETKMPAKL  58

Query  462   LEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPD  641
              EE++AIVDN +E+LN         + +D  +A K  KE P+ERRPGLGR++ RFS KP 
Sbjct  59    FEEARAIVDNAAELLNTK------CMGIDGDLAMK-GKEKPKERRPGLGRRKPRFSFKPS  111

Query  642   TSQPNISLQS---SLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTA  812
             T +P + L S   SLD+D+L+DP E+F A E+ E A++E+ R  G+  ++ ++N+ P  A
Sbjct  112   TCKPPVILGSTLESLDMDQLEDPVEFFAAAERWEEAEKEMKRLKGISINE-DVNDPPANA  170

Query  813   RRRRPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVelee  992
             RRRRPGIL KSVRYKHRFSS+  +++D  +SSQET   D      S L +E    + +E 
Sbjct  171   RRRRPGILNKSVRYKHRFSSIESENDDAFISSQETLGSDIRAGQNSQLPEEPPG-LNVEL  229

Query  993   leltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDA  1172
              E     + ++   N IL+ELLS +  DL+    LS LQE  Q+KP +L  LC PEFP A
Sbjct  230   QEADSPGSVEKTENNGILNELLSSNGGDLNGGMALSKLQEWLQIKPIELGPLCFPEFPMA  289

Query  1173  -RTDYMTLGERIPKARKSVLGLPN-----SDKRTSGKRQWEESPQSNLtsptppkspfss  1334
              + D    GERI K RK  L + +     ++  TS +RQ EESP +NL SPTPPKSP +S
Sbjct  290   GKVDGKAFGERIRKPRKFSLEIRDLVKSATEGTTSTRRQHEESPTNNLASPTPPKSPHAS  349

Query  1335  LALLRKQVLKSNPLRDPFSPLNIDLNDINKNSDQVGLVKDFSKSGNLHGESNIKGMNVSD  1514
             L+LLR+++ +SNPLRDPFSPLNIDL+    NSD                       + SD
Sbjct  350   LSLLRQKISQSNPLRDPFSPLNIDLD----NSD-----------------------SQSD  382

Query  1515  HQADRSAETNAQSSNIDISHSGSHAQMGDCDGHTDAGHMVTRGLEQLNNEQSLEKNSGGE  1694
             H    S + N Q  +     + SH +  +  G  +A  M+       ++EQ +  +SG +
Sbjct  383   HPPGWSMKMNPQCISNSAGPTESHGETENIAGSDNANIMLPLSGSNFSHEQLMINDSGKD  442

Query  1695  TIAAGQGDSHGSMERCNGWNHMDIRTADENSGMQNRDTEVQPSGHDITDK----------  1844
              +  G   S    E  NG++ +DI T D N  M+  D+  +    D+ DK          
Sbjct  443   NVKTGPNGSQSGEELENGYD-IDINT-DINLTMRIMDSHYE---SDVLDKVKDVSVVNDV  497

Query  1845  ---------------EKMHDTCIFIQGLSPAQVQVeaddetntsnetetdIQNNVSCRTD  1979
                            +KM D  +  + LS  Q Q   + +   +   ET   +  S   D
Sbjct  498   LKDQQGLETESYISCQKMQDGEVLAETLSSPQAQ--GEADDTHNCSVETVAVDFGSSEID  555

Query  1980  EHVEDMPSMSAFPEEQEHNGNDAHTSENWSGNQNPSDQSNSAAVQNHSVDMQSALPDINP  2159
               V++MP   A   EQ+H+  D+            SDQ +S AV+ HS +++S LPD++P
Sbjct  556   GQVDNMPPQRAHSAEQDHHFEDSVKGVT-------SDQLSSVAVEVHSTEVRSKLPDMSP  608

Query  2160  EQHIMKQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEF  2339
             + H   +     KQP+      G RE KAL+ RPSLADAGT F++GVRRSKR+K+RPLE+
Sbjct  609   QHHAKAKD----KQPKAERPAGGRRESKALRSRPSLADAGTSFQDGVRRSKRMKTRPLEY  664

Query  2340  WKGERLLFGRVNESMKLVGVKYVSPSLGNMKVKSYISDEYKEVVDLAARY  2489
             WKGERLLFGRVN+S+KLVGVKY+SP  G++KV+S+ISD+YK++V+LAARY
Sbjct  665   WKGERLLFGRVNDSLKLVGVKYISPGKGSVKVESFISDDYKDLVELAARY  714



>ref|NP_001289528.1| uncharacterized LOC104228251 [Nicotiana sylvestris]
 dbj|BAI48081.1| centromere protein C homologue [Nicotiana tabacum]
 dbj|BAI48086.1| centromere protein C [Nicotiana sylvestris]
Length=715

 Score =   433 bits (1114),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 310/768 (40%), Positives = 435/768 (57%), Gaps = 85/768 (11%)
 Frame = +3

Query  282   MTTEPLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKL  461
             M  E  T  P DPL    GL L P+TIRV ++ S+  +P NL S+H  MKS+  +++ KL
Sbjct  1     MANEAPTSGPVDPLHGLVGLSLFPKTIRVCTDVSV--DPKNLESVHNFMKSLETKSSAKL  58

Query  462   LEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPD  641
              EE++AIVDN +E+LN         + +D  +A K  KE P+ERRPGLGR++ RFS KP 
Sbjct  59    FEEARAIVDNAAELLNTK------CMGVDGDLAMK-GKEQPKERRPGLGRRKPRFSFKPS  111

Query  642   TSQPNI----SLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTT  809
             TSQP      S   SLD+D+L+DP ++F A E+ E A++EL R  G+  +D ++N+ P  
Sbjct  112   TSQPPPVILGSTLESLDMDQLEDPVDFFAAAERWEEAEKELKRLKGISIND-DVNDPPAN  170

Query  810   ARRRRPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVele  989
             ARRRRPGIL KSVRYKHRFSS+  +++D  +SSQ+T   D      S L +E    + +E
Sbjct  171   ARRRRPGILNKSVRYKHRFSSIQSENDDAFISSQKTLGSDTRACQNSQLPEELPG-LNVE  229

Query  990   eleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFP-  1166
               E     + ++  +N IL+ELLS + +DL  +  LS LQE+  +KP +L  LC+PEFP 
Sbjct  230   LQEADSPGSLEKTEINGILNELLSSNGEDLIGEMALSNLQERLGIKPIELGPLCIPEFPM  289

Query  1167  DARTDYMTLGERIPKARKSV-----LGLPNSDKRTSGKRQWEESPQSNLtsptppkspfs  1331
               + D    GERI K  K       L    ++   S +RQ EESP +NL SPTPPKSP +
Sbjct  290   TGKVDGKAFGERIRKPWKFSQDIRDLVKSATEGTASTRRQHEESPTNNLASPTPPKSPHA  349

Query  1332  sLALLRKQVLKSNPLRDPFSPLNIDLNDINKNSDQVGLVKDFSKSGNLHGESNIKGMNVS  1511
             SL+LL++++ +SNPLRDPFSPLNIDL   N +S                          S
Sbjct  350   SLSLLKQKIFRSNPLRDPFSPLNIDL--YNNDSQ-------------------------S  382

Query  1512  DHQADRSAETNAQSSNIDISHSGSHAQMGDCDGHTDAGHMVTRGLEQLNNEQSLEKNSGG  1691
             DH    S + N Q  + +   + SH +  +  G  D   MV       ++EQ +E +SG 
Sbjct  383   DHPPGWSMKMNPQCISNNAGPTESHGETENIAGSDDTNIMVPLSGSDFSHEQLMENDSGK  442

Query  1692  ETIAAGQGDSHGSMERCNGWNHMDIRTADENSGMQNRDTEVQPSGHD-------ITDK--  1844
             + +  G   S    E  NG++ ++I T D N  M+N D+  +    D       + D   
Sbjct  443   DNVKTGSNGSQSGEELENGYD-IEINT-DINLNMRNMDSHYESDALDKVKDVSVVNDVSK  500

Query  1845  -------------EKMHDTCIFIQGLSPAQVQVeaddetntsnetetdIQNNVSCRTDEH  1985
                          +KM D  +  + LS  Q Q   + +   +   ET   +  S   D  
Sbjct  501   DQQGLETESYFSCQKMQDGEVLAETLSSPQAQ--GEADDTHNCSVETVAADFGSFEIDGQ  558

Query  1986  VEDMPSMSAFPEEQEHNGNDAHTSENWSGNQNPSDQSNSAAVQNHSVDMQSALPDINPEQ  2165
             V+DMP   A   EQ+H+  D       S     SDQ +S AV+ HS +++S LPD++P+ 
Sbjct  559   VDDMPPQRANSAEQDHHFED-------SVKDVTSDQLSSVAVEVHSTEVRSKLPDMSPQH  611

Query  2166  HIMKQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWK  2345
             H   +     KQP+      G RE KAL+ RPSLADAGT F++GVRRSKR+K+RPLE+WK
Sbjct  612   HAKAK----DKQPKAKRPAGGRRESKALRSRPSLADAGTSFQDGVRRSKRMKTRPLEYWK  667

Query  2346  GERLLFGRVNESMKLVGVKYVSPSLGNMKVKSYISDEYKEVVDLAARY  2489
             GERLL+G +N+S+KLVGVKY+SP  G++KV+SYISD+YK++V+ AARY
Sbjct  668   GERLLYGWINDSLKLVGVKYLSPGKGSVKVESYISDDYKDLVESAARY  715



>gb|AAU04618.1| CENP-C [Solanum tuberosum]
Length=384

 Score =   313 bits (803),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 201/384 (52%), Positives = 257/384 (67%), Gaps = 10/384 (3%)
 Frame = +3

Query  282   MTTEPLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKL  461
             M  E L  DP DPL + AGL LLP T+RV ++ S+   P +L  IH  MKSM  +    L
Sbjct  1     MVNEALISDPVDPLHSLAGLSLLPTTVRVSTDASVSVNPKDLELIHNFMKSMETKGP-GL  59

Query  462   LEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKP-  638
             LEE++ IVDNG+E+LN  F  F  S  +D  +A K  KE  +ERRPGLGRKRARFS+KP 
Sbjct  60    LEEAREIVDNGAELLNTKFTSFILSKGIDGDLAMK-GKEKLQERRPGLGRKRARFSLKPP  118

Query  639   DTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARR  818
              TSQP +S+   LD+D+L DP E+F   EKLE+A++E+ RQ G    D ++NN P  ARR
Sbjct  119   STSQPTVSVAPRLDIDQLSDPVEFFSVAEKLEDAEKEIERQKGSSIHDPDVNNPPANARR  178

Query  819   RRPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKE-NSNDVeleel  995
             RRPGILGKSV+YKHRFSS  P+++D  +SSQET + D L    S L +E +  +VEL+E 
Sbjct  179   RRPGILGKSVKYKHRFSSTQPENDDAFISSQETLEDDILVEHGSQLPEELHGLNVELQEA  238

Query  996   eltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFP-DA  1172
             ELTG + + E R+N ILDELLS   +DLD D  +S LQE+ Q+ P +L  LC+PEFP   
Sbjct  239   ELTGSVKKTENRINKILDELLSGSDEDLDRDMAVSKLQERLQINPIELGTLCIPEFPVTG  298

Query  1173  RTDYMTLGERIPKARKSVLGL-----PNSDKRTSGKRQWEESPQSNLtsptppkspfssL  1337
             + D    GERI K RK  L +       ++   S  +Q EESP S L SPTPPKSPF SL
Sbjct  299   KLDGKAFGERIQKPRKFSLEVRELVKSATEGTPSSHKQHEESPASKLASPTPPKSPFGSL  358

Query  1338  ALLRKQVLKSNPLRDPFSPLNIDL  1409
             +LL+K++++SNPLRDPFSPLNIDL
Sbjct  359   SLLKKKLMQSNPLRDPFSPLNIDL  382



>ref|XP_007217291.1| hypothetical protein PRUPE_ppa018132mg [Prunus persica]
 gb|EMJ18490.1| hypothetical protein PRUPE_ppa018132mg [Prunus persica]
Length=675

 Score =   308 bits (788),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 259/754 (34%), Positives = 387/754 (51%), Gaps = 112/754 (15%)
 Frame = +3

Query  306   DPPDPLRAFAGLPLLPQTIRVQSEDSIPSE-PNNLNSIHQLMKSMGLRNA-EKLLEESKA  479
             DP DPL+ + GL + P + ++  ++S P +  ++L +IH  +KS+ L+ +  KL +++K 
Sbjct  8     DPVDPLQGYTGLAVFPNSGKILPDNSKPYDIGDDLQTIHTQLKSVALQQSPTKLKDQAKN  67

Query  480   IVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNI  659
             IV   SEI  +  P+   +L   D V  ++ +E PR++R  LGRKRARFS+KP++SQP +
Sbjct  68    IVSGTSEIPKSVNPQ---ALKQKDAVVPEMAEENPRQQRRALGRKRARFSVKPNSSQPAM  124

Query  660   SLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILG  839
             SL   LD+  L+D EE + A E+ ENAK+E+ +QMG    D++  N     R R+PGILG
Sbjct  125   SLLPPLDIKNLKDTEELWTAYERHENAKKEIEKQMGGAVLDADQQNPSPIKRSRQPGILG  184

Query  840   KSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltglite  1019
             +S +YK  + S   + ++   +SQ+  +      L    Q EN  DV LEE++L G   +
Sbjct  185   RSAKYKPLYPSTDAETSENGKTSQDMLETSIHSPLNHSSQAEN-KDVALEEVDLAGATAK  243

Query  1020  kegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDAR-TDYMTLG  1196
              +  +  IL +LLS++ +DL+ D  +S+LQE  ++KP  +  L +PEFP  R  DY +  
Sbjct  244   ADKELGEILHDLLSKNCEDLEGDGAVSLLQEHLKIKPIKMKKLSLPEFPSIRKVDYRSSR  303

Query  1197  ERIPKARKSVLGLPNSDK----RTSGKRQWEESPQSNLtsptppkspfssLALLRKQVLK  1364
               +PK    +  + N  K    +T  KR+       +L SPTPPKSPF+S++ L+K++L+
Sbjct  304   RTLPKPTNVLTDIDNLVKGIRSKTPAKRKQGAEGSIHLASPTPPKSPFASISALKKRILQ  363

Query  1365  SNPLRDPFSPLNID---------LNDINKNSDQVGLVKDFSKSGNLHGESNIKGMNVSDH  1517
             SNP  DPFS  +ID         + + NK S+ V   +  + S  L          V   
Sbjct  364   SNPSSDPFSADDIDRFLETNPSLVENGNKQSELVDTREQATISDKLKLIKQTDNFEVPTG  423

Query  1518  QADRSAETNAQSSNIDISHSGSHAQMGDCDGHTDAGHMVTRGLEQLNNEQSLEKNSGGET  1697
               + + E        + SH+   +  GD   H                         GE+
Sbjct  424   SPEVAIE--------EFSHAFERSMSGDSSKH-------------------------GES  450

Query  1698  IAAGQGDSHGSMERCNGWNHMDIRTADENSGMQNRDTEVQPSGHDITDKEKMHDTCIFIQ  1877
             I  G   SH  ME   G N+MDIR  D      + DT+   +G +  D +K+ DT    +
Sbjct  451   IVVGSSRSHLEMEDNIGSNNMDIRVMDGPLSRPDADTDTWENGGN--DGDKVEDT--LEE  506

Query  1878  GLSPAQVQVeaddetntsnetetdIQNNVSCRTDEHVEDMPSMSAFPEEQEHNGNDAHTS  2057
              L  A+ ++                  NVS                            T 
Sbjct  507   ALDSAEPEL------------------NVSV--------------------------STL  522

Query  2058  ENWSGNQNPSDQSNSAAVQNHSVDMQSALPDINPEQH--IMKQHP---LTKKQPRKNSCM  2222
             E  +G QN  DQ +S  V+ H  D  S   D  PE H  IM Q P      +Q + NS  
Sbjct  523   EKSNGTQNELDQLHSTEVEEHPTDGLSRNLDTGPETHNEIM-QEPSGASLNQQIKANSPQ  581

Query  2223  PGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGV  2399
                R+ K +  R SLA AGTL+++GVRRS RIK+RPLEFWKGERLLFGR++ES+  ++G+
Sbjct  582   QRKRKSKEVSKRQSLAGAGTLWQSGVRRSTRIKTRPLEFWKGERLLFGRIHESLPTVIGM  641

Query  2400  KYVSPSLGN----MKVKSYISDEYKEVVDLAARY  2489
             KY SP  G+    +KVKS++SD+YKE+V+LAA +
Sbjct  642   KYASPGKGDGKAPLKVKSFVSDKYKELVELAALH  675



>ref|XP_008228592.1| PREDICTED: uncharacterized protein LOC103327982 [Prunus mume]
Length=734

 Score =   299 bits (765),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 264/774 (34%), Positives = 402/774 (52%), Gaps = 93/774 (12%)
 Frame = +3

Query  306   DPPDPLRAFAGLPLLPQTIRVQSEDSIPSE-PNNLNSIHQLMKSMGLRNA-EKLLEESKA  479
             DP DPL+ + GL + P + ++  ++S P +  N+L SIH  +KS+ L+ +  KL +++K 
Sbjct  8     DPVDPLQGYTGLAVFPNSGKILPDNSKPYDIGNDLQSIHTQLKSVALQQSPTKLKDQAKN  67

Query  480   IVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNI  659
             IV   SEI  +  P+   +L   D V  ++ +E PR++R  LGRKRARFS+KP++SQP +
Sbjct  68    IVSGTSEIPKSVNPQ---ALKQKDAVVPEMAEENPRQQRRALGRKRARFSVKPNSSQPAM  124

Query  660   SLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILG  839
             SL   LD+  L+D EE + A E+ ENAK+E+ +QMG    D++  N     R R+PGILG
Sbjct  125   SLLPPLDIKNLKDTEELWTAYERHENAKKEIEKQMGGAVLDADQQNPSPIKRSRQPGILG  184

Query  840   KSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltglite  1019
             +S +YK  + S   + ++   +SQ+  +      L    Q EN  DV LEE++L G  T+
Sbjct  185   RSAKYKPLYPSTDAETSENGKTSQDMLETSIHSPLNHSSQAEN-KDVALEEVDLAGATTK  243

Query  1020  kegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPD-ARTDYMTLG  1196
              +  +  IL +LLS++ +DL+ D  +S+LQ+  ++KP  +  L +PEFP   + DY +  
Sbjct  244   ADKELGEILHDLLSKNCEDLEGDGAVSLLQDHLKIKPIKMKKLSLPEFPSIGKVDYRSSR  303

Query  1197  ERIPKARKSVLGLPNSDK----RTSGKRQWEESPQSNLtsptppkspfssLALLRKQVLK  1364
               +PK    +  + N  K    +T  KR+       +L SPTPPKSPF+S++ L+K++L+
Sbjct  304   RTLPKPTNVLTDIDNLVKGIRSKTPAKRKQGAEGSIHLASPTPPKSPFASISALKKRILQ  363

Query  1365  SNPLRDPFSPLNID---------LNDINKNSDQVGLVKDFSKSGNLHGESNIKGMNVSDH  1517
             SNP  DPFS  +ID         + + NK S+ V + +  + S  L          V   
Sbjct  364   SNPSSDPFSADDIDRFLETNPSLVENGNKQSELVDIREQATVSDELKLIKQTDNFEVPTG  423

Query  1518  QADRSAETNAQSSNIDISHSGSHAQMGDCDGHTDAGHMVTRGLEQLNNEQSLEKNSGGET  1697
               + + E        + SH+   +   D   H                         GE+
Sbjct  424   SPEVAIE--------EFSHAFERSMSEDSSKH-------------------------GES  450

Query  1698  IAAGQGDSHGSMERCNGWNHMDIRTADENSGMQNRDTEVQPSGHDITDKEKMHDTCIFIQ  1877
             I  G   SH  ME   G N+MD R  D      + DT+   +G +  D +K+ DT    +
Sbjct  451   IDVGSSRSHLEMEDNIGSNNMDNRVMDGTLSRPDADTDTWKNGAN--DGDKVEDT--LEE  506

Query  1878  GLSPAQVQVeaddetntsnetetdIQNNVSCRTDEHVEDMPS------MSAFPEE-----  2024
              L  A+ ++   + + ++ E     QN +       VE+ P+      +   PE      
Sbjct  507   ALDSAEPEL---NVSVSTLEKSNGTQNELDQLHSTEVEEHPTYGLSRNLDTGPETHNERI  563

Query  2025  QEHNGNDAHTSENWSGNQNP---------SDQSNSAAVQNHSVDMQSALPDINPEQH--I  2171
             QEH+G  A   +    N  P         S + + AAV     D +S   D   E H  I
Sbjct  564   QEHSG--ASLKKQIKANSRPRGKQKSKEVSKRQSRAAVDEDPADGRSRNLDSGSETHNEI  621

Query  2172  MKQHP---LTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFW  2342
             M Q P      +Q + NS     R+ K +  R SLA AGTL+++GVRRS RIK+RPLEFW
Sbjct  622   M-QEPSGASLNQQIKANSPQQRKRKSKEVSKRQSLAGAGTLWQSGVRRSTRIKTRPLEFW  680

Query  2343  KGERLLFGRVNESM-KLVGVKYVSPSLGN----MKVKSYISDEYKEVVDLAARY  2489
             KGERLLFGR++ES+  ++G+KY SP  G+    +KVKS++SDEYKE+V+LAA +
Sbjct  681   KGERLLFGRIHESLPTVIGMKYASPGKGDGKAPLKVKSFVSDEYKELVELAALH  734



>emb|CDO98077.1| unnamed protein product [Coffea canephora]
Length=649

 Score =   293 bits (749),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 203/463 (44%), Positives = 280/463 (60%), Gaps = 16/463 (3%)
 Frame = +3

Query  282   MTTEPLTM-DPPDPLRAFAGLPLLPQTI-RVQSEDSIPSEPNNLNSIHQLMKSMGLRNAE  455
             M TE L + +  DPL++  G  L P+TI R  ++ ++PS+P +L+S+H LMKS+ L + E
Sbjct  1     MATESLMVSESVDPLQSLFGPSLFPRTIVRAPTDPAMPSDPKDLDSVHHLMKSVALSSPE  60

Query  456   KLLEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMK  635
              LL+  KAIVD G E+LN+ F +F  S+ +D         E P+ERRPGLGR R RFS+K
Sbjct  61    MLLDAGKAIVDRGPELLNSEFEKFAKSIGIDKEALRPRGNEKPQERRPGLGRPRPRFSLK  120

Query  636   PDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTAR  815
             P+T++P+++L+ S D+D+LQDPEE+F A EK ENAK+E+ RQ G + DDS+  +  T  R
Sbjct  121   PNTNKPSVTLEPSWDIDRLQDPEEFFSAFEKAENAKREIQRQEGGIMDDSDKYDSSTRNR  180

Query  816   RRRPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKEN-SNDVelee  992
              RRPGILGKSV YKHR+SSV  +  D  +SSQ T   D L A  +    E    DV    
Sbjct  181   PRRPGILGKSVSYKHRYSSVLLESGDKPISSQGTGGLDLLGAPSNVADTETQETDV----  236

Query  993   leltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPD-  1169
                TG IT  E RVN ILDEL+SR ++DLD D  LS+LQE+F++KP DL   C+P F D 
Sbjct  237   AVSTGSITMTENRVNGILDELISRTSQDLDADEALSLLQERFKIKPIDLDKTCVPVFQDI  296

Query  1170  ARTDYMTLGERIPKARKSVLGLPNSDKRTSGK-----RQWEESPQSNLtsptppkspfss  1334
              RTD+M LGE++P  RK++  + N  K  SG+      +  E   S + SP PPKSPF+S
Sbjct  297   GRTDFMALGEKVPNVRKTLSNISNLVKPLSGETTVNCEKAAEISISPIASPPPPKSPFAS  356

Query  1335  LALLRKQVLKSNPLRDPFSPLNIDLND-INKNSDQVGLVKDFSKSGNLHGESNIKGMNVS  1511
             ++LL+K+   SN LRDPFSP ++DL +  N    Q  L    S S  L   S       +
Sbjct  357   ISLLKKRCTYSNSLRDPFSPFSVDLLERRNPAGSQTDLADKGSGSALLESSSECNTSRGA  416

Query  1512  DHQADRSAETN-AQSSNIDISHSGSHAQM-GDCDGHTDAGHMV  1634
             +   + S E N ++ +  + S  G+  Q+  D D +  AG  V
Sbjct  417   ETLLENSNERNTSRGAESNDSADGTDKQIEKDGDKYESAGRSV  459


 Score =   132 bits (331),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 113/170 (66%), Gaps = 7/170 (4%)
 Frame = +3

Query  1983  HVEDMPSMSAFPEEQEHNGNDAHTSENWSGNQNPSDQSNSAAVQNHSVDMQSALPDINPE  2162
              VE + S +A P   + N + +    N  G+Q  SDQ N+AA++++ V + S   +IN +
Sbjct  484   EVEGIRSEAAIPARPDANMDKSPVMINMHGSQPLSDQLNTAAIEDNIVVIPSTTAEINAK  543

Query  2163  QHIMKQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFW  2342
             ++   ++   K+Q R         E KAL  R S+ +AGT FE+GVRRSKRIK+RPLE+W
Sbjct  544   KN--SENLPAKEQGRTKRPWREIHELKALARRKSIQEAGTSFESGVRRSKRIKTRPLEYW  601

Query  2343  KGERLLFGRVNESMKLVGVKYVSPSLGN--MKVKSYISDEYKEVVDLAAR  2486
             KGER L+GRVNES+KL+G+KY+SP+ G+  +KVKSY+ +   E++++AAR
Sbjct  602   KGERFLYGRVNESVKLIGLKYISPAKGDGQLKVKSYVPN---EILEVAAR  648



>ref|XP_006385477.1| hypothetical protein POPTR_0003s05530g [Populus trichocarpa]
 gb|ERP63274.1| hypothetical protein POPTR_0003s05530g [Populus trichocarpa]
Length=744

 Score =   294 bits (752),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 258/786 (33%), Positives = 407/786 (52%), Gaps = 108/786 (14%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIP---SEPNNLNSIHQLMKSMGLRNAEKLLEESKAIV  485
             DPL+ ++GL L  +T+      S+P   ++P++L S H L+KS+ ++N +KL+E++++I+
Sbjct  6     DPLQGYSGLSLFRRTL-----GSLPKPTNDPDDLLSAHNLLKSLPVKNPDKLIEQARSIL  60

Query  486   DNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNISL  665
             D   E  +A+ P      D  + VA K + E PR RRPGLGRKRARFS+ P+ SQP ++L
Sbjct  61    DATPEPTDADLPNGVMPEDKSEVVAQK-DAESPRARRPGLGRKRARFSLFPNASQPTVNL  119

Query  666   QSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILGKS  845
             + +LD+D L+DPE++FLA E+LE+AK+E+ +Q G V+  SN +      R RRPG+ G+S
Sbjct  120   EPTLDIDSLKDPEQFFLAFERLEDAKKEMAKQTGRVSIGSNQSRASMAPRHRRPGMPGRS  179

Query  846   --VRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKEN-----------SNDVel  986
                +Y+H + +         MSSQETF +  L       Q+E            S ++  
Sbjct  180   RTAKYQHLYPT---------MSSQETFMEKILSPANPGSQQETFSPDVASQLRESTNLVP  230

Query  987   eeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFP  1166
             EE  L G + + E RV+ +LDELLSRD ++LD D  +++L++  Q+K  DL  L +PE  
Sbjct  231   EESGLAGSMAKAEKRVDKLLDELLSRDYEELDGDGAVTLLRDCLQVKALDLEKLSLPELL  290

Query  1167  DA-RTDYMTLGERIPKARKSVLGLPNSDKRTSG--KRQWEESPQSNLtsptppkspfssL  1337
             +  +T    LG  +PK R  +  + N  +RT    ++Q   +   +  SPTPPKSP +SL
Sbjct  291   NVQKTSLNALGGNLPKPRNVLSDIHNLPRRTITPMRQQIAGNSSCSFGSPTPPKSPLASL  350

Query  1338  ALLRKQVLKSNPLRDPFSPLNID---------LNDINKNSDQVGLVKDFSKSGNLHGESN  1490
             ALLRK++L+SNP  DPFS  ++D         L +IN +SD V +  D S          
Sbjct  351   ALLRKRILQSNPPTDPFSVFDVDQSPETNASSLKNINNSSDPVDIENDLSL---------  401

Query  1491  IKGMNVSDHQADRSAETNAQSSNIDISHSGSHAQMGDCDGHTDAGHMVTRGLEQLNNEQS  1670
             +K + +   + D +   N    ++ I  SG+       D  T  G   + G    ++ + 
Sbjct  402   LKSLII---EEDDTTAGNTSPVHVAIGDSGTQTDKSLNDNLTSPGSG-SDGCPSRSSAEV  457

Query  1671  LEKNSGGETIAAGQGDSHGSMERCNGWNHMDIRTADENSGMQNRDTEVQPSGHDITDKE-  1847
               ++ G + +   +  S            MDI+T   N+     +  V+   H   DK  
Sbjct  458   KNRDVGADNVIIDENSSQLG-------GDMDIQTKGPNA----VEDMVEDMQHKTVDKSL  506

Query  1848  --------KMHDTCIF-----IQGLSPAQVQVeaddetntsnetetdIQNNVSCRTDEHV  1988
                       +D C       ++  SP  V     D+  +    + DIQ N     ++ V
Sbjct  507   NDNLISLGPSNDVCCSKSSAEVESGSPG-VDNGVIDDNLSQIGGDADIQTNRPNELEDMV  565

Query  1989  EDMPSMSAFPEEQEHNGNDAHTSENWSGNQNPSDQSNSAAVQNHSVDMQSALPDINPEQ-  2165
             ED+   +      +    D    E  +  Q+  +Q + A V++H++D      D   EQ 
Sbjct  566   EDIQQKAV-----DSTQPDDTAMEFLNNAQDQFEQLSPAVVEDHAMDGCPETQDSGLEQT  620

Query  2166  ---------HIMKQHPLTK--KQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSK  2312
                        +++ P+    KQ +  S     R+  +L  R SLA +GT +E G+RRS 
Sbjct  621   KDNCPEHQDETVEEPPVVSLNKQAKAKSHTAKGRKNGSLSKRHSLAASGTSWETGLRRST  680

Query  2313  RIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSLGN------MKVKSYISDEYKEVV  2471
             RI+SRPLE+WKGER L+GR++ S+  ++G+KY SP  GN      +KVKSY+SDEYK++V
Sbjct  681   RIRSRPLEYWKGERFLYGRIHGSLATVIGIKYESP--GNDKGKRALKVKSYVSDEYKDLV  738

Query  2472  DLAARY  2489
             +LAA +
Sbjct  739   ELAALH  744



>emb|CBI36186.3| unnamed protein product [Vitis vinifera]
Length=899

 Score =   280 bits (715),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 197/414 (48%), Positives = 260/414 (63%), Gaps = 17/414 (4%)
 Frame = +3

Query  282   MTTEPLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKL  461
             M  +  + D  DPL  + GL L P+T R  S  S PS  +N++S+H  +KSM LR+  KL
Sbjct  1     MANDRRSSDLADPLLGYFGLSLFPRTFRDSSTVSKPSGHDNIDSLHSYLKSMALRSPTKL  60

Query  462   LEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPD  641
             LE++K+I+D GSE+LN NFP   AS D    ++ K+ KE P ERRP LGRKRARFS+KPD
Sbjct  61    LEQAKSILDGGSELLNPNFPSDVASEDNCGPISEKL-KENPPERRPALGRKRARFSLKPD  119

Query  642   TSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRR  821
             +SQP + L+ SLD+DKLQDPEEYFLA EKLENAK+EL RQ G V  D N  NL TTAR R
Sbjct  120   SSQPTMVLEPSLDIDKLQDPEEYFLAHEKLENAKKELQRQRGGVLMDLNQYNLSTTARHR  179

Query  822   RPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSN-DVeleele  998
             RPGILG+SV YKH +SS+  D+++  M S  T +Q  +       Q E  + +V L+E E
Sbjct  180   RPGILGRSVSYKHHYSSLVSDNDENLMPSPATVEQMIVSPSNYSSQVEMVDPNVALQERE  239

Query  999   ltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDA-R  1175
             LT  +T+ E +V+ ILDELLS + +DLD D  L+ LQE+ Q+KP DL  LC+PE  D  R
Sbjct  240   LTVSVTQAENKVDEILDELLSGNCEDLDGDGALTFLQERLQIKPIDLDKLCLPELHDIQR  299

Query  1176  TDYMTLGERIPKARKSVLGLPN-----SDKRTSGKRQWEESPQSNLtsptppkspfssLA  1340
              D+ + G    + R S+  + +     S K    K Q  ES    L SPTPPKSPF+S+ 
Sbjct  300   NDFKSSGGNWLRHRDSLSDIKSMLEGLSSKTPIKKGQVVESFVHTLASPTPPKSPFASIC  359

Query  1341  LLRKQVLKSNPLRDPFSPLNIDLN---------DINKNSDQVGLVKDFSKSGNL  1475
             LL++ +L+SN   DPFS L ++L+           +K SDQ+   K+ S S  L
Sbjct  360   LLKRHILQSNLTSDPFSVLKVNLSPARNSSTVKSSDKQSDQIENGKELSFSAKL  413


 Score =   123 bits (308),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 97/161 (60%), Gaps = 21/161 (13%)
 Frame = +3

Query  2052  TSENWSGNQNPSDQSNSAAVQNHSVDMQSALPD----------INPEQHIMKQHPLTKKQ  2201
             T E  + + +  DQ   A V+ H +D  S   D          + P    + +    K  
Sbjct  745   TLEKLNSSDSQGDQPTPAVVEAHDMDGPSKTGDDDLEQCTEKILEPSGESLNKRSKAKTP  804

Query  2202  PRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNES  2381
             PR+       R+RK +  R SLA AGTL+ +GVRRS RIK RPLE+WKGER L+GRV++S
Sbjct  805   PRRE------RKRKEISGRQSLAGAGTLWSSGVRRSTRIKMRPLEYWKGERFLYGRVHKS  858

Query  2382  M-KLVGVKYVSPSLGN----MKVKSYISDEYKEVVDLAARY  2489
             +  ++GVKYVSP+ G+    +KVKSY+SDEYKE+VDLAA +
Sbjct  859   LTSVIGVKYVSPAKGDGKPTIKVKSYVSDEYKELVDLAALH  899



>ref|XP_010654918.1| PREDICTED: uncharacterized protein LOC100244530 [Vitis vinifera]
Length=926

 Score =   276 bits (705),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 199/429 (46%), Positives = 261/429 (61%), Gaps = 32/429 (7%)
 Frame = +3

Query  282   MTTEPLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKL  461
             M  +  + D  DPL  + GL L P+T R  S  S PS  +N++S+H  +KSM LR+  KL
Sbjct  1     MANDRRSSDLADPLLGYFGLSLFPRTFRDSSTVSKPSGHDNIDSLHSYLKSMALRSPTKL  60

Query  462   LEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPD  641
             LE++K+I+D GSE+LN NFP   AS D    ++ K+ KE P ERRP LGRKRARFS+KPD
Sbjct  61    LEQAKSILDGGSELLNPNFPSDVASEDNCGPISEKL-KENPPERRPALGRKRARFSLKPD  119

Query  642   TSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRR  821
             +SQP + L+ SLD+DKLQDPEEYFLA EKLENAK+EL RQ G V  D N  NL TTAR R
Sbjct  120   SSQPTMVLEPSLDIDKLQDPEEYFLAHEKLENAKKELQRQRGGVLMDLNQYNLSTTARHR  179

Query  822   RPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQ---------------DDLCALKS-D  953
             RPGILG+SV YKH +SS+  D+++  M S  T +Q               D   AL+  +
Sbjct  180   RPGILGRSVSYKHHYSSLVSDNDENLMPSPATVEQMIVSPSNYSSQVEMVDPNVALQERE  239

Query  954   LQKENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPP  1133
             L +     VE  E ELT  +T+ E +V+ ILDELLS + +DLD D  L+ LQE+ Q+KP 
Sbjct  240   LTETVDPSVESLERELTVSVTQAENKVDEILDELLSGNCEDLDGDGALTFLQERLQIKPI  299

Query  1134  DLSALCMPEFPDA-RTDYMTLGERIPKARKSVLGLPN-----SDKRTSGKRQWEESPQSN  1295
             DL  LC+PE  D  R D+ + G    + R S+  + +     S K    K Q  ES    
Sbjct  300   DLDKLCLPELHDIQRNDFKSSGGNWLRHRDSLSDIKSMLEGLSSKTPIKKGQVVESFVHT  359

Query  1296  LtsptppkspfssLALLRKQVLKSNPLRDPFSPLNIDLN---------DINKNSDQVGLV  1448
             L SPTPPKSPF+S+ LL++ +L+SN   DPFS L ++L+           +K SDQ+   
Sbjct  360   LASPTPPKSPFASICLLKRHILQSNLTSDPFSVLKVNLSPARNSSTVKSSDKQSDQIENG  419

Query  1449  KDFSKSGNL  1475
             K+ S S  L
Sbjct  420   KELSFSAKL  428


 Score =   123 bits (308),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 97/161 (60%), Gaps = 21/161 (13%)
 Frame = +3

Query  2052  TSENWSGNQNPSDQSNSAAVQNHSVDMQSALPD----------INPEQHIMKQHPLTKKQ  2201
             T E  + + +  DQ   A V+ H +D  S   D          + P    + +    K  
Sbjct  772   TLEKLNSSDSQGDQPTPAVVEAHDMDGPSKTGDDDLEQCTEKILEPSGESLNKRSKAKTP  831

Query  2202  PRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNES  2381
             PR+       R+RK +  R SLA AGTL+ +GVRRS RIK RPLE+WKGER L+GRV++S
Sbjct  832   PRRE------RKRKEISGRQSLAGAGTLWSSGVRRSTRIKMRPLEYWKGERFLYGRVHKS  885

Query  2382  M-KLVGVKYVSPSLGN----MKVKSYISDEYKEVVDLAARY  2489
             +  ++GVKYVSP+ G+    +KVKSY+SDEYKE+VDLAA +
Sbjct  886   LTSVIGVKYVSPAKGDGKPTIKVKSYVSDEYKELVDLAALH  926



>gb|EYU21562.1| hypothetical protein MIMGU_mgv1a004387mg [Erythranthe guttata]
Length=530

 Score =   260 bits (664),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 168/388 (43%), Positives = 248/388 (64%), Gaps = 13/388 (3%)
 Frame = +3

Query  282   MTTEPLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKL  461
             M ++    D  DPL    G  L P+TIR  ++  +P++  +L+SIH  MKS+ LR+ EKL
Sbjct  1     MASKAGVSDSVDPLGGINGPSLFPRTIRASADVPVPADSKDLDSIHNFMKSLELRSPEKL  60

Query  462   LEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGR--KRARFSMK  635
             + E+K IVD G +++ +NF  F  ++ + D +AAK  K+ P+ERRPGL R  KRA FS+K
Sbjct  61    MCEAKKIVDGGIQLMESNFASFAENVGIGDAIAAK-GKDRPQERRPGLARVRKRAPFSLK  119

Query  636   PDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTAR  815
              + SQP++ L+ +L++D LQDP+EYF A E+++NAK+E+ +Q+G   D+ ++      AR
Sbjct  120   TNISQPSVILEPTLNIDHLQDPDEYFDAYERMQNAKKEIQKQLGGSTDNLDLYKPSNNAR  179

Query  816   RRRPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQK-----ENSNDV  980
              RRPGILGKS  YKHRFSS P +++DT M SQET  +D   + K + Q+     + S D 
Sbjct  180   PRRPGILGKSYNYKHRFSSTPYENDDTSMPSQETVDEDIPNSPKDESQEKLVHPDPSPDA  239

Query  981   eleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPE  1160
               EE+E      + +  VN IL+ELLS + +DL+    L+ILQ++ ++KP D   L M E
Sbjct  240   GSEEVEAAESTKKTDNEVNNILEELLSCNYEDLEGHGALNILQDRLKIKPLDRENLYMTE  299

Query  1161  FPDA-RTDYMTLGERIPKARKSVLGLPNSDKRTSGKRQWEESPQSN----Ltsptppksp  1325
               D  RT    + E + K RK+   + +  K  S KR  E  P +N    ++SPTPP+SP
Sbjct  300   LADVGRTSISIVSESLQKPRKNSSVIDSVLKSFSRKRSIEHEPVANPNNHVSSPTPPRSP  359

Query  1326  fssLALLRKQVLKSNPLRDPFSPLNIDL  1409
             F+S+A L+K++L+SNPLRDPFSPL++DL
Sbjct  360   FASMAFLKKRILQSNPLRDPFSPLDVDL  387



>ref|XP_002303277.2| hypothetical protein POPTR_0003s05530g [Populus trichocarpa]
 gb|EEE78256.2| hypothetical protein POPTR_0003s05530g [Populus trichocarpa]
Length=718

 Score =   259 bits (662),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 237/743 (32%), Positives = 379/743 (51%), Gaps = 99/743 (13%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIP---SEPNNLNSIHQLMKSMGLRNAEKLLEESKAIV  485
             DPL+ ++GL L  +T+      S+P   ++P++L S H L+KS+ ++N +KL+E++++I+
Sbjct  6     DPLQGYSGLSLFRRTL-----GSLPKPTNDPDDLLSAHNLLKSLPVKNPDKLIEQARSIL  60

Query  486   DNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNISL  665
             D   E  +A+ P      D  + VA K + E PR RRPGLGRKRARFS+ P+ SQP ++L
Sbjct  61    DATPEPTDADLPNGVMPEDKSEVVAQK-DAESPRARRPGLGRKRARFSLFPNASQPTVNL  119

Query  666   QSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILGKS  845
             + +LD+D L+DPE++FLA E+LE+AK+E+ +Q G V+  SN +      R RRPG+ G+S
Sbjct  120   EPTLDIDSLKDPEQFFLAFERLEDAKKEMAKQTGRVSIGSNQSRASMAPRHRRPGMPGRS  179

Query  846   --VRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKEN-----------SNDVel  986
                +Y+H + +         MSSQETF +  L       Q+E            S ++  
Sbjct  180   RTAKYQHLYPT---------MSSQETFMEKILSPANPGSQQETFSPDVASQLRESTNLVP  230

Query  987   eeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFP  1166
             EE  L G + + E RV+ +LDELLSRD ++LD D  +++L++  Q+K  DL  L +PE  
Sbjct  231   EESGLAGSMAKAEKRVDKLLDELLSRDYEELDGDGAVTLLRDCLQVKALDLEKLSLPELL  290

Query  1167  DA-RTDYMTLGERIPKARKSVLGLPNSDKRTSG--KRQWEESPQSNLtsptppkspfssL  1337
             +  +T    LG  +PK R  +  + N  +RT    ++Q   +   +  SPTPPKSP +SL
Sbjct  291   NVQKTSLNALGGNLPKPRNVLSDIHNLPRRTITPMRQQIAGNSSCSFGSPTPPKSPLASL  350

Query  1338  ALLRKQVLKSNPLRDPFSPLNID---------LNDINKNSDQVGLVKDFSKSGNLHGESN  1490
             ALLRK++L+SNP  DPFS  ++D         L +IN +SD V +  D S          
Sbjct  351   ALLRKRILQSNPPTDPFSVFDVDQSPETNASSLKNINNSSDPVDIENDLSL---------  401

Query  1491  IKGMNVSDHQADRSAETNAQSSNIDISHSGSHAQMGDCDGHTDAGHMVTRGLEQLNNEQS  1670
             +K + +   + D +   N    ++ I  SG+       D  T  G   + G    ++ + 
Sbjct  402   LKSLII---EEDDTTAGNTSPVHVAIGDSGTQTDKSLNDNLTSPGSG-SDGCPSRSSAEV  457

Query  1671  LEKNSGGETIAAGQGDSHGSMERCNGWNHMDIRTADENSGMQNRDTEVQPSGHDITDKE-  1847
               ++ G + +   +  S            MDI+T   N+ +++   ++Q   H   DK  
Sbjct  458   KNRDVGADNVIIDENSSQLG-------GDMDIQTKGPNA-VEDMVEDMQ---HKTVDKSL  506

Query  1848  --------KMHDTCIF-----IQGLSPAQVQVeaddetntsnetetdIQNNVSCRTDEHV  1988
                       +D C       ++  SP  V     D+  +    + DIQ N     ++ V
Sbjct  507   NDNLISLGPSNDVCCSKSSAEVESGSPG-VDNGVIDDNLSQIGGDADIQTNRPNELEDMV  565

Query  1989  EDMPSMSAFPEEQEHNGNDAHTSENWSGNQNPSDQSNSAAVQNHSVDMQSALPDINPEQ-  2165
             ED+   +      +    D    E  +  Q+  +Q + A V++H++D      D   EQ 
Sbjct  566   EDIQQKAV-----DSTQPDDTAMEFLNNAQDQFEQLSPAVVEDHAMDGCPETQDSGLEQT  620

Query  2166  ---------HIMKQHPLTK--KQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSK  2312
                        +++ P+    KQ +  S     R+  +L  R SLA +GT +E G+RRS 
Sbjct  621   KDNCPEHQDETVEEPPVVSLNKQAKAKSHTAKGRKNGSLSKRHSLAASGTSWETGLRRST  680

Query  2313  RIKSRPLEFWKGERLLFGRVNES  2381
             RI+SRPLE+WKGER L+GR++ S
Sbjct  681   RIRSRPLEYWKGERFLYGRIHGS  703



>ref|XP_011072288.1| PREDICTED: uncharacterized protein LOC105157576 isoform X2 [Sesamum 
indicum]
Length=612

 Score =   253 bits (645),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 198/533 (37%), Positives = 298/533 (56%), Gaps = 43/533 (8%)
 Frame = +3

Query  282   MTTEPLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKL  461
             M +E    D  DPLR  +G  L P+TIR   +  +P +P +L+SIH  MKS+ LR+ EKL
Sbjct  1     MASEASLSDSVDPLRGISGPLLFPRTIRPSVDVPVPVDPKDLDSIHNFMKSLELRSPEKL  60

Query  462   LEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGL--GRKRARFSMK  635
             + E+K IVD G+E L +    F  ++ + D  AAK  K+ P+ERRPGL   RKRA FS++
Sbjct  61    MNEAKRIVDGGAEFLESKLGSFAENVGITDANAAK-GKDRPQERRPGLRLDRKRATFSLR  119

Query  636   PDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTAR  815
                SQP++SL+ +L++D+L DP+E+F A E++ENAK+E+ +Q+G   D+ N+     TAR
Sbjct  120   TSVSQPSVSLEPTLNIDQLHDPDEFFDAYERMENAKKEIQKQLGGSIDNVNLYEPSNTAR  179

Query  816   RRRPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQK-----ENSNDV  980
             RRRPGILGKS  YKHR+SS  P +ND  M+SQ+   QD   A + +LQ+     + + D 
Sbjct  180   RRRPGILGKSYNYKHRYSSE-PSENDMLMASQKAVDQDIPSAPEDELQEKLVHPDPNPDA  238

Query  981   eleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPE  1160
             +L E+E      + +  V+ IL+ELLS + +DL+ D  L+ILQE+ ++KP DL  L + E
Sbjct  239   DLAEVEPAVSTKKTDNEVSDILEELLSCNNEDLEGDGALNILQEKLKIKPLDLGNLYITE  298

Query  1161  FP-DARTDYMTLGERIPKARKSVLGLPNSDKRTSGKRQWEESPQSNLtsptppkspfssL  1337
              P D RT   T+   + K  +S L + +  K  + K    + P   ++SPTPP+SPF+SL
Sbjct  299   IPDDGRTSISTVTASLQKPCRSSLVIDSVLKNLTMKSPVAD-PVKPVSSPTPPRSPFASL  357

Query  1338  ALLRKQVLKSNPLRDPFSPLNIDLNDI---------NKNSDQVGLVKDFSKSGNLHGESN  1490
             +LL+K++L+ NPLRDPFSP ++DL+           +K  DQV + K    S  L  ES 
Sbjct  358   SLLQKRILQPNPLRDPFSPTHVDLSACQNAFPGPSKDKLLDQVDVPKILGMSNQL--ESC  415

Query  1491  IKGMNVSDHQADRSAETNAQSSNIDISHSGSHAQMGDCDGHTDAGHMVTRGLEQLNNEQS  1670
             I        + D +  T        +S++ +   M D D   +       G++  N +  
Sbjct  416   I--------EVDNAEPT--------VSNTDAEKVMEDADSLPEQFAYENAGVQSSNADSR  459

Query  1671  LEKNSGGETIAAGQGDSHGSMERCNGWNHMDIRTADENSGMQNRDTEVQPSGH  1829
               + SG         D++GS       + ++    D+ S  +  D E QP  H
Sbjct  460   THEESGNNIEETMNNDANGSKP-----SELEDEARDDTSSRRPNDPEQQPEVH  507


 Score =   120 bits (300),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 80/120 (67%), Gaps = 12/120 (10%)
 Frame = +3

Query  2145  PDINPEQHIMKQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKS  2324
             P+  PE H         K PR        R RKA   R SLA++GT FE GVRRSKRIKS
Sbjct  500   PEQQPEVH-------QAKLPRGKRVAGEKRIRKAHPMRKSLAESGTSFEAGVRRSKRIKS  552

Query  2325  RPLEFWKGERLLFGRVNESMKLVGVKYVSPS--LGNMKVKSYI---SDEYKEVVDLAARY  2489
             RPLE+WKGER L+GRV+ S+KL+GVKY+SP     N+KVK YI   S EY+E+++LAAR+
Sbjct  553   RPLEYWKGERFLYGRVDNSLKLIGVKYLSPGKDTDNLKVKPYIASQSSEYQELLELAARH  612



>ref|XP_011072287.1| PREDICTED: uncharacterized protein LOC105157576 isoform X1 [Sesamum 
indicum]
Length=614

 Score =   247 bits (631),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 198/535 (37%), Positives = 298/535 (56%), Gaps = 45/535 (8%)
 Frame = +3

Query  282   MTTEPLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKL  461
             M +E    D  DPLR  +G  L P+TIR   +  +P +P +L+SIH  MKS+ LR+ EKL
Sbjct  1     MASEASLSDSVDPLRGISGPLLFPRTIRPSVDVPVPVDPKDLDSIHNFMKSLELRSPEKL  60

Query  462   LEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGL--GRKRARFSMK  635
             + E+K IVD G+E L +    F  ++ + D  AAK  K+ P+ERRPGL   RKRA FS++
Sbjct  61    MNEAKRIVDGGAEFLESKLGSFAENVGITDANAAK-GKDRPQERRPGLRLDRKRATFSLR  119

Query  636   PDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTAR  815
                SQP++SL+ +L++D+L DP+E+F A E++ENAK+E+ +Q+G   D+ N+     TAR
Sbjct  120   TSVSQPSVSLEPTLNIDQLHDPDEFFDAYERMENAKKEIQKQLGGSIDNVNLYEPSNTAR  179

Query  816   RRRPGILG--KSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQK-----ENSN  974
             RRRPGILG  KS  YKHR+SS  P +ND  M+SQ+   QD   A + +LQ+     + + 
Sbjct  180   RRRPGILGYRKSYNYKHRYSSE-PSENDMLMASQKAVDQDIPSAPEDELQEKLVHPDPNP  238

Query  975   DVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCM  1154
             D +L E+E      + +  V+ IL+ELLS + +DL+ D  L+ILQE+ ++KP DL  L +
Sbjct  239   DADLAEVEPAVSTKKTDNEVSDILEELLSCNNEDLEGDGALNILQEKLKIKPLDLGNLYI  298

Query  1155  PEFP-DARTDYMTLGERIPKARKSVLGLPNSDKRTSGKRQWEESPQSNLtsptppkspfs  1331
              E P D RT   T+   + K  +S L + +  K  + K    + P   ++SPTPP+SPF+
Sbjct  299   TEIPDDGRTSISTVTASLQKPCRSSLVIDSVLKNLTMKSPVAD-PVKPVSSPTPPRSPFA  357

Query  1332  sLALLRKQVLKSNPLRDPFSPLNIDLNDI---------NKNSDQVGLVKDFSKSGNLHGE  1484
             SL+LL+K++L+ NPLRDPFSP ++DL+           +K  DQV + K    S  L  E
Sbjct  358   SLSLLQKRILQPNPLRDPFSPTHVDLSACQNAFPGPSKDKLLDQVDVPKILGMSNQL--E  415

Query  1485  SNIKGMNVSDHQADRSAETNAQSSNIDISHSGSHAQMGDCDGHTDAGHMVTRGLEQLNNE  1664
             S I        + D +  T        +S++ +   M D D   +       G++  N +
Sbjct  416   SCI--------EVDNAEPT--------VSNTDAEKVMEDADSLPEQFAYENAGVQSSNAD  459

Query  1665  QSLEKNSGGETIAAGQGDSHGSMERCNGWNHMDIRTADENSGMQNRDTEVQPSGH  1829
                 + SG         D++GS       + ++    D+ S  +  D E QP  H
Sbjct  460   SRTHEESGNNIEETMNNDANGSKP-----SELEDEARDDTSSRRPNDPEQQPEVH  509


 Score =   119 bits (299),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 80/120 (67%), Gaps = 12/120 (10%)
 Frame = +3

Query  2145  PDINPEQHIMKQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKS  2324
             P+  PE H         K PR        R RKA   R SLA++GT FE GVRRSKRIKS
Sbjct  502   PEQQPEVH-------QAKLPRGKRVAGEKRIRKAHPMRKSLAESGTSFEAGVRRSKRIKS  554

Query  2325  RPLEFWKGERLLFGRVNESMKLVGVKYVSPS--LGNMKVKSYI---SDEYKEVVDLAARY  2489
             RPLE+WKGER L+GRV+ S+KL+GVKY+SP     N+KVK YI   S EY+E+++LAAR+
Sbjct  555   RPLEYWKGERFLYGRVDNSLKLIGVKYLSPGKDTDNLKVKPYIASQSSEYQELLELAARH  614



>ref|XP_010249870.1| PREDICTED: uncharacterized protein LOC104592284 isoform X2 [Nelumbo 
nucifera]
Length=701

 Score =   231 bits (590),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 158/395 (40%), Positives = 231/395 (58%), Gaps = 24/395 (6%)
 Frame = +3

Query  282   MTTEPLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKL  461
             M ++  + D  DPL   + + L P+T +  S  ++ SE  ++ +IH  +KSM L+N +KL
Sbjct  1     MASKLQSADLVDPLVGLSTISLFPRTFK-DSMKAVESEQQDMENIHNYLKSMTLKNPKKL  59

Query  462   LEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPD  641
             LE++K I+ N SE L++  P   +S + +D  AA   K  P+ERRP LGRKRARFS+KP+
Sbjct  60    LEQAKTILSNSSEPLDSELPCHISS-EHEDGAAAAKGKGRPQERRPALGRKRARFSLKPN  118

Query  642   TSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRR  821
              SQP + L SS+D+D+L+DPEEYFLA EK+ENAK+E+ +Q G V  + N  NL T  R R
Sbjct  119   ASQPTLDLDSSIDIDQLEDPEEYFLAHEKIENAKKEIQKQRGDVLINPNQQNLSTNVRCR  178

Query  822   RPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDL--------------Q  959
             RPGILGK+V YKHR+SS+  D+ +  +SSQ+ F+ D+    +SD               +
Sbjct  179   RPGILGKTVNYKHRYSSISVDNEEISVSSQKEFEMDNPS--QSDYSPHEEKKNQDGTSEE  236

Query  960   KENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDL  1139
             KE   D   + +   G +   E +VN +LDELLS +  DLD D  +S+L+E+ Q+K  DL
Sbjct  237   KERVGDEVEDVIPEEGSVALAENKVNNLLDELLSTNCNDLDADGTVSLLRERLQIKSIDL  296

Query  1140  SALCMPEFPDART-DYMTLGERIPKARKSVLGLPNSDKRTSGK-----RQWEESPQSNLt  1301
               L  P     R+ D     E   + RK++  + N  +RTS +     +Q   SP     
Sbjct  297   DKLSFPSLDSVRSNDVKAADEWSLRPRKALSDIHNIIRRTSTETSTEHKQMSGSPVCPKV  356

Query  1302  sptppkspfssLALLRKQVLKSNPLRDPFSPLNID  1406
             S T  +SP +SL LL++++   +P  DPFS   ID
Sbjct  357   STTLQRSPLTSLFLLKRRMPDMDPPNDPFSSDGID  391


 Score =   114 bits (284),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 76/103 (74%), Gaps = 6/103 (6%)
 Frame = +3

Query  2199  QPRKNSCMPGN-RERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVN  2375
             Q  K    PGN R+RKAL  R SLA AG+ +E+GVRRS RIK RPLE+W GER L+GR++
Sbjct  599   QQSKAQAPPGNTRKRKALSHRNSLAGAGSSWESGVRRSHRIKFRPLEYWNGERFLYGRIH  658

Query  2376  ESM-KLVGVKYVSPSLGN----MKVKSYISDEYKEVVDLAARY  2489
              S+  ++G+KY SP+ G+     KVKSY+SDEYKE+V+LAA +
Sbjct  659   GSLATVIGLKYASPAKGDGKPTFKVKSYVSDEYKELVELAALH  701



>ref|XP_010249869.1| PREDICTED: uncharacterized protein LOC104592284 isoform X1 [Nelumbo 
nucifera]
Length=711

 Score =   231 bits (590),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 158/395 (40%), Positives = 231/395 (58%), Gaps = 24/395 (6%)
 Frame = +3

Query  282   MTTEPLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKL  461
             M ++  + D  DPL   + + L P+T +  S  ++ SE  ++ +IH  +KSM L+N +KL
Sbjct  1     MASKLQSADLVDPLVGLSTISLFPRTFK-DSMKAVESEQQDMENIHNYLKSMTLKNPKKL  59

Query  462   LEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPD  641
             LE++K I+ N SE L++  P   +S + +D  AA   K  P+ERRP LGRKRARFS+KP+
Sbjct  60    LEQAKTILSNSSEPLDSELPCHISS-EHEDGAAAAKGKGRPQERRPALGRKRARFSLKPN  118

Query  642   TSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRR  821
              SQP + L SS+D+D+L+DPEEYFLA EK+ENAK+E+ +Q G V  + N  NL T  R R
Sbjct  119   ASQPTLDLDSSIDIDQLEDPEEYFLAHEKIENAKKEIQKQRGDVLINPNQQNLSTNVRCR  178

Query  822   RPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDL--------------Q  959
             RPGILGK+V YKHR+SS+  D+ +  +SSQ+ F+ D+    +SD               +
Sbjct  179   RPGILGKTVNYKHRYSSISVDNEEISVSSQKEFEMDNPS--QSDYSPHEEKKNQDGTSEE  236

Query  960   KENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDL  1139
             KE   D   + +   G +   E +VN +LDELLS +  DLD D  +S+L+E+ Q+K  DL
Sbjct  237   KERVGDEVEDVIPEEGSVALAENKVNNLLDELLSTNCNDLDADGTVSLLRERLQIKSIDL  296

Query  1140  SALCMPEFPDART-DYMTLGERIPKARKSVLGLPNSDKRTSGK-----RQWEESPQSNLt  1301
               L  P     R+ D     E   + RK++  + N  +RTS +     +Q   SP     
Sbjct  297   DKLSFPSLDSVRSNDVKAADEWSLRPRKALSDIHNIIRRTSTETSTEHKQMSGSPVCPKV  356

Query  1302  sptppkspfssLALLRKQVLKSNPLRDPFSPLNID  1406
             S T  +SP +SL LL++++   +P  DPFS   ID
Sbjct  357   STTLQRSPLTSLFLLKRRMPDMDPPNDPFSSDGID  391


 Score =   114 bits (284),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 76/103 (74%), Gaps = 6/103 (6%)
 Frame = +3

Query  2199  QPRKNSCMPGN-RERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVN  2375
             Q  K    PGN R+RKAL  R SLA AG+ +E+GVRRS RIK RPLE+W GER L+GR++
Sbjct  609   QQSKAQAPPGNTRKRKALSHRNSLAGAGSSWESGVRRSHRIKFRPLEYWNGERFLYGRIH  668

Query  2376  ESM-KLVGVKYVSPSLGN----MKVKSYISDEYKEVVDLAARY  2489
              S+  ++G+KY SP+ G+     KVKSY+SDEYKE+V+LAA +
Sbjct  669   GSLATVIGLKYASPAKGDGKPTFKVKSYVSDEYKELVELAALH  711



>gb|KDO58182.1| hypothetical protein CISIN_1g043062mg [Citrus sinensis]
Length=868

 Score =   225 bits (573),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 176/440 (40%), Positives = 254/440 (58%), Gaps = 41/440 (9%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIVDNG  494
             DPL  F+GL L P+T+        P +PN+L S   L+KS+ L++  +LLE+ +AIV + 
Sbjct  10    DPLEGFSGLMLFPRTLATVGIAPRPLDPNDLQSASNLLKSVPLQSPNELLEQGRAIVHSS  69

Query  495   SEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNISLQSS  674
             S I     P F    D ++  AAKV  + P+ERRPGLGRKRARFS+KP +SQP + L+ S
Sbjct  70    SGISRCEIPSFVTLKDQNNVAAAKV-TDNPQERRPGLGRKRARFSLKPKSSQPTVKLEPS  128

Query  675   LDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTA-RRRRPGILG-KSV  848
              D+DKL+DPEE+F+A EK ENAK+E+ +Q G V D S +N  P+ A R RR GILG +SV
Sbjct  129   FDIDKLKDPEEFFMAYEKFENAKREIEKQTGGVTDWSKLN--PSMAPRPRRQGILGRRSV  186

Query  849   RYKHRFS----------SVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSN--------  974
              YKHR+S          +V  +     ++SQ TF+++ L     ++Q+E ++        
Sbjct  187   TYKHRYSNDISSQEIFENVKHERTKAIVASQGTFEENILSDSNYNVQEETAHASVGSQEM  246

Query  975   ---DVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSA  1145
                D  L+E EL G  T+KE RV+ +LDEL++ + ++LD+D  +++LQEQ Q+KP  L  
Sbjct  247   ELGDAALQESELVGSETKKEKRVSELLDELVTGEDEELDEDGAVALLQEQLQIKPIVLGK  306

Query  1146  LCMPEFPDA-RTDYMTLGERIPKARKSVLGLPNSDK----RTSGKRQWEESPQSNLtspt  1310
             LC+P+   A R D    G  +PK R  +  + N  K    RT  KR+  ES    L+SPT
Sbjct  307   LCLPDLHVARRIDLKASGADVPKHRNPLSDIQNLVKGMSSRTPKKRKSAESSVHCLSSPT  366

Query  1311  ppkspfssLALLRKQVLKSNPLRDPFSPLNID---------LNDINKNSDQVGLVKDFSK  1463
             PP+SP  S+  L+K +L+SN   D FS  +ID           +  K  D+V + K+ S 
Sbjct  367   PPRSPLGSIIALKKHILQSNLSLDAFSAHDIDQSPARNASPFANPGKQIDEVNMEKELSI  426

Query  1464  SGNLHGESNIKGMNVSDHQA  1523
             S  L     I+G  ++D  A
Sbjct  427   SPKLKSPM-IEGNGIADVAA  445


 Score =   112 bits (279),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 96/145 (66%), Gaps = 13/145 (9%)
 Frame = +3

Query  2088  DQSNSAAVQNHSVDMQSALPDINPEQHIMKQHPLTKKQPRKNSCMPGNR----ERKALKF  2255
             DQ++   V + ++D+ +   D  P+Q+  +    T++   K S +  +     +R+    
Sbjct  726   DQTSRDVVDDCTIDVPAKTADAGPQQYNEEVERSTREPSDKRSKIISHARIKGKREVATR  785

Query  2256  RPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSLGN--  2426
             R SLA +GT +E+GVRRS RI+SRPLE+WKGER L+GRV+ES+  ++G+KY SP  GN  
Sbjct  786   RQSLAASGTSWESGVRRSTRIRSRPLEYWKGERFLYGRVHESLTTVIGIKYESP--GNAD  843

Query  2427  ----MKVKSYISDEYKEVVDLAARY  2489
                 +KVKS++SDEYK++V+LAAR+
Sbjct  844   GKPGIKVKSFVSDEYKDLVELAARF  868



>ref|XP_006465448.1| PREDICTED: uncharacterized protein LOC102609595 isoform X2 [Citrus 
sinensis]
Length=868

 Score =   225 bits (573),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 175/440 (40%), Positives = 255/440 (58%), Gaps = 41/440 (9%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIVDNG  494
             DPL  F+GL L P+T+        P +PN+L S   L+KS+ L++  +LLE+ +AIV + 
Sbjct  10    DPLEGFSGLMLFPRTLATVGIAPRPLDPNDLQSASNLLKSVPLQSPNELLEQGRAIVHSS  69

Query  495   SEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNISLQSS  674
             S I     P F    D ++  AAKV  + P+ERRPGLGRKRARFS+KP +SQP + L+ S
Sbjct  70    SGISRCEIPSFVTLKDQNNVAAAKV-TDNPQERRPGLGRKRARFSLKPKSSQPTVKLEPS  128

Query  675   LDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTA-RRRRPGILG-KSV  848
              D+DKL+DPEE+F+A EK ENAK+E+ +Q G + D S +N  P+ A R RR GILG +SV
Sbjct  129   FDIDKLKDPEEFFMAYEKFENAKREIEKQTGGITDWSKLN--PSMAPRPRRQGILGRRSV  186

Query  849   RYKHRFS----------SVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSN--------  974
              YKHR+S          +V  +     ++SQ TF+++ L     ++Q+E ++        
Sbjct  187   TYKHRYSNDISSQEIFENVKHERTKAIVASQGTFEENILSDSNYNVQEETAHASVGSQEM  246

Query  975   ---DVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSA  1145
                D  L+E EL G +T+KE RV+ +LDEL++ + ++LD+D  +++LQEQ Q+KP  L  
Sbjct  247   ELGDAALQESELVGSVTKKEKRVSELLDELVTGEDEELDEDGAVALLQEQLQIKPIVLGK  306

Query  1146  LCMPEFPDA-RTDYMTLGERIPKARKSVLGLPNSDK----RTSGKRQWEESPQSNLtspt  1310
             LC+P+   A R D    G  +PK R  +  + N  K    RT  KR+  ES    L+SPT
Sbjct  307   LCLPDLHVARRIDLKASGADVPKHRNPLSDIQNLVKGMSSRTPKKRKSAESSVHCLSSPT  366

Query  1311  ppkspfssLALLRKQVLKSNPLRDPFSPLNID---------LNDINKNSDQVGLVKDFSK  1463
             PP+SP  S+  L+K +L+SN   D FS  +ID           +  K  D+V + K+ S 
Sbjct  367   PPRSPLGSIIALKKHILQSNLSLDAFSAHDIDQSPARNASPFANPGKQIDEVNMEKELSI  426

Query  1464  SGNLHGESNIKGMNVSDHQA  1523
             S  L     I+G  ++D  A
Sbjct  427   SPKLKSPM-IEGNGIADVAA  445


 Score =   112 bits (280),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 96/145 (66%), Gaps = 13/145 (9%)
 Frame = +3

Query  2088  DQSNSAAVQNHSVDMQSALPDINPEQHIMKQHPLTKKQPRKNSCMPGNR----ERKALKF  2255
             DQ++   V + ++D+ +   D  P+Q+  +    T++   K S +  +     +R+    
Sbjct  726   DQTSRDVVDDCTIDVPAKTADAGPQQYNEEVERSTREPSDKRSKIISHARIKGKREVATR  785

Query  2256  RPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSLGN--  2426
             R SLA +GT +E+GVRRS RI+SRPLE+WKGER L+GRV+ES+  ++G+KY SP  GN  
Sbjct  786   RQSLAASGTSWESGVRRSTRIRSRPLEYWKGERFLYGRVHESLTTVIGIKYESP--GNAD  843

Query  2427  ----MKVKSYISDEYKEVVDLAARY  2489
                 +KVKS++SDEYK++V+LAAR+
Sbjct  844   GKPGIKVKSFVSDEYKDLVELAARF  868



>ref|XP_006465447.1| PREDICTED: uncharacterized protein LOC102609595 isoform X1 [Citrus 
sinensis]
Length=870

 Score =   225 bits (573),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 175/440 (40%), Positives = 255/440 (58%), Gaps = 41/440 (9%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIVDNG  494
             DPL  F+GL L P+T+        P +PN+L S   L+KS+ L++  +LLE+ +AIV + 
Sbjct  10    DPLEGFSGLMLFPRTLATVGIAPRPLDPNDLQSASNLLKSVPLQSPNELLEQGRAIVHSS  69

Query  495   SEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNISLQSS  674
             S I     P F    D ++  AAKV  + P+ERRPGLGRKRARFS+KP +SQP + L+ S
Sbjct  70    SGISRCEIPSFVTLKDQNNVAAAKV-TDNPQERRPGLGRKRARFSLKPKSSQPTVKLEPS  128

Query  675   LDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTA-RRRRPGILG-KSV  848
              D+DKL+DPEE+F+A EK ENAK+E+ +Q G + D S +N  P+ A R RR GILG +SV
Sbjct  129   FDIDKLKDPEEFFMAYEKFENAKREIEKQTGGITDWSKLN--PSMAPRPRRQGILGRRSV  186

Query  849   RYKHRFS----------SVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSN--------  974
              YKHR+S          +V  +     ++SQ TF+++ L     ++Q+E ++        
Sbjct  187   TYKHRYSNDISSQEIFENVKHERTKAIVASQGTFEENILSDSNYNVQEETAHASVGSQEM  246

Query  975   ---DVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSA  1145
                D  L+E EL G +T+KE RV+ +LDEL++ + ++LD+D  +++LQEQ Q+KP  L  
Sbjct  247   ELGDAALQESELVGSVTKKEKRVSELLDELVTGEDEELDEDGAVALLQEQLQIKPIVLGK  306

Query  1146  LCMPEFPDA-RTDYMTLGERIPKARKSVLGLPNSDK----RTSGKRQWEESPQSNLtspt  1310
             LC+P+   A R D    G  +PK R  +  + N  K    RT  KR+  ES    L+SPT
Sbjct  307   LCLPDLHVARRIDLKASGADVPKHRNPLSDIQNLVKGMSSRTPKKRKSAESSVHCLSSPT  366

Query  1311  ppkspfssLALLRKQVLKSNPLRDPFSPLNID---------LNDINKNSDQVGLVKDFSK  1463
             PP+SP  S+  L+K +L+SN   D FS  +ID           +  K  D+V + K+ S 
Sbjct  367   PPRSPLGSIIALKKHILQSNLSLDAFSAHDIDQSPARNASPFANPGKQIDEVNMEKELSI  426

Query  1464  SGNLHGESNIKGMNVSDHQA  1523
             S  L     I+G  ++D  A
Sbjct  427   SPKLKSPM-IEGNGIADVAA  445


 Score =   112 bits (280),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 96/145 (66%), Gaps = 13/145 (9%)
 Frame = +3

Query  2088  DQSNSAAVQNHSVDMQSALPDINPEQHIMKQHPLTKKQPRKNSCMPGNR----ERKALKF  2255
             DQ++   V + ++D+ +   D  P+Q+  +    T++   K S +  +     +R+    
Sbjct  728   DQTSRDVVDDCTIDVPAKTADAGPQQYNEEVERSTREPSDKRSKIISHARIKGKREVATR  787

Query  2256  RPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSLGN--  2426
             R SLA +GT +E+GVRRS RI+SRPLE+WKGER L+GRV+ES+  ++G+KY SP  GN  
Sbjct  788   RQSLAASGTSWESGVRRSTRIRSRPLEYWKGERFLYGRVHESLTTVIGIKYESP--GNAD  845

Query  2427  ----MKVKSYISDEYKEVVDLAARY  2489
                 +KVKS++SDEYK++V+LAAR+
Sbjct  846   GKPGIKVKSFVSDEYKDLVELAARF  870



>ref|XP_007024046.1| Centromere protein C, putative isoform 2 [Theobroma cacao]
 gb|EOY26668.1| Centromere protein C, putative isoform 2 [Theobroma cacao]
Length=727

 Score =   221 bits (562),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 172/408 (42%), Positives = 241/408 (59%), Gaps = 40/408 (10%)
 Frame = +3

Query  294   PLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEES  473
             PL    PDPL  + GL L  +T         P +P++L   H  +KSM L++  KLLE++
Sbjct  15    PLQTLAPDPLEGYTGLSLFARTFASLPNPPRPYDPDDLQHSHHFLKSMPLQSPNKLLEQA  74

Query  474   KAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQP  653
             KAIVD  SE++N           LD   +     E  RERRP LGRKRARFS+KP++SQP
Sbjct  75    KAIVDESSELVN-----------LDTSSSDAEVMENLRERRPALGRKRARFSLKPNSSQP  123

Query  654   NISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQM-GVVAD-DSNINNLPTTARRRRP  827
               +L  SLD+DKL+DPEE+F A E+ E AK+E+ +Q  GV+ D D NI ++   AR RRP
Sbjct  124   TGNLGLSLDIDKLKDPEEFFTAFERAETAKREIQKQTDGVLMDLDQNIQSM--AARPRRP  181

Query  828   GILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltg  1007
             GIL +SV+YKH +S        T MS  E F+++ L  L    Q+E+  +VEL+E EL+G
Sbjct  182   GILRRSVKYKHHYS--------TAMSPVENFEEEILSPLGCSQQEESDPNVELQEKELSG  233

Query  1008  litekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDA-RTDY  1184
             L+T  E +VN +LD LL+    + D D  +S+LQE+ Q+KP +L  +C+P+  D  R D 
Sbjct  234   LVTNAEKKVNELLDHLLT---SNYDKDEAVSLLQERLQIKPINLEKICLPDMQDIRRIDL  290

Query  1185  MTLGERIPKARKSVLGLPNSDK---RTSGKRQWEESPQSNLtsptppkspfssLALLRKQ  1355
                 E + K R SV  + +  K   + + KRQ E S   +L S TPP+SP +S++LL+KQ
Sbjct  291   KASRESLAKPRNSVSDIQSLMKGISKRTPKRQAESSVH-HLASCTPPRSPLASISLLKKQ  349

Query  1356  VLKSNPLRDPFSPLNID---------LNDINKNSDQVGLVKDFSKSGN  1472
             +L+S+ L DPFS  +ID         +  I+K S QV   K+ S S N
Sbjct  350   MLQSDVLSDPFSTDDIDRLPVRNSSPIGSISKQSGQVDTHKELSGSHN  397


 Score = 92.0 bits (227),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 96/175 (55%), Gaps = 14/175 (8%)
 Frame = +3

Query  1986  VEDMPSMSAFPEEQEHNGNDAHTSENWSGNQNPSDQSNSAAVQNHSVDMQSALPDINPEQ  2165
             VED+P M A    Q     +  T +N    Q   D+ N A  ++ ++D      +   E 
Sbjct  560   VEDIP-MEAVASAQTQLNVEGPTIDNSHIIQREPDEYNPAMAEDCTMDGSMKTAESGQEL  618

Query  2166  HIMKQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLF-ENGVRRSKRIKSRPLEFW  2342
             H       TK  PR        R RKAL  R SLA +GT +   G RRS RI+SRPLEFW
Sbjct  619   HGQYNKGKTKPHPR------NERMRKALSRRQSLAGSGTTYNAEGRRRSTRIRSRPLEFW  672

Query  2343  KGERLLFGRVNESM-KLVGVKYVSPSL-----GNMKVKSYISDEYKEVVDLAARY  2489
             KGER L+GR++ S+  ++G+KY SP         +KVKS++SDEYK++V+ AAR+
Sbjct  673   KGERFLYGRIHSSLATVIGIKYESPVRPDGKNATLKVKSFVSDEYKDLVERAARF  727



>ref|XP_007024045.1| Centromere protein C, putative isoform 1 [Theobroma cacao]
 gb|EOY26667.1| Centromere protein C, putative isoform 1 [Theobroma cacao]
Length=729

 Score =   221 bits (562),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 172/408 (42%), Positives = 241/408 (59%), Gaps = 40/408 (10%)
 Frame = +3

Query  294   PLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEES  473
             PL    PDPL  + GL L  +T         P +P++L   H  +KSM L++  KLLE++
Sbjct  15    PLQTLAPDPLEGYTGLSLFARTFASLPNPPRPYDPDDLQHSHHFLKSMPLQSPNKLLEQA  74

Query  474   KAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQP  653
             KAIVD  SE++N           LD   +     E  RERRP LGRKRARFS+KP++SQP
Sbjct  75    KAIVDESSELVN-----------LDTSSSDAEVMENLRERRPALGRKRARFSLKPNSSQP  123

Query  654   NISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQM-GVVAD-DSNINNLPTTARRRRP  827
               +L  SLD+DKL+DPEE+F A E+ E AK+E+ +Q  GV+ D D NI ++   AR RRP
Sbjct  124   TGNLGLSLDIDKLKDPEEFFTAFERAETAKREIQKQTDGVLMDLDQNIQSM--AARPRRP  181

Query  828   GILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltg  1007
             GIL +SV+YKH +S        T MS  E F+++ L  L    Q+E+  +VEL+E EL+G
Sbjct  182   GILRRSVKYKHHYS--------TAMSPVENFEEEILSPLGCSQQEESDPNVELQEKELSG  233

Query  1008  litekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDA-RTDY  1184
             L+T  E +VN +LD LL+    + D D  +S+LQE+ Q+KP +L  +C+P+  D  R D 
Sbjct  234   LVTNAEKKVNELLDHLLT---SNYDKDEAVSLLQERLQIKPINLEKICLPDMQDIRRIDL  290

Query  1185  MTLGERIPKARKSVLGLPNSDK---RTSGKRQWEESPQSNLtsptppkspfssLALLRKQ  1355
                 E + K R SV  + +  K   + + KRQ E S   +L S TPP+SP +S++LL+KQ
Sbjct  291   KASRESLAKPRNSVSDIQSLMKGISKRTPKRQAESSVH-HLASCTPPRSPLASISLLKKQ  349

Query  1356  VLKSNPLRDPFSPLNID---------LNDINKNSDQVGLVKDFSKSGN  1472
             +L+S+ L DPFS  +ID         +  I+K S QV   K+ S S N
Sbjct  350   MLQSDVLSDPFSTDDIDRLPVRNSSPIGSISKQSGQVDTHKELSGSHN  397


 Score = 92.0 bits (227),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 96/175 (55%), Gaps = 14/175 (8%)
 Frame = +3

Query  1986  VEDMPSMSAFPEEQEHNGNDAHTSENWSGNQNPSDQSNSAAVQNHSVDMQSALPDINPEQ  2165
             VED+P M A    Q     +  T +N    Q   D+ N A  ++ ++D      +   E 
Sbjct  562   VEDIP-MEAVASAQTQLNVEGPTIDNSHIIQREPDEYNPAMAEDCTMDGSMKTAESGQEL  620

Query  2166  HIMKQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLF-ENGVRRSKRIKSRPLEFW  2342
             H       TK  PR        R RKAL  R SLA +GT +   G RRS RI+SRPLEFW
Sbjct  621   HGQYNKGKTKPHPR------NERMRKALSRRQSLAGSGTTYNAEGRRRSTRIRSRPLEFW  674

Query  2343  KGERLLFGRVNESM-KLVGVKYVSPSL-----GNMKVKSYISDEYKEVVDLAARY  2489
             KGER L+GR++ S+  ++G+KY SP         +KVKS++SDEYK++V+ AAR+
Sbjct  675   KGERFLYGRIHSSLATVIGIKYESPVRPDGKNATLKVKSFVSDEYKDLVERAARF  729



>ref|XP_006465449.1| PREDICTED: uncharacterized protein LOC102609595 isoform X3 [Citrus 
sinensis]
Length=868

 Score =   222 bits (565),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 170/438 (39%), Positives = 250/438 (57%), Gaps = 39/438 (9%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIVDNG  494
             DPL  F+GL L P+T+        P +PN+L S   L+KS+ L++  +LLE+ +AIV + 
Sbjct  10    DPLEGFSGLMLFPRTLATVGIAPRPLDPNDLQSASNLLKSVPLQSPNELLEQGRAIVHSS  69

Query  495   SEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNISLQSS  674
             S I     P F    D ++  AAKV  + P+ERRPGLGRKRARFS+KP +SQP + L+ S
Sbjct  70    SGISRCEIPSFVTLKDQNNVAAAKV-TDNPQERRPGLGRKRARFSLKPKSSQPTVKLEPS  128

Query  675   LDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTA-RRRRPGILG-KSV  848
              D+DKL+DPEE+F+A EK ENAK+E+ +Q G + D S +N  P+ A R RR GILG +SV
Sbjct  129   FDIDKLKDPEEFFMAYEKFENAKREIEKQTGGITDWSKLN--PSMAPRPRRQGILGRRSV  186

Query  849   RYKHRFS----------SVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVe-----  983
              YKHR+S          +V  +     ++SQ TF+++ L     ++Q+E ++        
Sbjct  187   TYKHRYSNDISSQEIFENVKHERTKAIVASQGTFEENILSDSNYNVQEETAHASVGSQEM  246

Query  984   ----leeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALC  1151
                     E   ++T+KE RV+ +LDEL++ + ++LD+D  +++LQEQ Q+KP  L  LC
Sbjct  247   ELGDAALQESELVVTKKEKRVSELLDELVTGEDEELDEDGAVALLQEQLQIKPIVLGKLC  306

Query  1152  MPEFPDA-RTDYMTLGERIPKARKSVLGLPNSDK----RTSGKRQWEESPQSNLtsptpp  1316
             +P+   A R D    G  +PK R  +  + N  K    RT  KR+  ES    L+SPTPP
Sbjct  307   LPDLHVARRIDLKASGADVPKHRNPLSDIQNLVKGMSSRTPKKRKSAESSVHCLSSPTPP  366

Query  1317  kspfssLALLRKQVLKSNPLRDPFSPLNID---------LNDINKNSDQVGLVKDFSKSG  1469
             +SP  S+  L+K +L+SN   D FS  +ID           +  K  D+V + K+ S S 
Sbjct  367   RSPLGSIIALKKHILQSNLSLDAFSAHDIDQSPARNASPFANPGKQIDEVNMEKELSISP  426

Query  1470  NLHGESNIKGMNVSDHQA  1523
              L     I+G  ++D  A
Sbjct  427   KLKSPM-IEGNGIADVAA  443


 Score =   112 bits (280),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 96/145 (66%), Gaps = 13/145 (9%)
 Frame = +3

Query  2088  DQSNSAAVQNHSVDMQSALPDINPEQHIMKQHPLTKKQPRKNSCMPGNR----ERKALKF  2255
             DQ++   V + ++D+ +   D  P+Q+  +    T++   K S +  +     +R+    
Sbjct  726   DQTSRDVVDDCTIDVPAKTADAGPQQYNEEVERSTREPSDKRSKIISHARIKGKREVATR  785

Query  2256  RPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSLGN--  2426
             R SLA +GT +E+GVRRS RI+SRPLE+WKGER L+GRV+ES+  ++G+KY SP  GN  
Sbjct  786   RQSLAASGTSWESGVRRSTRIRSRPLEYWKGERFLYGRVHESLTTVIGIKYESP--GNAD  843

Query  2427  ----MKVKSYISDEYKEVVDLAARY  2489
                 +KVKS++SDEYK++V+LAAR+
Sbjct  844   GKPGIKVKSFVSDEYKDLVELAARF  868



>ref|XP_008461044.1| PREDICTED: uncharacterized protein LOC103499749 isoform X1 [Cucumis 
melo]
Length=729

 Score =   216 bits (551),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 180/524 (34%), Positives = 280/524 (53%), Gaps = 43/524 (8%)
 Frame = +3

Query  306   DPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNS----IHQLMKSMGLRNAEKLLEES  473
             D  DPL A++G+ L P      ++   PS+P++L +    IH+ +KSM LR+  KLLE++
Sbjct  12    DVIDPLAAYSGINLFPTAFGTLTD---PSKPHDLGTDLDGIHKRLKSMVLRSPSKLLEQA  68

Query  474   KAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQP  653
             ++I+D  S+ + +    F    + ++  + K E E P+ERRP L RKRARFS+KPD  QP
Sbjct  69    RSILDGNSKSMISEAATFLVKNEKNEAASVKAE-ENPQERRPALNRKRARFSLKPDAGQP  127

Query  654   NISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGI  833
              ++L+ + D+ +L+DPEE+FLA EK ENAK+E+ +QMG V  D N  N  T  R+RRPGI
Sbjct  128   PVNLEPTFDIKQLKDPEEFFLAYEKHENAKKEIQKQMGAVLKDLNQQNPSTNTRQRRPGI  187

Query  834   LGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALK-----------SDLQKENSNDV  980
             LG+SVRYKH++SS+  +D+     SQ TF       LK            D +K+   DV
Sbjct  188   LGRSVRYKHQYSSITTEDDQNVDPSQVTFDSGVFSPLKLGTETHPSPHIIDSEKKTDEDV  247

Query  981   e----leeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSAL  1148
                   EE EL    T+ E RVN ILDE LS + +DL+ DR ++ILQE+ Q+KP  L  L
Sbjct  248   AFEEEEEEEELVASATKAENRVNDILDEFLSGNCEDLEGDRAINILQERLQIKPLTLEKL  307

Query  1149  CMPEFPDARTDYMTL-GERIPKARKSVLGLPNSDKRTSGKRQWE--ESPQSNLtsptppk  1319
             C+P+     T  M L   R   +++S++ + N  ++T   +  E  E+  + +++P+  +
Sbjct  308   CLPDLEAIPT--MNLKSTRGNLSKRSLISVDNQLQKTETLKSKEDNENLVNLVSTPSSMR  365

Query  1320  spfssLALLRKQVLKSNPLRDPFSPLNID--------LNDI-NKNSDQVGLVKDFSKSG-  1469
             SP +SL+ L +++  SN   D FS   ID        L ++ N  SD VG+ +  S S  
Sbjct  366   SPLASLSALNRRISLSNSSGDSFSAHGIDRSPARDPYLFELGNHLSDAVGITEHSSVSKL  425

Query  1470  ----NLHGESNIKGMNVSDHQADRSAETNAQSSNI-DISHSGSHAQMGDCDGHTDAGHMV  1634
                    G +   G+  S   +   + +   SSNI ++   GS+  +      TDA ++ 
Sbjct  426   KPLLTRDGGTIANGIQPSKILSGDDSMSKISSSNILNVLQVGSNTALSGTYASTDAKNVS  485

Query  1635  TRGLEQLNNEQSLEKNSGGETIAAGQGDSHGSMERCNGWNHMDI  1766
                 +   NE+     +  + +A  Q D  GS       + +D+
Sbjct  486   GSSTDVEINEKLSCLEAQADVVANMQIDHQGSASEQPKLSEVDL  529


 Score =   110 bits (275),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 73/95 (77%), Gaps = 7/95 (7%)
 Frame = +3

Query  2226  GNRERKALKF--RPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVG  2396
              N++RK  K   R SLA AGT +++GVRRS R K RPLE+WKGER+L+GRV+ES+  ++G
Sbjct  635   ANKQRKGKKISGRQSLAGAGTTWKSGVRRSTRFKIRPLEYWKGERMLYGRVHESLATVIG  694

Query  2397  VKYVSPSLGN----MKVKSYISDEYKEVVDLAARY  2489
             +KYVSP  GN    MKVKS +S+EYK++VDLAA +
Sbjct  695   LKYVSPEKGNGKPTMKVKSLVSNEYKDLVDLAALH  729



>ref|XP_008461045.1| PREDICTED: uncharacterized protein LOC103499749 isoform X2 [Cucumis 
melo]
Length=727

 Score =   216 bits (550),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 180/524 (34%), Positives = 280/524 (53%), Gaps = 43/524 (8%)
 Frame = +3

Query  306   DPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNS----IHQLMKSMGLRNAEKLLEES  473
             D  DPL A++G+ L P      ++   PS+P++L +    IH+ +KSM LR+  KLLE++
Sbjct  12    DVIDPLAAYSGINLFPTAFGTLTD---PSKPHDLGTDLDGIHKRLKSMVLRSPSKLLEQA  68

Query  474   KAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQP  653
             ++I+D  S+ + +    F    + ++  + K E E P+ERRP L RKRARFS+KPD  QP
Sbjct  69    RSILDGNSKSMISEAATFLVKNEKNEAASVKAE-ENPQERRPALNRKRARFSLKPDAGQP  127

Query  654   NISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGI  833
              ++L+ + D+ +L+DPEE+FLA EK ENAK+E+ +QMG V  D N  N  T  R+RRPGI
Sbjct  128   PVNLEPTFDIKQLKDPEEFFLAYEKHENAKKEIQKQMGAVLKDLNQQNPSTNTRQRRPGI  187

Query  834   LGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALK-----------SDLQKENSNDV  980
             LG+SVRYKH++SS+  +D+     SQ TF       LK            D +K+   DV
Sbjct  188   LGRSVRYKHQYSSITTEDDQNVDPSQVTFDSGVFSPLKLGTETHPSPHIIDSEKKTDEDV  247

Query  981   e----leeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSAL  1148
                   EE EL    T+ E RVN ILDE LS + +DL+ DR ++ILQE+ Q+KP  L  L
Sbjct  248   AFEEEEEEEELVASATKAENRVNDILDEFLSGNCEDLEGDRAINILQERLQIKPLTLEKL  307

Query  1149  CMPEFPDARTDYMTL-GERIPKARKSVLGLPNSDKRTSGKRQWE--ESPQSNLtsptppk  1319
             C+P+     T  M L   R   +++S++ + N  ++T   +  E  E+  + +++P+  +
Sbjct  308   CLPDLEAIPT--MNLKSTRGNLSKRSLISVDNQLQKTETLKSKEDNENLVNLVSTPSSMR  365

Query  1320  spfssLALLRKQVLKSNPLRDPFSPLNID--------LNDI-NKNSDQVGLVKDFSKSG-  1469
             SP +SL+ L +++  SN   D FS   ID        L ++ N  SD VG+ +  S S  
Sbjct  366   SPLASLSALNRRISLSNSSGDSFSAHGIDRSPARDPYLFELGNHLSDAVGITEHSSVSKL  425

Query  1470  ----NLHGESNIKGMNVSDHQADRSAETNAQSSNI-DISHSGSHAQMGDCDGHTDAGHMV  1634
                    G +   G+  S   +   + +   SSNI ++   GS+  +      TDA ++ 
Sbjct  426   KPLLTRDGGTIANGIQPSKILSGDDSMSKISSSNILNVLQVGSNTALSGTYASTDAKNVS  485

Query  1635  TRGLEQLNNEQSLEKNSGGETIAAGQGDSHGSMERCNGWNHMDI  1766
                 +   NE+     +  + +A  Q D  GS       + +D+
Sbjct  486   GSSTDVEINEKLSCLEAQADVVANMQIDHQGSASEQPKLSEVDL  529


 Score =   110 bits (275),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 73/95 (77%), Gaps = 7/95 (7%)
 Frame = +3

Query  2226  GNRERKALKF--RPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVG  2396
              N++RK  K   R SLA AGT +++GVRRS R K RPLE+WKGER+L+GRV+ES+  ++G
Sbjct  633   ANKQRKGKKISGRQSLAGAGTTWKSGVRRSTRFKIRPLEYWKGERMLYGRVHESLATVIG  692

Query  2397  VKYVSPSLGN----MKVKSYISDEYKEVVDLAARY  2489
             +KYVSP  GN    MKVKS +S+EYK++VDLAA +
Sbjct  693   LKYVSPEKGNGKPTMKVKSLVSNEYKDLVDLAALH  727



>ref|XP_011000820.1| PREDICTED: uncharacterized protein LOC105108269 isoform X2 [Populus 
euphratica]
Length=744

 Score =   216 bits (549),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 159/414 (38%), Positives = 244/414 (59%), Gaps = 43/414 (10%)
 Frame = +3

Query  303   MDPPDPLRAFAGLPLLPQTIRVQSEDSIPS---EPNNLNSIHQLMKSMGLRNAEKLLEES  473
             M+  DPL+ ++GL L  +T+      S+P    +P++L S H L+KS+ ++N +KL+E++
Sbjct  2     MELEDPLQGYSGLSLFRRTL-----GSLPKPTHDPDDLLSAHNLLKSLPVKNPDKLIEQA  56

Query  474   KAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQP  653
             ++I+D   E  NA+ P      D  + VA K + E PR RRPGLGRKRARFS+ P++SQP
Sbjct  57    RSILDATPEPTNADLPSGVMPEDKSEVVAQK-DAESPRARRPGLGRKRARFSLFPNSSQP  115

Query  654   NISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGI  833
              ++L+ +LD+D L+DPE++FLA E+LE+AK+E+ +Q G V+  SN +      R RRPG+
Sbjct  116   TVNLEPTLDIDSLKDPEQFFLAFERLEDAKKEMAKQTGRVSIGSNQSRPSMAPRHRRPGM  175

Query  834   LGKS--VRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKEN-----------SN  974
              G+S   +Y+H + +         MSSQETF +          Q+E            S 
Sbjct  176   PGRSRTAKYQHLYPT---------MSSQETFMEKIHSPANPGSQQETFSPDVASELREST  226

Query  975   DVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCM  1154
             ++  EE  + G + + E RV+ +LDELLSRD ++LD D  +++L++  Q+K  DL  L +
Sbjct  227   NLAPEESGIAGSMAKAEKRVDKLLDELLSRDYEELDGDGAVTLLRDCLQVKSLDLEKLSL  286

Query  1155  PEFPDA-RTDYMTLGERIPKARKSVLGLPNSDKRTSG--KRQWEESPQSNLtsptppksp  1325
             PE  +  +T    LG  +PK R  +  + N  +RT    ++Q   +   +  SPTPPKSP
Sbjct  287   PELLNVQKTSLNALGGNLPKPRNVLSDIHNLPRRTITPMRQQITGNSSCSFGSPTPPKSP  346

Query  1326  fssLALLRKQVLKSNPLRDPFSPLNID---------LNDINKNSDQVGLVKDFS  1460
              +SLALLRK++L+SNP  DPFS  ++D         L +IN +SD V +  D S
Sbjct  347   LASLALLRKRILQSNPPTDPFSVFDVDQSPETNASSLKNINNSSDPVDIENDLS  400


 Score =   104 bits (260),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 74/105 (70%), Gaps = 9/105 (9%)
 Frame = +3

Query  2196  KQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVN  2375
             KQ R  S     R+  +L  R SLA +GT +E G+RRS RI+SRPLE+WKGER L+GR++
Sbjct  642   KQARARSHRAKGRKNGSLSKRHSLAASGTSWETGLRRSTRIRSRPLEYWKGERFLYGRIH  701

Query  2376  ESM-KLVGVKYVSPSLGN------MKVKSYISDEYKEVVDLAARY  2489
              S+  ++G+KY SP  GN      +KVKSY+SDEYK++V+LAA +
Sbjct  702   GSLATVIGIKYESP--GNDKGKRALKVKSYVSDEYKDLVELAALH  744



>ref|XP_008461046.1| PREDICTED: uncharacterized protein LOC103499749 isoform X3 [Cucumis 
melo]
Length=696

 Score =   215 bits (547),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 130/305 (43%), Positives = 186/305 (61%), Gaps = 23/305 (8%)
 Frame = +3

Query  306   DPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNS----IHQLMKSMGLRNAEKLLEES  473
             D  DPL A++G+ L P      ++   PS+P++L +    IH+ +KSM LR+  KLLE++
Sbjct  12    DVIDPLAAYSGINLFPTAFGTLTD---PSKPHDLGTDLDGIHKRLKSMVLRSPSKLLEQA  68

Query  474   KAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQP  653
             ++I+D  S+ + +    F    + ++  + K E E P+ERRP L RKRARFS+KPD  QP
Sbjct  69    RSILDGNSKSMISEAATFLVKNEKNEAASVKAE-ENPQERRPALNRKRARFSLKPDAGQP  127

Query  654   NISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGI  833
              ++L+ + D+ +L+DPEE+FLA EK ENAK+E+ +QMG V  D N  N  T  R+RRPGI
Sbjct  128   PVNLEPTFDIKQLKDPEEFFLAYEKHENAKKEIQKQMGAVLKDLNQQNPSTNTRQRRPGI  187

Query  834   LGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALK-----------SDLQKENSNDV  980
             LG+SVRYKH++SS+  +D+     SQ TF       LK            D +K+   DV
Sbjct  188   LGRSVRYKHQYSSITTEDDQNVDPSQVTFDSGVFSPLKLGTETHPSPHIIDSEKKTDEDV  247

Query  981   e----leeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSAL  1148
                   EE EL    T+ E RVN ILDE LS + +DL+ DR ++ILQE+ Q+KP  L  L
Sbjct  248   AFEEEEEEEELVASATKAENRVNDILDEFLSGNCEDLEGDRAINILQERLQIKPLTLEKL  307

Query  1149  CMPEF  1163
             C+P+ 
Sbjct  308   CLPDL  312


 Score =   110 bits (275),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 73/95 (77%), Gaps = 7/95 (7%)
 Frame = +3

Query  2226  GNRERKALKF--RPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVG  2396
              N++RK  K   R SLA AGT +++GVRRS R K RPLE+WKGER+L+GRV+ES+  ++G
Sbjct  602   ANKQRKGKKISGRQSLAGAGTTWKSGVRRSTRFKIRPLEYWKGERMLYGRVHESLATVIG  661

Query  2397  VKYVSPSLGN----MKVKSYISDEYKEVVDLAARY  2489
             +KYVSP  GN    MKVKS +S+EYK++VDLAA +
Sbjct  662   LKYVSPEKGNGKPTMKVKSLVSNEYKDLVDLAALH  696



>ref|XP_006427091.1| hypothetical protein CICLE_v10024870mg [Citrus clementina]
 gb|ESR40331.1| hypothetical protein CICLE_v10024870mg [Citrus clementina]
Length=868

 Score =   215 bits (547),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 173/440 (39%), Positives = 253/440 (58%), Gaps = 41/440 (9%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIVDNG  494
             DPL  F+GL L P+T+        P +PN+L S   L+KS+ L++  +LLE+ +AIV + 
Sbjct  10    DPLEGFSGLMLFPRTLATVGIAPRPLDPNDLQSASNLLKSVPLQSPNELLEQGRAIVHSS  69

Query  495   SEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNISLQSS  674
             S I     P      D ++  AAKV  + P+ERRPGLGRKRARFS+KP +SQP + L+ S
Sbjct  70    SGISRCEIPSSVTLKDQNNVAAAKV-TDNPQERRPGLGRKRARFSLKPKSSQPTVKLEPS  128

Query  675   LDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTA-RRRRPGILG-KSV  848
              ++DKL+DPEE+F+A EK ENAK+E+ +Q G V D S +N  P+ A R RR GILG +SV
Sbjct  129   FNIDKLKDPEEFFMAYEKFENAKREIEKQTGGVTDWSKLN--PSMAPRPRRQGILGRRSV  186

Query  849   RYKHRFS----------SVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSN--------  974
              YKHR+S          +V  +     ++SQ TF+++ L     ++Q+E ++        
Sbjct  187   TYKHRYSNDISSQEIFENVKHERTKAIVASQGTFEENILSDSNYNVQEETAHASVGSQEM  246

Query  975   ---DVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSA  1145
                D EL+E EL G  T+KE RV+ +LDEL++ + ++LD+D  +++LQEQ Q+KP  L  
Sbjct  247   ELGDAELQESELVGSETKKEKRVSELLDELVTGEDEELDEDGAVALLQEQLQIKPIVLGK  306

Query  1146  LCMPEFPDA-RTDYMTLGERIPKARKSVLGLPNSDK----RTSGKRQWEESPQSNLtspt  1310
             LC+P+   A R D       +PK R  +  + N  K    RT  KR+  ES    L+SPT
Sbjct  307   LCLPDLHVARRIDLKASRADVPKHRNPLSDIQNLVKGMSSRTPKKRKSAESSVHCLSSPT  366

Query  1311  ppkspfssLALLRKQVLKSNPLRDPFSPLNID---------LNDINKNSDQVGLVKDFSK  1463
             PP+SP  S+  L+K +L+SN   D FS  +ID           +  K  D+V + K+ + 
Sbjct  367   PPRSPLGSIIALKKHILQSNLSLDAFSAHDIDQSPARNASPFANPGKQIDEVNMEKELTI  426

Query  1464  SGNLHGESNIKGMNVSDHQA  1523
             S  L     I+G  ++D  A
Sbjct  427   SPKLKSPM-IEGNGIADVAA  445


 Score =   112 bits (280),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 96/145 (66%), Gaps = 13/145 (9%)
 Frame = +3

Query  2088  DQSNSAAVQNHSVDMQSALPDINPEQHIMKQHPLTKKQPRKNSCMPGNR----ERKALKF  2255
             DQ++   V + ++D+ +   D  P+Q+  +    T++   K S +  +     +R+    
Sbjct  726   DQTSRDVVDDCTIDVPAKTADAGPQQYNEEVERSTREPSDKRSKIISHARIKGKREVATR  785

Query  2256  RPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSLGN--  2426
             R SLA +GT +E+GVRRS RI+SRPLE+WKGER L+GRV+ES+  ++G+KY SP  GN  
Sbjct  786   RQSLAASGTSWESGVRRSTRIRSRPLEYWKGERFLYGRVHESLTTVIGIKYESP--GNAD  843

Query  2427  ----MKVKSYISDEYKEVVDLAARY  2489
                 +KVKS++SDEYK++V+LAAR+
Sbjct  844   GKPGIKVKSFVSDEYKDLVELAARF  868



>gb|KHG12472.1| Mannose-1-phosphate guanyltransferase [Gossypium arboreum]
Length=708

 Score =   213 bits (542),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 166/403 (41%), Positives = 234/403 (58%), Gaps = 43/403 (11%)
 Frame = +3

Query  309   PPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIVD  488
             P DPL A++GL L P+T         P +P++L  +H  +KSM L+  +KL+E++KAIVD
Sbjct  4     PSDPLEAYSGLSLFPRTFASFPNPPPPYDPHDLQHLHHFLKSMPLQCPDKLMEQAKAIVD  63

Query  489   NGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNISLQ  668
             N SE+LN         LD+    A  +E   PRERRP LGRKR RFS+KP++S P +SL+
Sbjct  64    NSSELLN---------LDMSSSDAEVLEN--PRERRPALGRKRPRFSLKPNSSLPTVSLE  112

Query  669   SSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILGKSV  848
              S+D+DK  DPEE+F+A EK ENAK+E+ +Q G V  D + N     AR RRPGIL +SV
Sbjct  113   PSIDIDKFNDPEEFFVAFEKAENAKREIEKQTGGVLMDLDQNIQSMAARPRRPGILRRSV  172

Query  849   RYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltglitekeg  1028
             +YKHR+S        T +S  E+F ++++ +   + Q E S+  +  E +    +T  E 
Sbjct  173   KYKHRYS--------TPISPVESF-EEEIPSPVCNSQPEKSD--QNVEFQEELSVTNAEN  221

Query  1029  RVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDA-RTDYMTLGERI  1205
             +VN +LD LL+      D +  +S+LQEQ Q+KP DL  +C+P+  D  R D     E +
Sbjct  222   KVNDLLDHLLTSTC---DGNEAISLLQEQLQIKPIDLEKICLPDLQDIRRIDLKASRENL  278

Query  1206  PKARKS---VLGLPNSDKRTSGKRQWEESPQSNLtsptppkspfssLALLRKQVLKSNPL  1376
              K R S   V  L     + + KR+ E S    L S TPP+SP +S++LLRKQ L+S+ L
Sbjct  279   AKPRNSLSDVESLFKGISKRTPKRKAESSVHL-LASLTPPRSPLASISLLRKQKLQSDVL  337

Query  1377  RDPF-------SPL----NIDLNDINKNSDQVGLVKDFSKSGN  1472
              DPF       SP+     I++N  NK S QV   K+ S S N
Sbjct  338   SDPFSTDDVRRSPVRNASGIEIN--NKESVQVDTEKELSVSHN  378


 Score = 86.3 bits (212),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 66/85 (78%), Gaps = 7/85 (8%)
 Frame = +3

Query  2256  RPSLADAGTLFE-NGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSLGN-  2426
             R SLA +GT F+  G RRS RI+SRPLEFWKGER L+GRV+ S+  ++G+KY SP  G+ 
Sbjct  624   RQSLAGSGTTFDPEGRRRSTRIRSRPLEFWKGERFLYGRVHSSLATVIGIKYESPEKGDG  683

Query  2427  ----MKVKSYISDEYKEVVDLAARY  2489
                 +KVKS++SDEYKE+++LAAR+
Sbjct  684   GNATLKVKSFVSDEYKELIELAARF  708



>ref|XP_011000819.1| PREDICTED: uncharacterized protein LOC105108269 isoform X1 [Populus 
euphratica]
Length=753

 Score =   213 bits (541),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 160/416 (38%), Positives = 246/416 (59%), Gaps = 38/416 (9%)
 Frame = +3

Query  303   MDPPDPLRAFAGLPLLPQTIRVQSEDSIPS---EPNNLNSIHQLMKSMGLRNAEKLLEES  473
             M+  DPL+ ++GL L  +T+      S+P    +P++L S H L+KS+ ++N +KL+E++
Sbjct  2     MELEDPLQGYSGLSLFRRTL-----GSLPKPTHDPDDLLSAHNLLKSLPVKNPDKLIEQA  56

Query  474   KAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQP  653
             ++I+D   E  NA+ P      D  + VA K + E PR RRPGLGRKRARFS+ P++SQP
Sbjct  57    RSILDATPEPTNADLPSGVMPEDKSEVVAQK-DAESPRARRPGLGRKRARFSLFPNSSQP  115

Query  654   NISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGI  833
              ++L+ +LD+D L+DPE++FLA E+LE+AK+E+ +Q G V+  SN +      R RRPG+
Sbjct  116   TVNLEPTLDIDSLKDPEQFFLAFERLEDAKKEMAKQTGRVSIGSNQSRPSMAPRHRRPGM  175

Query  834   LGKS--VRYKHRFSSVPPDDNDTDM----------SSQETFKQDDLCALK--SDLQKENS  971
              G+S   +Y+H + ++     +T M          S QETF  D    L+  ++L  E S
Sbjct  176   PGRSRTAKYQHLYPTM--SSQETFMEKIHSPANPGSQQETFSPDVASELRESTNLAPEES  233

Query  972   NDVel-eeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSAL  1148
                     +E  G + + E RV+ +LDELLSRD ++LD D  +++L++  Q+K  DL  L
Sbjct  234   GIAGEWLLVEEQGSMAKAEKRVDKLLDELLSRDYEELDGDGAVTLLRDCLQVKSLDLEKL  293

Query  1149  CMPEFPDA-RTDYMTLGERIPKARKSVLGLPNSDKRTSG--KRQWEESPQSNLtsptppk  1319
              +PE  +  +T    LG  +PK R  +  + N  +RT    ++Q   +   +  SPTPPK
Sbjct  294   SLPELLNVQKTSLNALGGNLPKPRNVLSDIHNLPRRTITPMRQQITGNSSCSFGSPTPPK  353

Query  1320  spfssLALLRKQVLKSNPLRDPFSPLNID---------LNDINKNSDQVGLVKDFS  1460
             SP +SLALLRK++L+SNP  DPFS  ++D         L +IN +SD V +  D S
Sbjct  354   SPLASLALLRKRILQSNPPTDPFSVFDVDQSPETNASSLKNINNSSDPVDIENDLS  409


 Score =   104 bits (259),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 74/105 (70%), Gaps = 9/105 (9%)
 Frame = +3

Query  2196  KQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVN  2375
             KQ R  S     R+  +L  R SLA +GT +E G+RRS RI+SRPLE+WKGER L+GR++
Sbjct  651   KQARARSHRAKGRKNGSLSKRHSLAASGTSWETGLRRSTRIRSRPLEYWKGERFLYGRIH  710

Query  2376  ESM-KLVGVKYVSPSLGN------MKVKSYISDEYKEVVDLAARY  2489
              S+  ++G+KY SP  GN      +KVKSY+SDEYK++V+LAA +
Sbjct  711   GSLATVIGIKYESP--GNDKGKRALKVKSYVSDEYKDLVELAALH  753



>gb|KGN45338.1| hypothetical protein Csa_7G440590 [Cucumis sativus]
Length=730

 Score =   202 bits (514),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 124/305 (41%), Positives = 181/305 (59%), Gaps = 23/305 (8%)
 Frame = +3

Query  306   DPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNS----IHQLMKSMGLRNAEKLLEES  473
             D  DPL A++G+ L         +   PS+P++L +    IH+ +KSM LR+  KLLE++
Sbjct  13    DVIDPLAAYSGINLFSTAFGTLPD---PSKPHDLGTDLDGIHKRLKSMVLRSPSKLLEQA  69

Query  474   KAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQP  653
             ++I+D  S  + +    F    + ++    K E+ + +ERRP L RKRARFS+KPD  QP
Sbjct  70    RSILDGNSNSMISEAATFLVKNEKNEEATVKAEENL-QERRPALNRKRARFSLKPDARQP  128

Query  654   NISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGI  833
              ++L+ + D+ +L+DPEE+FLA EK ENAK+E+ +Q G V  D N  N  T  R+RRPGI
Sbjct  129   PVNLEPTFDIKQLKDPEEFFLAYEKHENAKKEIQKQTGAVLKDLNQQNPSTNTRQRRPGI  188

Query  834   LGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALK-----------SDLQKENSNDV  980
             LG+SVRYKH++SS+  +D+     SQ TF       LK            D +K+   DV
Sbjct  189   LGRSVRYKHQYSSIATEDDQNVDPSQVTFDSGIFSPLKLGTETHPSPHIIDSEKKTDEDV  248

Query  981   e----leeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSAL  1148
                   EE EL    T+ E R+N IL+E LS + +DL+ DR ++ILQE+ Q+KP  L  L
Sbjct  249   AFEEEEEEEELVASATKAENRINDILNEFLSGNCEDLEGDRAINILQERLQIKPLTLEKL  308

Query  1149  CMPEF  1163
             C+P+ 
Sbjct  309   CLPDL  313


 Score =   110 bits (274),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 74/95 (78%), Gaps = 7/95 (7%)
 Frame = +3

Query  2226  GNRERKALKF--RPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVG  2396
              N++ K  K   R SLA AGT +++GVRRS R K+RPLE+WKGERLL+GRV+ES+  ++G
Sbjct  636   ANKQHKGKKISRRQSLAGAGTTWQSGVRRSTRFKTRPLEYWKGERLLYGRVHESLTTVIG  695

Query  2397  VKYVSPSLGN----MKVKSYISDEYKEVVDLAARY  2489
             +KYVSP+ GN    MKVKS +S+EYK++V+LAA +
Sbjct  696   LKYVSPAKGNGKPTMKVKSLVSNEYKDLVELAALH  730



>ref|XP_011013528.1| PREDICTED: uncharacterized protein LOC105117535 isoform X2 [Populus 
euphratica]
Length=565

 Score =   196 bits (497),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 147/383 (38%), Positives = 230/383 (60%), Gaps = 33/383 (9%)
 Frame = +3

Query  303   MDPPDPLRAFAGLPLLPQTIRVQSE---DSIPSEPNNLNSIHQLMKSMGLRNAEKLLEES  473
             M+  DPL+ ++GL +L  ++   S+   DS P + ++L S H  +KS+ ++N++KL+E++
Sbjct  1     MNLEDPLQRYSGLSILHGSLGSLSKPPCDSDPHQDDDLLSAHNFLKSLPVKNSDKLIEQA  60

Query  474   KAIVDNGSEILNANFPRFKASLDLDDHVAAKVEK--EMPRERRPGLGRKRARFSMKPDTS  647
             K+I+D  S ++NA+          +D +   VEK  E PR RRPGLGRKRARFS+  ++S
Sbjct  61    KSILDATSGLVNADLANDAMP---EDKIEVVVEKAAESPRARRPGLGRKRARFSLIHNSS  117

Query  648   QPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRP  827
             QP++ L+ +LD+D L+DPE++FLA E+LE+AK+E+ +Q G V+  SN +++    R RRP
Sbjct  118   QPSVILEPTLDMDNLKDPEQFFLAFERLEDAKKEMAKQTGRVSIGSNQSSMAMAPRPRRP  177

Query  828   GILGKS--VRYKHRFSSVPPDDNDTDMSSQETFKQD-----------DLCALKSDLQKEN  968
             G+ G+S  V+Y+H + +         MS QET  +D           +  +    LQ   
Sbjct  178   GMPGRSRTVKYQHLYPT---------MSFQETSIEDIFSPSNPGSQQETVSQAVALQLME  228

Query  969   SNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSAL  1148
             S +V LEE EL   + + E RV+ +LDELL+ D ++LD D  +++LQ++ Q+K   +  L
Sbjct  229   STNVALEESELAVSMAKAEKRVDKLLDELLACDCEELDGDGAVTLLQDRLQVKSLGIEKL  288

Query  1149  CMPEFPDA-RTDYMTLGERIPKARKSVLGLPNSDKRTSG--KRQWEESPQSNLtsptppk  1319
              +PE     RT+   LG  +PK R  +  + N  +RTS   K+Q   +  S+  SPTPPK
Sbjct  289   NLPELLYVQRTNLNALGGNLPKPRNVLSHIHNLPRRTSTPMKQQIAGNSTSSFGSPTPPK  348

Query  1320  spfssLALLRKQVLKSNPLRDPF  1388
             S  + LALLRK +L SNP  +P 
Sbjct  349   SQLALLALLRKHILHSNPPTNPV  371



>ref|XP_011013527.1| PREDICTED: uncharacterized protein LOC105117535 isoform X1 [Populus 
euphratica]
Length=692

 Score =   196 bits (497),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 143/374 (38%), Positives = 228/374 (61%), Gaps = 15/374 (4%)
 Frame = +3

Query  303   MDPPDPLRAFAGLPLLPQTIRVQSE---DSIPSEPNNLNSIHQLMKSMGLRNAEKLLEES  473
             M+  DPL+ ++GL +L  ++   S+   DS P + ++L S H  +KS+ ++N++KL+E++
Sbjct  1     MNLEDPLQRYSGLSILHGSLGSLSKPPCDSDPHQDDDLLSAHNFLKSLPVKNSDKLIEQA  60

Query  474   KAIVDNGSEILNANFPRFKASLDLDDHVAAKVEK--EMPRERRPGLGRKRARFSMKPDTS  647
             K+I+D  S ++NA+          +D +   VEK  E PR RRPGLGRKRARFS+  ++S
Sbjct  61    KSILDATSGLVNADLANDAMP---EDKIEVVVEKAAESPRARRPGLGRKRARFSLIHNSS  117

Query  648   QPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRP  827
             QP++ L+ +LD+D L+DPE++FLA E+LE+AK+E+ +Q G V+  SN +++    R RRP
Sbjct  118   QPSVILEPTLDMDNLKDPEQFFLAFERLEDAKKEMAKQTGRVSIGSNQSSMAMAPRPRRP  177

Query  828   GILGKS--VRYKHRFSSVPPDDNDTD--MSSQETFKQDDLCALKSDLQKENSNDVeleel  995
             G+ G+S  V+Y+H + ++   +   +   S      Q +  +    LQ   S +V LEE 
Sbjct  178   GMPGRSRTVKYQHLYPTMSFQETSIEDIFSPSNPGSQQETVSQAVALQLMESTNVALEES  237

Query  996   eltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDA-  1172
             EL   + + E RV+ +LDELL+ D ++LD D  +++LQ++ Q+K   +  L +PE     
Sbjct  238   ELAVSMAKAEKRVDKLLDELLACDCEELDGDGAVTLLQDRLQVKSLGIEKLNLPELLYVQ  297

Query  1173  RTDYMTLGERIPKARKSVLGLPNSDKRTSG--KRQWEESPQSNLtsptppkspfssLALL  1346
             RT+   LG  +PK R  +  + N  +RTS   K+Q   +  S+  SPTPPKS  + LALL
Sbjct  298   RTNLNALGGNLPKPRNVLSHIHNLPRRTSTPMKQQIAGNSTSSFGSPTPPKSQLALLALL  357

Query  1347  RKQVLKSNPLRDPF  1388
             RK +L SNP  +P 
Sbjct  358   RKHILHSNPPTNPV  371


 Score =   107 bits (267),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 96/157 (61%), Gaps = 20/157 (13%)
 Frame = +3

Query  2079  NPSDQS---NSAAVQNHSVDMQSALPDINPEQ----------HIMKQHPL--TKKQPRKN  2213
             NP DQ    ++A V++H++D   A  D + EQ            ++  P+  T K  ++ 
Sbjct  536   NPRDQFEQLSAAFVEDHAMDSCPATQDRDVEQTKASTLEHNNERVEDPPVVSTNKLNKEK  595

Query  2214  SCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KL  2390
             SC    R+ ++L  R SLA +GT +E GVRRS RIKSRPLE+WKGER L+GR++ S+  +
Sbjct  596   SCTAKGRKNRSLSRRQSLAASGTSWETGVRRSTRIKSRPLEYWKGERFLYGRIHGSLATI  655

Query  2391  VGVKYVSPSLGN----MKVKSYISDEYKEVVDLAARY  2489
             +G+KY +P        +KVKS++SDEYK +V LAA +
Sbjct  656   IGIKYETPQNDKRKPALKVKSFVSDEYKNLVKLAALH  692



>ref|XP_011002717.1| PREDICTED: uncharacterized protein LOC105109647 isoform X2 [Populus 
euphratica]
Length=565

 Score =   192 bits (488),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 145/383 (38%), Positives = 229/383 (60%), Gaps = 33/383 (9%)
 Frame = +3

Query  303   MDPPDPLRAFAGLPLLPQTIRVQSE---DSIPSEPNNLNSIHQLMKSMGLRNAEKLLEES  473
             M+  DPL+ ++GL +L  ++   S+   D  P + ++L S H  +KS+ ++N++KL+E++
Sbjct  1     MNLEDPLQRYSGLSILHGSLGSLSKPPCDPDPHQDDDLLSAHNFLKSLPVKNSDKLIEQA  60

Query  474   KAIVDNGSEILNANFPRFKASLDLDDHVAAKVEK--EMPRERRPGLGRKRARFSMKPDTS  647
             K+I+D  S ++NA+          +D +   V+K  E PR RRPGLGRKRARFS+  ++S
Sbjct  61    KSILDATSGLVNADLANDAMP---EDKIEVVVQKAAESPRARRPGLGRKRARFSLIHNSS  117

Query  648   QPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRP  827
             QP++ L+ +LD+D L+DPE++FLA E+LE+AK+E+ +Q G V+  SN +++    R RRP
Sbjct  118   QPSVILEPTLDMDNLKDPEQFFLAFERLEDAKKEMAKQTGRVSIGSNQSSMAMAPRPRRP  177

Query  828   GILGKS--VRYKHRFSSVPPDDNDTDMSSQETFKQD-----------DLCALKSDLQKEN  968
             G+ G+S  V+Y+H + +         MS QET  +D           +  +    LQ   
Sbjct  178   GMPGRSRTVKYQHLYPT---------MSFQETSIEDIFSPSNPGSQQETVSQAVALQLME  228

Query  969   SNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSAL  1148
             S +V LEE EL   + + E RV+ +LDELL+ D ++LD D  +++LQ++ Q+K   +  L
Sbjct  229   STNVALEESELAVSMAKAEKRVDKLLDELLACDCEELDGDGAVTLLQDRLQVKSLGIEKL  288

Query  1149  CMPEFPDA-RTDYMTLGERIPKARKSVLGLPNSDKRTSG--KRQWEESPQSNLtsptppk  1319
              +PE     RT+   LG  +PK R  +  + N  +RTS   K+Q   +  S+  SPTPPK
Sbjct  289   NLPELLYVQRTNLNALGGNLPKPRNVLSHIHNLPRRTSTPMKQQIAGNSTSSFGSPTPPK  348

Query  1320  spfssLALLRKQVLKSNPLRDPF  1388
             S  + LALLRK +L SNP  +P 
Sbjct  349   SQLALLALLRKHILHSNPPTNPV  371



>ref|XP_004136069.1| PREDICTED: uncharacterized protein LOC101218908 [Cucumis sativus]
 ref|XP_004169083.1| PREDICTED: uncharacterized protein LOC101224500 [Cucumis sativus]
Length=738

 Score =   194 bits (494),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 124/313 (40%), Positives = 181/313 (58%), Gaps = 31/313 (10%)
 Frame = +3

Query  306   DPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNS----IHQLMKSMGLRNAEKLLEES  473
             D  DPL A++G+ L         +   PS+P++L +    IH+ +KSM LR+  KLLE++
Sbjct  13    DVIDPLAAYSGINLFSTAFGTLPD---PSKPHDLGTDLDGIHKRLKSMVLRSPSKLLEQA  69

Query  474   KAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQP  653
             ++I+D  S  + +    F    + ++    K E+ + +ERRP L RKRARFS+KPD  QP
Sbjct  70    RSILDGNSNSMISEAATFLVKNEKNEEATVKAEENL-QERRPALNRKRARFSLKPDARQP  128

Query  654   NISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGI  833
              ++L+ + D+ +L+DPEE+FLA EK ENAK+E+ +Q G V  D N  N  T  R+RRPGI
Sbjct  129   PVNLEPTFDIKQLKDPEEFFLAYEKHENAKKEIQKQTGAVLKDLNQQNPSTNTRQRRPGI  188

Query  834   LG--------KSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALK-----------SDL  956
             LG        +SVRYKH++SS+  +D+     SQ TF       LK            D 
Sbjct  189   LGPKSSRACRRSVRYKHQYSSIATEDDQNVDPSQVTFDSGIFSPLKLGTETHPSPHIIDS  248

Query  957   QKENSNDVe----leeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQM  1124
             +K+   DV      EE EL    T+ E R+N IL+E LS + +DL+ DR ++ILQE+ Q+
Sbjct  249   EKKTDEDVAFEEEEEEEELVASATKAENRINDILNEFLSGNCEDLEGDRAINILQERLQI  308

Query  1125  KPPDLSALCMPEF  1163
             KP  L  LC+P+ 
Sbjct  309   KPLTLEKLCLPDL  321


 Score =   109 bits (273),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 73/93 (78%), Gaps = 7/93 (8%)
 Frame = +3

Query  2226  GNRERKALKF--RPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVG  2396
              N++ K  K   R SLA AGT +++GVRRS R K+RPLE+WKGERLL+GRV+ES+  ++G
Sbjct  644   ANKQHKGKKISRRQSLAGAGTTWQSGVRRSTRFKTRPLEYWKGERLLYGRVHESLTTVIG  703

Query  2397  VKYVSPSLGN----MKVKSYISDEYKEVVDLAA  2483
             +KYVSP+ GN    MKVKS +S+EYK++V+LAA
Sbjct  704   LKYVSPAKGNGKPTMKVKSLVSNEYKDLVELAA  736



>ref|XP_011002716.1| PREDICTED: uncharacterized protein LOC105109647 isoform X1 [Populus 
euphratica]
Length=692

 Score =   192 bits (488),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 145/381 (38%), Positives = 227/381 (60%), Gaps = 29/381 (8%)
 Frame = +3

Query  303   MDPPDPLRAFAGLPLLPQTIRVQSE---DSIPSEPNNLNSIHQLMKSMGLRNAEKLLEES  473
             M+  DPL+ ++GL +L  ++   S+   D  P + ++L S H  +KS+ ++N++KL+E++
Sbjct  1     MNLEDPLQRYSGLSILHGSLGSLSKPPCDPDPHQDDDLLSAHNFLKSLPVKNSDKLIEQA  60

Query  474   KAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQP  653
             K+I+D  S ++NA+        D  + V  K   E PR RRPGLGRKRARFS+  ++SQP
Sbjct  61    KSILDATSGLVNADLANDAMPEDKIEVVVQKA-AESPRARRPGLGRKRARFSLIHNSSQP  119

Query  654   NISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGI  833
             ++ L+ +LD+D L+DPE++FLA E+LE+AK+E+ +Q G V+  SN +++    R RRPG+
Sbjct  120   SVILEPTLDMDNLKDPEQFFLAFERLEDAKKEMAKQTGRVSIGSNQSSMAMAPRPRRPGM  179

Query  834   LGKS--VRYKHRFSSVPPDDNDTDMSSQETFKQD-----------DLCALKSDLQKENSN  974
              G+S  V+Y+H + +         MS QET  +D           +  +    LQ   S 
Sbjct  180   PGRSRTVKYQHLYPT---------MSFQETSIEDIFSPSNPGSQQETVSQAVALQLMEST  230

Query  975   DVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCM  1154
             +V LEE EL   + + E RV+ +LDELL+ D ++LD D  +++LQ++ Q+K   +  L +
Sbjct  231   NVALEESELAVSMAKAEKRVDKLLDELLACDCEELDGDGAVTLLQDRLQVKSLGIEKLNL  290

Query  1155  PEFPDA-RTDYMTLGERIPKARKSVLGLPNSDKRTSG--KRQWEESPQSNLtsptppksp  1325
             PE     RT+   LG  +PK R  +  + N  +RTS   K+Q   +  S+  SPTPPKS 
Sbjct  291   PELLYVQRTNLNALGGNLPKPRNVLSHIHNLPRRTSTPMKQQIAGNSTSSFGSPTPPKSQ  350

Query  1326  fssLALLRKQVLKSNPLRDPF  1388
              + LALLRK +L SNP  +P 
Sbjct  351   LALLALLRKHILHSNPPTNPV  371


 Score =   107 bits (267),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 96/157 (61%), Gaps = 20/157 (13%)
 Frame = +3

Query  2079  NPSDQS---NSAAVQNHSVDMQSALPDINPEQ----------HIMKQHPL--TKKQPRKN  2213
             NP DQ    ++A V++H++D   A  D + EQ            ++  P+  T K  ++ 
Sbjct  536   NPRDQFEQLSAAFVEDHAMDSCPATQDRDLEQTKASTLEHNNERVEDPPVVSTNKLNKEK  595

Query  2214  SCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KL  2390
             SC    R+ ++L  R SLA +GT +E GVRRS RIKSRPLE+WKGER L+GR++ S+  +
Sbjct  596   SCTAKGRKNRSLSRRQSLAASGTSWETGVRRSTRIKSRPLEYWKGERFLYGRIHGSLATI  655

Query  2391  VGVKYVSPSLGN----MKVKSYISDEYKEVVDLAARY  2489
             +G+KY +P        +KVKS++SDEYK +V LAA +
Sbjct  656   IGIKYETPQNDKRKPALKVKSFVSDEYKNLVKLAALH  692



>ref|XP_010062445.1| PREDICTED: uncharacterized protein LOC104449856 isoform X3 [Eucalyptus 
grandis]
 gb|KCW69585.1| hypothetical protein EUGRSUZ_F03008 [Eucalyptus grandis]
Length=677

 Score =   183 bits (465),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 147/433 (34%), Positives = 237/433 (55%), Gaps = 18/433 (4%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSE-PNNLNSIHQLMKSMGLRNAEKLLEESKAIVDN  491
             DPL  ++ L L P+T+ V      P +   +L+S+H  +KS+ LR+ ++LL+++KAIV N
Sbjct  13    DPLAEYSVLSLFPRTLGVLRRAPEPYDLERDLDSLHDHLKSVVLRSPKRLLDQAKAIVSN  72

Query  492   GSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNISLQS  671
              SE+LN + P   AS D ++   A +  E+ R+RRPGLG KR RFS+KPD+SQP ++L+ 
Sbjct  73    SSELLNTSIPSKAASED-ENRANAVMANEVTRKRRPGLGLKRPRFSLKPDSSQPMVTLEP  131

Query  672   SLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILGKSVR  851
             + D+D+ +DP E+F A E  ENAK+E++RQ GV  D +  + +   AR RRPG L KS +
Sbjct  132   TFDIDRYEDPVEFFEAYEMFENAKREIHRQTGVSMDQNQYDTV-RNARPRRPGTLRKSFK  190

Query  852   --YKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltgliteke  1025
               +     S+     +  +SSQ T + D +       Q E    +EL +          E
Sbjct  191   NLFDQSVISLQLTSQNDIISSQLTSQNDIVPGPVYTTQPEA---IELTDETELAGSEMAE  247

Query  1026  gRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDARTDYMTLGER-  1202
              +VN +LD+LLS++ +D D D  +++LQE  Q+KP ++  L +P+  D   + +   +R 
Sbjct  248   NKVNDLLDDLLSKNCEDFDGDGAVNLLQECLQIKPVNVENLSLPDMQDIMGNDLNASQRE  307

Query  1203  IPKARKSVLGLPNSDKRTSGKRQWEESPQSNLts-ptppkspfssLALLRKQVLKSNPLR  1379
                 R+++  + N  KR   K   +    S       P KSP + L LL+K++ K N + 
Sbjct  308   TSLGRRALSDIQNILKRIHSKSPSKRGDVSRKDVPSPPTKSPLAPLILLKKRLFKDNSI-  366

Query  1380  DPFSPLNIDLNDINKNSDQVGLVKDFSKSGNLHGESNIKGMNVS---DHQADRSAET---  1541
             DPFS  NID+    KNS     ++ +S   ++  E    G ++S   +  A RS  +   
Sbjct  367   DPFSAANIDVA-ATKNSPLSNCLEIYSDDADMRKEPGTSGKSMSPMVEEDAGRSQHSSND  425

Query  1542  NAQSSNIDISHSG  1580
             N ++ N+D++  G
Sbjct  426   NNENFNLDLTTLG  438


 Score =   110 bits (276),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 75/109 (69%), Gaps = 11/109 (10%)
 Frame = +3

Query  2172  MKQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGE  2351
             +  H  +K  P K       R RK L  R SLA AGT + +GVRRS RI+SRPLE+WKGE
Sbjct  573   LNAHKKSKAHPSKG------RLRKELSRRQSLAAAGTSWSSGVRRSTRIRSRPLEYWKGE  626

Query  2352  RLLFGRVNESM-KLVGVKYVSPSLGN----MKVKSYISDEYKEVVDLAA  2483
             R L+GRV++S+  ++G+KY SP   +    MKVKSY+SDEYKE+V+LA+
Sbjct  627   RFLYGRVHQSLATVIGIKYASPGKADGKLTMKVKSYVSDEYKELVELAS  675



>ref|XP_010062443.1| PREDICTED: uncharacterized protein LOC104449856 isoform X1 [Eucalyptus 
grandis]
Length=699

 Score =   182 bits (463),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 140/404 (35%), Positives = 223/404 (55%), Gaps = 12/404 (3%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSE-PNNLNSIHQLMKSMGLRNAEKLLEESKAIVDN  491
             DPL  ++ L L P+T+ V      P +   +L+S+H  +KS+ LR+ ++LL+++KAIV N
Sbjct  13    DPLAEYSVLSLFPRTLGVLRRAPEPYDLERDLDSLHDHLKSVVLRSPKRLLDQAKAIVSN  72

Query  492   GSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNISLQS  671
              SE+LN + P   AS D ++   A +  E+ R+RRPGLG KR RFS+KPD+SQP ++L+ 
Sbjct  73    SSELLNTSIPSKAASED-ENRANAVMANEVTRKRRPGLGLKRPRFSLKPDSSQPMVTLEP  131

Query  672   SLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILGKSVR  851
             + D+D+ +DP E+F A E  ENAK+E++RQ GV  D +  + +   AR RRPG L KS +
Sbjct  132   TFDIDRYEDPVEFFEAYEMFENAKREIHRQTGVSMDQNQYDTV-RNARPRRPGTLRKSFK  190

Query  852   --YKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltgliteke  1025
               +     S+     +  +SSQ T + D +       Q E    +EL +          E
Sbjct  191   NLFDQSVISLQLTSQNDIISSQLTSQNDIVPGPVYTTQPEA---IELTDETELAGSEMAE  247

Query  1026  gRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDARTDYMTLGER-  1202
              +VN +LD+LLS++ +D D D  +++LQE  Q+KP ++  L +P+  D   + +   +R 
Sbjct  248   NKVNDLLDDLLSKNCEDFDGDGAVNLLQECLQIKPVNVENLSLPDMQDIMGNDLNASQRE  307

Query  1203  IPKARKSVLGLPNSDKRTSGKRQWEESPQSNLts-ptppkspfssLALLRKQVLKSNPLR  1379
                 R+++  + N  KR   K   +    S       P KSP + L LL+K++ K N + 
Sbjct  308   TSLGRRALSDIQNILKRIHSKSPSKRGDVSRKDVPSPPTKSPLAPLILLKKRLFKDNSI-  366

Query  1380  DPFSPLNIDLNDINKNSDQVGLVKDFSKSGNLHGESNIKGMNVS  1511
             DPFS  NID+    KNS     ++ +S   ++  E    G ++S
Sbjct  367   DPFSAANIDVA-ATKNSPLSNCLEIYSDDADMRKEPGTSGKSMS  409


 Score =   110 bits (276),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 75/109 (69%), Gaps = 11/109 (10%)
 Frame = +3

Query  2172  MKQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGE  2351
             +  H  +K  P K       R RK L  R SLA AGT + +GVRRS RI+SRPLE+WKGE
Sbjct  595   LNAHKKSKAHPSKG------RLRKELSRRQSLAAAGTSWSSGVRRSTRIRSRPLEYWKGE  648

Query  2352  RLLFGRVNESM-KLVGVKYVSPSLGN----MKVKSYISDEYKEVVDLAA  2483
             R L+GRV++S+  ++G+KY SP   +    MKVKSY+SDEYKE+V+LA+
Sbjct  649   RFLYGRVHQSLATVIGIKYASPGKADGKLTMKVKSYVSDEYKELVELAS  697



>ref|XP_010062444.1| PREDICTED: uncharacterized protein LOC104449856 isoform X2 [Eucalyptus 
grandis]
Length=677

 Score =   182 bits (461),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 140/404 (35%), Positives = 223/404 (55%), Gaps = 12/404 (3%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSE-PNNLNSIHQLMKSMGLRNAEKLLEESKAIVDN  491
             DPL  ++ L L P+T+ V      P +   +L+S+H  +KS+ LR+ ++LL+++KAIV N
Sbjct  13    DPLAEYSVLSLFPRTLGVLRRAPEPYDLERDLDSLHDHLKSVVLRSPKRLLDQAKAIVSN  72

Query  492   GSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNISLQS  671
              SE+LN + P   AS D ++   A +  E+ R+RRPGLG KR RFS+KPD+SQP ++L+ 
Sbjct  73    SSELLNTSIPSKAASED-ENRANAVMANEVTRKRRPGLGLKRPRFSLKPDSSQPMVTLEP  131

Query  672   SLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILGKSVR  851
             + D+D+ +DP E+F A E  ENAK+E++RQ GV  D +  + +   AR RRPG L KS +
Sbjct  132   TFDIDRYEDPVEFFEAYEMFENAKREIHRQTGVSMDQNQYDTV-RNARPRRPGTLRKSFK  190

Query  852   --YKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltgliteke  1025
               +     S+     +  +SSQ T + D +       Q E    +EL +          E
Sbjct  191   NLFDQSVISLQLTSQNDIISSQLTSQNDIVPGPVYTTQPEA---IELTDETELAGSEMAE  247

Query  1026  gRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDARTDYMTLGER-  1202
              +VN +LD+LLS++ +D D D  +++LQE  Q+KP ++  L +P+  D   + +   +R 
Sbjct  248   NKVNDLLDDLLSKNCEDFDGDGAVNLLQECLQIKPVNVENLSLPDMQDIMGNDLNASQRE  307

Query  1203  IPKARKSVLGLPNSDKRTSGKRQWEESPQSNLts-ptppkspfssLALLRKQVLKSNPLR  1379
                 R+++  + N  KR   K   +    S       P KSP + L LL+K++ K N + 
Sbjct  308   TSLGRRALSDIQNILKRIHSKSPSKRGDVSRKDVPSPPTKSPLAPLILLKKRLFKDNSI-  366

Query  1380  DPFSPLNIDLNDINKNSDQVGLVKDFSKSGNLHGESNIKGMNVS  1511
             DPFS  NID+    KNS     ++ +S   ++  E    G ++S
Sbjct  367   DPFSAANIDVA-ATKNSPLSNCLEIYSDDADMRKEPGTSGKSMS  409


 Score =   110 bits (276),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 75/109 (69%), Gaps = 11/109 (10%)
 Frame = +3

Query  2172  MKQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGE  2351
             +  H  +K  P K       R RK L  R SLA AGT + +GVRRS RI+SRPLE+WKGE
Sbjct  573   LNAHKKSKAHPSKG------RLRKELSRRQSLAAAGTSWSSGVRRSTRIRSRPLEYWKGE  626

Query  2352  RLLFGRVNESM-KLVGVKYVSPSLGN----MKVKSYISDEYKEVVDLAA  2483
             R L+GRV++S+  ++G+KY SP   +    MKVKSY+SDEYKE+V+LA+
Sbjct  627   RFLYGRVHQSLATVIGIKYASPGKADGKLTMKVKSYVSDEYKELVELAS  675



>gb|KDP37184.1| hypothetical protein JCGZ_06240 [Jatropha curcas]
Length=766

 Score =   178 bits (452),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 147/409 (36%), Positives = 220/409 (54%), Gaps = 36/409 (9%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIVDNG  494
             DPL  +  L L P+T       S P   ++  SIH  +KS+ ++N ++L++++K+I++N 
Sbjct  6     DPLEGYGELSLFPRTFASLPNPSRPLNSDDPRSIHDYLKSLPVKNPDRLIQQAKSILENT  65

Query  495   SEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNISLQSS  674
             +E          A+ D D  V  +   + P  +RPGL RKR RFS+ P+ SQP + L+ +
Sbjct  66    AEAPETEMTNIAATEDKD--VVTEKAVQYPWGQRPGLNRKRPRFSLLPNISQPTVDLEPT  123

Query  675   LDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILGKSV-R  851
             LD DKL+DPEE+F A E+LENAK+E+ +Q G    DS+  N+    R +RPGI G+S  +
Sbjct  124   LDFDKLKDPEEFFSAYERLENAKKEIAKQTGRAFTDSDQYNVFKVPRSQRPGIPGRSTAK  183

Query  852   YKHRFSSVPPDDND----------------TDMSSQET----FKQDDLCALKSDLQKENS  971
             YKH + ++   +                   D++SQ+T         L       Q+   
Sbjct  184   YKHLYPTMSSQEMSGVDILPNCGSQQEGVYPDLASQQTEPVNVSPQQLGLTNDASQQTEP  243

Query  972   NDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALC  1151
              +V  EE+ELTG + + E RV  +LDELL  D ++LD+D   ++LQE  Q+KP  +  L 
Sbjct  244   ANVASEEMELTGSLLKAENRVGKLLDELLGNDLEELDEDGTTNLLQELLQIKPLHIEKLN  303

Query  1152  MPEFPDAR-TDYMTLGERIPKARKSVLGLPNSDKRTSG----KRQWEESPQSNLtsptpp  1316
             +PE  D +  D    G  + K RK +  +    K T      K +  ES  S   SPTPP
Sbjct  304   LPEVQDIQEVDCKASGVNLLKPRKVLSDMNTLLKATRNVTPLKLKNIESLLSGFGSPTPP  363

Query  1317  kspfssLALLRKQVLKSNPLRDPFSPLNID--------LNDINKNSDQV  1439
             KSP +SL+LL+K + +SNP  DPFS ++ID        + +INK SD V
Sbjct  364   KSPLASLSLLKKHIFQSNPSSDPFSAVDIDDSPARITPVGNINKRSDPV  412


 Score = 97.1 bits (240),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 69/101 (68%), Gaps = 7/101 (7%)
 Frame = +3

Query  2205  RKNSCMPGNRERKALKFR-PSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNES  2381
             + NSC P  + +   + R  SLA  G  +E G+RRS RI+SRPLE+WKGER L+GRV+ES
Sbjct  667   KANSC-PSKKNKCTTRSRGKSLAGCGMSWEAGLRRSTRIRSRPLEYWKGERFLYGRVHES  725

Query  2382  M-KLVGVKYVSPSLG----NMKVKSYISDEYKEVVDLAARY  2489
             +  ++G+KY SP        MKVKS++SD+YK +V+ AA Y
Sbjct  726   LATIIGIKYESPGKDKGGPTMKVKSFVSDKYKNLVEQAALY  766



>gb|ABO07412.1| centromere protein C1, partial [Solanum lycopersicum]
Length=173

 Score =   164 bits (416),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 118/180 (66%), Gaps = 11/180 (6%)
 Frame = +3

Query  1950  IQNNVSCRTDEHVEDMPSMSAFPEEQEHNGNDAHTSENWSGNQNPSDQSNSAAVQNHSVD  2129
             +++  S   D  V++M   +A   EQ+H   D+    N       SDQ NS  V+  S D
Sbjct  5     VEDFGSTEIDPLVDNMLPETAPSAEQDHYFEDSVKDLN-------SDQLNSVGVEVPSRD  57

Query  2130  MQSALPDINPEQHIMKQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRS  2309
             ++   P+++P+ H   +     KQ +      G RERK L  RPSLADAGT FE+GVRRS
Sbjct  58    VRPKFPEMSPQHHKQAKD----KQQKAKELAVGRRERKHLSSRPSLADAGTSFESGVRRS  113

Query  2310  KRIKSRPLEFWKGERLLFGRVNESMKLVGVKYVSPSLGNMKVKSYISDEYKEVVDLAARY  2489
             KR+K+RPLE+WKGERLL+GRV+E +KLVG+KY+SP  G+ KVKSYI D+YK++VDLAARY
Sbjct  114   KRMKTRPLEYWKGERLLYGRVDEGLKLVGLKYISPGKGSFKVKSYIPDDYKDLVDLAARY  173



>ref|XP_002517519.1| hypothetical protein RCOM_0894640 [Ricinus communis]
 gb|EEF44683.1| hypothetical protein RCOM_0894640 [Ricinus communis]
Length=888

 Score =   176 bits (445),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 159/447 (36%), Positives = 244/447 (55%), Gaps = 58/447 (13%)
 Frame = +3

Query  306   DPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLN--SIHQLMKSMGLRNAEKLLEESKA  479
             D  DPL+ + GL L PQT    S  + P  P+  +   +H  + S+ +RN +KL++E++ 
Sbjct  3     DLEDPLKDYNGLSLFPQTFSSLSLPNPPPPPSTHDPLCLHNFLNSLPVRNQDKLIKEAER  62

Query  480   IVDNGSEILNANFPRFKASLDLDDH----VAAKVEKEMPRERRPGLGRKRAR--FSMKPD  641
             I+ N  E+ N   P+   ++  +D+    VAA+     PR +RPGL RKR R  F++ P+
Sbjct  63    ILKNNEEVSN---PKMAYTVVSEDNNSEVVAAENAVIYPRGQRPGLDRKRPRPRFALLPN  119

Query  642   TSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRR  821
               QPN++L+ +LD DKL+DPEE+F A ++LENAK+E+ +Q G    D +  N+    R +
Sbjct  120   IRQPNVNLEPTLDFDKLKDPEEFFSAFDRLENAKKEIAKQTGRAFTDFDHYNVFNVPRSQ  179

Query  822   RPGILGKS--VRYKHRFSSVPPDD------------------------NDTDMSSQETFK  923
             RPGI G+S   +YKH + S+   +                           +++SQE  +
Sbjct  180   RPGIEGRSRTAKYKHLYPSMTCQELSEMDILSNSASQQEIGYTASEQTQPANVASQELEQ  239

Query  924   QDDL---CALKSDL-QKENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDR  1091
              DD      L  D  QK+ S D   E++ELTG I + E RVN +LD+LL+  +++L  D 
Sbjct  240   ADDASQRTKLADDASQKKKSADAAFEKMELTGSILKVENRVNKLLDDLLA--SEELAGDG  297

Query  1092  VLSILQEQFQMKPPDLSALCMPEFPDA-RTDYMTLGERIPKARKSVLGLPN----SDKRT  1256
              + +LQE+  +KP  +  L +PE  D  R D+   G  +PK+R     + +    +  +T
Sbjct  298   AIGLLQERLHIKPLHIEKLNLPELQDIQRIDFKASGVNLPKSRNIFSDITHLMRGTRSKT  357

Query  1257  SGKRQWEESPQSNLtsptppkspfssLALLRKQVLKSNPLRDPFSPLNID---------L  1409
               K +  ES  +N  SPTPPKSP +SL LL+K++ +SNP  DPFS  +ID         +
Sbjct  358   PTKMKNAES-TANFGSPTPPKSPLASLLLLKKRIFQSNPSNDPFSADDIDQSPTRNASHV  416

Query  1410  NDINKNSDQVGLVKDFSKSGNLHGESN  1490
              +I KNSD VG+ K    SGNL+ + N
Sbjct  417   ENITKNSDPVGVEKMLDMSGNLNPQIN  443


 Score = 85.1 bits (209),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +3

Query  2196  KQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVN  2375
             +Q R+ S     R+RKA   R SLA  G   + GVRRS RIKSRPLE+WKGER L+GR++
Sbjct  739   EQTREKSHPKKERKRKAFSTRQSLAGFGMSLDTGVRRSTRIKSRPLEYWKGERFLYGRIH  798

Query  2376  ESM-KLVGVKYVSP  2414
             ES+  ++G+KY SP
Sbjct  799   ESLATVIGIKYASP  812



>ref|XP_006597140.1| PREDICTED: uncharacterized protein LOC100778037 [Glycine max]
Length=798

 Score =   174 bits (442),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 145/408 (36%), Positives = 227/408 (56%), Gaps = 34/408 (8%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEPNN----LNSIHQLMKSMGLRNAEKLLEESKAI  482
             DPL ++ GL L PQ          PS+P N    L+ IH  ++SM LR+  KL++++K+I
Sbjct  10    DPLASYWGLSLFPQ------PSLPPSKPYNSDQDLHIIHTHLRSMALRSPAKLMQQAKSI  63

Query  483   VDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNI-  659
             VD   ++ N        S + +    A+ + E  R  RPGLG KR RFSMKP T +P++ 
Sbjct  64    VDGNPQLFNTENLNDPTSQNTN---VAEEDGEFRRNPRPGLGLKRPRFSMKP-TKKPSVE  119

Query  660   SLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILG  839
             SL  +LD+D L+DP ++F+A E+LENAK+E+ +Q+G  + +S+ +      R+RRPG+LG
Sbjct  120   SLLPTLDLDSLKDPADFFMAHERLENAKREIQKQLGGASFESDQDKAAARPRQRRPGLLG  179

Query  840   K---SVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltgl  1010
                 S++YKHR+   P + +D  +SSQET     L  +  +  K  S  +   E E+   
Sbjct  180   NDQLSIKYKHRY---PKETSDDVLSSQETLGSRSLAPVTENTDKGESC-MASLEKEVIDS  235

Query  1011  itekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDAR-TDYM  1187
                +  +++ +LD LL  +++DL+ D  +++LQE+ Q+KP  L    +P+FPD +  D  
Sbjct  236   SGTEGNKLDELLDGLLHCNSEDLEGDGAMTLLQERLQIKPIALEKFSVPDFPDKQMVDLK  295

Query  1188  TLGERIPKARKS------VLGLPNSDKRTSGKRQWEESPQSNLtsptppkspfssLALLR  1349
             +L     K RK+      +L   N +K+T  K+   + P   L SPTPP+SPF+SL+LL+
Sbjct  296   SLQGNKSKPRKALSDIDNLLKGMNMNKKTPLKKAV-QCPGQQLASPTPPRSPFASLSLLQ  354

Query  1350  KQVLKSNPLRDPFSPLNIDLNDINKNSDQVGLVKDFSKSGNLHGESNI  1493
             + + +S    DPFS   ID    N +S    L    +   NL G  N+
Sbjct  355   RHISRSKQSVDPFSAHEID----NLSSKNYSLTHTVNPELNLAGSGNL  398


 Score = 98.6 bits (244),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 88/140 (63%), Gaps = 10/140 (7%)
 Frame = +3

Query  2097  NSAAVQNHSVDMQSALPDINPEQHIMKQHP-----LTKKQPRKNSCMPGNRERKALKFRP  2261
             NS   + ++VD ++   D +PE H +++           Q R  S +    + K L  R 
Sbjct  660   NSLGYEANAVDKRARTSDDDPE-HCLQEKTDGSVVAVNGQKRVKSRVQKVSKNKKLSNRQ  718

Query  2262  SLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSLGN---M  2429
             SLA AGT + +G+RRS RI++RPLE+WKGER ++GRV++S+  ++GVK +SP       M
Sbjct  719   SLAAAGTSWTSGLRRSTRIRTRPLEYWKGERPVYGRVHQSLATVIGVKCISPGSDGKPIM  778

Query  2430  KVKSYISDEYKEVVDLAARY  2489
             KVKSY+S++YKE+ +LA+ Y
Sbjct  779   KVKSYVSNKYKELFELASLY  798



>gb|KHM98777.1| hypothetical protein glysoja_030830 [Glycine soja]
Length=808

 Score =   174 bits (442),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 145/408 (36%), Positives = 227/408 (56%), Gaps = 34/408 (8%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEPNN----LNSIHQLMKSMGLRNAEKLLEESKAI  482
             DPL ++ GL L PQ          PS+P N    L+ IH  ++SM LR+  KL++++K+I
Sbjct  10    DPLASYWGLSLFPQP------SLPPSKPYNSDQDLHIIHTHLRSMALRSPAKLMQQAKSI  63

Query  483   VDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNI-  659
             VD   ++ N        S + +    A+ + E  R  RPGLG KR RFSMKP T +P++ 
Sbjct  64    VDGNPQLFNTENLNDPTSQNTN---VAEEDGEFRRNPRPGLGLKRPRFSMKP-TKKPSVE  119

Query  660   SLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILG  839
             SL  +LD+D L+DP ++F+A E+LENAK+E+ +Q+G  + +S+ +      R+RRPG+LG
Sbjct  120   SLLPTLDLDSLKDPADFFMAHERLENAKREIQKQLGGASFESDQDKAAARPRQRRPGLLG  179

Query  840   K---SVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltgl  1010
                 S++YKHR+   P + +D  +SSQET     L  +  +  K  S  +   E E+   
Sbjct  180   NDQLSIKYKHRY---PKETSDDVLSSQETLGSRSLAPVTENTDKGESC-MASLEKEVIDS  235

Query  1011  itekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDAR-TDYM  1187
                +  +++ +LD LL  +++DL+ D  +++LQE+ Q+KP  L    +P+FPD +  D  
Sbjct  236   SGTEGNKLDELLDGLLHCNSEDLEGDGAMTLLQERLQIKPIALEKFSVPDFPDKQMVDLK  295

Query  1188  TLGERIPKARKS------VLGLPNSDKRTSGKRQWEESPQSNLtsptppkspfssLALLR  1349
             +L     K RK+      +L   N +K+T  K+   + P   L SPTPP+SPF+SL+LL+
Sbjct  296   SLQGNKSKPRKALSDIDNLLKGMNMNKKTPLKKAV-QCPGQQLASPTPPRSPFASLSLLQ  354

Query  1350  KQVLKSNPLRDPFSPLNIDLNDINKNSDQVGLVKDFSKSGNLHGESNI  1493
             + + +S    DPFS   ID    N +S    L    +   NL G  N+
Sbjct  355   RHISRSKQSVDPFSAHEID----NLSSKNYSLTHTVNPELNLAGSGNL  398


 Score = 98.6 bits (244),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 106/189 (56%), Gaps = 26/189 (14%)
 Frame = +3

Query  1950  IQNNVSCRTDEHVEDMPSMSAFPEEQEHNGNDAHTSENWSGNQNPSDQSNSAAVQNHSVD  2129
             I+ N SC++++  E++ + +A     + N N                  NS   + ++VD
Sbjct  637   IEVNESCQSEDKSENIQTFTASIPTDDTNLNVL----------------NSLGYEANAVD  680

Query  2130  MQSALPDINPEQHIMKQHP-----LTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFEN  2294
              ++   D +PE H +++           Q R  S +    + K L  R SLA AGT + +
Sbjct  681   KRARTSDDDPE-HCLQEKTDGSVVAVNGQKRVKSRVQKVSKNKKLSNRQSLAAAGTSWTS  739

Query  2295  GVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSLGN---MKVKSYISDEYK  2462
             G+RRS RI++RPLE+WKGER ++GRV++S+  ++GVK +SP       MKVKSY+S++YK
Sbjct  740   GLRRSTRIRTRPLEYWKGERPVYGRVHQSLATVIGVKCISPGSDGKPIMKVKSYVSNKYK  799

Query  2463  EVVDLAARY  2489
             E+ +LA+ Y
Sbjct  800   ELFELASLY  808



>ref|XP_010110298.1| hypothetical protein L484_019452 [Morus notabilis]
 gb|EXC25818.1| hypothetical protein L484_019452 [Morus notabilis]
Length=856

 Score =   171 bits (433),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 146/410 (36%), Positives = 221/410 (54%), Gaps = 36/410 (9%)
 Frame = +3

Query  282   MTTEPLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSM--------  437
             M T+    D  DPL  ++GL L P+T  V    +       L +IH  +KS+        
Sbjct  1     MVTDDRFSDFVDPLENYSGLSLFPKTFEVIHASNSDDLDGQLQAIHNHLKSLFAGFRLLE  60

Query  438   ----------------GLRNAEKLLEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKV  569
                              LR+ +KL E++  I+D  S+ LN       A +  ++ + A +
Sbjct  61    ACYFILLGVNSLIWAGALRSPDKLREQANKILDGNSKSLNTKTTSDLAPMGKNEALPA-L  119

Query  570   EKEMPRERRPGLGRKRARFSMKPDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQE  749
              K  PRERRP L RKRARFS+KP++S P +S + +LD+ KL++PEE+F+A E+ ENAK+E
Sbjct  120   PKVNPRERRPALNRKRARFSLKPNSSHPAVSSEPALDLKKLKNPEEFFMAYERHENAKRE  179

Query  750   LNRQMGVVADDSNINNLPTTARRRRPGILG----KSVRYKHRFSSVPPDDNDTDMSSQET  917
             + +Q+G    DS   N     R RRPG+LG    +S++YKH +S    +      SSQE 
Sbjct  180   ILKQIGGNLSDSEQQNTSLIERPRRPGMLGHDKRRSIKYKHLYSCEDSETGKNVPSSQER  239

Query  918   FKQDDLCALKSDLQKENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVL  1097
                  L  +    Q+E       +E EL G I++++ +V+ ILD+LLS + +DLD D VL
Sbjct  240   NDSSILSPIYHSSQEETEQGFTSQETELVGSISKEDHKVDEILDQLLSYNCEDLDGDGVL  299

Query  1098  SILQEQFQMKPPDLSALCMPEFPDA-RTDYM-TLGERIPKARKSVLGLPNSDKRTSGKRQ  1271
             +ILQE  Q+KP +L  L +P+F +  + D   +   ++P   + +L + N  K  S K  
Sbjct  300   NILQEHLQIKPVELEKLQLPDFQEIPKIDLKSSRSGKLPTRSRVLLDVENILKGLSSKTP  359

Query  1272  WE-----ESPQSNLtsptppkspfssLALLRKQVLKSNPLRDPFSPLNID  1406
              +     ESP S   SPTPPKSPF+S  L+ +++L+S+   D FS  +ID
Sbjct  360   TKHGPGAESPFSYGASPTPPKSPFASFLLVHQEILRSSLSNDRFSAHDID  409


 Score = 96.7 bits (239),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 93/149 (62%), Gaps = 10/149 (7%)
 Frame = +3

Query  2067  SGNQNPSDQSNSAAVQNHSVDMQSALPDINPEQ--HIMKQHP---LTKKQPRKNSCMPGN  2231
             S  Q+  D+ ++A++ +   D    +PD + EQ   + ++HP   L K            
Sbjct  710   SNKQSHLDEPSTASIHDQE-DRNPEIPDNDSEQDSEMEEEHPNMPLDKNHKATTQSQKSR  768

Query  2232  RERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYV  2408
             + RK+ + + SL  AGT +E+GVRRS RI+ RPLE+WKGERLL+GR++ ++  ++G+KY 
Sbjct  769   KRRKSSQGK-SLGGAGTHWESGVRRSTRIRCRPLEYWKGERLLYGRIHRTLPTVIGLKYA  827

Query  2409  SPSLGN--MKVKSYISDEYKEVVDLAARY  2489
             SP  GN  + +KSY+S E++++V+LA  +
Sbjct  828   SPGKGNGALTLKSYVSAEHQDLVELAGLH  856



>ref|XP_002298134.2| hypothetical protein POPTR_0001s17850g [Populus trichocarpa]
 gb|EEE82939.2| hypothetical protein POPTR_0001s17850g [Populus trichocarpa]
Length=561

 Score =   167 bits (424),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 149/442 (34%), Positives = 246/442 (56%), Gaps = 25/442 (6%)
 Frame = +3

Query  546   DDHVAAKVEK--EMPRERRPGLGRKRARFSMKPDTSQPNISLQSSLDVDKLQDPEEYFLA  719
             +D +   V+K  E PR RRPGLGRKRARFS+  ++SQP++ L+ +LD+D L+DPE++FLA
Sbjct  3     EDKIEVVVQKAAESPRARRPGLGRKRARFSLIHNSSQPSVILEPTLDMDNLKDPEQFFLA  62

Query  720   CEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILGKS--VRYKHRFSSVPPDDND  893
              E+LE+AK+E+ +Q G V+  SN +++    R RRPG+ G+S  V+Y+H + ++   +  
Sbjct  63    FERLEDAKKEMAKQTGRVSIGSNQSSMAMAPRPRRPGMPGRSRTVKYQHLYPTMSFQETS  122

Query  894   TD--MSSQETFKQDDLCALKSDLQKENSNDVeleeleltglitekegRVNAILDELLSRD  1067
              +  +S      Q +  +    LQ   S +V LEE EL   + + E RV+ +LDELL+ D
Sbjct  123   IEDILSPSNPGSQQETVSQAVALQLMESTNVALEESELAASMAKAEKRVDKLLDELLACD  182

Query  1068  AKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDA-RTDYMTLGERIPKARKSVLGLPNS  1244
              ++LD D  +++LQ++ Q+K  D+  L +PE     RT+   LG  +PK R  +  + N 
Sbjct  183   CEELDGDGAVTLLQDRLQVKSLDIEKLNLPELLYVQRTNLNALGGNLPKPRNVLSHIHNL  242

Query  1245  DKRTSG--KRQWEESPQSNLtsptppkspfssLALLRKQVLKSNPLRDP-FSPLNIDLND  1415
              +RT    K+Q   +  S+  SP PPKS  +SLALLRK +L+SNP  +P    L I+ +D
Sbjct  243   PRRTLTPMKQQIAGNSTSSFGSPAPPKSQLASLALLRKHILQSNPPTNPVLKSLIIEEDD  302

Query  1416  INKNSDQVGLVKDFSKSGNLHGESNIKGMNVSDHQADRSAETNAQSSNIDISHSGSHAQM  1595
                 +     V   + + NL    +  G +V   ++  SAE   ++SN+ + +  ++  +
Sbjct  303   TTAGNSSPTEVAVKALNDNLTSLGS--GSDVRPSKS--SAEV--ENSNVGVDNGITYEYL  356

Query  1596  ----GDCDGHTDAGHMVTRGLEQLNNEQSLEKNSGGETIAAGQGD----SHGSMERCNGW  1751
                 GD D  T+  + +   +E +  +++++K+  G   + G G     S  S E  N  
Sbjct  357   SQLGGDADVQTNGPNELEDMVEDI-QQKAVDKSLNGNLSSLGSGSIVCPSKTSAEVENSN  415

Query  1752  NHMDIRTADENSGMQNRDTEVQ  1817
               +D    DENS ++  D ++Q
Sbjct  416   IGVDDGVIDENSSLRGGDVDIQ  437


 Score =   109 bits (272),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 74/103 (72%), Gaps = 5/103 (5%)
 Frame = +3

Query  2190  TKKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGR  2369
             T KQ ++ SC    R+ ++L  R SLA +GT +E GVRRS RI+SRPLE+WKGER L+GR
Sbjct  457   TNKQTKEKSCTAKGRKYRSLSRRQSLAASGTSWETGVRRSTRIRSRPLEYWKGERFLYGR  516

Query  2370  VNESM-KLVGVKYVSP----SLGNMKVKSYISDEYKEVVDLAA  2483
             ++ S+  ++G+KY SP        +KVKS++SDEYK +V+LAA
Sbjct  517   IHGSLATVIGIKYESPQNDKGKPALKVKSFVSDEYKNLVELAA  559



>ref|XP_006595147.1| PREDICTED: uncharacterized protein LOC547764 isoform X4 [Glycine 
max]
Length=805

 Score =   169 bits (429),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 142/381 (37%), Positives = 217/381 (57%), Gaps = 34/381 (9%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEPNN----LNSIHQLMKSMGLRNAEKLLEESKAI  482
             DPL  + GL L PQ          PS+P N    L++IH  ++SM LR+  KL+ ++K+I
Sbjct  10    DPLSNYWGLSLFPQ------PSFPPSKPYNSDQDLHTIHTHLRSMALRSPAKLVHQAKSI  63

Query  483   VDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNI-  659
             VD   ++ N+       S   +D      E E  R  RPGLG KR RFSMKP T +P++ 
Sbjct  64    VDGNPQLFNSENSNHPTSQKTND-----AEGEFRRNPRPGLGLKRPRFSMKP-TKKPSVE  117

Query  660   SLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILG  839
             SL  +LD+D L+DP E+FLA E+LENAK+E+ +Q+G  + +S+ +N+    R+RRPG+LG
Sbjct  118   SLLPTLDLDSLKDPAEFFLAHERLENAKREIQKQLGGASFESDQDNVAARPRQRRPGLLG  177

Query  840   KS---VRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltgl  1010
              +   ++YKHR+   P + +D  +SSQET     L  +  +  K  ++ +   E E+   
Sbjct  178   NNQLPIKYKHRY---PKETSDDVLSSQETLGSQSLAPVTENTDKGEAS-MASSEKEVIDS  233

Query  1011  itekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDAR-TDYM  1187
                K   ++ +LD LL  D++DL+ D  +++LQE+ Q+KP  L    +P+FPD +  D  
Sbjct  234   SGTKGIELDELLDGLLHCDSEDLEGDGAITLLQERLQIKPIALEKFSVPDFPDKQMVDLK  293

Query  1188  TLGERIPKARKSVLGLP--------NSDKRTSGKRQWEESPQSNLtsptppkspfssLAL  1343
             +L     K RK++  +         N +K+T  K+   + P   L SPTPP+SPF+SL+L
Sbjct  294   SLQGNKSKPRKALSDIDNLLKGMSMNMNKKTPLKKAV-QCPVQQLASPTPPRSPFASLSL  352

Query  1344  LRKQVLKSNPLRDPFSPLNID  1406
             L+K + +S    DPFS   ID
Sbjct  353   LQKHISQSKQSMDPFSAHEID  373


 Score =   105 bits (261),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 95/147 (65%), Gaps = 11/147 (7%)
 Frame = +3

Query  2079  NP-SDQSNSAAVQNHSVDMQSALPDINPEQHIMKQH-----PLTKKQPRKNSCMPGNRER  2240
             NP +DQ N A  + +SVD ++   D +PE  + ++      P+   Q R  S +    + 
Sbjct  660   NPLADQPNPAGYEANSVDKRARRSDDDPEHCLQEKTDGSMVPVNG-QKRVKSLVQKVSKN  718

Query  2241  KALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPS  2417
             K L  R SLA AGT + +G+RRS RI++RPLE+WKGERL++GRV++S+  ++GVK +SP 
Sbjct  719   KKLSNRHSLAAAGTSWTSGLRRSTRIRTRPLEYWKGERLVYGRVHKSLATVIGVKCISPG  778

Query  2418  LGN---MKVKSYISDEYKEVVDLAARY  2489
                   MKVKSY+SD++KE+ +LA+ Y
Sbjct  779   SDGKPIMKVKSYVSDKHKELFELASLY  805



>ref|XP_006595146.1| PREDICTED: uncharacterized protein LOC547764 isoform X3 [Glycine 
max]
Length=807

 Score =   169 bits (429),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 142/381 (37%), Positives = 217/381 (57%), Gaps = 34/381 (9%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEPNN----LNSIHQLMKSMGLRNAEKLLEESKAI  482
             DPL  + GL L PQ          PS+P N    L++IH  ++SM LR+  KL+ ++K+I
Sbjct  10    DPLSNYWGLSLFPQ------PSFPPSKPYNSDQDLHTIHTHLRSMALRSPAKLVHQAKSI  63

Query  483   VDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNI-  659
             VD   ++ N+       S   +D      E E  R  RPGLG KR RFSMKP T +P++ 
Sbjct  64    VDGNPQLFNSENSNHPTSQKTND-----AEGEFRRNPRPGLGLKRPRFSMKP-TKKPSVE  117

Query  660   SLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILG  839
             SL  +LD+D L+DP E+FLA E+LENAK+E+ +Q+G  + +S+ +N+    R+RRPG+LG
Sbjct  118   SLLPTLDLDSLKDPAEFFLAHERLENAKREIQKQLGGASFESDQDNVAARPRQRRPGLLG  177

Query  840   KS---VRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltgl  1010
              +   ++YKHR+   P + +D  +SSQET     L  +  +  K  ++ +   E E+   
Sbjct  178   NNQLPIKYKHRY---PKETSDDVLSSQETLGSQSLAPVTENTDKGEAS-MASSEKEVIDS  233

Query  1011  itekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDAR-TDYM  1187
                K   ++ +LD LL  D++DL+ D  +++LQE+ Q+KP  L    +P+FPD +  D  
Sbjct  234   SGTKGIELDELLDGLLHCDSEDLEGDGAITLLQERLQIKPIALEKFSVPDFPDKQMVDLK  293

Query  1188  TLGERIPKARKSVLGLP--------NSDKRTSGKRQWEESPQSNLtsptppkspfssLAL  1343
             +L     K RK++  +         N +K+T  K+   + P   L SPTPP+SPF+SL+L
Sbjct  294   SLQGNKSKPRKALSDIDNLLKGMSMNMNKKTPLKKAV-QCPVQQLASPTPPRSPFASLSL  352

Query  1344  LRKQVLKSNPLRDPFSPLNID  1406
             L+K + +S    DPFS   ID
Sbjct  353   LQKHISQSKQSMDPFSAHEID  373


 Score =   104 bits (260),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 95/147 (65%), Gaps = 11/147 (7%)
 Frame = +3

Query  2079  NP-SDQSNSAAVQNHSVDMQSALPDINPEQHIMKQH-----PLTKKQPRKNSCMPGNRER  2240
             NP +DQ N A  + +SVD ++   D +PE  + ++      P+   Q R  S +    + 
Sbjct  662   NPLADQPNPAGYEANSVDKRARRSDDDPEHCLQEKTDGSMVPVNG-QKRVKSLVQKVSKN  720

Query  2241  KALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPS  2417
             K L  R SLA AGT + +G+RRS RI++RPLE+WKGERL++GRV++S+  ++GVK +SP 
Sbjct  721   KKLSNRHSLAAAGTSWTSGLRRSTRIRTRPLEYWKGERLVYGRVHKSLATVIGVKCISPG  780

Query  2418  LGN---MKVKSYISDEYKEVVDLAARY  2489
                   MKVKSY+SD++KE+ +LA+ Y
Sbjct  781   SDGKPIMKVKSYVSDKHKELFELASLY  807



>ref|XP_003542108.1| PREDICTED: uncharacterized protein LOC547764 isoform X1 [Glycine 
max]
Length=817

 Score =   169 bits (429),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 142/381 (37%), Positives = 217/381 (57%), Gaps = 34/381 (9%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEPNN----LNSIHQLMKSMGLRNAEKLLEESKAI  482
             DPL  + GL L PQ          PS+P N    L++IH  ++SM LR+  KL+ ++K+I
Sbjct  10    DPLSNYWGLSLFPQP------SFPPSKPYNSDQDLHTIHTHLRSMALRSPAKLVHQAKSI  63

Query  483   VDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNI-  659
             VD   ++ N+       S   +D      E E  R  RPGLG KR RFSMKP T +P++ 
Sbjct  64    VDGNPQLFNSENSNHPTSQKTND-----AEGEFRRNPRPGLGLKRPRFSMKP-TKKPSVE  117

Query  660   SLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILG  839
             SL  +LD+D L+DP E+FLA E+LENAK+E+ +Q+G  + +S+ +N+    R+RRPG+LG
Sbjct  118   SLLPTLDLDSLKDPAEFFLAHERLENAKREIQKQLGGASFESDQDNVAARPRQRRPGLLG  177

Query  840   KS---VRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltgl  1010
              +   ++YKHR+   P + +D  +SSQET     L  +  +  K  ++ +   E E+   
Sbjct  178   NNQLPIKYKHRY---PKETSDDVLSSQETLGSQSLAPVTENTDKGEAS-MASSEKEVIDS  233

Query  1011  itekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDAR-TDYM  1187
                K   ++ +LD LL  D++DL+ D  +++LQE+ Q+KP  L    +P+FPD +  D  
Sbjct  234   SGTKGIELDELLDGLLHCDSEDLEGDGAITLLQERLQIKPIALEKFSVPDFPDKQMVDLK  293

Query  1188  TLGERIPKARKSVLGLP--------NSDKRTSGKRQWEESPQSNLtsptppkspfssLAL  1343
             +L     K RK++  +         N +K+T  K+   + P   L SPTPP+SPF+SL+L
Sbjct  294   SLQGNKSKPRKALSDIDNLLKGMSMNMNKKTPLKKAV-QCPVQQLASPTPPRSPFASLSL  352

Query  1344  LRKQVLKSNPLRDPFSPLNID  1406
             L+K + +S    DPFS   ID
Sbjct  353   LQKHISQSKQSMDPFSAHEID  373


 Score =   105 bits (262),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 113/190 (59%), Gaps = 19/190 (10%)
 Frame = +3

Query  1950  IQNNVSCRTDEHVEDMPSMSAFPEEQEHNGNDAHTSENWSGNQNP-SDQSNSAAVQNHSV  2126
             I+ N SC++++ ++   +M  F      +G + +         NP +DQ N A  + +SV
Sbjct  637   IEVNASCQSEDKMQ-AENMQTFTASIPTDGMNLNV-------LNPLADQPNPAGYEANSV  688

Query  2127  DMQSALPDINPEQHIMKQH-----PLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFE  2291
             D ++   D +PE  + ++      P+   Q R  S +    + K L  R SLA AGT + 
Sbjct  689   DKRARRSDDDPEHCLQEKTDGSMVPVNG-QKRVKSLVQKVSKNKKLSNRHSLAAAGTSWT  747

Query  2292  NGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSLGN---MKVKSYISDEY  2459
             +G+RRS RI++RPLE+WKGERL++GRV++S+  ++GVK +SP       MKVKSY+SD++
Sbjct  748   SGLRRSTRIRTRPLEYWKGERLVYGRVHKSLATVIGVKCISPGSDGKPIMKVKSYVSDKH  807

Query  2460  KEVVDLAARY  2489
             KE+ +LA+ Y
Sbjct  808   KELFELASLY  817



>gb|KHN44134.1| hypothetical protein glysoja_031795 [Glycine soja]
Length=817

 Score =   169 bits (429),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 142/381 (37%), Positives = 217/381 (57%), Gaps = 34/381 (9%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEPNN----LNSIHQLMKSMGLRNAEKLLEESKAI  482
             DPL  + GL L PQ          PS+P N    L++IH  ++SM LR+  KL+ ++K+I
Sbjct  10    DPLSNYWGLSLFPQP------SFPPSKPYNSDQDLHTIHTHLRSMALRSPAKLVHQAKSI  63

Query  483   VDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNI-  659
             VD   ++ N+       S   +D      E E  R  RPGLG KR RFSMKP T +P++ 
Sbjct  64    VDGNPQLFNSENSNHPTSQKTND-----AEGEFRRNPRPGLGLKRPRFSMKP-TKKPSVE  117

Query  660   SLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILG  839
             SL  +LD+D L+DP E+FLA E+LENAK+E+ +Q+G  + +S+ +N+    R+RRPG+LG
Sbjct  118   SLLPTLDLDSLKDPAEFFLAHERLENAKREIQKQLGGASFESDQDNVAARPRQRRPGLLG  177

Query  840   KS---VRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltgl  1010
              +   ++YKHR+   P + +D  +SSQET     L  +  +  K  ++ +   E E+   
Sbjct  178   NNQLPIKYKHRY---PKETSDDVLSSQETLGSQSLAPVTENTDKGEAS-MASSEKEVIDS  233

Query  1011  itekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDAR-TDYM  1187
                K   ++ +LD LL  D++DL+ D  +++LQE+ Q+KP  L    +P+FPD +  D  
Sbjct  234   SGTKGIELDELLDGLLHCDSEDLEGDGAITLLQERLQIKPIALEKFSVPDFPDEQMVDLK  293

Query  1188  TLGERIPKARKSVLGLP--------NSDKRTSGKRQWEESPQSNLtsptppkspfssLAL  1343
             +L     K RK++  +         N +K+T  K+   + P   L SPTPP+SPF+SL+L
Sbjct  294   SLQGNKSKPRKALSDIDNLLKGMSMNMNKKTPLKKAV-QCPVQQLASPTPPRSPFASLSL  352

Query  1344  LRKQVLKSNPLRDPFSPLNID  1406
             L+K + +S    DPFS   ID
Sbjct  353   LQKHISQSKQSMDPFSAHEID  373


 Score =   105 bits (262),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 113/190 (59%), Gaps = 19/190 (10%)
 Frame = +3

Query  1950  IQNNVSCRTDEHVEDMPSMSAFPEEQEHNGNDAHTSENWSGNQNP-SDQSNSAAVQNHSV  2126
             I+ N SC++++ ++   +M  F      +G + +         NP +DQ N A  + +SV
Sbjct  637   IEVNASCQSEDKMQ-AENMQTFTASIPTDGMNLNV-------LNPLADQPNPAGYEANSV  688

Query  2127  DMQSALPDINPEQHIMKQH-----PLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFE  2291
             D ++   D +PE  + ++      P+   Q R  S +    + K L  R SLA AGT + 
Sbjct  689   DKRARRSDDDPEHCLQEKTDGSMVPVNG-QKRVKSLVQKVSKNKKLSNRHSLAAAGTSWT  747

Query  2292  NGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSLGN---MKVKSYISDEY  2459
             +G+RRS RI++RPLE+WKGERL++GRV++S+  ++GVK +SP       MKVKSY+SD++
Sbjct  748   SGLRRSTRIRTRPLEYWKGERLVYGRVHKSLATVIGVKCISPGSDGKPIMKVKSYVSDKH  807

Query  2460  KEVVDLAARY  2489
             KE+ +LA+ Y
Sbjct  808   KELFELASLY  817



>ref|XP_006595145.1| PREDICTED: uncharacterized protein LOC547764 isoform X2 [Glycine 
max]
Length=815

 Score =   169 bits (429),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 142/381 (37%), Positives = 217/381 (57%), Gaps = 34/381 (9%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEPNN----LNSIHQLMKSMGLRNAEKLLEESKAI  482
             DPL  + GL L PQ          PS+P N    L++IH  ++SM LR+  KL+ ++K+I
Sbjct  10    DPLSNYWGLSLFPQP------SFPPSKPYNSDQDLHTIHTHLRSMALRSPAKLVHQAKSI  63

Query  483   VDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNI-  659
             VD   ++ N+       S   +D      E E  R  RPGLG KR RFSMKP T +P++ 
Sbjct  64    VDGNPQLFNSENSNHPTSQKTND-----AEGEFRRNPRPGLGLKRPRFSMKP-TKKPSVE  117

Query  660   SLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILG  839
             SL  +LD+D L+DP E+FLA E+LENAK+E+ +Q+G  + +S+ +N+    R+RRPG+LG
Sbjct  118   SLLPTLDLDSLKDPAEFFLAHERLENAKREIQKQLGGASFESDQDNVAARPRQRRPGLLG  177

Query  840   KS---VRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltgl  1010
              +   ++YKHR+   P + +D  +SSQET     L  +  +  K  ++ +   E E+   
Sbjct  178   NNQLPIKYKHRY---PKETSDDVLSSQETLGSQSLAPVTENTDKGEAS-MASSEKEVIDS  233

Query  1011  itekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDAR-TDYM  1187
                K   ++ +LD LL  D++DL+ D  +++LQE+ Q+KP  L    +P+FPD +  D  
Sbjct  234   SGTKGIELDELLDGLLHCDSEDLEGDGAITLLQERLQIKPIALEKFSVPDFPDKQMVDLK  293

Query  1188  TLGERIPKARKSVLGLP--------NSDKRTSGKRQWEESPQSNLtsptppkspfssLAL  1343
             +L     K RK++  +         N +K+T  K+   + P   L SPTPP+SPF+SL+L
Sbjct  294   SLQGNKSKPRKALSDIDNLLKGMSMNMNKKTPLKKAV-QCPVQQLASPTPPRSPFASLSL  352

Query  1344  LRKQVLKSNPLRDPFSPLNID  1406
             L+K + +S    DPFS   ID
Sbjct  353   LQKHISQSKQSMDPFSAHEID  373


 Score =   109 bits (272),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 112/190 (59%), Gaps = 21/190 (11%)
 Frame = +3

Query  1950  IQNNVSCRTDEHVEDMPSMSAFPEEQEHNGNDAHTSENWSGNQNP-SDQSNSAAVQNHSV  2126
             I+ N SC++++  E+M + +A       N N            NP +DQ N A  + +SV
Sbjct  637   IEVNASCQSEDKAENMQTFTASIPTDGMNLNVL----------NPLADQPNPAGYEANSV  686

Query  2127  DMQSALPDINPEQHIMKQH-----PLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFE  2291
             D ++   D +PE  + ++      P+   Q R  S +    + K L  R SLA AGT + 
Sbjct  687   DKRARRSDDDPEHCLQEKTDGSMVPVNG-QKRVKSLVQKVSKNKKLSNRHSLAAAGTSWT  745

Query  2292  NGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSLGN---MKVKSYISDEY  2459
             +G+RRS RI++RPLE+WKGERL++GRV++S+  ++GVK +SP       MKVKSY+SD++
Sbjct  746   SGLRRSTRIRTRPLEYWKGERLVYGRVHKSLATVIGVKCISPGSDGKPIMKVKSYVSDKH  805

Query  2460  KEVVDLAARY  2489
             KE+ +LA+ Y
Sbjct  806   KELFELASLY  815



>gb|AAU04630.1| CENP-C [Solanum lycopersicum]
Length=138

 Score =   150 bits (379),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 78/135 (58%), Positives = 100/135 (74%), Gaps = 4/135 (3%)
 Frame = +3

Query  2085  SDQSNSAAVQNHSVDMQSALPDINPEQHIMKQHPLTKKQPRKNSCMPGNRERKALKFRPS  2264
             SDQ NS  V+  S D++   P+++P+ H   +     KQ +      G RERK L  RPS
Sbjct  8     SDQLNSVGVEVPSRDVRPKFPEMSPQHHKQAK----DKQQKAKELAVGRRERKHLSSRPS  63

Query  2265  LADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESMKLVGVKYVSPSLGNMKVKSY  2444
             LADAGT FE+GVRRSKR+K+RPLE+WKGERLL+GRV+E +KLVG+KY+SP  G+ KVKSY
Sbjct  64    LADAGTSFESGVRRSKRMKTRPLEYWKGERLLYGRVDEGLKLVGLKYISPGKGSFKVKSY  123

Query  2445  ISDEYKEVVDLAARY  2489
             I D+YK++VDLAARY
Sbjct  124   IPDDYKDLVDLAARY  138



>gb|AAU04617.1| CENP-C [Medicago truncatula]
 gb|KEH19741.1| centromere C-like protein [Medicago truncatula]
Length=697

 Score =   162 bits (409),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 140/379 (37%), Positives = 220/379 (58%), Gaps = 30/379 (8%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEP-NNLNSIHQLMKSMGLRNAEKLLEESKAIVDN  491
             DP+  ++GL L   T  +Q      S P ++L++I+  ++SM L +  +L E+ ++I++N
Sbjct  10    DPIANYSGLSLFRSTFSLQPS----SNPFHDLDAINNNLRSMDLGSPTRLAEQGQSILEN  65

Query  492   GSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLG--RKRARFSMKPDTSQPNIS-  662
                 L  N       ++ DD  A +  +E PR+RRPGLG  R R RFS+KP T +P++  
Sbjct  66    N---LGFNTENLTQDVENDDVFAVEEGEEFPRKRRPGLGLNRARPRFSLKP-TKKPSVED  121

Query  663   LQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILGK  842
             L  SLD+   +DPEE+FLA E+ ENA++EL +Q+G+V+ + N ++  T  R RRPG+ G 
Sbjct  122   LLPSLDIKDHKDPEEFFLAHERRENARRELQKQLGIVSSEPNQDS--TKPRDRRPGLPGF  179

Query  843   S---VRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSN----DVeleelel  1001
             +   V+Y+HRFS    D+N   +SSQE F+ D+L     DL  +N++         + E+
Sbjct  180   NRGPVKYRHRFSQETLDNNVDVLSSQEVFESDNL-----DLVGDNTDTGDASPTSLDNEV  234

Query  1002  tglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDAR-T  1178
              G    +E + N IL  LL+ ++++L+ D  +++LQE+  +KP     L +P+FPD +  
Sbjct  235   AGSPAVEENKGNDILQGLLTCNSEELEGDGAMNLLQERLNIKPIVFEKLSVPDFPDIQPI  294

Query  1179  DYMTLGERIPKARKSVLGLPNSDKRTSGK---RQWEESPQSNLtsptppkspfssLALLR  1349
             D   L E   K RK++  + N   R   K   R+     +  L SPTPP+SPF+SL+ L+
Sbjct  295   DLKFLRENSSKPRKALSNIDNLLNRIDIKTPLRRDVGYTEKQLGSPTPPRSPFASLSKLQ  354

Query  1350  KQVLKSNPLRDPFSPLNID  1406
             KQ+L+S P  DPFS   ID
Sbjct  355   KQILRSKPSVDPFSAHEID  373


 Score =   104 bits (260),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 95/147 (65%), Gaps = 12/147 (8%)
 Frame = +3

Query  2085  SDQSNSAAVQNH---SVDMQSALPDINPEQHIMKQ-----HPLTKKQPRKNSCMPGNRER  2240
             +DQSN++    H   S+D +S   +  PE  + +       P+  ++  K      ++ +
Sbjct  551   ADQSNASNQDEHQANSMDKRSGRSNDGPELSLQENTVGSVAPVNGQKRVKVCAQKVSKGK  610

Query  2241  KALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESMK-LVGVKYVSP-  2414
             K  + R SLADAGT +E+GVRRSKR ++RPLE+WKGER+++GRV+ES+  ++GVK  SP 
Sbjct  611   KREQHRMSLADAGTSWESGVRRSKRFRTRPLEYWKGERMVYGRVHESLSTVIGVKRFSPG  670

Query  2415  --SLGNMKVKSYISDEYKEVVDLAARY  2489
                  NMKVKS++SD+YK++ ++A+ Y
Sbjct  671   GDGKPNMKVKSFVSDKYKQLFEIASLY  697



>ref|XP_004511206.1| PREDICTED: uncharacterized protein LOC101510656, partial [Cicer 
arietinum]
Length=671

 Score =   159 bits (403),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 139/385 (36%), Positives = 223/385 (58%), Gaps = 29/385 (8%)
 Frame = +3

Query  381   SIPS-EP-NNLNSIHQLMKSMGLRNAEKLLEESKAIVDNGSEILNANFPRFKASLDLDDH  554
             S+PS EP ++ +SIH  ++SM L++  KL+E++K+I ++  E +  N  +    +  D  
Sbjct  2     SLPSSEPFHDFDSIHNHLRSMALQSPAKLVEQAKSISEDNYEFVTENLTQ---DVGNDVV  58

Query  555   VAAKVEKEMPRERRPGLG--RKRARFSMKPDTSQPNIS-LQSSLDVDKLQDPEEYFLACE  725
             VA++  +E PR+RRPGLG  R R RFS+KP T +P++  L   LD+  L+DP E+F A E
Sbjct  59    VASEEGEEFPRKRRPGLGLNRARPRFSLKP-TKKPSVEDLLPILDLKALKDPVEFFAAHE  117

Query  726   KLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILG---KSVRYKHRFSSVPPDDNDT  896
             K ENAK+E+ +Q+G +   S +N      R RRPG+ G   + +RY+HR S++  D+ND 
Sbjct  118   KRENAKREIQKQLGFLP--SELNQDSNKPRERRPGLPGLNRRPIRYRHRSSTITLDNNDD  175

Query  897   DMSSQETFKQDDLCALKSDLQKENSNDVeleeleltglitekegRVNAILDELLSRDAKD  1076
              +SSQE F+ D +  +  +  K+ ++ +   + E+TG    +E  VN +L  LLS +++D
Sbjct  176   VLSSQEAFESDSINPVNDNTDKDKAS-LASLDTEVTGSSAIQEKEVNDVLQGLLSCNSED  234

Query  1077  LDDDRVLSILQEQFQMKPPDLSALCMPEFPDAR-TDYMTLGERIPKARKSVLGLPNSDKR  1253
             L+ D  +++LQE+ Q+KP     L +P+FPD +  D   L   + K RK++  + N  K 
Sbjct  235   LEGDGAMNLLQERLQIKPIVPEILSVPDFPDYQPIDLKLLRGNLSKPRKALSDVDNLLKG  294

Query  1254  TSGK---RQWEESPQSNLtsptppkspfssLALLRKQVLKSNPLRDPFSPLNIDLNDINK  1424
              + K   R+     +  L SPTPP+SPF+SL  L+K + +S P  DPF+   I       
Sbjct  295   INIKTPLRRDAGCIEKQLASPTPPRSPFASLLSLQKHISQSKPSVDPFATHEI-------  347

Query  1425  NSDQVGLVKDFSKSGNLHGESNIKG  1499
               D V   +++S +  +H E N  G
Sbjct  348   --DHVS-TRNYSPTHMIHQEVNTDG  369


 Score =   108 bits (270),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 94/144 (65%), Gaps = 9/144 (6%)
 Frame = +3

Query  2085  SDQSNSAAVQNHSVDMQSALPDINPEQHIMKQ-----HPLTKKQPRKNSCMPGNRERKAL  2249
             +DQSN    Q  S++ QS   D  PEQ + ++      P+  ++  K      ++ +K L
Sbjct  528   ADQSNPVGFQASSMNKQSRRSDDGPEQCLQEKTVGSVAPVNGQKRVKLRVQKESKGKKKL  587

Query  2250  KFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSLG-  2423
               R SLADAGT +E+GVRRS R ++RPLE+WKGER+++GRV++S+  ++GVK +SP    
Sbjct  588   VQRKSLADAGTSWESGVRRSTRFRTRPLEYWKGERMVYGRVHQSLTTVIGVKCMSPGSDG  647

Query  2424  --NMKVKSYISDEYKEVVDLAARY  2489
                MKVKS++SD+YKE+ ++A+ +
Sbjct  648   KPTMKVKSFVSDKYKELFEIASLH  671



>ref|XP_010691264.1| PREDICTED: uncharacterized protein LOC104904646 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=716

 Score =   158 bits (400),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 135/391 (35%), Positives = 202/391 (52%), Gaps = 49/391 (13%)
 Frame = +3

Query  288   TEPLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPS----EPNN--LNSIHQLMKSMGLRN  449
             TE    D  DPL  ++ L L P+T    S  S  S    +PN+  LNSI   +K+  L +
Sbjct  5     TETEGSDLVDPLADYSSLSLFPRTFSSLSTSSSSSIDLRKPNSPILNSILTHLKAKVLSS  64

Query  450   AEKLLEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFS  629
              +K+L+++K IV+      + NF      L  D   A    +++PRERRP LG KRA+FS
Sbjct  65    PDKMLKQAKPIVE-----YSLNF------LKTDKTEAIAENEKVPRERRPALGLKRAKFS  113

Query  630   MKPDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTT  809
              KP  SQP+ SL+ S+DVDKL DPEE F A E++ENAK+E+ R  G    D + N     
Sbjct  114   AKPMPSQPDASLEFSIDVDKLSDPEELFSAFERMENAKKEVQRLRGEPLFDLDQNRASLA  173

Query  810   ARRRRPGILGKSVRYKHR-FSSVPPDDND-TDMSSQETFKQDDLCALKSDLQKENSNDVe  983
              R RRP +LG+S  Y HR +SS    D D T + SQET   + L   + D+   ++N V 
Sbjct  174   RRPRRPSLLGRSSTYTHRPYSSKSMADVDETLLPSQETIYDEILSPTRDDVLP-HANVVN  232

Query  984   leeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEF  1163
                  +      +     +  DELLS + + LD+D V ++L+++ Q+KP ++    +P +
Sbjct  233   HSPSVVLSDSKSRTTSKVSEFDELLSSNYEGLDEDEVENLLRDKLQIKPVEIGKAALPNW  292

Query  1164  PDARTDYMTLGERIPK----------ARKSVLGLPNSDKRTSGKRQWEESPQSNLtsptp  1313
                  + MT    +PK          ARK+V    +SDK +  K Q   SP ++      
Sbjct  293   RVQLRESMTSSLALPKVNNMVSHRSAARKAVR---SSDKVSPAKSQ---SPLAS------  340

Query  1314  pkspfssLALLRKQVLKSNPLRDPFSPLNID  1406
                    ++LL + + K  P +DPFSP++I+
Sbjct  341   -------ISLLNRHIAKRTPSKDPFSPIHIN  364


 Score = 95.9 bits (237),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 69/101 (68%), Gaps = 5/101 (5%)
 Frame = +3

Query  2196  KQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVN  2375
             K+ +     P   +R   + R SL  AGT +E GVRRS RI+ RPL++WKGER L+GRV+
Sbjct  614   KKRKVQGAQPRRSKRDLQQRRTSLYCAGTKWEAGVRRSTRIRMRPLQYWKGERFLYGRVH  673

Query  2376  ESM-KLVGVKYVSPSL----GNMKVKSYISDEYKEVVDLAA  2483
             ES+  ++GVKY SPS       +KVKS++SD+YK++V+ A+
Sbjct  674   ESLVTVIGVKYASPSKDTEEAGVKVKSFVSDKYKDMVEFAS  714



>ref|XP_010691265.1| PREDICTED: uncharacterized protein LOC104904646 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=715

 Score =   158 bits (400),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 135/391 (35%), Positives = 202/391 (52%), Gaps = 49/391 (13%)
 Frame = +3

Query  288   TEPLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPS----EPNN--LNSIHQLMKSMGLRN  449
             TE    D  DPL  ++ L L P+T    S  S  S    +PN+  LNSI   +K+  L +
Sbjct  5     TETEGSDLVDPLADYSSLSLFPRTFSSLSTSSSSSIDLRKPNSPILNSILTHLKAKVLSS  64

Query  450   AEKLLEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFS  629
              +K+L+++K IV+      + NF      L  D   A    +++PRERRP LG KRA+FS
Sbjct  65    PDKMLKQAKPIVE-----YSLNF------LKTDKTEAIAENEKVPRERRPALGLKRAKFS  113

Query  630   MKPDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTT  809
              KP  SQP+ SL+ S+DVDKL DPEE F A E++ENAK+E+ R  G    D + N     
Sbjct  114   AKPMPSQPDASLEFSIDVDKLSDPEELFSAFERMENAKKEVQRLRGEPLFDLDQNRASLA  173

Query  810   ARRRRPGILGKSVRYKHR-FSSVPPDDND-TDMSSQETFKQDDLCALKSDLQKENSNDVe  983
              R RRP +LG+S  Y HR +SS    D D T + SQET   + L   + D+   ++N V 
Sbjct  174   RRPRRPSLLGRSSTYTHRPYSSKSMADVDETLLPSQETIYDEILSPTRDDVLP-HANVVN  232

Query  984   leeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEF  1163
                  +      +     +  DELLS + + LD+D V ++L+++ Q+KP ++    +P +
Sbjct  233   HSPSVVLSDSKSRTTSKVSEFDELLSSNYEGLDEDEVENLLRDKLQIKPVEIGKAALPNW  292

Query  1164  PDARTDYMTLGERIPK----------ARKSVLGLPNSDKRTSGKRQWEESPQSNLtsptp  1313
                  + MT    +PK          ARK+V    +SDK +  K Q   SP ++      
Sbjct  293   RVQLRESMTSSLALPKVNNMVSHRSAARKAVR---SSDKVSPAKSQ---SPLAS------  340

Query  1314  pkspfssLALLRKQVLKSNPLRDPFSPLNID  1406
                    ++LL + + K  P +DPFSP++I+
Sbjct  341   -------ISLLNRHIAKRTPSKDPFSPIHIN  364


 Score = 95.5 bits (236),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 69/101 (68%), Gaps = 5/101 (5%)
 Frame = +3

Query  2196  KQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVN  2375
             K+ +     P   +R   + R SL  AGT +E GVRRS RI+ RPL++WKGER L+GRV+
Sbjct  613   KKRKVQGAQPRRSKRDLQQRRTSLYCAGTKWEAGVRRSTRIRMRPLQYWKGERFLYGRVH  672

Query  2376  ESM-KLVGVKYVSPSL----GNMKVKSYISDEYKEVVDLAA  2483
             ES+  ++GVKY SPS       +KVKS++SD+YK++V+ A+
Sbjct  673   ESLVTVIGVKYASPSKDTEEAGVKVKSFVSDKYKDMVEFAS  713



>ref|XP_007150679.1| hypothetical protein PHAVU_005G1725000g, partial [Phaseolus vulgaris]
 gb|ESW22673.1| hypothetical protein PHAVU_005G1725000g, partial [Phaseolus vulgaris]
Length=698

 Score =   157 bits (396),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 140/404 (35%), Positives = 229/404 (57%), Gaps = 45/404 (11%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEPNN----LNSIHQLMKSMGLRNAEKLLEESKAI  482
             DPL  + G+ L        S    PS+P N    L++IH  +KSM LR+  KL++E+K  
Sbjct  10    DPLANYWGISLF------TSPSLPPSQPYNSDLDLHTIHSHLKSMALRSPAKLVQEAKLA  63

Query  483   VDNGSEILNANFPRFKASLDLDDHVA-----AKVEKEMPRERRPGLGRKRARFSMKPDTS  647
             +++   + ++    F+ S+     ++     A  + E  RE+RPGLG KR RFSMKP T 
Sbjct  64    LEDDPNLFDSEI--FQDSISQTTSISQTTNDAGEDGEFRREQRPGLGLKRPRFSMKP-TK  120

Query  648   QPNI-SLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRR  824
             +P++ SL  +LD+D L+DP E+FLA E+LENAK+E+ +Q+G  + +S+ ++L T  R+RR
Sbjct  121   KPSVESLLPALDLDSLKDPAEFFLAHERLENAKREIQKQLGGASFESDQDSLSTRPRQRR  180

Query  825   PGILGKS---VRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleel  995
             PG+L      +RYKHR+   P + +++ +SSQ+      L  L   +  + +  +   E 
Sbjct  181   PGLLRNDQLPIRYKHRY---PRETSESVLSSQDALGSQTLDPLAEKIDVDEAY-MISSEK  236

Query  996   eltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDAR  1175
             E+      K    + +LD LLS +++DL+ D  +S+LQE+ Q+KP  +     P FPD++
Sbjct  237   EVMDSSAIKGNEFDELLDGLLSCNSEDLEGDGAISLLQERLQIKPVAVDKFSFPIFPDSQ  296

Query  1176  -TDYMTLGERIP------KARKSVLGLPN------SDKRTSGKRQWEESPQSNLtsptpp  1316
              TD  +L    P      K RK++  + N      ++K+T  KR  + + Q  L+SPTPP
Sbjct  297   VTDLKSLQRNKPLQGNKSKPRKALSDIDNLLKGITTNKKTPLKRSEQFTVQ-QLSSPTPP  355

Query  1317  kspfssLALLRKQVLKSNPLRDPFSPLNIDLNDINKNSDQVGLV  1448
             +SPF+S+  L+K + +S    D FS     L++I+K++ +  LV
Sbjct  356   RSPFASILSLQKHISRSRQSLDSFS-----LDEISKDNSEPNLV  394



>ref|XP_004302929.1| PREDICTED: uncharacterized protein LOC101300739 [Fragaria vesca 
subsp. vesca]
Length=676

 Score =   155 bits (393),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 120/308 (39%), Positives = 178/308 (58%), Gaps = 13/308 (4%)
 Frame = +3

Query  306   DPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPN-NLNSIH-QLMKSMGLRNAEKLLEESKA  479
             DP DPL  F   P    T +V S+ S P + +  L++I+  L  SM  R+   L +++K 
Sbjct  6     DPVDPLLGFTLFP----TAKVSSDLSNPYDFDRELHAINLHLNSSMASRSG--LKDQAKN  59

Query  480   IVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNI  659
             I+   S I  +++   +A   L++ V A V  E  RERR  L  KR RFS+KP+ SQP+I
Sbjct  60    ILSGSSAIQQSDYS--EALKRLNEVVPANV-VENHRERRQALRCKRPRFSLKPNPSQPDI  116

Query  660   SLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILG  839
             SL+S+ D  K ++PEEYF+  E+ ENAK+EL +QMG    D +  N  +  R RRPGI  
Sbjct  117   SLESTFDSKKYKNPEEYFMIYERNENAKRELEKQMGGAIFDGDKQNPSSITRARRPGIPR  176

Query  840   KSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleelelt-glit  1016
             +SV+YKHR S +  +  ++ +S+QETF+   L  L    Q E+   V+LEE++L    + 
Sbjct  177   RSVKYKHRISLLENEIMESAISTQETFETSILSPLSHSAQTESHEKVDLEEMDLAGSEVK  236

Query  1017  ekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDAR-TDYMTL  1193
             E   R N ILD LLS+  ++L+ D  L  L+E F +K  +L  +C+PEFPD +  D+ + 
Sbjct  237   EDNNRNNDILDGLLSQPTEELEGDGALRRLKESFNVKTFELEDICLPEFPDIQMADFKSS  296

Query  1194  GERIPKAR  1217
                +P  R
Sbjct  297   RRTLPNPR  304


 Score = 89.4 bits (220),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 88/147 (60%), Gaps = 10/147 (7%)
 Frame = +3

Query  2079  NPSDQSNSAAVQNHSVDMQSALPDINPEQH--IMKQHP--LTKKQPRKNSCMPGNRERKA  2246
             N   Q +SA V+ H     S   D+  E+   IM+++   L  K    NS     ++ K 
Sbjct  530   NAPSQLDSAPVEEHPRVSLSKNADVGLEEQNEIMQENSGVLLNKPTEANSRSRRKQKNKE  589

Query  2247  LKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSLG  2423
             +  R SLA  GT + +GVRRS RI++RPLE+WKGERLL GRV+ S+  ++G+KY SP  G
Sbjct  590   VSKRQSLAGHGTSWNSGVRRSTRIRTRPLEYWKGERLLIGRVHNSLPTVIGMKYASPGKG  649

Query  2424  ----NMKVKSYI-SDEYKEVVDLAARY  2489
                 ++KVK ++ +DE+K +VDL + +
Sbjct  650   EGKDSLKVKYFVDNDEHKVLVDLVSYH  676



>gb|AAU04614.1| CENP-C [Beta vulgaris subsp. vulgaris]
Length=710

 Score =   154 bits (388),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 134/393 (34%), Positives = 203/393 (52%), Gaps = 50/393 (13%)
 Frame = +3

Query  282   MTTEPLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPS----EPNN--LNSIHQLMKSMGL  443
             + TE    D  DPL  ++ L L P+T    S  S  S    +PN+  LNSI   +K+  L
Sbjct  3     VRTETEGSDLVDPLADYSSLSLFPRTFSSLSTSSSSSIDLRKPNSPILNSILTHLKAKVL  62

Query  444   RNAEKLLEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRAR  623
              + +K+L+++K I+++     + NF      L  D   A    +++PRERRP LG KRA+
Sbjct  63    SSPDKMLKQAKPILED-----SLNF------LKTDKTEAIAENEKVPRERRPALGLKRAK  111

Query  624   FSMKPDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLP  803
             FS KP  SQP+ SL+ S+DVDKL DPEE F A E++ENAK+E+ R  G    D + N   
Sbjct  112   FSAKPMPSQPDASLEFSIDVDKLSDPEELFSAFERMENAKKEVQRLRGEPLFDLDQNRAS  171

Query  804   TTARRRRPGILGKSVRYKHR-FSSVPPDDND-TDMSSQETFKQDDLCALKSDLQKENSND  977
                R RRP +LG S  Y HR +SS    D D T   SQET   + L  ++ D+   ++N 
Sbjct  172   LARRPRRPSLLGSST-YTHRPYSSKSMADVDETLFPSQETIYDEILSPIRDDVLP-HANV  229

Query  978   VeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMP  1157
             V      +      +     +  DELLS + + LD+D V ++L+++ Q+KP ++    +P
Sbjct  230   VNHSPSVILSDSKSRTTSKVSEFDELLSSNYEGLDEDEVENLLRDKLQIKPVEIGKAALP  289

Query  1158  EFPDARTDYMTLGERIPK----------ARKSVLGLPNSDKRTSGKRQWEESPQSNLtsp  1307
              +     + MT    +PK          ARK+V    +SDK +  K Q   SP ++    
Sbjct  290   NWRVQLRESMTSSLALPKVNNMVSHRSAARKAVR---SSDKVSPAKSQ---SPLAS----  339

Query  1308  tppkspfssLALLRKQVLKSNPLRDPFSPLNID  1406
                      ++LL + + K  P +DPFSP++I+
Sbjct  340   ---------ISLLNRHIAKHTPSKDPFSPIHIN  363


 Score = 96.7 bits (239),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 69/101 (68%), Gaps = 5/101 (5%)
 Frame = +3

Query  2196  KQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVN  2375
             K+ +     P   +R   + R SL  AGT +E GVRRS RIK RPL++WKGER L+GRV+
Sbjct  608   KKRKVQGAQPRRSKRDLQQRRTSLYCAGTKWEAGVRRSTRIKMRPLQYWKGERFLYGRVH  667

Query  2376  ESM-KLVGVKYVSPSL----GNMKVKSYISDEYKEVVDLAA  2483
             ES+  ++GVKY SPS       +KVKS++SD+YK++V+ A+
Sbjct  668   ESLVTVIGVKYASPSKDTEEAGVKVKSFVSDKYKDMVEFAS  708



>ref|XP_007160179.1| hypothetical protein PHAVU_002G299500g [Phaseolus vulgaris]
 gb|ESW32173.1| hypothetical protein PHAVU_002G299500g [Phaseolus vulgaris]
Length=558

 Score =   151 bits (382),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 109/307 (36%), Positives = 176/307 (57%), Gaps = 27/307 (9%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEPNN----LNSIHQLMKSMGLRNAEKLLEESKAI  482
             DPL  + G+ L        S    PS+P N    L++IH  +KSM LR+  KL++E+K  
Sbjct  10    DPLANYWGISLF------TSPSLPPSQPYNSDLDLHTIHSHLKSMALRSPAKLVQEAKLA  63

Query  483   VDNGSEILNANFPRFKASLDLDDHVA-----AKVEKEMPRERRPGLGRKRARFSMKPDTS  647
             +D+   + ++    F+ S+     ++     A  + E  RE+RPGLG KR RFSMKP T 
Sbjct  64    LDDDPNLFDSEI--FRDSISQTTSISQTTNDAGEDGEFRREQRPGLGLKRPRFSMKP-TK  120

Query  648   QPNI-SLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRR  824
             +P++ SL  +LD+D L+DP E+FLA E+LENAK+E+ +Q+G  + +S+ ++L T  R+RR
Sbjct  121   KPSVESLLPTLDLDSLKDPAEFFLAHERLENAKREIQKQLGGASFESDQDSLSTRPRQRR  180

Query  825   PGILGKS---VRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleel  995
             PG+L      +RYKHR+   P + +++ +SSQ+      L  L   +  + +  +   E 
Sbjct  181   PGLLRNDQLPIRYKHRY---PRETSESVLSSQDALGSQTLDPLAEKIDVDEAYMI-SSEK  236

Query  996   eltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDAR  1175
             E+      K    + +LD LLS +++DL+ D  +S+LQE+ Q+K   +     P FPD++
Sbjct  237   EVMDSSAIKGNEFDELLDGLLSCNSEDLEGDGAISLLQERLQIKLVAVDKFSFPIFPDSQ  296

Query  1176  -TDYMTL  1193
              TD  +L
Sbjct  297   VTDLKSL  303


 Score = 98.6 bits (244),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 95/146 (65%), Gaps = 11/146 (8%)
 Frame = +3

Query  2085  SDQSNSAAVQNHSVDMQSALPD---INPEQH---IMKQHPLTKKQPRKN-SCMPGNRERK  2243
             +DQS+ A  Q  +VD +++  +    NP ++   I+++      +P KN      +R +K
Sbjct  413   ADQSDPAGYQASAVDKRASRSEDDQSNPTEYQAYIVQEKTDDSMEPVKNQKKRVKSRAKK  472

Query  2244  ALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSL  2420
              +  R SLAD+GT + +G+RRS RI++RPLE+WKGER ++GRV++S+  ++GVK +SP  
Sbjct  473   NVSKRKSLADSGTSWNDGLRRSTRIRTRPLEYWKGERPVYGRVHQSLATVIGVKCMSPGT  532

Query  2421  G---NMKVKSYISDEYKEVVDLAARY  2489
                  MKVKSY+SD +KE+ +LA+ Y
Sbjct  533   DGKPTMKVKSYVSDLHKELFELASLY  558



>ref|XP_010537934.1| PREDICTED: uncharacterized protein LOC104812471 [Tarenaya hassleriana]
 ref|XP_010537935.1| PREDICTED: uncharacterized protein LOC104812471 [Tarenaya hassleriana]
 ref|XP_010537936.1| PREDICTED: uncharacterized protein LOC104812471 [Tarenaya hassleriana]
Length=749

 Score =   145 bits (365),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 151/463 (33%), Positives = 222/463 (48%), Gaps = 47/463 (10%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEP------NNLNSIHQLMKSMGLRNAEKLLEESK  476
             DPL+ ++GL L P+T++  S   IP  P      ++L   H  ++SM  +   +L E++K
Sbjct  12    DPLQVYSGLSLFPRTLKSLS---IPLPPPRLQQSDDLQQTHSFLESMPSKFQSELAEQTK  68

Query  477   AIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPN  656
             AI+D+ SE+LN   P    S D D            RERR GLGRKRARFS+KP TSQPN
Sbjct  69    AILDSSSELLNPGIPVNVVSKD-DSQGIEMNPIANQRERRQGLGRKRARFSLKPTTSQPN  127

Query  657   ISL-QSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGI  833
              ++ + S D  K  +PE++F A EK ENAK+E  +Q G     ++ N      R RRPGI
Sbjct  128   PNVDEPSFDDSKYHNPEDFFAAYEKFENAKREWQKQTGTSLTHTHQNQ--PEIRPRRPGI  185

Query  834   LG-KSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltgl  1010
              G + V Y HR+S        TD  + E    + +      L K N+ +V   + E T  
Sbjct  186   SGRRRVSYNHRYS--------TDGVNLEASDGELVSPCDESLLKNNTANVTTVDEESTDP  237

Query  1011  itekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDARTDYMT  1190
              TE E  V +IL +LLS   + + D   +++L+E  Q+KP D   L +PE  D R     
Sbjct  238   STETEKNVESILGDLLSCSPELVGD---VNLLEECLQIKPIDTEKLSLPELQDVRKSNFM  294

Query  1191  LGERIPKARKSVLGLPNSDKRTSGKRQWEESPQSNLtsptppkspfssLALLRKQVLKSN  1370
               +R     ++VL    SD R   K    E+ + N  +P+P +SP  SL+   K +  SN
Sbjct  295   APQRYSSKPRTVL----SDIRNMLKGIRSETGRKNTQTPSPLQSPGDSLSSQIKHMSPSN  350

Query  1371  PLRDPFS--------PLNIDLNDINKNSDQVGLVKDFSKSGNLHGESNIKGMNVSDHQAD  1526
              L+D FS        P +I    + + S +V    D +K  N++  S+     +S    D
Sbjct  351   -LQDQFSFPDRNHLLPGDISTRALGQQSSEV----DAAKGSNIYSRSS---ATISGDDID  402

Query  1527  RSAETNAQSSNIDISHSGSHAQMG--DCDGHTDAGHMVTRGLE  1649
                 +N    +I   +       G  + D HTD    V+   E
Sbjct  403   NVFPSNVGYGDIGPVNKSVEKTSGELESDTHTDLSRPVSSSAE  445


 Score =   110 bits (276),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 9/94 (10%)
 Frame = +3

Query  2229  NRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKY  2405
             +RE KA   R SLA AGT +E+GVRRS RIKSRPLE+WKGER L+GR++ES+  ++GVKY
Sbjct  654   SRESKAFSRRKSLAAAGTEWESGVRRSTRIKSRPLEYWKGERFLYGRIHESLATVIGVKY  713

Query  2406  VSPSL---GN-----MKVKSYISDEYKEVVDLAA  2483
              SP++   GN     +KVKSY+S+EYKE+++ AA
Sbjct  714   ESPTMAAKGNREKPRLKVKSYVSNEYKELIERAA  747



>ref|XP_010925103.1| PREDICTED: uncharacterized protein LOC105047743 [Elaeis guineensis]
Length=700

 Score =   144 bits (363),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 135/405 (33%), Positives = 204/405 (50%), Gaps = 66/405 (16%)
 Frame = +3

Query  282   MTTEPLTMDPPDPLRAFAGLPLLPQTI----RVQSEDSIPSEPNNLNSIHQLMKSMGLRN  449
             M+TE    +  DP   F+ L LLP+T+     V    S+  E     +I  + KSM ++ 
Sbjct  1     MSTELEHPNLEDPFADFSALSLLPRTLGAHLHVAPALSVAQEEE---AIRDVFKSMAVKG  57

Query  450   AEKLLEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFS  629
             +++ LE+++ I+ + S   N   P F+   D D  +AA   K+ P+ RRP LGRKRA+FS
Sbjct  58    SKEFLEQAQQIMKSCS---NFPVPHFE---DGDKAIAAN-GKDRPQGRRPALGRKRAQFS  110

Query  630   MKPDTSQ--PNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLP  803
             +KP+TS   PN+   S   +D ++DPEEYF A E+LENA +EL +  G V+ D   ++  
Sbjct  111   LKPNTSHSVPNVDFDSG--IDHIEDPEEYFFAFEQLENADKELKKLRGEVSTDLLQHHQS  168

Query  804   TTARRRRPGILGKSVRYKHRFSSVPPDDNDTD---MSSQE---------------TFKQD  929
              TAR+RRPGILGK+  Y+H F    P   DT    M SQE                    
Sbjct  169   ATARKRRPGILGKTASYRHHF----PAKVDTAVVFMGSQEENSDKRTYSPFNAPTVVDSS  224

Query  930   DLCALKSDLQKENS-----NDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRV  1094
             D+   ++  Q + S     N   L+  E  G +T+KE +VN +LD+LLS   KDLD+D  
Sbjct  225   DILYPRTVDQPDTSQFRQTNSQLLDVTERQGSVTDKEKKVNDLLDKLLS-SFKDLDEDEG  283

Query  1095  LSILQEQFQMKPPDLSALCMPEFPDA-RTDYMTLGERIPKARKSVLGLPNSDKRTSGKRQ  1271
              ++L+E  Q+K  D+  + +PE     + D   L  R  + RK + G   S    +  R 
Sbjct  284   ATLLRESLQIKSIDVGKVHLPELHSVQKNDINALDGR--EMRKELEGCQLSQNSPTLSRS  341

Query  1272  WEESPQSNLtsptppkspfssLALLRKQVLKSNPLRDPFSPLNID  1406
               ++                 ++ L++++L  +P  DPFS L ID
Sbjct  342   RLDA-----------------ISTLKRRILLKDPQEDPFSVLPID  369


 Score = 97.4 bits (241),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = +3

Query  2256  RPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESMK-LVGVKYVSPSLGNMK  2432
             R SLADAG  ++ GVRRS RI+SRPL++W+GER L+GR+++S+  ++GVKY SPS   +K
Sbjct  622   RQSLADAGMAWKFGVRRSTRIRSRPLQYWRGERFLYGRIHDSLATVIGVKYASPSNPALK  681

Query  2433  VKSYISDEYKEVVDLAARY  2489
             VKS++S+EY E+V  A  +
Sbjct  682   VKSFVSEEYAELVAQAGLH  700



>ref|XP_008809133.1| PREDICTED: uncharacterized protein LOC103720936 [Phoenix dactylifera]
Length=699

 Score =   139 bits (351),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 111/308 (36%), Positives = 168/308 (55%), Gaps = 32/308 (10%)
 Frame = +3

Query  306   DPPDPLRAFAGLPLLPQTIRVQSEDS-IPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAI  482
             D  DP    + L LLP+T+ V    +   S      +I  + KSM L+ +++ LE+++ I
Sbjct  9     DLEDPFADCSVLSLLPRTLEVHLHVAPALSAAQEEEAIRNIFKSMALKGSKEFLEQAQQI  68

Query  483   VDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQ--PN  656
               + S     NFP  + S D D  +AA   K+ P+ RRP LGRKRA+FS+KP +S   PN
Sbjct  69    RKSCS-----NFP-VQHSKDGDKAIAA-TGKDRPQGRRPALGRKRAQFSLKPISSHSVPN  121

Query  657   ISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGIL  836
             +   S   +D ++DPEEYF A E+LENA +EL +  G V+ D    +   TAR+RRPGIL
Sbjct  122   VDFDSG--IDHIEDPEEYFYAFEQLENADKELKKLRGEVSTDLLQQHQSATARKRRPGIL  179

Query  837   GKSVRYKHRF-----SSVPPDDNDTDMSSQETF----------KQDDLCALKSDL----Q  959
             GK+  Y+H F     ++V   ++  ++S + T+            D L    +D     Q
Sbjct  180   GKTASYRHHFPAKVDTAVVFKESQEEISDKRTYSPSNTPTVVESSDTLHPRTADQLDTSQ  239

Query  960   KENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDL  1139
                +N   L+  E  G +T+KE +VN +LD+LLS   KDLD+D   ++L+E  Q+K  D+
Sbjct  240   FRQTNSQLLDATERQGSVTDKEKKVNDLLDKLLS-SFKDLDEDEGATLLRESLQIKSIDV  298

Query  1140  SALCMPEF  1163
               + +PE 
Sbjct  299   GKVHLPEL  306


 Score = 73.9 bits (180),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 70/106 (66%), Gaps = 11/106 (10%)
 Frame = +3

Query  2157  PEQHIMKQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLE  2336
             P+    +Q  L +KQ +K          K    R SLADAG  +++G+RRS RI+SRPL+
Sbjct  598   PQNEEKRQKALRRKQNKK----------KLTSRRQSLADAGMTWKSGIRRSTRIRSRPLQ  647

Query  2337  FWKGERLLFGRVNESMK-LVGVKYVSPSLGNMKVKSYISDEYKEVV  2471
             +W GER L+GR+++S+  ++GVKY SP    +KVKS++S++Y ++V
Sbjct  648   YWCGERFLYGRIHDSLATVIGVKYASPGNPALKVKSFVSEDYADLV  693



>gb|KFK43814.1| hypothetical protein AALP_AA1G176700 [Arabis alpina]
Length=724

 Score =   137 bits (344),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 95/307 (31%), Positives = 162/307 (53%), Gaps = 14/307 (5%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIVDNG  494
             DPL A++GL L P+T++  S   +  + ++L   H L++SM     +   E++KAI+D+ 
Sbjct  13    DPLLAYSGLSLFPRTLKSLSHPRL-YQSDDLQQTHTLLQSMPFEIQKDHQEQAKAILDDS  71

Query  495   SEILNANFPRFKASLDLDDHVAAKVEKEM--PRERRPGLGRKRARFSMKPDTSQPNISLQ  668
             S++L        AS DL+      V+  M   RERRPGL RKR  FS KP TSQP  + +
Sbjct  72    SQLLKLGIGTTVASQDLN------VDGNMNPKRERRPGLDRKRGHFSFKPTTSQPPPN-E  124

Query  669   SSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILGKSV  848
              + D  K  +P E+F A E+ +NAK+E  +Q G +  D++ N       RR      K  
Sbjct  125   PTFDATKYPNPVEFFTAFERYQNAKREWQKQTGTLVTDTHQNQPSRRPPRRPGIPGRKRG  184

Query  849   RYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltglitekeg  1028
              YKH ++    D   TD ++ E  ++++    +  L++  + +V   + E+     + + 
Sbjct  185   SYKHIYT----DSYSTDATNLEASEKENPIPSEQSLERSTAAEVTTADREVDDSAVDTDK  240

Query  1029  RVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDARTDYMTLGERIP  1208
              ++ IL +LL+ D  +L+ D  + +++E+ Q KP D+    +PEF + R   + +  R P
Sbjct  241   DLDNILTKLLACDPDELEGDNGIKLVEERLQFKPIDVGMFSLPEFQEVRKTDLKVSGRNP  300

Query  1209  KARKSVL  1229
               R++VL
Sbjct  301   SKRRTVL  307


 Score =   109 bits (272),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 68/90 (76%), Gaps = 6/90 (7%)
 Frame = +3

Query  2232  RERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYV  2408
             RE K    R SLA AGT +E+GVRRS RIKSRPLE+W+GER LFGR++ES+  ++G+KY 
Sbjct  633   RECKMFSRRKSLAGAGTKWESGVRRSTRIKSRPLEYWRGERFLFGRIHESLATVIGIKYE  692

Query  2409  SPSLGN-----MKVKSYISDEYKEVVDLAA  2483
             SP  G      +KVKS++SD+YKE++D AA
Sbjct  693   SPGKGKSEKPELKVKSFVSDDYKELIDSAA  722



>ref|XP_003619785.1| CENP-C [Medicago truncatula]
Length=641

 Score =   133 bits (334),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 121/345 (35%), Positives = 194/345 (56%), Gaps = 36/345 (10%)
 Frame = +3

Query  435   MGLRNAEKLLEESKAIVDNGSEILNANFPRFKASLDLDDH-VAAKVEKEMPRERRPGLG-  608
             M LR+  KLLE++  + ++     +  F    ++ D+ +H  A++ + E+PR+RRPGLG 
Sbjct  1     MALRSPTKLLEQAMPMSED-----DLGFCTENSTQDVGNHDFASQEDGELPRKRRPGLGL  55

Query  609   -RKRARFSMKPDTSQPNIS-LQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADD  782
              R R RFS+KP T +P++  L   LD+ KL DPEE+F+A E+LENAK+E+ +Q+G+V+  
Sbjct  56    NRARPRFSLKP-TKKPSVEDLLPILDLKKLTDPEEFFMAHERLENAKREIEKQLGIVSSQ  114

Query  783   SNINNLPTTARRRRPGILG---KSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSD  953
              + ++  T  R RRPG+ G   + VRY+HR S+    +ND  +SSQE F+ D L  +  +
Sbjct  115   PSQDS--TKPRERRPGLPGFNRRPVRYRHRVSTEALVNNDDVLSSQEAFESDGLDPVGDN  172

Query  954   LQKENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPP  1133
               K     +   + E+T     +E ++N IL  LL  D+++L+ +  +++LQE+ Q+K  
Sbjct  173   TDK-GKFSLASLDNEVTDSPAIEENKMNDILKGLLDCDSEELEGEGAMNLLQERLQVKSI  231

Query  1134  DLSALCMPEFPDARTDYMTLGERIPKARKSVLGLPNSDKRTSGKRQWE-----ESP----  1286
                 L +P+F D +   +       K+ +  L  P+  K  S    W      ++P    
Sbjct  232   VFEKLSVPDFLDIQPIDL-------KSLQGTLSKPSKGKAFSDVDNWLKGMNIQTPLRRS  284

Query  1287  ----QSNLtsptppkspfssLALLRKQVLKSNPLRDPFSPLNIDL  1409
                 +  L SPTPPKSPF+SL+ L+K + +S    DPFS   IDL
Sbjct  285   VGYAEKQLASPTPPKSPFASLSSLQKHISRSKLSTDPFSTHEIDL  329


 Score =   111 bits (277),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 94/144 (65%), Gaps = 11/144 (8%)
 Frame = +3

Query  2085  SDQSNSAAVQNHSVDMQSALPDINPEQHIMKQ-----HPLTKKQPRKNSCMPGNRERKAL  2249
             +DQSN    Q +S+D  S   D  PEQ + ++      P+  +   K SCM    + K L
Sbjct  500   ADQSNPVTYQANSMDKGSRRSDDGPEQCLQEKTIGSAAPVNGQTIVK-SCMRKGSKGKRL  558

Query  2250  KFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESMK-LVGVKYVSPSLG-  2423
               R SLADAGT +E+GVRRS R +++PLE+WKGER+++GRV+ES+  ++GVK +SP    
Sbjct  559   -LRKSLADAGTSWESGVRRSTRFRTKPLEYWKGERMVYGRVHESLSTVIGVKCMSPGSDG  617

Query  2424  --NMKVKSYISDEYKEVVDLAARY  2489
                MKVKS++SD+YKE+ ++A+ Y
Sbjct  618   KPTMKVKSFVSDKYKELFEIASEY  641



>gb|AES76003.2| centromere C-like protein [Medicago truncatula]
Length=628

 Score =   127 bits (318),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 112/310 (36%), Positives = 175/310 (56%), Gaps = 31/310 (10%)
 Frame = +3

Query  540   DLDDH-VAAKVEKEMPRERRPGLG--RKRARFSMKPDTSQPNIS-LQSSLDVDKLQDPEE  707
             D+ +H  A++ + E+PR+RRPGLG  R R RFS+KP T +P++  L   LD+ KL DPEE
Sbjct  18    DVGNHDFASQEDGELPRKRRPGLGLNRARPRFSLKP-TKKPSVEDLLPILDLKKLTDPEE  76

Query  708   YFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILG---KSVRYKHRFSSVP  878
             +F+A E+LENAK+E+ +Q+G+V+   + ++  T  R RRPG+ G   + VRY+HR S+  
Sbjct  77    FFMAHERLENAKREIEKQLGIVSSQPSQDS--TKPRERRPGLPGFNRRPVRYRHRVSTEA  134

Query  879   PDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltglitekegRVNAILDELL  1058
               +ND  +SSQE F+ D L  +  +  K     +   + E+T     +E ++N IL  LL
Sbjct  135   LVNNDDVLSSQEAFESDGLDPVGDNTDK-GKFSLASLDNEVTDSPAIEENKMNDILKGLL  193

Query  1059  SRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDARTDYMTLGERIPKARKSVLGLP  1238
               D+++L+ +  +++LQE+ Q+K      L +P+F D +   +       K+ +  L  P
Sbjct  194   DCDSEELEGEGAMNLLQERLQVKSIVFEKLSVPDFLDIQPIDL-------KSLQGTLSKP  246

Query  1239  NSDKRTSGKRQWEES-------------PQSNLtsptppkspfssLALLRKQVLKSNPLR  1379
             +  K  S    W +               +  L SPTPPKSPF+SL+ L+K + +S    
Sbjct  247   SKGKAFSDVDNWLKGMNIQTPLRRSVGYAEKQLASPTPPKSPFASLSSLQKHISRSKLST  306

Query  1380  DPFSPLNIDL  1409
             DPFS   IDL
Sbjct  307   DPFSTHEIDL  316


 Score =   111 bits (277),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 94/144 (65%), Gaps = 11/144 (8%)
 Frame = +3

Query  2085  SDQSNSAAVQNHSVDMQSALPDINPEQHIMKQ-----HPLTKKQPRKNSCMPGNRERKAL  2249
             +DQSN    Q +S+D  S   D  PEQ + ++      P+  +   K SCM    + K L
Sbjct  487   ADQSNPVTYQANSMDKGSRRSDDGPEQCLQEKTIGSAAPVNGQTIVK-SCMRKGSKGKRL  545

Query  2250  KFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESMK-LVGVKYVSPSLG-  2423
               R SLADAGT +E+GVRRS R +++PLE+WKGER+++GRV+ES+  ++GVK +SP    
Sbjct  546   -LRKSLADAGTSWESGVRRSTRFRTKPLEYWKGERMVYGRVHESLSTVIGVKCMSPGSDG  604

Query  2424  --NMKVKSYISDEYKEVVDLAARY  2489
                MKVKS++SD+YKE+ ++A+ Y
Sbjct  605   KPTMKVKSFVSDKYKELFEIASEY  628



>ref|XP_010912509.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105038377 
[Elaeis guineensis]
Length=703

 Score =   124 bits (312),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 116/354 (33%), Positives = 181/354 (51%), Gaps = 61/354 (17%)
 Frame = +3

Query  423   LMKSMGLRNAEKLLEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPG  602
             L  SM L+ +++ LE+++ I  + S     NFP   +    D  ++A V K+ P+ RRP 
Sbjct  45    LFTSMALKGSKEFLEQAQQIKKSCS-----NFPSPHSEYG-DKAISADV-KDRPQGRRPA  97

Query  603   LGRKRARFSMKPDTSQ--PNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVA  776
             LGRKRA+FS+KP++S   P +   S  D   ++DPEEYFLA E+LENA +EL +  G V 
Sbjct  98    LGRKRAQFSLKPNSSHSVPKMDFDSGFD--HIEDPEEYFLAFEQLENADKELKKLRGEVY  155

Query  777   DDSNINNLPTTARRRRPGILGKSVRYKHRFSSVPPDDNDT---------DMSSQETF--K  923
              D   ++   TAR+RRPGILGK+  YKH F    P   DT         ++S + TF   
Sbjct  156   TDLLEHHQSPTARKRRPGILGKTASYKHHF----PAKVDTAQAFRESQQEISDKRTFSPS  211

Query  924   QDDLCALKSDL------------QKENSNDVeleeleltglitekegRVNAILDELLSRD  1067
                + A  S++            Q   +N   L+  E  G +T KE  VN +LD+LL   
Sbjct  212   STSIIAESSNILHPRTVDQRVTSQSRKTNSELLDAKERQGSVTHKEKNVNDLLDKLLI-S  270

Query  1068  AKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDARTDYM-TLGERIPKARKSVLGLPNS  1244
              KDLD+    ++L+E   +K  ++  +C+PE    + +   TL  R+   RK + G   S
Sbjct  271   FKDLDEGEGATLLRESLHIKSINVGKVCLPELHTVQKNVTRTLEGRV--MRKELEGRQLS  328

Query  1245  DKRTSGKRQWEESPQSNLtsptppkspfssLALLRKQVLKSNPLRDPFS--PLN  1400
                ++  R    SP +             ++++L++++   +PL DP+S  P+N
Sbjct  329   QNSSTLAR----SPLA-------------AISILQRRISPKDPLEDPYSGPPIN  365


 Score = 76.3 bits (186),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 68/103 (66%), Gaps = 13/103 (13%)
 Frame = +3

Query  2214  SCMPGNRER------------KALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERL  2357
             S  P NRER            K +  R SLADAG  +++G+RRS RI+SRPL++W GER 
Sbjct  599   SGAPQNRERRQKAPSHKQNRKKLVSRRQSLADAGMAWKSGIRRSTRIRSRPLQYWLGERF  658

Query  2358  LFGRVNESMK-LVGVKYVSPSLGNMKVKSYISDEYKEVVDLAA  2483
             L+GR+++S+  ++GVKY SP    +KVKS++S+EY ++V  A 
Sbjct  659   LYGRIHDSLATVIGVKYASPGNPALKVKSFVSEEYADLVAQAG  701



>ref|XP_006416891.1| hypothetical protein EUTSA_v10006918mg [Eutrema salsugineum]
 gb|ESQ35244.1| hypothetical protein EUTSA_v10006918mg [Eutrema salsugineum]
Length=732

 Score =   121 bits (304),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 99/314 (32%), Positives = 165/314 (53%), Gaps = 22/314 (7%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIP--SEPNNLNSIHQLMKSMGLRNAEKLLEESKAIVD  488
             DPL A++GL L P+T++  S    P   +  +L+  H L++SM     ++  E++KAI+D
Sbjct  13    DPLHAYSGLSLFPRTLKCLSYPLPPPLYQSVDLHQTHTLLESMPFEIQKEHQEQAKAILD  72

Query  489   NGSEILNANFPRFKASLDLDDHVAAKVEKEMP--RERRPGLGRKRARFSMKPDTSQPNIS  662
             + +E+L        AS + +  V AK+ K +P  RERRPG  RKR  F++KP TSQP  +
Sbjct  73    DNAELLKQGIGTSVASENTN--VGAKM-KTIPNKRERRPGYERKREPFTIKPRTSQPPQN  129

Query  663   LQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILG-  839
              + S D  K   PEEYF A E+ + AK+E ++Q G +  D++ N    + R RRP + G 
Sbjct  130   -EPSFDPSKYPKPEEYFAAYERFKIAKREWDKQSGTLVTDTHQNK--PSRRPRRPEMPGR  186

Query  840   KSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltglite  1019
             K   YKH ++       D  +++ +  ++++    + +L+K  +  V   + E+      
Sbjct  187   KRGSYKHTYT-------DRFLTNLKASEKENPIPSEQNLEKTTAIHVTTADREVDDSTVN  239

Query  1020  kegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDL---SALCMPEFPDA-RTDYM  1187
                 +N +L ELL+    +L+ D  + +L E+  +KP D    S   +P+FPD  RT   
Sbjct  240   TAKGLNNVLTELLACSPDELEGDAGVKLLLERLHIKPIDKQIPSLPVLPDFPDVTRTRLK  299

Query  1188  TLGERIPKARKSVL  1229
               G   P  +++ L
Sbjct  300   AAGRSNPSNQRTAL  313


 Score = 94.0 bits (232),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 64/94 (68%), Gaps = 8/94 (9%)
 Frame = +3

Query  2232  RERKALKFRPSLADAGTLFE--NGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVK  2402
             RE K    R SLA AG  +E  +GVRRS RIKSRPLE+W+GER L+GR++ES+  ++G+K
Sbjct  639   RESKLFSRRKSLAGAGLQWEKESGVRRSTRIKSRPLEYWRGERFLYGRIHESLTTVIGIK  698

Query  2403  YVSPSLGN-----MKVKSYISDEYKEVVDLAARY  2489
               S   G       KVKS+++D+YKE+VD  A Y
Sbjct  699   TASAKKGENEKRVYKVKSFVADDYKELVDSVALY  732



>ref|XP_006416890.1| hypothetical protein EUTSA_v10006918mg [Eutrema salsugineum]
 gb|ESQ35243.1| hypothetical protein EUTSA_v10006918mg [Eutrema salsugineum]
Length=731

 Score =   121 bits (304),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 99/314 (32%), Positives = 165/314 (53%), Gaps = 22/314 (7%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIP--SEPNNLNSIHQLMKSMGLRNAEKLLEESKAIVD  488
             DPL A++GL L P+T++  S    P   +  +L+  H L++SM     ++  E++KAI+D
Sbjct  13    DPLHAYSGLSLFPRTLKCLSYPLPPPLYQSVDLHQTHTLLESMPFEIQKEHQEQAKAILD  72

Query  489   NGSEILNANFPRFKASLDLDDHVAAKVEKEMP--RERRPGLGRKRARFSMKPDTSQPNIS  662
             + +E+L        AS + +  V AK+ K +P  RERRPG  RKR  F++KP TSQP  +
Sbjct  73    DNAELLKQGIGTSVASENTN--VGAKM-KTIPNKRERRPGYERKREPFTIKPRTSQPPQN  129

Query  663   LQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILG-  839
              + S D  K   PEEYF A E+ + AK+E ++Q G +  D++ N    + R RRP + G 
Sbjct  130   -EPSFDPSKYPKPEEYFAAYERFKIAKREWDKQSGTLVTDTHQNK--PSRRPRRPEMPGR  186

Query  840   KSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltglite  1019
             K   YKH ++       D  +++ +  ++++    + +L+K  +  V   + E+      
Sbjct  187   KRGSYKHTYT-------DRFLTNLKASEKENPIPSEQNLEKTTAIHVTTADREVDDSTVN  239

Query  1020  kegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDL---SALCMPEFPDA-RTDYM  1187
                 +N +L ELL+    +L+ D  + +L E+  +KP D    S   +P+FPD  RT   
Sbjct  240   TAKGLNNVLTELLACSPDELEGDAGVKLLLERLHIKPIDKQIPSLPVLPDFPDVTRTRLK  299

Query  1188  TLGERIPKARKSVL  1229
               G   P  +++ L
Sbjct  300   AAGRSNPSNQRTAL  313


 Score = 94.0 bits (232),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 64/94 (68%), Gaps = 8/94 (9%)
 Frame = +3

Query  2232  RERKALKFRPSLADAGTLFE--NGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVK  2402
             RE K    R SLA AG  +E  +GVRRS RIKSRPLE+W+GER L+GR++ES+  ++G+K
Sbjct  638   RESKLFSRRKSLAGAGLQWEKESGVRRSTRIKSRPLEYWRGERFLYGRIHESLTTVIGIK  697

Query  2403  YVSPSLGN-----MKVKSYISDEYKEVVDLAARY  2489
               S   G       KVKS+++D+YKE+VD  A Y
Sbjct  698   TASAKKGENEKRVYKVKSFVADDYKELVDSVALY  731



>ref|XP_008792976.1| PREDICTED: uncharacterized protein LOC103709431 [Phoenix dactylifera]
Length=705

 Score =   121 bits (303),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 126/406 (31%), Positives = 201/406 (50%), Gaps = 54/406 (13%)
 Frame = +3

Query  282   MTTEPLTMDPPDPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSM--GLRNAE  455
             M  E    D  DP    + L  LP+ +         SE     +I  L KSM   L+ ++
Sbjct  1     MAAENERPDLEDPFADCSILSFLPRNLGAHL---YASEAQEEEAIRNLFKSMDQALKGSK  57

Query  456   KLLEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMK  635
             + LE+++ I  + S     NFP      D D  +AA   K+ P+ RRP LGRKRA+FS+K
Sbjct  58    EFLEQAQQIKKSCS-----NFPSPHPE-DGDKAIAAD-GKDRPQGRRPALGRKRAQFSLK  110

Query  636   PDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTAR  815
              ++S     + S   +D ++DPEEYFLA E+LENA +EL +  G V+ D   ++   TAR
Sbjct  111   LNSSHSVPKMDSDSGIDHIEDPEEYFLAFEQLENADKELKKLRGEVSTDPLEHHQSPTAR  170

Query  816   RRRPGILGKSVRYKHRFSSVPPDDNDTDMSSQE------TFKQDD--LCALKSDL-----  956
             +RRPGILGK+  YKH F +   D  +  M SQE      TF   +  + A  S++     
Sbjct  171   KRRPGILGKTASYKHHFPA-KVDTAEVFMESQEEISDKKTFSPSNTSIIAASSNILRPRT  229

Query  957   -------QKENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQ  1115
                    Q   +N   L+ +E  G +T++  +VN +LD+LL    KDLD+   +++L+E 
Sbjct  230   VDQPETSQSRKTNSELLDAVERQGSVTDRVKKVNDLLDKLLI-SFKDLDEAEGVTLLRES  288

Query  1116  FQMKPPDLSALCMPEFPDARTDYM-TLGERIPKARKSVLGLPNSDKRTSGKRQWEESPQS  1292
               +K  ++  + +PE    + + + TL  R+   RK + G       ++  R    SP +
Sbjct  289   LHIKSINVGKVHLPELQTVQKNAVRTLKGRV--MRKELEGCQFPQNSSTIAR----SPLA  342

Query  1293  NLtsptppkspfssLALLRKQVLKSNPLRDPFSPLNIDLNDINKNS  1430
                          +++ L++ +  ++PL DP+S   ID   I++ S
Sbjct  343   -------------AISTLQRCISLNDPLEDPYSVPPIDDAPISRYS  375


 Score = 97.1 bits (240),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 86/128 (67%), Gaps = 9/128 (7%)
 Frame = +3

Query  2124  VDMQS----ALPDINPEQHIMKQ---HPLTKKQPRKNSCMPGNRERKALKFRPSLADAGT  2282
             +D+QS     LP+ N E+  ++     P  K++ +  S    NR++ A + R SLADAG 
Sbjct  577   MDVQSEKAHGLPEENNERQGLQGTSGAPQNKERSKIASRQKQNRKKLASR-RQSLADAGM  635

Query  2283  LFENGVRRSKRIKSRPLEFWKGERLLFGRVNESMK-LVGVKYVSPSLGNMKVKSYISDEY  2459
              +++GVRRS RI+SRPL++W GER L+GR+N+S+  ++GVKY SPS   +KVKS++S+EY
Sbjct  636   TWKSGVRRSTRIRSRPLQYWLGERFLYGRINDSLATVIGVKYNSPSNPALKVKSFVSEEY  695

Query  2460  KEVVDLAA  2483
              ++V  A 
Sbjct  696   ADLVAQAG  703



>gb|EPS59112.1| hypothetical protein M569_15699, partial [Genlisea aurea]
Length=141

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 95/143 (66%), Gaps = 6/143 (4%)
 Frame = +3

Query  315  DPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIVDNG  494
            DPL+ F    L P+TI  +    +P+E  +L+SI+Q MKS+ L++ EKLL E+K IVD G
Sbjct  3    DPLKVFNWPALFPRTIISKIGGQVPTEFKDLDSINQFMKSLELKSPEKLLNEAKRIVDGG  62

Query  495  SEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLG--RKRARFSMKPDTSQPNISLQ  668
            +E++ +N          ++ +  K+ K+ P+ERRPGLG  RKRA FS+K    +P + +Q
Sbjct  63   AELVESNL--VAEIKGFENAMVVKI-KDKPQERRPGLGLARKRASFSLKASVRRPLVEIQ  119

Query  669  SSLDVDKLQDPEEYFLACEKLEN  737
             ++++DKLQDP+E+F A ++LE+
Sbjct  120  -NMEIDKLQDPDEFFDAYDRLES  141



>ref|XP_009407451.1| PREDICTED: uncharacterized protein LOC103990134 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=731

 Score =   114 bits (284),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 98/322 (30%), Positives = 156/322 (48%), Gaps = 35/322 (11%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIR-VQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIVDN  491
             DP   F+ L LLP+T+      D  P + +    I  L+ S+    ++++LE++ AI ++
Sbjct  13    DPFADFSLLSLLPRTLGGALRADPPPLDAHETEVIKALLDSV--VGSKEVLEQAHAINNS  70

Query  492   GSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNISLQS  671
                ++N+       S D +  + A V+  +   RRP LGRKRA+FS+KP +S P   +  
Sbjct  71    CQNVVNS-------SQDGNKTIPADVKNRL-VSRRPALGRKRAQFSLKPISSNPVPDVDF  122

Query  672   SLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILGKSVR  851
             +  +D L DPEE+F A E+LENA +EL +  G    +    N   T R+RR GILGK+V 
Sbjct  123   NSQIDHLDDPEEFFFAFEQLENAGKELKKLRGEAVTEP-AKNQQVTGRKRRLGILGKTVS  181

Query  852   YKHRFSSVPPDDNDTDMSSQETFKQDDLCALKS-------------------DLQKENSN  974
             YKH FS+   D  +    SQE   Q +    K+                   +L   ++N
Sbjct  182   YKHHFSAT-VDTAEAFSVSQEVLDQRNATPYKASIKIKPTANLHPTSFDQPCNLHSTDTN  240

Query  975   DVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCM  1154
             ++              E   N IL++LL    +DLD+    + L+E  Q+K  ++  + +
Sbjct  241   NI-HLLANEREDSVADENNANNILEKLLF-SFRDLDEGEGTAFLRESLQIKSIEIGKIHL  298

Query  1155  PEFPDA-RTDYMTLGERIPKAR  1217
             PE     R D+ TL  R+ K +
Sbjct  299   PELHSIQRNDFRTLENRVAKEK  320


 Score = 95.5 bits (236),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 75/104 (72%), Gaps = 3/104 (3%)
 Frame = +3

Query  2187  LTKKQPRKNSCMPGNRER-KALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLF  2363
             L++   +K   +P  +++ K +  R SLADAG ++ +GVRRS RIKSRPLE+W+GER L+
Sbjct  628   LSQNIEKKQKALPSRKDKQKLVSRRQSLADAGMIWNSGVRRSTRIKSRPLEYWRGERFLY  687

Query  2364  GRVNESM-KLVGVKYVSP-SLGNMKVKSYISDEYKEVVDLAARY  2489
             GR+++S+  ++GVK  SP + G +KV S++S+EY ++V  AA+ 
Sbjct  688   GRIHDSLATVIGVKRSSPGNNGKLKVTSFVSEEYADLVAQAAQL  731



>ref|XP_009407450.1| PREDICTED: uncharacterized protein LOC103990134 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=877

 Score =   114 bits (284),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 98/322 (30%), Positives = 156/322 (48%), Gaps = 35/322 (11%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIR-VQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIVDN  491
             DP   F+ L LLP+T+      D  P + +    I  L+ S  +  ++++LE++ AI ++
Sbjct  13    DPFADFSLLSLLPRTLGGALRADPPPLDAHETEVIKALLDS--VVGSKEVLEQAHAINNS  70

Query  492   GSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNISLQS  671
                ++N+       S D +  + A V+  +   RRP LGRKRA+FS+KP +S P   +  
Sbjct  71    CQNVVNS-------SQDGNKTIPADVKNRL-VSRRPALGRKRAQFSLKPISSNPVPDVDF  122

Query  672   SLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILGKSVR  851
             +  +D L DPEE+F A E+LENA +EL +  G    +    N   T R+RR GILGK+V 
Sbjct  123   NSQIDHLDDPEEFFFAFEQLENAGKELKKLRGEAVTEP-AKNQQVTGRKRRLGILGKTVS  181

Query  852   YKHRFSSVPPDDNDTDMSSQETFKQDDLCALKS-------------------DLQKENSN  974
             YKH FS+   D  +    SQE   Q +    K+                   +L   ++N
Sbjct  182   YKHHFSAT-VDTAEAFSVSQEVLDQRNATPYKASIKIKPTANLHPTSFDQPCNLHSTDTN  240

Query  975   DVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCM  1154
             ++              E   N IL++LL    +DLD+    + L+E  Q+K  ++  + +
Sbjct  241   NI-HLLANEREDSVADENNANNILEKLLFS-FRDLDEGEGTAFLRESLQIKSIEIGKIHL  298

Query  1155  PEFPDA-RTDYMTLGERIPKAR  1217
             PE     R D+ TL  R+ K +
Sbjct  299   PELHSIQRNDFRTLENRVAKEK  320


 Score = 95.9 bits (237),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 75/104 (72%), Gaps = 3/104 (3%)
 Frame = +3

Query  2187  LTKKQPRKNSCMPGNRER-KALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLF  2363
             L++   +K   +P  +++ K +  R SLADAG ++ +GVRRS RIKSRPLE+W+GER L+
Sbjct  774   LSQNIEKKQKALPSRKDKQKLVSRRQSLADAGMIWNSGVRRSTRIKSRPLEYWRGERFLY  833

Query  2364  GRVNESM-KLVGVKYVSP-SLGNMKVKSYISDEYKEVVDLAARY  2489
             GR+++S+  ++GVK  SP + G +KV S++S+EY ++V  AA+ 
Sbjct  834   GRIHDSLATVIGVKRSSPGNNGKLKVTSFVSEEYADLVAQAAQL  877



>ref|XP_009407449.1| PREDICTED: uncharacterized protein LOC103990134 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=883

 Score =   113 bits (283),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 98/322 (30%), Positives = 156/322 (48%), Gaps = 35/322 (11%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIR-VQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIVDN  491
             DP   F+ L LLP+T+      D  P + +    I  L+ S  +  ++++LE++ AI ++
Sbjct  13    DPFADFSLLSLLPRTLGGALRADPPPLDAHETEVIKALLDS--VVGSKEVLEQAHAINNS  70

Query  492   GSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNISLQS  671
                ++N+       S D +  + A V+  +   RRP LGRKRA+FS+KP +S P   +  
Sbjct  71    CQNVVNS-------SQDGNKTIPADVKNRL-VSRRPALGRKRAQFSLKPISSNPVPDVDF  122

Query  672   SLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILGKSVR  851
             +  +D L DPEE+F A E+LENA +EL +  G    +    N   T R+RR GILGK+V 
Sbjct  123   NSQIDHLDDPEEFFFAFEQLENAGKELKKLRGEAVTEP-AKNQQVTGRKRRLGILGKTVS  181

Query  852   YKHRFSSVPPDDNDTDMSSQETFKQDDLCALKS-------------------DLQKENSN  974
             YKH FS+   D  +    SQE   Q +    K+                   +L   ++N
Sbjct  182   YKHHFSAT-VDTAEAFSVSQEVLDQRNATPYKASIKIKPTANLHPTSFDQPCNLHSTDTN  240

Query  975   DVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCM  1154
             ++              E   N IL++LL    +DLD+    + L+E  Q+K  ++  + +
Sbjct  241   NI-HLLANEREDSVADENNANNILEKLLFS-FRDLDEGEGTAFLRESLQIKSIEIGKIHL  298

Query  1155  PEFPDA-RTDYMTLGERIPKAR  1217
             PE     R D+ TL  R+ K +
Sbjct  299   PELHSIQRNDFRTLENRVAKEK  320


 Score = 95.9 bits (237),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 75/104 (72%), Gaps = 3/104 (3%)
 Frame = +3

Query  2187  LTKKQPRKNSCMPGNRER-KALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLF  2363
             L++   +K   +P  +++ K +  R SLADAG ++ +GVRRS RIKSRPLE+W+GER L+
Sbjct  780   LSQNIEKKQKALPSRKDKQKLVSRRQSLADAGMIWNSGVRRSTRIKSRPLEYWRGERFLY  839

Query  2364  GRVNESM-KLVGVKYVSP-SLGNMKVKSYISDEYKEVVDLAARY  2489
             GR+++S+  ++GVK  SP + G +KV S++S+EY ++V  AA+ 
Sbjct  840   GRIHDSLATVIGVKRSSPGNNGKLKVTSFVSEEYADLVAQAAQL  883



>gb|AAU04611.1| CENP-C [Arabidopsis arenosa]
Length=710

 Score =   112 bits (280),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 73/105 (70%), Gaps = 7/105 (7%)
 Frame = +3

Query  2193  KKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRV  2372
             +K+P KN+     RE K    R SLA AGT  E GVRRS RIKSRPLE+WKGER L+GR+
Sbjct  607   EKKP-KNTRKTLTREGKLFSRRKSLAAAGTKMEGGVRRSTRIKSRPLEYWKGERFLYGRI  665

Query  2373  NESM-KLVGVKYVSPSLGN-----MKVKSYISDEYKEVVDLAARY  2489
             +ES+  ++G+KY SP  G       KVKS++SDEYKE+VD AA +
Sbjct  666   HESLTTVIGIKYASPGEGKSDVRACKVKSFVSDEYKELVDFAASH  710


 Score = 90.1 bits (222),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 91/346 (26%), Positives = 159/346 (46%), Gaps = 46/346 (13%)
 Frame = +3

Query  300   TMDPPDPLRAFAGLPLLPQTIRVQSEDSIPS----EPNNLNSIHQLMKSMGLRNAEKLLE  467
             ++D  DPL+A++GL L P+T++  S    P     +  +L   H L++SM      +  E
Sbjct  9     SLDAEDPLQAYSGLSLFPRTLKSLSNPLPPPPPLHQSEDLQQTHTLLRSMPFEVQNEHQE  68

Query  468   ESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTS  647
             ++KAI+++               +++D  +     K   RERRPGL RKR  FS+   +S
Sbjct  69    QAKAILED---------------MNVDVKLNPIPNK---RERRPGLDRKRKSFSLNLTSS  110

Query  648   QPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTAR----  815
             QP   +  S D  K   PE++F   +K E A +E  +Q G    D+  N      R    
Sbjct  111   QP-PPVAPSFDGSKYPRPEDFFAEYDKFELANREWQKQTGSSVIDTQQNPPSRRPRRPGI  169

Query  816   ---RRRPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVel  986
                +RRP        ++H F+    D   TD  + E   +++  A +  L++  +  V  
Sbjct  170   PGRKRRP--------FEHTFT----DSYFTDAINLEASDKENPIASEQCLERTTAAHVTT  217

Query  987   eeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFP  1166
              + E+     + +  +N IL +LL+    +L+ D  + +L++  Q++  ++    +PEF 
Sbjct  218   VDREVDDSTVDTDKDLNNILKKLLASSRDELEGDAAVKLLEDHLQIESLNVEKFSIPEFQ  277

Query  1167  DARTDYMTLGERIPKARKSVLGLPNSDK---RTSGKRQWEE-SPQS  1292
             D R   +      P  RKS+  + N  K   R +G++     SPQ+
Sbjct  278   DVRKMNLKASGSNPSNRKSLSDIQNILKGTHRVAGRKNSHSPSPQT  323



>dbj|BAD42454.1| centromere protein C homolog [Arabidopsis thaliana]
Length=318

 Score =   108 bits (269),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 69/102 (68%), Gaps = 10/102 (10%)
 Frame = +3

Query  2196  KQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVN  2375
             K+P+K     G    K    R SLA AGT  E GVRRS RIKSRPLE+W+GER L+GR++
Sbjct  219   KKPKKTLTHEG----KLFSCRKSLAAAGTKIEGGVRRSTRIKSRPLEYWRGERFLYGRIH  274

Query  2376  ESM-KLVGVKYVSPSLGNM-----KVKSYISDEYKEVVDLAA  2483
             ES+  ++G+KY SP  G       KVKS++SDEYK++VD AA
Sbjct  275   ESLTTVIGIKYASPGEGKRDSRASKVKSFVSDEYKKLVDFAA  316



>ref|XP_009358207.1| PREDICTED: uncharacterized protein LOC103948854 [Pyrus x bretschneideri]
 ref|XP_009358221.1| PREDICTED: uncharacterized protein LOC103948861 [Pyrus x bretschneideri]
 ref|XP_009349659.1| PREDICTED: uncharacterized protein LOC103941190 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009349660.1| PREDICTED: uncharacterized protein LOC103941190 isoform X1 [Pyrus 
x bretschneideri]
Length=639

 Score =   110 bits (276),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 71/88 (81%), Gaps = 5/88 (6%)
 Frame = +3

Query  2241  KALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPS  2417
             + L  R SLA AGT +++GVRRS RIK+RPLE+WKGERLL+GR+++S+  ++G+KY SP 
Sbjct  552   RELSRRKSLAGAGTTWQSGVRRSTRIKTRPLEYWKGERLLYGRIHDSLVTVIGIKYASPE  611

Query  2418  LGN----MKVKSYISDEYKEVVDLAARY  2489
              GN    +KVKS++SDEYKE+V+LAA +
Sbjct  612   KGNGRGPLKVKSFVSDEYKELVELAALH  639


 Score =   108 bits (270),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 111/333 (33%), Positives = 168/333 (50%), Gaps = 32/333 (10%)
 Frame = +3

Query  411   SIHQLMKSMGLRNA-EKLLEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPR  587
             +IH    SM  +++  KL ++ + I    SEIL    P  + +L   + +  +   + PR
Sbjct  34    AIHIRHNSMASQHSPSKLKDQVENIASVTSEILE---PGNRQALKQKNKIVPEKAAKSPR  90

Query  588   ERRPGLGRKRARFSMKPDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMG  767
             +RRP LG KRARFSMKPD+SQPN +L +  D    +DPEE F   EK ENAK+EL +  G
Sbjct  91    QRRPALGLKRARFSMKPDSSQPNTNLLTPFDPKNYKDPEELFKEHEKYENAKKELEKLKG  150

Query  768   VVADDSNINNLPTTARRRRPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALK  947
                 D+  +N     R RRP I+ K  ++KH +  +       D  S E     + C+  
Sbjct  151   GAMFDAYKHNPSPIKRTRRPSIMRKRAKHKHSYPLM-------DFESSENGSPLNHCS--  201

Query  948   SDLQKENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMK  1127
                Q E + +V  EE++L G + E+    +   DELLS + + L+ D  ++ +Q+  +MK
Sbjct  202   ---QVEPNENVTWEEMDLAGSLAEEVN--DGSFDELLSLNTECLEGDEAVTHVQKCLRMK  256

Query  1128  PPDLSALCMPEFPDARTDYMTLGERIPKARKSVLGLPNSDKRTSGKRQWEESPQSNLtsp  1307
             P +     +PEF       MT  + + K   S  G+ +  KR  G   +  SP S     
Sbjct  257   PIEPEKSDLPEF-----QSMTNIDNLVKGLISSTGVEHR-KRAEGSVLF-ASPTS-----  304

Query  1308  tppkspfssLALLRKQVLKSNPLRDPFSPLNID  1406
               PKS  +S+  L K++L S+   DPFS  +ID
Sbjct  305   --PKSLSASVLDLHKRILHSSQSSDPFSAHDID  335



>ref|XP_009349661.1| PREDICTED: uncharacterized protein LOC103941190 isoform X2 [Pyrus 
x bretschneideri]
Length=637

 Score =   110 bits (276),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 71/88 (81%), Gaps = 5/88 (6%)
 Frame = +3

Query  2241  KALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPS  2417
             + L  R SLA AGT +++GVRRS RIK+RPLE+WKGERLL+GR+++S+  ++G+KY SP 
Sbjct  550   RELSRRKSLAGAGTTWQSGVRRSTRIKTRPLEYWKGERLLYGRIHDSLVTVIGIKYASPE  609

Query  2418  LGN----MKVKSYISDEYKEVVDLAARY  2489
              GN    +KVKS++SDEYKE+V+LAA +
Sbjct  610   KGNGRGPLKVKSFVSDEYKELVELAALH  637


 Score =   108 bits (270),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 111/333 (33%), Positives = 168/333 (50%), Gaps = 32/333 (10%)
 Frame = +3

Query  411   SIHQLMKSMGLRNA-EKLLEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPR  587
             +IH    SM  +++  KL ++ + I    SEIL    P  + +L   + +  +   + PR
Sbjct  34    AIHIRHNSMASQHSPSKLKDQVENIASVTSEILE---PGNRQALKQKNKIVPEKAAKSPR  90

Query  588   ERRPGLGRKRARFSMKPDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMG  767
             +RRP LG KRARFSMKPD+SQPN +L +  D    +DPEE F   EK ENAK+EL +  G
Sbjct  91    QRRPALGLKRARFSMKPDSSQPNTNLLTPFDPKNYKDPEELFKEHEKYENAKKELEKLKG  150

Query  768   VVADDSNINNLPTTARRRRPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALK  947
                 D+  +N     R RRP I+ K  ++KH +  +       D  S E     + C+  
Sbjct  151   GAMFDAYKHNPSPIKRTRRPSIMRKRAKHKHSYPLM-------DFESSENGSPLNHCS--  201

Query  948   SDLQKENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMK  1127
                Q E + +V  EE++L G + E+    +   DELLS + + L+ D  ++ +Q+  +MK
Sbjct  202   ---QVEPNENVTWEEMDLAGSLAEEVN--DGSFDELLSLNTECLEGDEAVTHVQKCLRMK  256

Query  1128  PPDLSALCMPEFPDARTDYMTLGERIPKARKSVLGLPNSDKRTSGKRQWEESPQSNLtsp  1307
             P +     +PEF       MT  + + K   S  G+ +  KR  G   +  SP S     
Sbjct  257   PIEPEKSDLPEF-----QSMTNIDNLVKGLISSTGVEHR-KRAEGSVLF-ASPTS-----  304

Query  1308  tppkspfssLALLRKQVLKSNPLRDPFSPLNID  1406
               PKS  +S+  L K++L S+   DPFS  +ID
Sbjct  305   --PKSLSASVLDLHKRILHSSQSSDPFSAHDID  335



>ref|XP_009338999.1| PREDICTED: uncharacterized protein LOC103931287 isoform X3 [Pyrus 
x bretschneideri]
Length=758

 Score =   108 bits (271),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 76/102 (75%), Gaps = 5/102 (5%)
 Frame = +3

Query  2199  QPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNE  2378
             Q + NS     R+ + +  R SLA AGT +++GVRRS RIK+RPLE+WKGERLL+GR+++
Sbjct  657   QIKANSRPQIKRKSREVSRRKSLAGAGTTWQSGVRRSTRIKTRPLEYWKGERLLYGRIHD  716

Query  2379  SM-KLVGVKYVSP----SLGNMKVKSYISDEYKEVVDLAARY  2489
             S+  ++G+KY SP      G +KVKS++SDEYKE+V+LAA +
Sbjct  717   SLVTVIGIKYASPEKDNGRGPLKVKSFVSDEYKELVELAALH  758


 Score =   108 bits (269),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 116/368 (32%), Positives = 177/368 (48%), Gaps = 41/368 (11%)
 Frame = +3

Query  411   SIHQLMKSMGLRNA-EKLLEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPR  587
             + H  +K M  +++  KL +E + IV   SEIL    P  + +L     V  +   E PR
Sbjct  132   AFHIRLKLMASQHSPSKLKDEGENIVRGTSEILE---PGNRQALKQKSKVVTEKGVESPR  188

Query  588   ERRPGLGRKRARFSMKPDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMG  767
             +RRP LG KRARFSMKPD+SQP+ SL    D  K  DPEE F   EK ENAK+EL +  G
Sbjct  189   QRRPALGLKRARFSMKPDSSQPDTSLLPPFDAQKYTDPEELFKELEKYENAKKELEKLRG  248

Query  768   VVADDSNINNLPTTARRRRPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALK  947
                 D+  +N     R RRP IL K  ++KH +  +       D  S E     +   L 
Sbjct  249   GAMLDAYKHNPSPIKRTRRPSILRKRAKHKHSYPLM-------DFESSE-----NGSPLN  296

Query  948   SDLQKENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMK  1127
                + E + +V  EE++L G + E+    N   DELLS + + L+ D  ++ +Q+  +M+
Sbjct  297   HSTRIEPNKNVAREEMDLAGSLAEEVNDRN--FDELLSLNTECLEGDGAVTHVQKCLRMQ  354

Query  1128  PPDLSALCMPEFPDA-RTDYMTLGERIPKARKSVLGLPNSDKRTSGKRQWEE--SPQSNL  1298
               +     +P+F    + D +T  + + K   S  G  +  KR  G  ++     P+S  
Sbjct  355   SIEPEKSDLPDFQSIPKGDCLTDIDNLLKGLISSTGAKHR-KRPEGSIRFASPTPPKSPF  413

Query  1299  tsptppkspfssLALLRKQVLKSNPLRDPFSPLNID---------LNDINKNSDQVGLVK  1451
                       +S+  L K++L S+P  DPFS  +ID         + + NK S+ V + +
Sbjct  414   ----------ASILDLHKRILHSSPSSDPFSAHDIDRLPETNPSSVENCNKQSELVDMRE  463

Query  1452  DFSKSGNL  1475
               + S  L
Sbjct  464   QITVSNTL  471



>ref|XP_009338996.1| PREDICTED: uncharacterized protein LOC103931287 isoform X1 [Pyrus 
x bretschneideri]
Length=760

 Score =   108 bits (270),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 76/102 (75%), Gaps = 5/102 (5%)
 Frame = +3

Query  2199  QPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNE  2378
             Q + NS     R+ + +  R SLA AGT +++GVRRS RIK+RPLE+WKGERLL+GR+++
Sbjct  659   QIKANSRPQIKRKSREVSRRKSLAGAGTTWQSGVRRSTRIKTRPLEYWKGERLLYGRIHD  718

Query  2379  SM-KLVGVKYVSP----SLGNMKVKSYISDEYKEVVDLAARY  2489
             S+  ++G+KY SP      G +KVKS++SDEYKE+V+LAA +
Sbjct  719   SLVTVIGIKYASPEKDNGRGPLKVKSFVSDEYKELVELAALH  760


 Score =   108 bits (270),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 116/368 (32%), Positives = 177/368 (48%), Gaps = 41/368 (11%)
 Frame = +3

Query  411   SIHQLMKSMGLRNA-EKLLEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPR  587
             + H  +K M  +++  KL +E + IV   SEIL    P  + +L     V  +   E PR
Sbjct  132   AFHIRLKLMASQHSPSKLKDEGENIVRGTSEILE---PGNRQALKQKSKVVTEKGVESPR  188

Query  588   ERRPGLGRKRARFSMKPDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMG  767
             +RRP LG KRARFSMKPD+SQP+ SL    D  K  DPEE F   EK ENAK+EL +  G
Sbjct  189   QRRPALGLKRARFSMKPDSSQPDTSLLPPFDAQKYTDPEELFKELEKYENAKKELEKLRG  248

Query  768   VVADDSNINNLPTTARRRRPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALK  947
                 D+  +N     R RRP IL K  ++KH +  +       D  S E     +   L 
Sbjct  249   GAMLDAYKHNPSPIKRTRRPSILRKRAKHKHSYPLM-------DFESSE-----NGSPLN  296

Query  948   SDLQKENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMK  1127
                + E + +V  EE++L G + E+    N   DELLS + + L+ D  ++ +Q+  +M+
Sbjct  297   HSTRIEPNKNVAREEMDLAGSLAEEVNDRN--FDELLSLNTECLEGDGAVTHVQKCLRMQ  354

Query  1128  PPDLSALCMPEFPDA-RTDYMTLGERIPKARKSVLGLPNSDKRTSGKRQWEE--SPQSNL  1298
               +     +P+F    + D +T  + + K   S  G  +  KR  G  ++     P+S  
Sbjct  355   SIEPEKSDLPDFQSIPKGDCLTDIDNLLKGLISSTGAKHR-KRPEGSIRFASPTPPKSPF  413

Query  1299  tsptppkspfssLALLRKQVLKSNPLRDPFSPLNID---------LNDINKNSDQVGLVK  1451
                       +S+  L K++L S+P  DPFS  +ID         + + NK S+ V + +
Sbjct  414   ----------ASILDLHKRILHSSPSSDPFSAHDIDRLPETNPSSVENCNKQSELVDMRE  463

Query  1452  DFSKSGNL  1475
               + S  L
Sbjct  464   QITVSNTL  471



>ref|XP_009338997.1| PREDICTED: uncharacterized protein LOC103931287 isoform X2 [Pyrus 
x bretschneideri]
Length=758

 Score =   108 bits (270),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 76/102 (75%), Gaps = 5/102 (5%)
 Frame = +3

Query  2199  QPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNE  2378
             Q + NS     R+ + +  R SLA AGT +++GVRRS RIK+RPLE+WKGERLL+GR+++
Sbjct  657   QIKANSRPQIKRKSREVSRRKSLAGAGTTWQSGVRRSTRIKTRPLEYWKGERLLYGRIHD  716

Query  2379  SM-KLVGVKYVSP----SLGNMKVKSYISDEYKEVVDLAARY  2489
             S+  ++G+KY SP      G +KVKS++SDEYKE+V+LAA +
Sbjct  717   SLVTVIGIKYASPEKDNGRGPLKVKSFVSDEYKELVELAALH  758


 Score =   108 bits (269),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 116/368 (32%), Positives = 177/368 (48%), Gaps = 41/368 (11%)
 Frame = +3

Query  411   SIHQLMKSMGLRNA-EKLLEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPR  587
             + H  +K M  +++  KL +E + IV   SEIL    P  + +L     V  +   E PR
Sbjct  132   AFHIRLKLMASQHSPSKLKDEGENIVRGTSEILE---PGNRQALKQKSKVVTEKGVESPR  188

Query  588   ERRPGLGRKRARFSMKPDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMG  767
             +RRP LG KRARFSMKPD+SQP+ SL    D  K  DPEE F   EK ENAK+EL +  G
Sbjct  189   QRRPALGLKRARFSMKPDSSQPDTSLLPPFDAQKYTDPEELFKELEKYENAKKELEKLRG  248

Query  768   VVADDSNINNLPTTARRRRPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALK  947
                 D+  +N     R RRP IL K  ++KH +  +       D  S E     +   L 
Sbjct  249   GAMLDAYKHNPSPIKRTRRPSILRKRAKHKHSYPLM-------DFESSE-----NGSPLN  296

Query  948   SDLQKENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMK  1127
                + E + +V  EE++L G + E+    N   DELLS + + L+ D  ++ +Q+  +M+
Sbjct  297   HSTRIEPNKNVAREEMDLAGSLAEEVNDRN--FDELLSLNTECLEGDGAVTHVQKCLRMQ  354

Query  1128  PPDLSALCMPEFPDA-RTDYMTLGERIPKARKSVLGLPNSDKRTSGKRQWEE--SPQSNL  1298
               +     +P+F    + D +T  + + K   S  G  +  KR  G  ++     P+S  
Sbjct  355   SIEPEKSDLPDFQSIPKGDCLTDIDNLLKGLISSTGAKHR-KRPEGSIRFASPTPPKSPF  413

Query  1299  tsptppkspfssLALLRKQVLKSNPLRDPFSPLNID---------LNDINKNSDQVGLVK  1451
                       +S+  L K++L S+P  DPFS  +ID         + + NK S+ V + +
Sbjct  414   ----------ASILDLHKRILHSSPSSDPFSAHDIDRLPETNPSSVENCNKQSELVDMRE  463

Query  1452  DFSKSGNL  1475
               + S  L
Sbjct  464   QITVSNTL  471



>ref|XP_009339000.1| PREDICTED: uncharacterized protein LOC103931287 isoform X4 [Pyrus 
x bretschneideri]
Length=706

 Score =   108 bits (269),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 76/102 (75%), Gaps = 5/102 (5%)
 Frame = +3

Query  2199  QPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNE  2378
             Q + NS     R+ + +  R SLA AGT +++GVRRS RIK+RPLE+WKGERLL+GR+++
Sbjct  605   QIKANSRPQIKRKSREVSRRKSLAGAGTTWQSGVRRSTRIKTRPLEYWKGERLLYGRIHD  664

Query  2379  SM-KLVGVKYVSP----SLGNMKVKSYISDEYKEVVDLAARY  2489
             S+  ++G+KY SP      G +KVKS++SDEYKE+V+LAA +
Sbjct  665   SLVTVIGIKYASPEKDNGRGPLKVKSFVSDEYKELVELAALH  706


 Score =   107 bits (268),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 116/368 (32%), Positives = 177/368 (48%), Gaps = 41/368 (11%)
 Frame = +3

Query  411   SIHQLMKSMGLRNA-EKLLEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPR  587
             + H  +K M  +++  KL +E + IV   SEIL    P  + +L     V  +   E PR
Sbjct  132   AFHIRLKLMASQHSPSKLKDEGENIVRGTSEILE---PGNRQALKQKSKVVTEKGVESPR  188

Query  588   ERRPGLGRKRARFSMKPDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMG  767
             +RRP LG KRARFSMKPD+SQP+ SL    D  K  DPEE F   EK ENAK+EL +  G
Sbjct  189   QRRPALGLKRARFSMKPDSSQPDTSLLPPFDAQKYTDPEELFKELEKYENAKKELEKLRG  248

Query  768   VVADDSNINNLPTTARRRRPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALK  947
                 D+  +N     R RRP IL K  ++KH +  +       D  S E     +   L 
Sbjct  249   GAMLDAYKHNPSPIKRTRRPSILRKRAKHKHSYPLM-------DFESSE-----NGSPLN  296

Query  948   SDLQKENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMK  1127
                + E + +V  EE++L G + E+    N   DELLS + + L+ D  ++ +Q+  +M+
Sbjct  297   HSTRIEPNKNVAREEMDLAGSLAEEVNDRN--FDELLSLNTECLEGDGAVTHVQKCLRMQ  354

Query  1128  PPDLSALCMPEFPDA-RTDYMTLGERIPKARKSVLGLPNSDKRTSGKRQWEE--SPQSNL  1298
               +     +P+F    + D +T  + + K   S  G  +  KR  G  ++     P+S  
Sbjct  355   SIEPEKSDLPDFQSIPKGDCLTDIDNLLKGLISSTGAKHR-KRPEGSIRFASPTPPKSPF  413

Query  1299  tsptppkspfssLALLRKQVLKSNPLRDPFSPLNID---------LNDINKNSDQVGLVK  1451
                       +S+  L K++L S+P  DPFS  +ID         + + NK S+ V + +
Sbjct  414   ----------ASILDLHKRILHSSPSSDPFSAHDIDRLPETNPSSVENCNKQSELVDMRE  463

Query  1452  DFSKSGNL  1475
               + S  L
Sbjct  464   QITVSNTL  471



>ref|XP_006306866.1| hypothetical protein CARUB_v10008413mg, partial [Capsella rubella]
 gb|EOA39764.1| hypothetical protein CARUB_v10008413mg, partial [Capsella rubella]
Length=737

 Score =   107 bits (268),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 67/92 (73%), Gaps = 6/92 (7%)
 Frame = +3

Query  2232  RERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYV  2408
             RE K    R SLA AGT  E G+RRS RIKSRPLE+W+GER L+GR++ES+  ++G+KY 
Sbjct  646   REAKIFSRRKSLAGAGTKMEGGIRRSTRIKSRPLEYWRGERFLYGRIHESLTTVIGIKYG  705

Query  2409  SPSLGN-----MKVKSYISDEYKEVVDLAARY  2489
             SP  G       KVKS++SD+YK++VD AAR+
Sbjct  706   SPEDGKNDKRASKVKSFVSDDYKDLVDFAARH  737


 Score = 93.2 bits (230),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 81/281 (29%), Positives = 139/281 (49%), Gaps = 29/281 (10%)
 Frame = +3

Query  300   TMDPPDPLRAFAGLPLLPQTIRVQSEDSIP---SEPNNLNSIHQLMKSMGLRNAEKLLEE  470
             +++  DPL A++GL L P+T++  S    P    +  +L   H L++SM     ++  E+
Sbjct  34    SLESDDPLHAYSGLSLFPRTLKSLSNPLPPPRLHQSEDLQQTHTLLESMPFEIQKEHQEQ  93

Query  471   SKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQ  650
             +KAI+++               +++D  +     K   RERRPGL RKR  FS+   TS+
Sbjct  94    AKAILED---------------MNVDVKLNPDPNK---RERRPGLDRKRKSFSVNLTTSR  135

Query  651   PNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPG  830
             P   +  S D  K   PE+YF   +K E A +E  +  G    D+  N  P + R  R G
Sbjct  136   P-PPVAPSFDGGKFPRPEDYFAEYDKFELANREWQKLTGSSVIDTQQN--PPSRRPHRSG  192

Query  831   ILG-KSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltg  1007
             I G K   +KH ++    D+  TD  +QET +++     +  L+K  +  V   + E+  
Sbjct  193   IPGRKRAPFKHSYT----DNYFTDAINQETSEKEHPIPSEQSLEKTTAAPVMNTDREVED  248

Query  1008  litekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKP  1130
                  +  ++ IL+ELL+    +L+ D  +++LQ++  +KP
Sbjct  249   STVATDKDLDNILNELLACSRDELEGDGAINLLQDRLHIKP  289



>ref|XP_006306865.1| hypothetical protein CARUB_v10008413mg, partial [Capsella rubella]
 gb|EOA39763.1| hypothetical protein CARUB_v10008413mg, partial [Capsella rubella]
Length=736

 Score =   107 bits (268),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 67/92 (73%), Gaps = 6/92 (7%)
 Frame = +3

Query  2232  RERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYV  2408
             RE K    R SLA AGT  E G+RRS RIKSRPLE+W+GER L+GR++ES+  ++G+KY 
Sbjct  645   REAKIFSRRKSLAGAGTKMEGGIRRSTRIKSRPLEYWRGERFLYGRIHESLTTVIGIKYG  704

Query  2409  SPSLGN-----MKVKSYISDEYKEVVDLAARY  2489
             SP  G       KVKS++SD+YK++VD AAR+
Sbjct  705   SPEDGKNDKRASKVKSFVSDDYKDLVDFAARH  736


 Score = 93.2 bits (230),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 81/281 (29%), Positives = 139/281 (49%), Gaps = 29/281 (10%)
 Frame = +3

Query  300   TMDPPDPLRAFAGLPLLPQTIRVQSEDSIP---SEPNNLNSIHQLMKSMGLRNAEKLLEE  470
             +++  DPL A++GL L P+T++  S    P    +  +L   H L++SM     ++  E+
Sbjct  34    SLESDDPLHAYSGLSLFPRTLKSLSNPLPPPRLHQSEDLQQTHTLLESMPFEIQKEHQEQ  93

Query  471   SKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQ  650
             +KAI+++               +++D  +     K   RERRPGL RKR  FS+   TS+
Sbjct  94    AKAILED---------------MNVDVKLNPDPNK---RERRPGLDRKRKSFSVNLTTSR  135

Query  651   PNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPG  830
             P   +  S D  K   PE+YF   +K E A +E  +  G    D+  N  P + R  R G
Sbjct  136   P-PPVAPSFDGGKFPRPEDYFAEYDKFELANREWQKLTGSSVIDTQQN--PPSRRPHRSG  192

Query  831   ILG-KSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltg  1007
             I G K   +KH ++    D+  TD  +QET +++     +  L+K  +  V   + E+  
Sbjct  193   IPGRKRAPFKHSYT----DNYFTDAINQETSEKEHPIPSEQSLEKTTAAPVMNTDREVED  248

Query  1008  litekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKP  1130
                  +  ++ IL+ELL+    +L+ D  +++LQ++  +KP
Sbjct  249   STVATDKDLDNILNELLACSRDELEGDGAINLLQDRLHIKP  289



>gb|AAU04625.1| CENP-C [Glycine max]
Length=170

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 97/147 (66%), Gaps = 11/147 (7%)
 Frame = +3

Query  2079  NP-SDQSNSAAVQNHSVDMQSALPDINPEQHIMKQH-----PLTKKQPRKNSCMPGNRER  2240
             NP +DQ N A  + +SVD ++   D +PE  + ++      P+   Q R  S +    + 
Sbjct  25    NPLADQPNPAGYEANSVDKRARRSDDDPEHCLQEKTDGSMVPVNG-QKRVKSLVQKVSKN  83

Query  2241  KALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSP-  2414
             K L  R SLA AGT + +G+RRS RI++RPLE+WKGERL++GRV++S+  ++GVK +SP 
Sbjct  84    KKLSNRHSLAAAGTSWTSGLRRSTRIRTRPLEYWKGERLVYGRVHKSLATVIGVKCISPG  143

Query  2415  SLGN--MKVKSYISDEYKEVVDLAARY  2489
             S G   MKVKSY+SD++KE+ +LA+ Y
Sbjct  144   SDGKPIMKVKSYVSDKHKELFELASLY  170



>gb|AAF71990.1|AC013453_15 Hypothetical protein [Arabidopsis thaliana]
Length=710

 Score =   107 bits (266),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 70/103 (68%), Gaps = 10/103 (10%)
 Frame = +3

Query  2193  KKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRV  2372
             +K+P+K     G    K    R SLA AGT  E GVRRS RIKSRPLE+W+GER L+GR+
Sbjct  610   EKKPKKTLTHEG----KLFSCRKSLAAAGTKIEGGVRRSTRIKSRPLEYWRGERFLYGRI  665

Query  2373  NESM-KLVGVKYVSPSLGNM-----KVKSYISDEYKEVVDLAA  2483
             +ES+  ++G+KY SP  G       KVKS++SDEYK++VD AA
Sbjct  666   HESLTTVIGIKYASPGEGKRDSRASKVKSFVSDEYKKLVDFAA  708


 Score = 87.4 bits (215),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 88/322 (27%), Positives = 147/322 (46%), Gaps = 44/322 (14%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPS-EPNNLNSIHQLMKSMGLRNAEKLLEESKAIVDN  491
             DPL+A++GL L P+T++  S    PS +  +L   H L++SM      +  E++KAI+++
Sbjct  15    DPLQAYSGLSLFPRTLKSLSNPLPPSYQSEDLQQTHTLLQSMPFEIQSEHQEQAKAILED  74

Query  492   GSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNISLQS  671
                            +D+D  +     K   RERRPGL RKR  FS+   TSQP   +  
Sbjct  75    ---------------VDVDVQLNPIPNK---RERRPGLDRKRKSFSLHLTTSQPP-PVAP  115

Query  672   SLDVDKLQDPEEYFLACEKLEN-----AKQELNRQMGVVADDSNINNLPTTAR-------  815
             S D  K    E++F A +K E      A +E  +Q G    D   N      R       
Sbjct  116   SFDPSKYPRSEDFFAAYDKFEPGFETVANREWQKQTGSSVIDIQENPPSRRPRRPGIPGR  175

Query  816   RRRPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleel  995
             +RRP        +K  F+    D   TD+ + E  +++   A +  L+   +  V   + 
Sbjct  176   KRRP--------FKESFT----DSYFTDVINLEASEKEIPIASEQSLESATAAHVTTVDR  223

Query  996   eltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDAR  1175
             E+     + +  +N +L +LL+   ++L+ D  + +L+E+ Q+K  ++    +PEF D R
Sbjct  224   EVDDSTVDTDKDLNNVLKDLLACSREELEGDGAIKLLEERLQIKSFNIEKFSIPEFQDVR  283

Query  1176  TDYMTLGERIPKARKSVLGLPN  1241
                +      P  RKS+  + N
Sbjct  284   KMNLKASGSNPPNRKSLSDIQN  305



>ref|NP_173018.2| centromere protein C [Arabidopsis thaliana]
 gb|AAU04629.1| CENP-C [Arabidopsis thaliana]
 gb|AEE29346.1| centromere protein C [Arabidopsis thaliana]
Length=705

 Score =   107 bits (266),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 70/103 (68%), Gaps = 10/103 (10%)
 Frame = +3

Query  2193  KKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRV  2372
             +K+P+K     G    K    R SLA AGT  E GVRRS RIKSRPLE+W+GER L+GR+
Sbjct  605   EKKPKKTLTHEG----KLFSCRKSLAAAGTKIEGGVRRSTRIKSRPLEYWRGERFLYGRI  660

Query  2373  NESM-KLVGVKYVSPSLGNM-----KVKSYISDEYKEVVDLAA  2483
             +ES+  ++G+KY SP  G       KVKS++SDEYK++VD AA
Sbjct  661   HESLTTVIGIKYASPGEGKRDSRASKVKSFVSDEYKKLVDFAA  703


 Score = 92.8 bits (229),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 88/317 (28%), Positives = 147/317 (46%), Gaps = 39/317 (12%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPS-EPNNLNSIHQLMKSMGLRNAEKLLEESKAIVDN  491
             DPL+A++GL L P+T++  S    PS +  +L   H L++SM      +  E++KAI+++
Sbjct  15    DPLQAYSGLSLFPRTLKSLSNPLPPSYQSEDLQQTHTLLQSMPFEIQSEHQEQAKAILED  74

Query  492   GSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNISLQS  671
                            +D+D  +     K   RERRPGL RKR  FS+   TSQP   +  
Sbjct  75    ---------------VDVDVQLNPIPNK---RERRPGLDRKRKSFSLHLTTSQPP-PVAP  115

Query  672   SLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTAR-------RRRPG  830
             S D  K    E++F A +K E A +E  +Q G    D   N      R       +RRP 
Sbjct  116   SFDPSKYPRSEDFFAAYDKFELANREWQKQTGSSVIDIQENPPSRRPRRPGIPGRKRRP-  174

Query  831   ILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltgl  1010
                    +K  F+    D   TD+ + E  +++   A +  L+   +  V   + E+   
Sbjct  175   -------FKESFT----DSYFTDVINLEASEKEIPIASEQSLESATAAHVTTVDREVDDS  223

Query  1011  itekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDARTDYMT  1190
               + +  +N +L +LL+   ++L+ D  + +L+E+ Q+K  ++    +PEF D R   + 
Sbjct  224   TVDTDKDLNNVLKDLLACSREELEGDGAIKLLEERLQIKSFNIEKFSIPEFQDVRKMNLK  283

Query  1191  LGERIPKARKSVLGLPN  1241
                  P  RKS+  + N
Sbjct  284   ASGSNPPNRKSLSDIQN  300



>ref|XP_008342750.1| PREDICTED: uncharacterized protein LOC103405517 [Malus domestica]
Length=714

 Score =   106 bits (265),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 68/83 (82%), Gaps = 5/83 (6%)
 Frame = +3

Query  2256  RPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSP----SL  2420
             R SLA AGT +++GVRRS RIK+RPLE+WKGERLL+GR+++S+  ++G+KY SP      
Sbjct  632   RKSLAGAGTTWQSGVRRSTRIKTRPLEYWKGERLLYGRIHDSLVTVIGIKYASPEKDNGR  691

Query  2421  GNMKVKSYISDEYKEVVDLAARY  2489
             G +KVKS++SDEYKE+V+LAA +
Sbjct  692   GPLKVKSFVSDEYKELVELAALH  714


 Score =   106 bits (265),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 122/438 (28%), Positives = 189/438 (43%), Gaps = 75/438 (17%)
 Frame = +3

Query  411   SIHQLMKSMGLRNA-EKLLEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPR  587
             +IH  +K M  +++  K  ++ + IV   SEIL    P  + +L   + V      E PR
Sbjct  89    AIHIRLKPMASQHSPSKPKDQVENIVSGTSEILE---PGNRQALKQKNKVVPGKAAESPR  145

Query  588   ERRPGLGRKRARFSMKPDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMG  767
             +RRP LG KRARFSM PD+SQ   SL    D  K  DPEE F   EK ENAK+EL +  G
Sbjct  146   QRRPALGLKRARFSMMPDSSQHETSLLPPFDAQKYTDPEELFKELEKYENAKKELEKLKG  205

Query  768   VVADDSNINNLPTTARRRRPGILGKSVRYKHRFSSV--------PPDDNDTDMSSQETFK  923
                 D+  +N     R RRP IL K  ++KH +  +         P ++ T +   E   
Sbjct  206   GAILDAYKHNPSPIKRTRRPSILRKRAKHKHSYPLMDFESGENGSPLNHSTRIKPNENVA  265

Query  924   QDDLCALKSDLQKENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSI  1103
              +++    S  ++ N  D                       DELLS   + L+ D  ++ 
Sbjct  266   WEEMDLAGSLAEEVNVGD----------------------FDELLSLSTECLEGDGAVTH  303

Query  1104  LQEQFQMKPPDLSALCMPEFPDA-RTDYMTLGERIPKARKSVLGLPNSDKRTSGKRQWE-  1277
             +Q+  +MKP +     +PE     + D +T  + + K   S  G+ +  KR  G   +  
Sbjct  304   VQKCLRMKPIEPEKSDVPELQGIPKGDCLTDIDNLLKGLISSTGVKHR-KRAEGSIHFAS  362

Query  1278  -ESPQSNLtsptppkspfssLALLRKQVLKSNPLRDPFSPLNID---------LNDINKN  1427
              + P+S            +S+  L K++L S+P  DPFS   ID         + + NK 
Sbjct  363   PKPPKSPF----------TSILDLHKRILHSSPSSDPFSAHGIDQLPVPNPSSVENRNKQ  412

Query  1428  SDQVGLVKDFSKSGNLH---------------GESNIKGMNVSDHQADRSA--ETNAQSS  1556
             S+ V + +  + S  L                G S++     S + + RS   +++   +
Sbjct  413   SELVDMREQITVSNALKSPFIEPDSIEVAVIGGSSDVDIKEFS-YASKRSVSEDSSKHDA  471

Query  1557  NIDISHSGSHAQMGDCDG  1610
              ID   SGSH  + D  G
Sbjct  472   RIDFGSSGSHVGLEDNIG  489



>ref|XP_010497282.1| PREDICTED: uncharacterized protein LOC104774341 isoform X2 [Camelina 
sativa]
Length=752

 Score =   106 bits (264),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 64/90 (71%), Gaps = 6/90 (7%)
 Frame = +3

Query  2232  RERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYV  2408
             RE      R SLA AGT  + G+RRS RIKSRPLEFW+GER L+GR++ESM  ++G+KY 
Sbjct  661   REAAIFSRRKSLAGAGTKMDGGIRRSTRIKSRPLEFWRGERFLYGRIHESMTTVIGIKYG  720

Query  2409  SPSLGN-----MKVKSYISDEYKEVVDLAA  2483
             SP  G       KVKSY+SD+YK++VD AA
Sbjct  721   SPGDGKSDKRASKVKSYVSDDYKDLVDFAA  750


 Score = 82.0 bits (201),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 92/341 (27%), Positives = 149/341 (44%), Gaps = 63/341 (18%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPS----EPNNLNSIHQLMKSMGLRNAEKLLEESKAI  482
             DPL A++GL L P+T++  S    P     +  +    H L++SM      +  E++KAI
Sbjct  13    DPLHAYSGLSLFPRTLKSLSNPLPPPPPLHQSEDPQQTHTLLESMPFEIQNEHQEQAKAI  72

Query  483   VDNGSEILNANFPRFKASLDLDDHVAAKVEKEMP--RERRPGLGRKRARFSMKPDTSQPN  656
             ++                   D +V AK+   +P  RERR GL R+R  FS+   TSQ  
Sbjct  73    LE-------------------DINVDAKLLNPIPNKRERRQGLDRQRKSFSLDLPTSQ-P  112

Query  657   ISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGIL  836
                  S D  K+  PEEYF   +K E A +E ++Q G    D+  N  P + R RR G+ 
Sbjct  113   PPAPPSFDGIKIPRPEEYFAEYDKYELANREWHKQTGTSVIDTQQN--PPSRRPRRSGLQ  170

Query  837   GKSVRYKHRFSSVPPD------------DNDTDMSSQETFKQDDLCALKSD---------  953
             G   R +  F+    D            + +  + S++  K+     + +D         
Sbjct  171   G---RKRPSFTLTSEDGYFADDVNLEASEKEIPIPSEQGLKRTTAAQVMTDAVNLEASEK  227

Query  954   ---------LQKENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSIL  1106
                      L++  +  V   + E+     +K+  ++ IL ELL+    +L+D   + IL
Sbjct  228   EIPIPSKQSLKRTTAAQVMTADREVDDSTVDKDKDLSNILHELLACSRDELEDGGAIKIL  287

Query  1107  QEQFQMKPPDLSALCMPEFPDARTDYMTLGERIPKARKSVL  1229
             +++F +KP       + E PD R   +   +R P  RKSVL
Sbjct  288   EDRFNIKP--FVVEDISEVPDVRKMDLKASQRNPSNRKSVL  326



>ref|XP_010459101.1| PREDICTED: uncharacterized protein LOC104740251 isoform X1 [Camelina 
sativa]
Length=750

 Score =   106 bits (264),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 64/90 (71%), Gaps = 6/90 (7%)
 Frame = +3

Query  2232  RERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYV  2408
             RE      R SLA AGT  E G+RRS RIKSRPLEFW+GER L+GR++ES+  ++G+KY 
Sbjct  659   REGAIFSRRKSLAGAGTKLEGGIRRSTRIKSRPLEFWRGERFLYGRIHESLTTVIGIKYG  718

Query  2409  SPSLGN-----MKVKSYISDEYKEVVDLAA  2483
             SP  G       KVKSY+SD+YK++VD AA
Sbjct  719   SPGDGKSDKRASKVKSYVSDDYKDLVDFAA  748


 Score = 73.6 bits (179),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 87/336 (26%), Positives = 140/336 (42%), Gaps = 57/336 (17%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPS----EPNNLNSIHQLMKSMGLRNAEKLLEESKAI  482
             DPL A++GL L P+T++  S    P     +  +    H L++SM      +  E++KAI
Sbjct  14    DPLHAYSGLSLFPRTLKFLSNPLPPPPPLHQSEDPQQTHTLLESMPFEIQNEHQEQAKAI  73

Query  483   VDNGSEILNANFPRFKASLDLDDHVAAKVEKEMP--RERRPGLGRKRARFSMKPDTSQPN  656
             +++                       AK+   +P  RERR GL R+R  FS+   TSQ  
Sbjct  74    LED-----------------------AKLLNPIPNKRERRQGLDRQRKSFSLDLPTSQ-P  109

Query  657   ISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTAR------R  818
                    D  K+  PEEYF A +K E A +E ++Q G    D+  N      R      R
Sbjct  110   PPAPPGFDSSKIPRPEEYFAAYDKYELANREWHKQTGTSVIDTQQNPPSRRPRRPGLQGR  169

Query  819   RRP--------GILGKSVRYKHRFSSVP-PDDND----------TDMSSQETFKQDDLCA  941
             +RP        G     V  +     +P P +            TD  + E  +++    
Sbjct  170   KRPSFTLTSEDGYFADDVNLEASEKEIPIPSEKSLKRTTAAQVMTDAVNLEVSEKESPIP  229

Query  942   LKSDLQKENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQ  1121
              +  L++  +  V   + E+     + +  ++ IL ELL+    +L+    + IL+++  
Sbjct  230   SEQSLKRTTAAQVMTADREVDDSTVDTDKDLSNILHELLACSQDELEGGGAIKILEDRLN  289

Query  1122  MKPPDLSALCMPEFPDARTDYMTLGERIPKARKSVL  1229
             +KP    A  + E PD R   +    R P  RKSVL
Sbjct  290   IKP--FVAEDISEVPDVRKMDLKASGRNPSNRKSVL  323



>ref|XP_010497274.1| PREDICTED: uncharacterized protein LOC104774341 isoform X1 [Camelina 
sativa]
Length=753

 Score =   106 bits (264),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 64/90 (71%), Gaps = 6/90 (7%)
 Frame = +3

Query  2232  RERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYV  2408
             RE      R SLA AGT  + G+RRS RIKSRPLEFW+GER L+GR++ESM  ++G+KY 
Sbjct  662   REAAIFSRRKSLAGAGTKMDGGIRRSTRIKSRPLEFWRGERFLYGRIHESMTTVIGIKYG  721

Query  2409  SPSLGN-----MKVKSYISDEYKEVVDLAA  2483
             SP  G       KVKSY+SD+YK++VD AA
Sbjct  722   SPGDGKSDKRASKVKSYVSDDYKDLVDFAA  751


 Score = 82.0 bits (201),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 92/341 (27%), Positives = 149/341 (44%), Gaps = 63/341 (18%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPS----EPNNLNSIHQLMKSMGLRNAEKLLEESKAI  482
             DPL A++GL L P+T++  S    P     +  +    H L++SM      +  E++KAI
Sbjct  13    DPLHAYSGLSLFPRTLKSLSNPLPPPPPLHQSEDPQQTHTLLESMPFEIQNEHQEQAKAI  72

Query  483   VDNGSEILNANFPRFKASLDLDDHVAAKVEKEMP--RERRPGLGRKRARFSMKPDTSQPN  656
             ++                   D +V AK+   +P  RERR GL R+R  FS+   TSQ  
Sbjct  73    LE-------------------DINVDAKLLNPIPNKRERRQGLDRQRKSFSLDLPTSQ-P  112

Query  657   ISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGIL  836
                  S D  K+  PEEYF   +K E A +E ++Q G    D+  N  P + R RR G+ 
Sbjct  113   PPAPPSFDGIKIPRPEEYFAEYDKYELANREWHKQTGTSVIDTQQN--PPSRRPRRSGLQ  170

Query  837   GKSVRYKHRFSSVPPD------------DNDTDMSSQETFKQDDLCALKSD---------  953
             G   R +  F+    D            + +  + S++  K+     + +D         
Sbjct  171   G---RKRPSFTLTSEDGYFADDVNLEASEKEIPIPSEQGLKRTTAAQVMTDAVNLEASEK  227

Query  954   ---------LQKENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSIL  1106
                      L++  +  V   + E+     +K+  ++ IL ELL+    +L+D   + IL
Sbjct  228   EIPIPSKQSLKRTTAAQVMTADREVDDSTVDKDKDLSNILHELLACSRDELEDGGAIKIL  287

Query  1107  QEQFQMKPPDLSALCMPEFPDARTDYMTLGERIPKARKSVL  1229
             +++F +KP       + E PD R   +   +R P  RKSVL
Sbjct  288   EDRFNIKP--FVVEDISEVPDVRKMDLKASQRNPSNRKSVL  326



>ref|XP_010459103.1| PREDICTED: uncharacterized protein LOC104740251 isoform X2 [Camelina 
sativa]
Length=749

 Score =   106 bits (264),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 64/90 (71%), Gaps = 6/90 (7%)
 Frame = +3

Query  2232  RERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYV  2408
             RE      R SLA AGT  E G+RRS RIKSRPLEFW+GER L+GR++ES+  ++G+KY 
Sbjct  658   REGAIFSRRKSLAGAGTKLEGGIRRSTRIKSRPLEFWRGERFLYGRIHESLTTVIGIKYG  717

Query  2409  SPSLGN-----MKVKSYISDEYKEVVDLAA  2483
             SP  G       KVKSY+SD+YK++VD AA
Sbjct  718   SPGDGKSDKRASKVKSYVSDDYKDLVDFAA  747


 Score = 73.6 bits (179),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 87/336 (26%), Positives = 140/336 (42%), Gaps = 57/336 (17%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPS----EPNNLNSIHQLMKSMGLRNAEKLLEESKAI  482
             DPL A++GL L P+T++  S    P     +  +    H L++SM      +  E++KAI
Sbjct  14    DPLHAYSGLSLFPRTLKFLSNPLPPPPPLHQSEDPQQTHTLLESMPFEIQNEHQEQAKAI  73

Query  483   VDNGSEILNANFPRFKASLDLDDHVAAKVEKEMP--RERRPGLGRKRARFSMKPDTSQPN  656
             +++                       AK+   +P  RERR GL R+R  FS+   TSQ  
Sbjct  74    LED-----------------------AKLLNPIPNKRERRQGLDRQRKSFSLDLPTSQ-P  109

Query  657   ISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTAR------R  818
                    D  K+  PEEYF A +K E A +E ++Q G    D+  N      R      R
Sbjct  110   PPAPPGFDSSKIPRPEEYFAAYDKYELANREWHKQTGTSVIDTQQNPPSRRPRRPGLQGR  169

Query  819   RRP--------GILGKSVRYKHRFSSVP-PDDND----------TDMSSQETFKQDDLCA  941
             +RP        G     V  +     +P P +            TD  + E  +++    
Sbjct  170   KRPSFTLTSEDGYFADDVNLEASEKEIPIPSEKSLKRTTAAQVMTDAVNLEVSEKESPIP  229

Query  942   LKSDLQKENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQ  1121
              +  L++  +  V   + E+     + +  ++ IL ELL+    +L+    + IL+++  
Sbjct  230   SEQSLKRTTAAQVMTADREVDDSTVDTDKDLSNILHELLACSQDELEGGGAIKILEDRLN  289

Query  1122  MKPPDLSALCMPEFPDARTDYMTLGERIPKARKSVL  1229
             +KP    A  + E PD R   +    R P  RKSVL
Sbjct  290   IKP--FVAEDISEVPDVRKMDLKASGRNPSNRKSVL  323



>ref|XP_010476653.1| PREDICTED: transcription factor IRO1-like isoform X1 [Camelina 
sativa]
Length=754

 Score =   106 bits (264),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 64/90 (71%), Gaps = 6/90 (7%)
 Frame = +3

Query  2232  RERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYV  2408
             RE      R SLA AGT  E G+RRS RIKSRPLEFW+GER L+GR++ES+  ++G+KY 
Sbjct  663   REAAIFSRRKSLAGAGTKMEGGIRRSTRIKSRPLEFWRGERFLYGRIHESLTTVIGIKYG  722

Query  2409  SPSLGN-----MKVKSYISDEYKEVVDLAA  2483
             SP  G       KVKSY+SD+YK++VD AA
Sbjct  723   SPGDGKSDKRASKVKSYVSDDYKDLVDFAA  752


 Score = 73.2 bits (178),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 90/336 (27%), Positives = 145/336 (43%), Gaps = 53/336 (16%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPS---EPNNLNSIHQLMKSMGLRNAEKLLEESKAIV  485
             DPL A++GL L P+T++  S    P    +  +    H L++SM      +  E++KAI+
Sbjct  14    DPLHAYSGLSLFPRTLKSLSNPLPPPPLHQSEDPQQTHTLLESMPFEIQNEHQEQAKAIL  73

Query  486   DNGSEILNANFPRFKASLDLDDHVAAKVEKEMP--RERRPGLG-RKRARFSMKPDTSQPN  656
             +                   D +V AK+   +P  RERRPGL  R+R  FS+   TSQP 
Sbjct  74    E-------------------DINVDAKLLNPIPNKRERRPGLDPRQRKSFSLDLPTSQPP  114

Query  657   ISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTAR------R  818
              +L  S    K+  PEEYF   +K E A +E ++Q G    D+  N      R      R
Sbjct  115   PAL-PSFGGSKIPRPEEYFAEYDKYELANREWHKQTGTSVIDTQQNPPARRPRRPGLQGR  173

Query  819   RRP--------GILGKSVRYKHRFSSVP-PDDND----------TDMSSQETFKQDDLCA  941
             +RP        G +   V  +     +P P +            TD  + E  +++    
Sbjct  174   KRPSFMLTSEDGYIADDVNLEGSEKEIPVPSEKSLKRTTAAQVMTDAVNLEASEKEIPIP  233

Query  942   LKSDLQKENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQ  1121
              +  L++  +  V   + E+     + +  ++ IL ELL+    +L+    + IL+++  
Sbjct  234   SEQSLKRTTAAQVMTADREVDDSTVDTDKDLSKILHELLACSRDELEGGGAIKILEDRLN  293

Query  1122  MKPPDLSALCMPEFPDARTDYMTLGERIPKARKSVL  1229
             +KP       + E PD R   +    R P  RKSVL
Sbjct  294   VKP--FVVEDISEVPDVRKMDLKASGRNPSNRKSVL  327



>ref|XP_010497290.1| PREDICTED: uncharacterized protein LOC104774341 isoform X3 [Camelina 
sativa]
Length=744

 Score =   106 bits (264),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 64/90 (71%), Gaps = 6/90 (7%)
 Frame = +3

Query  2232  RERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYV  2408
             RE      R SLA AGT  + G+RRS RIKSRPLEFW+GER L+GR++ESM  ++G+KY 
Sbjct  653   REAAIFSRRKSLAGAGTKMDGGIRRSTRIKSRPLEFWRGERFLYGRIHESMTTVIGIKYG  712

Query  2409  SPSLGN-----MKVKSYISDEYKEVVDLAA  2483
             SP  G       KVKSY+SD+YK++VD AA
Sbjct  713   SPGDGKSDKRASKVKSYVSDDYKDLVDFAA  742


 Score = 79.0 bits (193),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 92/341 (27%), Positives = 148/341 (43%), Gaps = 72/341 (21%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPS----EPNNLNSIHQLMKSMGLRNAEKLLEESKAI  482
             DPL A++GL L P+T++  S    P     +  +    H L++SM         E++KAI
Sbjct  13    DPLHAYSGLSLFPRTLKSLSNPLPPPPPLHQSEDPQQTHTLLESM---------EQAKAI  63

Query  483   VDNGSEILNANFPRFKASLDLDDHVAAKVEKEMP--RERRPGLGRKRARFSMKPDTSQPN  656
             ++                   D +V AK+   +P  RERR GL R+R  FS+   TSQ  
Sbjct  64    LE-------------------DINVDAKLLNPIPNKRERRQGLDRQRKSFSLDLPTSQ-P  103

Query  657   ISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGIL  836
                  S D  K+  PEEYF   +K E A +E ++Q G    D+  N  P + R RR G+ 
Sbjct  104   PPAPPSFDGIKIPRPEEYFAEYDKYELANREWHKQTGTSVIDTQQN--PPSRRPRRSGLQ  161

Query  837   GKSVRYKHRFSSVPPD------------DNDTDMSSQETFKQDDLCALKSD---------  953
             G   R +  F+    D            + +  + S++  K+     + +D         
Sbjct  162   G---RKRPSFTLTSEDGYFADDVNLEASEKEIPIPSEQGLKRTTAAQVMTDAVNLEASEK  218

Query  954   ---------LQKENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSIL  1106
                      L++  +  V   + E+     +K+  ++ IL ELL+    +L+D   + IL
Sbjct  219   EIPIPSKQSLKRTTAAQVMTADREVDDSTVDKDKDLSNILHELLACSRDELEDGGAIKIL  278

Query  1107  QEQFQMKPPDLSALCMPEFPDARTDYMTLGERIPKARKSVL  1229
             +++F +KP       + E PD R   +   +R P  RKSVL
Sbjct  279   EDRFNIKP--FVVEDISEVPDVRKMDLKASQRNPSNRKSVL  317



>ref|XP_010476654.1| PREDICTED: uncharacterized protein LOC104755878 isoform X2 [Camelina 
sativa]
Length=753

 Score =   106 bits (264),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 64/90 (71%), Gaps = 6/90 (7%)
 Frame = +3

Query  2232  RERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYV  2408
             RE      R SLA AGT  E G+RRS RIKSRPLEFW+GER L+GR++ES+  ++G+KY 
Sbjct  662   REAAIFSRRKSLAGAGTKMEGGIRRSTRIKSRPLEFWRGERFLYGRIHESLTTVIGIKYG  721

Query  2409  SPSLGN-----MKVKSYISDEYKEVVDLAA  2483
             SP  G       KVKSY+SD+YK++VD AA
Sbjct  722   SPGDGKSDKRASKVKSYVSDDYKDLVDFAA  751


 Score = 73.2 bits (178),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 90/336 (27%), Positives = 145/336 (43%), Gaps = 53/336 (16%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPS---EPNNLNSIHQLMKSMGLRNAEKLLEESKAIV  485
             DPL A++GL L P+T++  S    P    +  +    H L++SM      +  E++KAI+
Sbjct  14    DPLHAYSGLSLFPRTLKSLSNPLPPPPLHQSEDPQQTHTLLESMPFEIQNEHQEQAKAIL  73

Query  486   DNGSEILNANFPRFKASLDLDDHVAAKVEKEMP--RERRPGLG-RKRARFSMKPDTSQPN  656
             +                   D +V AK+   +P  RERRPGL  R+R  FS+   TSQP 
Sbjct  74    E-------------------DINVDAKLLNPIPNKRERRPGLDPRQRKSFSLDLPTSQPP  114

Query  657   ISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTAR------R  818
              +L  S    K+  PEEYF   +K E A +E ++Q G    D+  N      R      R
Sbjct  115   PAL-PSFGGSKIPRPEEYFAEYDKYELANREWHKQTGTSVIDTQQNPPARRPRRPGLQGR  173

Query  819   RRP--------GILGKSVRYKHRFSSVP-PDDND----------TDMSSQETFKQDDLCA  941
             +RP        G +   V  +     +P P +            TD  + E  +++    
Sbjct  174   KRPSFMLTSEDGYIADDVNLEGSEKEIPVPSEKSLKRTTAAQVMTDAVNLEASEKEIPIP  233

Query  942   LKSDLQKENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQ  1121
              +  L++  +  V   + E+     + +  ++ IL ELL+    +L+    + IL+++  
Sbjct  234   SEQSLKRTTAAQVMTADREVDDSTVDTDKDLSKILHELLACSRDELEGGGAIKILEDRLN  293

Query  1122  MKPPDLSALCMPEFPDARTDYMTLGERIPKARKSVL  1229
             +KP       + E PD R   +    R P  RKSVL
Sbjct  294   VKP--FVVEDISEVPDVRKMDLKASGRNPSNRKSVL  327



>ref|XP_006844397.1| hypothetical protein AMTR_s00142p00096890 [Amborella trichopoda]
 gb|ERN06072.1| hypothetical protein AMTR_s00142p00096890 [Amborella trichopoda]
Length=647

 Score =   105 bits (261),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 107/191 (56%), Gaps = 23/191 (12%)
 Frame = +3

Query  315  DPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIVDNG  494
            DPL   +   LLP+T+   S  + P    +   +H L++S  L  A +++E +KA+V++ 
Sbjct  11   DPLAGLSLHSLLPRTLDFVS--NTPEFTGSHEELHDLLRSKALDRANEIMELAKAVVESN  68

Query  495  SEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNISLQSS  674
             E           + + ++ + AK       ERRPGL RKR  FS+KPDTS P++S   +
Sbjct  69   KE-----------NKEKENVIHAK-------ERRPGLDRKRPVFSLKPDTSVPSLSFDVN  110

Query  675  L---DVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILGKS  845
            +   +V++LQDP ++F A E  E+A++EL R  G    +   +N PT  R RRP +LG+ 
Sbjct  111  VAEPNVEELQDPAQFFAAFELKEHAERELKRLRGKCVMEQTDDNKPTKTRLRRPSLLGRK  170

Query  846  VRYKHRFSSVP  878
              YKH +S++P
Sbjct  171  AIYKHAYSNLP  181


 Score = 96.3 bits (238),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 67/97 (69%), Gaps = 12/97 (12%)
 Frame = +3

Query  2235  ERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVS  2411
             +RK L  R SLA AGT FE GVRRS RIKSRPLE+W+GERL++GR+++S+  ++G KY S
Sbjct  541   KRKELTHRKSLAGAGTKFEGGVRRSTRIKSRPLEYWRGERLIYGRIHDSLATVIGRKYAS  600

Query  2412  P-----SLGN------MKVKSYISDEYKEVVDLAARY  2489
             P     S G       +K++S++ +E+  +V+ A RY
Sbjct  601   PLPMGRSKGRKDIEPALKIESFVPEEFTRLVEFAGRY  637



>ref|XP_007150678.1| hypothetical protein PHAVU_005G1725001g, partial [Phaseolus vulgaris]
 gb|ESW22672.1| hypothetical protein PHAVU_005G1725001g, partial [Phaseolus vulgaris]
Length=145

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 94/145 (65%), Gaps = 11/145 (8%)
 Frame = +3

Query  2088  DQSNSAAVQNHSVDMQSALPD---INPEQH---IMKQHPLTKKQPRKN-SCMPGNRERKA  2246
             DQS+ A  Q  +VD +++  +    NP ++   I+++      +P KN      +R +K 
Sbjct  1     DQSDPAGYQASAVDKRASRSEDDQSNPTEYQAYIVQEKTDDSMEPVKNQKKRVKSRAKKN  60

Query  2247  LKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSLG  2423
             +  R SLAD+GT + +G+RRS RI++RPLE+WKGER ++GRV++S+  ++GVK +SP   
Sbjct  61    VSKRKSLADSGTSWNDGLRRSTRIRTRPLEYWKGERPVYGRVHQSLATVIGVKCMSPGTD  120

Query  2424  ---NMKVKSYISDEYKEVVDLAARY  2489
                 MKVKSY+SD +KE+ +LA+ Y
Sbjct  121   GKPTMKVKSYVSDLHKELFELASLY  145



>emb|CDY36578.1| BnaA06g10310D [Brassica napus]
Length=711

 Score =   102 bits (253),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 92/316 (29%), Positives = 149/316 (47%), Gaps = 22/316 (7%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIV-DN  491
             DPL A++GL L P+T++  S    P   + L   H L++SM    +++  E++K+I+ D 
Sbjct  14    DPLHAYSGLSLFPRTLKSMS-IPPPHHSDALQQTHTLLQSMPFEVSKEHEEQAKSILEDE  72

Query  492   GSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQP-NISLQ  668
              SE+L        AS D D  V     K   RERRP   RKR  F+ KP T+   +   +
Sbjct  73    SSELLKKGVGSSVASEDTDVGVNPIANK---RERRPAYERKRGHFTFKPTTTTSESPQKE  129

Query  669   SSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILG-KS  845
              + D  K   P +YF A ++   A++E  +Q G    +++        R RRP + G K 
Sbjct  130   PTFDPSKYPKPGDYFAAYDRFLLAQREWQKQTGTFVKETHQYQ----PRPRRPELPGRKR  185

Query  846   VRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltgliteke  1025
               YKH ++S  P D  T  S +ET    +       +++  +  V+  + E+       +
Sbjct  186   GAYKHTYTSSYPIDLKT--SEKETPTPSEQI-----VEENTAAHVKTVDREVDDSTAYTD  238

Query  1026  gRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPD----ARTDYMTL  1193
               +  IL ELL+    +LD D  + +LQE+  +KP +   L  P+ PD     R D    
Sbjct  239   KNLENILTELLACSPDELDGDAGVKLLQERLNIKPVNEEMLSFPDIPDFPDVRRMDLKAS  298

Query  1194  GERIPKARKSVLGLPN  1241
             G ++ K R ++  + N
Sbjct  299   GRKLSKPRTALSNIQN  314


 Score =   102 bits (253),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 72/112 (64%), Gaps = 9/112 (8%)
 Frame = +3

Query  2175  KQHPLTKKQPRKNSCMPGN--RERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKG  2348
             K+ P  K   RK   +     RE K    R SLA AGT +E GVRRS RIKSRPLE+W+G
Sbjct  598   KKQPKGKANERKEKTLKKTVTRESKMFSRRKSLAAAGTNWEAGVRRSTRIKSRPLEYWRG  657

Query  2349  ERLLFGRVNESM-KLVGVKYVSPSLGN------MKVKSYISDEYKEVVDLAA  2483
             ER L+GRV+ES+  ++G+KY SP          +KVKS++SD+YK +V+ AA
Sbjct  658   ERFLYGRVHESLTTVIGIKYESPGKNGKGETRALKVKSFVSDDYKGLVESAA  709



>ref|XP_009148956.1| PREDICTED: uncharacterized protein LOC103872354 isoform X1 [Brassica 
rapa]
Length=711

 Score =   102 bits (253),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 72/112 (64%), Gaps = 9/112 (8%)
 Frame = +3

Query  2175  KQHPLTKKQPRKNSCMPGN--RERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKG  2348
             K+ P  K   RK   +     RE K    R SLA AGT +E GVRRS RIKSRPLE+W+G
Sbjct  598   KKQPKGKANERKEKTLKKTVTRESKMFSRRKSLAAAGTNWEAGVRRSTRIKSRPLEYWRG  657

Query  2349  ERLLFGRVNESM-KLVGVKYVSPSLGN------MKVKSYISDEYKEVVDLAA  2483
             ER L+GRV+ES+  ++G+KY SP          +KVKS++SD+YK +V+ AA
Sbjct  658   ERFLYGRVHESLTTVIGIKYESPGKNGKGETRALKVKSFVSDDYKGLVESAA  709


 Score =   100 bits (249),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 91/316 (29%), Positives = 149/316 (47%), Gaps = 22/316 (7%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIV-DN  491
             DPL A++GL L P+T++  S    P   + L   H L++S+    +++  E++K+I+ D 
Sbjct  14    DPLHAYSGLSLFPRTLKSMS-IPPPHHSDALQQTHTLLQSIPFEVSKEHEEQAKSILEDE  72

Query  492   GSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQP-NISLQ  668
              SE+L        AS D D  V     K   RERRP   RKR  F+ KP T+   +   +
Sbjct  73    SSELLKKGVGSSVASEDTDVGVNPIANK---RERRPAYERKRGHFTFKPTTTTSESPQKE  129

Query  669   SSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILG-KS  845
              + D  K   P +YF A ++   A++E  +Q G    +++        R RRP + G K 
Sbjct  130   PTFDPSKYPKPGDYFAAYDRFLLAQREWQKQTGTFVKETHQYQ----PRPRRPELPGRKR  185

Query  846   VRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltgliteke  1025
               YKH ++S  P D  T  S +ET    +       +++  +  V+  + E+       +
Sbjct  186   GAYKHTYTSSYPIDLKT--SEKETPTPSEQI-----VEENTAAHVKTVDREVDDSTAYTD  238

Query  1026  gRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPD----ARTDYMTL  1193
               +  IL ELL+    +LD D  + +LQE+  +KP +   L  P+ PD     R D    
Sbjct  239   KNLENILTELLACSPDELDGDAGVKLLQERLNIKPVNEEMLSFPDIPDFPDVRRMDLKAS  298

Query  1194  GERIPKARKSVLGLPN  1241
             G ++ K R ++  + N
Sbjct  299   GRKLSKPRTALSNIQN  314



>ref|XP_009148957.1| PREDICTED: uncharacterized protein LOC103872354 isoform X2 [Brassica 
rapa]
Length=710

 Score =   101 bits (252),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 72/112 (64%), Gaps = 9/112 (8%)
 Frame = +3

Query  2175  KQHPLTKKQPRKNSCMPGN--RERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKG  2348
             K+ P  K   RK   +     RE K    R SLA AGT +E GVRRS RIKSRPLE+W+G
Sbjct  597   KKQPKGKANERKEKTLKKTVTRESKMFSRRKSLAAAGTNWEAGVRRSTRIKSRPLEYWRG  656

Query  2349  ERLLFGRVNESM-KLVGVKYVSPSLGN------MKVKSYISDEYKEVVDLAA  2483
             ER L+GRV+ES+  ++G+KY SP          +KVKS++SD+YK +V+ AA
Sbjct  657   ERFLYGRVHESLTTVIGIKYESPGKNGKGETRALKVKSFVSDDYKGLVESAA  708


 Score =   100 bits (249),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 91/316 (29%), Positives = 149/316 (47%), Gaps = 22/316 (7%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIV-DN  491
             DPL A++GL L P+T++  S    P   + L   H L++S+    +++  E++K+I+ D 
Sbjct  14    DPLHAYSGLSLFPRTLKSMS-IPPPHHSDALQQTHTLLQSIPFEVSKEHEEQAKSILEDE  72

Query  492   GSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQP-NISLQ  668
              SE+L        AS D D  V     K   RERRP   RKR  F+ KP T+   +   +
Sbjct  73    SSELLKKGVGSSVASEDTDVGVNPIANK---RERRPAYERKRGHFTFKPTTTTSESPQKE  129

Query  669   SSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILG-KS  845
              + D  K   P +YF A ++   A++E  +Q G    +++        R RRP + G K 
Sbjct  130   PTFDPSKYPKPGDYFAAYDRFLLAQREWQKQTGTFVKETHQYQ----PRPRRPELPGRKR  185

Query  846   VRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltgliteke  1025
               YKH ++S  P D  T  S +ET    +       +++  +  V+  + E+       +
Sbjct  186   GAYKHTYTSSYPIDLKT--SEKETPTPSEQI-----VEENTAAHVKTVDREVDDSTAYTD  238

Query  1026  gRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPD----ARTDYMTL  1193
               +  IL ELL+    +LD D  + +LQE+  +KP +   L  P+ PD     R D    
Sbjct  239   KNLENILTELLACSPDELDGDAGVKLLQERLNIKPVNEEMLSFPDIPDFPDVRRMDLKAS  298

Query  1194  GERIPKARKSVLGLPN  1241
             G ++ K R ++  + N
Sbjct  299   GRKLSKPRTALSNIQN  314



>emb|CDY58029.1| BnaC05g49770D [Brassica napus]
Length=710

 Score =   101 bits (251),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 66/91 (73%), Gaps = 7/91 (8%)
 Frame = +3

Query  2232  RERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYV  2408
             RE K    R SLA AGT +E GVRRS RIKSRPLE+W+GER L+GRV++S+  ++G+KY 
Sbjct  618   RESKMFSRRKSLAAAGTNWEAGVRRSTRIKSRPLEYWRGERFLYGRVHKSLTTVIGIKYE  677

Query  2409  SPSLGN------MKVKSYISDEYKEVVDLAA  2483
             SP          +KVKS++SD+YKE+V+ AA
Sbjct  678   SPGKNGKGETRALKVKSFVSDDYKELVESAA  708


 Score = 94.4 bits (233),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 86/317 (27%), Positives = 148/317 (47%), Gaps = 33/317 (10%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIV-DN  491
             DPL A++GL L P+T++  S        + L   H L++SM    +++  E++KAI+ D 
Sbjct  13    DPLHAYSGLSLFPRTLKSMSIPPPLYPSDALQQTHTLLQSMPFEVSKEHQEQAKAILEDE  72

Query  492   GSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNISLQS  671
              SE+L       + S+  +D     V     RERRP   RKR  F+ KP  +  +   + 
Sbjct  73    SSELLK------QGSVGSED-TDVGVSFANKRERRPACERKRGHFTFKPTMTSESPQKEP  125

Query  672   SLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGILG-KSV  848
             + D  K   P EYF A ++   A++E  +Q G    +++        R RRP + G K  
Sbjct  126   TFDPSKYPKPGEYFAAYDRFLLAQREWQKQTGTFVKETHQYQ----PRPRRPELPGRKRG  181

Query  849   RYKHRFSSVPP-----DDNDTDMSSQETFKQDDLCALKSDLQKEN--SNDVeleeleltg  1007
              YKH +++  P      + +  + S++  +++    +K+  ++ +  SND          
Sbjct  182   TYKHTYTASCPIGLKTSEKENPIPSEQVLEENTAAHVKTADREVDGESND----------  231

Query  1008  litekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPD---LSALCMPEFPDART  1178
                  +  +  IL ELL+    +LD D  + +LQE+  +KP +   LS   +P+FPD R 
Sbjct  232   STAYTDKNLENILTELLACSPDELDGDAGVKLLQERLNIKPVNEEMLSFPDIPDFPDVRR  291

Query  1179  DYMTLGERIPKARKSVL  1229
               +    R P   ++ L
Sbjct  292   MDLKASGRNPSKPRTAL  308



>ref|XP_009416686.1| PREDICTED: uncharacterized protein LOC103997241 [Musa acuminata 
subsp. malaccensis]
Length=160

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 61/98 (62%), Gaps = 1/98 (1%)
 Frame = +3

Query  582  PRERRPGLGRKRARFSMKPDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQ  761
            P  RRP LGRKRA F +KP +  P      +  +D + DPEEY+ A E+LENA +EL + 
Sbjct  28   PLGRRPALGRKRAMFRLKPLSGNPVPDFDLNSQLDHIDDPEEYYFAFEQLENADKELKKL  87

Query  762  MGVVADDSNINNLPTTARRRRPGILGKSVRYKHRFSSV  875
             G VA ++   N   T RRRRPGILGK+V YK   S++
Sbjct  88   RGEVATEA-AKNQQATGRRRRPGILGKTVSYKPHVSAI  124



>ref|XP_009416096.1| PREDICTED: uncharacterized protein LOC103996811 [Musa acuminata 
subsp. malaccensis]
Length=368

 Score = 91.7 bits (226),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 68/97 (70%), Gaps = 4/97 (4%)
 Frame = +3

Query  2205  RKNSCMPGNR-ERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNES  2381
             +K   +P  + +RK +  R S ADAG ++++GVRRS RIKSRPL++W+GER L+GR+++S
Sbjct  270   KKQKALPSRKNKRKLVSRRQSFADAGMMWKSGVRRSTRIKSRPLQYWRGERFLYGRIHDS  329

Query  2382  M-KLVGVKYVSP--SLGNMKVKSYISDEYKEVVDLAA  2483
             +  ++G+KY         +KVKS++S+EY  +V  AA
Sbjct  330   LTTVIGLKYTGEDGKDAELKVKSFVSEEYSHLVAQAA  366



>dbj|BAF63162.1| kinetochore protein [Capsella rubella]
Length=680

 Score = 93.6 bits (231),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 81/281 (29%), Positives = 139/281 (49%), Gaps = 29/281 (10%)
 Frame = +3

Query  300   TMDPPDPLRAFAGLPLLPQTIRVQSEDSIP---SEPNNLNSIHQLMKSMGLRNAEKLLEE  470
             +++  DPL A++GL L P+T++  S    P    +  +L   H L++SM     ++  E+
Sbjct  9     SLESDDPLHAYSGLSLFPRTLKSLSNPLPPPRLHQSEDLQQTHTLLESMPFEIQKEHQEQ  68

Query  471   SKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQ  650
             +KAI+++               +++D  +     K   RERRPGL RKR  FS+   TS+
Sbjct  69    AKAILED---------------MNVDVKLNPDPNK---RERRPGLDRKRKSFSVNLTTSR  110

Query  651   PNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPG  830
             P   +  S D  K   PE+YF   +K E A +E  +  G    D+  N  P + R  R G
Sbjct  111   P-PPVAPSFDGSKFPRPEDYFAEYDKFELANREWQKLTGSSVIDTQQN--PPSRRPHRSG  167

Query  831   ILG-KSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltg  1007
             I G K   +KH ++    D+  TD  +QET +++     +  L+K  +  V   + E+  
Sbjct  168   IPGRKRAPFKHSYT----DNYFTDAINQETSEKEHPIPSEQSLEKTTAAPVMNTDREVED  223

Query  1008  litekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKP  1130
                  +  ++ IL+ELL+    +L+ D  +++LQ++  +KP
Sbjct  224   STVATDKDLDNILNELLACSRDELEGDGAINLLQDRLHIKP  264


 Score = 61.2 bits (147),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 37/64 (58%), Gaps = 10/64 (16%)
 Frame = +3

Query  2232  RERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESMKLVGVKYVS  2411
             RE K    R SLA AGT  E G+RRS RIKSRPLE+W+G             ++G+KY S
Sbjct  620   REAKIFSRRKSLAGAGTKMEGGIRRSTRIKSRPLEYWRG----------LTTVIGIKYGS  669

Query  2412  PSLG  2423
             P  G
Sbjct  670   PEDG  673



>dbj|BAD42453.1| centromere protein C homolog [Arabidopsis thaliana]
Length=583

 Score = 92.4 bits (228),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 88/317 (28%), Positives = 147/317 (46%), Gaps = 39/317 (12%)
 Frame = +3

Query  315   DPLRAFAGLPLLPQTIRVQSEDSIPS-EPNNLNSIHQLMKSMGLRNAEKLLEESKAIVDN  491
             DPL+A++GL L P+T++  S    PS +  +L   H L++SM      +  E++KAI+++
Sbjct  15    DPLQAYSGLSLFPRTLKSLSNPLPPSYQSEDLQQTHTLLQSMPFEIQSEHQEQAKAILED  74

Query  492   GSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQPNISLQS  671
                            +D+D  +     K   RERRPGL RKR  FS+   TSQP   +  
Sbjct  75    ---------------VDVDVQLNPIPNK---RERRPGLDRKRKSFSLHLTTSQP-PPVAP  115

Query  672   SLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTAR-------RRRPG  830
             S D  K    E++F A +K E A +E  +Q G    D   N      R       +RRP 
Sbjct  116   SFDPSKYPRSEDFFAAYDKFELANREWQKQTGSSVIDIQENPPSRRPRRPGIPGRKRRP-  174

Query  831   ILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltgl  1010
                    +K  F+    D   TD+ + E  +++   A +  L+   +  V   + E+   
Sbjct  175   -------FKESFT----DSYFTDVINLEASEKEIPIASEQSLESATAAHVTTVDREVDDS  223

Query  1011  itekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDARTDYMT  1190
               + +  +N +L +LL+   ++L+ D  + +L+E+ Q+K  ++    +PEF D R   + 
Sbjct  224   TVDTDKDLNNVLKDLLACSREELEGDGAIKLLEERLQIKSFNIEKFSIPEFQDVRKMNLK  283

Query  1191  LGERIPKARKSVLGLPN  1241
                  P  RKS+  + N
Sbjct  284   ASGSNPPNRKSLSDIQN  300



>ref|XP_007024047.1| Centromere protein C, putative isoform 3 [Theobroma cacao]
 gb|EOY26669.1| Centromere protein C, putative isoform 3 [Theobroma cacao]
Length=547

 Score = 92.0 bits (227),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 96/175 (55%), Gaps = 14/175 (8%)
 Frame = +3

Query  1986  VEDMPSMSAFPEEQEHNGNDAHTSENWSGNQNPSDQSNSAAVQNHSVDMQSALPDINPEQ  2165
             VED+P M A    Q     +  T +N    Q   D+ N A  ++ ++D      +   E 
Sbjct  380   VEDIP-MEAVASAQTQLNVEGPTIDNSHIIQREPDEYNPAMAEDCTMDGSMKTAESGQEL  438

Query  2166  HIMKQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLF-ENGVRRSKRIKSRPLEFW  2342
             H       TK  PR        R RKAL  R SLA +GT +   G RRS RI+SRPLEFW
Sbjct  439   HGQYNKGKTKPHPR------NERMRKALSRRQSLAGSGTTYNAEGRRRSTRIRSRPLEFW  492

Query  2343  KGERLLFGRVNESM-KLVGVKYVSPSL-----GNMKVKSYISDEYKEVVDLAARY  2489
             KGER L+GR++ S+  ++G+KY SP         +KVKS++SDEYK++V+ AAR+
Sbjct  493   KGERFLYGRIHSSLATVIGIKYESPVRPDGKNATLKVKSFVSDEYKDLVERAARF  547


 Score = 85.1 bits (209),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 87/227 (38%), Positives = 130/227 (57%), Gaps = 25/227 (11%)
 Frame = +3

Query  831   ILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVeleeleltgl  1010
             +  +SV+YKH +S        T MS  E F+++ L  L    Q+E+  +VEL+E EL+GL
Sbjct  1     MFRRSVKYKHHYS--------TAMSPVENFEEEILSPLGCSQQEESDPNVELQEKELSGL  52

Query  1011  itekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDA-RTDYM  1187
             +T  E +VN +LD LL+    + D D  +S+LQE+ Q+KP +L  +C+P+  D  R D  
Sbjct  53    VTNAEKKVNELLDHLLT---SNYDKDEAVSLLQERLQIKPINLEKICLPDMQDIRRIDLK  109

Query  1188  TLGERIPKARKSVLGLPNSDK---RTSGKRQWEESPQSNLtsptppkspfssLALLRKQV  1358
                E + K R SV  + +  K   + + KRQ E S   +L S TPP+SP +S++LL+KQ+
Sbjct  110   ASRESLAKPRNSVSDIQSLMKGISKRTPKRQAESSVH-HLASCTPPRSPLASISLLKKQM  168

Query  1359  LKSNPLRDPFSPLNID---------LNDINKNSDQVGLVKDFSKSGN  1472
             L+S+ L DPFS  +ID         +  I+K S QV   K+ S S N
Sbjct  169   LQSDVLSDPFSTDDIDRLPVRNSSPIGSISKQSGQVDTHKELSGSHN  215



>ref|XP_008373737.1| PREDICTED: uncharacterized protein LOC103437051 [Malus domestica]
Length=295

 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 79/143 (55%), Gaps = 4/143 (3%)
 Frame = +3

Query  411  SIHQLMKSMGLRNA-EKLLEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPR  587
            +IH  + SM  +++  KL ++ + I    SEI+    P  + +L   + V  +   + PR
Sbjct  155  AIHIQLNSMASQHSPSKLKDQVENIASVTSEIVE---PGNRQALKQKNKVVPEKAAKSPR  211

Query  588  ERRPGLGRKRARFSMKPDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMG  767
            +RRP LG KR RFSMKPD+SQP+ +L    D    +DPEE F   EK ENAK+EL +  G
Sbjct  212  QRRPALGLKRTRFSMKPDSSQPDTNLLPPFDPKNYKDPEELFKEHEKYENAKKELEKLKG  271

Query  768  VVADDSNINNLPTTARRRRPGIL  836
                D+  +N     R RRP ++
Sbjct  272  GAMFDAYKHNPSPIKRTRRPSVM  294


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 74/131 (56%), Gaps = 9/131 (7%)
 Frame = +3

Query  300  TMDPPDPLRAFAGLPLLPQTIRV--QSEDSIPSEPN-NLNSIHQLMKSMGLRNAEKLLEE  470
            + DP DPL+ F GL L  Q+ +    S  SIP + + NL +IH    S    +  KL+++
Sbjct  6    SSDPLDPLQGFTGLSLFHQSFKAIPDSSTSIPFDFDPNLQAIHSQFNSTA--SQVKLVDQ  63

Query  471  SKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRERRPGLGRKRARFSMKPDTSQ  650
             K I+ + S+IL +  P+ K + ++   V  K E + P +R P  GR+ ARFS+KP++SQ
Sbjct  64   VKNILSDTSKILKSGIPQAKQNSEV---VPEKAE-DNPLQRIPASGRELARFSVKPNSSQ  119

Query  651  PNISLQSSLDV  683
            PN+      D+
Sbjct  120  PNMCSLPPFDI  130



>ref|XP_008373746.1| PREDICTED: uncharacterized protein LOC103437058 [Malus domestica]
Length=260

 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 79/143 (55%), Gaps = 4/143 (3%)
 Frame = +3

Query  411  SIHQLMKSMGLRNA-EKLLEESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPR  587
            +IH  + SM  +++  KL ++ + I    SEI+    P  + +L   + V  +   + PR
Sbjct  120  AIHIQLNSMASQHSPSKLKDQVENIASVTSEIVE---PGNRQALKQKNKVVPEKAAKSPR  176

Query  588  ERRPGLGRKRARFSMKPDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMG  767
            +RRP LG KR RFSMKPD+SQP+ +L    D    +DPEE F   EK ENAK+EL +  G
Sbjct  177  QRRPALGLKRTRFSMKPDSSQPDTNLLPPFDPKNYKDPEELFKEHEKYENAKKELEKLKG  236

Query  768  VVADDSNINNLPTTARRRRPGIL  836
                D+  +N     R RRP ++
Sbjct  237  GAMFDAYKHNPSPIKRTRRPSVM  259



>ref|XP_002890116.1| CENP-C [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66375.1| CENP-C [Arabidopsis lyrata subsp. lyrata]
Length=708

 Score = 87.8 bits (216),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 94/346 (27%), Positives = 156/346 (45%), Gaps = 48/346 (14%)
 Frame = +3

Query  300   TMDPPDPLRAFAGLPLLPQTIRVQSEDSIP--SEPNNLNSIHQLMKSMGLRNAEKLLEES  473
             ++D  DPL+A++GL L P+T++  S    P   +  +L   H L++SM      +  E++
Sbjct  9     SLDAEDPLQAYSGLSLFPRTLKSLSNPLPPPLHQSEDLQQTHTLLESMPFEVQNEHQEQA  68

Query  474   KAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMP--RERRPGLGRKRARFSMKPDTS  647
             KAI +                   D +V  K+   +P  RERR GL R R  FS+   +S
Sbjct  69    KAIFE-------------------DVNVDVKLNP-IPNKRERRLGLDRNRKSFSLNLTSS  108

Query  648   QPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTAR----  815
             QP   +  S D  K   PE++F   +K E A +E  +Q G    D+  N      R    
Sbjct  109   QP-PPVAPSFDGSKYPRPEDFFAEYDKFELANREWQKQTGSSVIDTQQNPPSRRPRRPGI  167

Query  816   ---RRRPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDLQKENSNDVel  986
                +RRP        ++H F+    D   TD  + E  ++++  A +  L++  +  V  
Sbjct  168   PGRKRRP--------FEHTFT----DSYFTDAINLEASEKENPIASEQSLERTTAAHVTT  215

Query  987   eeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFP  1166
              + E+     + +  +N IL ELL+    +L+ D  +  L++  Q+K  ++    +PEF 
Sbjct  216   VDREVDDSTVDTDKDLNNILKELLASSRDELEGDAAVKRLEDVLQIKSLNVEKFSIPEFQ  275

Query  1167  DARTDYMTLGERIPKARKSVLGLPNSDK---RTSGKRQWEE-SPQS  1292
             D R   M      P  RKS+  + N  K   R +G++     SPQ+
Sbjct  276   DVRKMNMKASGSNPSNRKSLSDIQNILKGIHRVAGRKNSHSPSPQT  321



>gb|KHG03078.1| Chromosomal replication initiator DnaA [Gossypium arboreum]
Length=585

 Score = 86.7 bits (213),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 84/241 (35%), Positives = 124/241 (51%), Gaps = 44/241 (18%)
 Frame = +3

Query  810   ARRRRPGILGKSVRYKHRFSSVPPDDNDTDMSSQETFKQDDLCALKSDL---QKENSNDV  980
             AR RRPGI  +SV+YKH +S        T MS  E+F ++    L+S L   Q+E S+ V
Sbjct  3     ARPRRPGIARRSVKYKHCYS--------TSMSPGESFVEE----LRSPLCGSQQEKSDPV  50

Query  981   eleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPE  1160
                E +L G +T+ E  +N +LD LLS    + D D  +S+L+E+ Q+KP DL  +C+P+
Sbjct  51    LELEEKLAGSVTKAENNINQLLDHLLS---SNYDGDEAVSLLKERLQIKPVDLDKICLPD  107

Query  1161  FPDA-RTDYMTLGERIPKARKSVLGL--------PNSDKRTSGKRQWEESPQSNLtsptp  1313
               D  R D     E + K R S+  L        PN     S       +P S+L     
Sbjct  108   LQDIRRIDLKASKENLTKPRNSISDLMKGISKRTPNRLAECSVHCSGSPTPPSSL-----  162

Query  1314  pkspfssLALLRKQVLKSNPLRDPFSPLNIDLNDI-------NKNSDQVGLVKDFSKSGN  1472
                  +S++LL+KQ  + N L DPFS  +ID + +       N +SDQVG+ K+ S S +
Sbjct  163   -----ASVSLLKKQSSRFNVLNDPFSNDDIDRSPVRNASPMENTSSDQVGIEKEPSVSHS  217

Query  1473  L  1475
             +
Sbjct  218   I  218


 Score = 69.3 bits (168),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 89/166 (54%), Gaps = 19/166 (11%)
 Frame = +3

Query  1986  VEDMPSMSAFPEEQEHNGNDAHTSENWSGNQNPSDQSNSAAVQNHSVDMQSALPDINPEQ  2165
             VED+PS +      + N  +  T  N    Q  SDQ+N A  ++H +D         P +
Sbjct  382   VEDIPSEAVVSAHVQLNV-EGTTIVNSQTIQIESDQANPAMDEDHGMD--------GPSR  432

Query  2166  HIMKQHPLTKKQPRKNSCMPGNR---ERKALKFRPSLADAGTLFEN-GVRRSKRIKSRPL  2333
              +     L ++Q +K           +RK +  R SLA AGT F+  G RRS RI+SRPL
Sbjct  433   AVESGQELHEQQNKKGKTKRSAHRVLKRKEISRRQSLAGAGTTFDTEGRRRSTRIRSRPL  492

Query  2334  EFWKGERLLFGRVNESMK-LVGVKYVSPSLGN-----MKVKSYISD  2453
             EFWKGER L+GRV+ S+  ++G+KY SP   +     +KVKS+ ++
Sbjct  493   EFWKGERFLYGRVHSSLSTVIGIKYESPEKADGENPTLKVKSFTNE  538



>gb|EEC71093.1| hypothetical protein OsI_02875 [Oryza sativa Indica Group]
Length=837

 Score = 87.0 bits (214),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 62/201 (31%), Positives = 106/201 (53%), Gaps = 34/201 (17%)
 Frame = +3

Query  1983  HVEDMPSMSAFPEEQE--HNGNDAHTS------------ENWSGN--QNPSDQSNSAAVQ  2114
             H +++P    +P+ Q   H GN    +            +   GN  + PS +   AA  
Sbjct  639   HTQEIPPEDTYPQNQSEIHRGNTEKLAVDINNALSPSKGKEQRGNNKKQPSKRQKRAA--  696

Query  2115  NHSVDMQSALPDINPE--QHI----MKQHP-LTKKQPRKNSCMPGNRERKA-----LKFR  2258
               + D+++  P+  PE   H+    ++Q P  T + P  ++    N  RK      L  R
Sbjct  697   GEAGDLETHAPNFEPEIQPHVQDTDVEQQPACTSQSPSPSNGTSKNEVRKRNKKQDLNRR  756

Query  2259  PSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSL---GN  2426
              SLADAG  ++ GVRRS RI+S+PL+ W GER ++GR++ +M  ++GVK  SPS    G 
Sbjct  757   KSLADAGLTWQAGVRRSTRIRSKPLQHWLGERFIYGRIHGTMATVIGVKSFSPSQEGKGP  816

Query  2427  MKVKSYISDEYKEVVDLAARY  2489
             ++VKS++ +++ +++  +A+Y
Sbjct  817   LRVKSFVPEQFSDLLAESAKY  837


 Score = 75.5 bits (184),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 97/202 (48%), Gaps = 14/202 (7%)
 Frame = +3

Query  591   RRPGLGRKRARFSMKPDTSQP--NISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQM  764
             RRP   RKR R   KP  ++P  N+     L++   +DP+EYFL  EKLE A +E+ R  
Sbjct  93    RRPAPDRKRFRLKTKPPANKPVQNVDYTELLNI---EDPDEYFLTLEKLERADKEIKRLR  149

Query  765   GVVADDSNINNLPTTARRRRPGILGKSVRYKHRF--SSVPPDDNDTDMSSQETF-----K  923
             G V  +   NN      + RPG+L +   + ++F  SS  PD  +   S  ET       
Sbjct  150   GEVPTEGTYNNRGIEPPKLRPGLLRRKSVHSYKFSASSDAPDAIEAPASQTETVTESQTT  209

Query  924   QDDLCALKSDLQKE--NSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVL  1097
             QDD+     ++  E  +S   +    +++       G+ N+     L    KDLD+D   
Sbjct  210   QDDVHGSAHEMTTEPVSSRSSQDAIPDISAREDSFVGKDNSFTLNYLLSAFKDLDEDEEE  269

Query  1098  SILQEQFQMKPPDLSALCMPEF  1163
             ++L++  Q+K   +  +C+P+F
Sbjct  270   NLLRKTLQIKEISIGKVCLPDF  291



>gb|AAU04616.1| CENP-C [Oryza sativa Japonica Group]
Length=490

 Score = 85.9 bits (211),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 62/201 (31%), Positives = 105/201 (52%), Gaps = 34/201 (17%)
 Frame = +3

Query  1983  HVEDMPSMSAFPEEQE--HNGNDAHTS------------ENWSGN--QNPSDQSNSAAVQ  2114
             H  ++P    +P+ Q   H GN    +            +   GN  + PS +   AA  
Sbjct  292   HTPEIPPEDTYPQNQSEIHRGNTEKLAVDINNALSPSKGKEQRGNNKKQPSKRQKRAA--  349

Query  2115  NHSVDMQSALPDINPE--QHI----MKQHP-LTKKQPRKNSCMPGNRERKA-----LKFR  2258
               + D+++  P+  PE   H+    ++Q P  T + P  ++    N  RK      L  R
Sbjct  350   GEAGDLETHAPNFEPEIQPHVQDTDVEQQPACTSQSPSPSNGTSKNEVRKRNKKQDLNRR  409

Query  2259  PSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPS---LGN  2426
              SLADAG  ++ GVRRS RI+S+PL+ W GER ++GR++ +M  ++GVK  SPS    G 
Sbjct  410   KSLADAGLTWQAGVRRSTRIRSKPLQHWLGERFIYGRIHGTMATVIGVKSFSPSQEGKGP  469

Query  2427  MKVKSYISDEYKEVVDLAARY  2489
             ++VKS++ +++ +++  +A+Y
Sbjct  470   LRVKSFVPEQFSDLLAESAKY  490



>ref|XP_004969175.1| PREDICTED: uncharacterized protein LOC101770859 isoform X2 [Setaria 
italica]
Length=756

 Score = 86.3 bits (212),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 62/87 (71%), Gaps = 4/87 (5%)
 Frame = +3

Query  2241  KALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESMK-LVGVKYVSPS  2417
             K L  R SL DAG  +++GVRRS RI+SRPLE W+GER ++GR++++M  ++G+K  SP 
Sbjct  670   KHLNQRKSLGDAGLAWQSGVRRSTRIRSRPLEHWRGERFVYGRIHDTMATVIGIKAYSPG  729

Query  2418  L---GNMKVKSYISDEYKEVVDLAARY  2489
                   +KVKS++ ++Y ++V  +A+Y
Sbjct  730   QDGKKTLKVKSFVPEQYSDLVAESAKY  756


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 107/225 (48%), Gaps = 25/225 (11%)
 Frame = +3

Query  303  MDPPDPLRAFAG-LPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKA  479
            MD  DPLRA +    LLP+T+   +  + PS+   +  +  + ++  L+ +++L+E+++ 
Sbjct  1    MDAADPLRAISSPARLLPRTLGPAATAASPSKAREV-LLEAISRARLLKGSKELVEQARM  59

Query  480  IVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRE---RRPGLGRKRARFSMKPDTSQ  650
            ++    +I           L  DD V         ++   RRPG  RKR+RF+ K    +
Sbjct  60   VLKGHGDI---------RMLYHDDGVKVAPHANGTKDQQGRRPGPDRKRSRFTQKAHERK  110

Query  651  PNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPG  830
               ++  S +V K++DP EY+   + +E A++E+ R  G V D+  +N  P    +RR  
Sbjct  111  LVPAVDHS-NVLKIKDPNEYYKKLDDIEEAEKEIRRLNGEVVDEMVMNFDPVVEPKRRST  169

Query  831  ILGKSVRYKHRF--------SSVPPDDNDTDMSSQETFKQDDLCA  941
            +LG+      +F        + VP    +T   SQ    QDD  A
Sbjct  170  LLGRKSVRTFKFADADTQDPTEVPASQTETMTGSQ--LSQDDAHA  212



>ref|XP_004969174.1| PREDICTED: uncharacterized protein LOC101770859 isoform X1 [Setaria 
italica]
Length=757

 Score = 86.3 bits (212),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 62/87 (71%), Gaps = 4/87 (5%)
 Frame = +3

Query  2241  KALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESMK-LVGVKYVSPS  2417
             K L  R SL DAG  +++GVRRS RI+SRPLE W+GER ++GR++++M  ++G+K  SP 
Sbjct  671   KHLNQRKSLGDAGLAWQSGVRRSTRIRSRPLEHWRGERFVYGRIHDTMATVIGIKAYSPG  730

Query  2418  L---GNMKVKSYISDEYKEVVDLAARY  2489
                   +KVKS++ ++Y ++V  +A+Y
Sbjct  731   QDGKKTLKVKSFVPEQYSDLVAESAKY  757


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 107/225 (48%), Gaps = 25/225 (11%)
 Frame = +3

Query  303  MDPPDPLRAFAG-LPLLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKA  479
            MD  DPLRA +    LLP+T+   +  + PS+   +  +  + ++  L+ +++L+E+++ 
Sbjct  1    MDAADPLRAISSPARLLPRTLGPAATAASPSKAREV-LLEAISRARLLKGSKELVEQARM  59

Query  480  IVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRE---RRPGLGRKRARFSMKPDTSQ  650
            ++    +I           L  DD V         ++   RRPG  RKR+RF+ K    +
Sbjct  60   VLKGHGDI---------RMLYHDDGVKVAPHANGTKDQQGRRPGPDRKRSRFTQKAHERK  110

Query  651  PNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPG  830
               ++  S +V K++DP EY+   + +E A++E+ R  G V D+  +N  P    +RR  
Sbjct  111  LVPAVDHS-NVLKIKDPNEYYKKLDDIEEAEKEIRRLNGEVVDEMVMNFDPVVEPKRRST  169

Query  831  ILGKSVRYKHRF--------SSVPPDDNDTDMSSQETFKQDDLCA  941
            +LG+      +F        + VP    +T   SQ    QDD  A
Sbjct  170  LLGRKSVRTFKFADADTQDPTEVPASQTETMTGSQ--LSQDDAHA  212



>dbj|BAD61293.1| CENPCA protein-like [Oryza sativa Japonica Group]
Length=618

 Score = 85.5 bits (210),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/201 (31%), Positives = 105/201 (52%), Gaps = 34/201 (17%)
 Frame = +3

Query  1983  HVEDMPSMSAFPEEQE--HNGNDAHTS------------ENWSGN--QNPSDQSNSAAVQ  2114
             H  ++P    +P+ Q   H GN    +            +   GN  + PS +   AA  
Sbjct  420   HTPEIPPEDTYPQNQSEIHRGNTEKLAVDINNALSPSKGKEQRGNNKKQPSKRQKRAA--  477

Query  2115  NHSVDMQSALPDINPE--QHI----MKQHP-LTKKQPRKNSCMPGNRERKA-----LKFR  2258
               + D+++  P+  PE   H+    ++Q P  T + P  ++    N  RK      L  R
Sbjct  478   GEAGDLETHAPNFEPEIQPHVQDTDVEQQPACTSQSPSPSNGTSKNEVRKRNKKQDLNRR  537

Query  2259  PSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPS---LGN  2426
              SLADAG  ++ GVRRS RI+S+PL+ W GER ++GR++ +M  ++GVK  SPS    G 
Sbjct  538   KSLADAGLTWQAGVRRSTRIRSKPLQHWLGERFIYGRIHGTMATVIGVKSFSPSQEGKGP  597

Query  2427  MKVKSYISDEYKEVVDLAARY  2489
             ++VKS++ +++ +++  +A+Y
Sbjct  598   LRVKSFVPEQFSDLLAESAKY  618



>ref|NP_001043584.1| Os01g0617700 [Oryza sativa Japonica Group]
 dbj|BAF05498.1| Os01g0617700 [Oryza sativa Japonica Group]
 gb|EEE54993.1| hypothetical protein OsJ_02621 [Oryza sativa Japonica Group]
Length=837

 Score = 85.9 bits (211),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/201 (31%), Positives = 105/201 (52%), Gaps = 34/201 (17%)
 Frame = +3

Query  1983  HVEDMPSMSAFPEEQE--HNGNDAHTS------------ENWSGN--QNPSDQSNSAAVQ  2114
             H  ++P    +P+ Q   H GN    +            +   GN  + PS +   AA  
Sbjct  639   HTPEIPPEDTYPQNQSEIHRGNTEKLAVDINNALSPSKGKEQRGNNKKQPSKRQKRAA--  696

Query  2115  NHSVDMQSALPDINPE--QHI----MKQHP-LTKKQPRKNSCMPGNRERKA-----LKFR  2258
               + D+++  P+  PE   H+    ++Q P  T + P  ++    N  RK      L  R
Sbjct  697   GEAGDLETHAPNFEPEIQPHVQDTDVEQQPACTSQSPSPSNGTSKNEVRKRNKKQDLNRR  756

Query  2259  PSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSL---GN  2426
              SLADAG  ++ GVRRS RI+S+PL+ W GER ++GR++ +M  ++GVK  SPS    G 
Sbjct  757   KSLADAGLTWQAGVRRSTRIRSKPLQHWLGERFIYGRIHGTMATVIGVKSFSPSQEGKGP  816

Query  2427  MKVKSYISDEYKEVVDLAARY  2489
             ++VKS++ +++ +++  +A+Y
Sbjct  817   LRVKSFVPEQFSDLLAESAKY  837


 Score = 75.5 bits (184),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 96/202 (48%), Gaps = 14/202 (7%)
 Frame = +3

Query  591   RRPGLGRKRARFSMKPDTSQP--NISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQM  764
             RRP   RKR R   KP  ++P  N+     L++   +DP+EYFL  EKLE A +E+ R  
Sbjct  93    RRPAPDRKRFRLKTKPPANKPVQNVDYTELLNI---EDPDEYFLTLEKLERADKEIKRLR  149

Query  765   GVVADDSNINNLPTTARRRRPGILGKSVRYKHRF--SSVPPDDNDTDMSSQETF-----K  923
             G V  +   NN      + RPG+L +   + ++F  SS  PD  +   S  ET       
Sbjct  150   GEVPTEGTYNNRGIEPPKLRPGLLRRKSVHSYKFSASSDAPDAIEAPASQTETVTESQTT  209

Query  924   QDDLCALKSDLQKE--NSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVL  1097
             QDD+     ++  E  +S   +    +++        + N+     L    KDLD+D   
Sbjct  210   QDDVHGSAHEMTTEPVSSRSSQDAIPDISAREDSFVWKDNSFTLNYLLSAFKDLDEDEEE  269

Query  1098  SILQEQFQMKPPDLSALCMPEF  1163
             ++L++  Q+K   +  +C+P+F
Sbjct  270   NLLRKTLQIKEISIGKVCLPDF  291



>gb|AAU04631.1| CENP-C [Triticum aestivum]
Length=234

 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 64/90 (71%), Gaps = 4/90 (4%)
 Frame = +3

Query  2232  RERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYV  2408
             ++RK +  R SL   G  +++GVRRS RI+SRPL+ W GERLL+GR++++M  ++GVK  
Sbjct  145   KKRKEVNRRKSLTAFGLAWQSGVRRSTRIRSRPLQDWLGERLLYGRIHDTMATVIGVKSY  204

Query  2409  SPSLG---NMKVKSYISDEYKEVVDLAARY  2489
             SPS      ++VKS++ ++Y ++V  AA+Y
Sbjct  205   SPSQDGKVELRVKSFVPEQYSDMVAQAAKY  234



>ref|XP_006646103.1| PREDICTED: uncharacterized protein LOC102711938 [Oryza brachyantha]
Length=707

 Score = 85.1 bits (209),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 97/196 (49%), Gaps = 28/196 (14%)
 Frame = +3

Query  1983  HVEDMPSMSAFPEEQE--HNGNDAHTSENWSGNQNPSD--------QSNSAAVQNHSVDM  2132
             H  D+P    +P  Q   H GN    + + S   + S+        Q  S  V   + D+
Sbjct  513   HTLDIPPEDTYPHNQSEIHRGNTEKLAVDTSNVLSSSEGKERGKRKQQPSKRVAGEAGDL  572

Query  2133  QSALPDINPEQH-------------IMKQHPLTKKQPRKNSCMPGNRERKALKFRPSLAD  2273
             +   P+  PE                +   P      R+N     N+ ++ L  R SLAD
Sbjct  573   EIPAPNFEPENQPDVLDTDVEQQPACISHSPSPSNGKRQNEVRKRNK-KQDLNRRKSLAD  631

Query  2274  AGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSL---GNMKVKS  2441
             AG  +++GVRRS RI+S PL+ W GER ++GR++ +M  ++GVK  SPS    G M++KS
Sbjct  632   AGLTWQSGVRRSTRIRSEPLKHWLGERFVYGRIHGTMATVIGVKSFSPSQEGKGPMRIKS  691

Query  2442  YISDEYKEVVDLAARY  2489
             ++ ++Y +++  +++Y
Sbjct  692   FVPEQYSDLLARSSKY  707


 Score = 74.7 bits (182),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 97/202 (48%), Gaps = 14/202 (7%)
 Frame = +3

Query  591   RRPGLGRKRARFSMKPDTSQP--NISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQM  764
             RRP + RKR RF+ KP    P  N+     L++   +DP+EYF   ++LE A +E+ R  
Sbjct  47    RRPAVDRKRFRFNAKPPRDNPVQNVDFSELLNI---EDPDEYFATLDQLEKADKEIKRLR  103

Query  765   GVVADDSNINNLPTTARRRRPGILGKSVRYKHRFSSV--PPDDNDTDMSSQET-----FK  923
             G V  ++  N+      ++RPG+L +   + ++FS+    PD  +T  S  ET     F 
Sbjct  104   GEVPTEATYNDRAIELPKKRPGLLRRKSVHSYKFSASVDTPDAIETSSSQTETITEYEFA  163

Query  924   QDDLCALKSDLQKE--NSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVL  1097
             Q D+ A    + KE  +S   +    + +       G+ N      L    KDLD+    
Sbjct  164   QVDVHASAPKMPKEPVSSRSSQHAIPDTSVRKDSFVGKDNIFTLNYLLSAFKDLDETGGE  223

Query  1098  SILQEQFQMKPPDLSALCMPEF  1163
             ++L+E  Q+K      +C+P+F
Sbjct  224   NLLRETLQIKEISTGKVCLPDF  245



>gb|AAU04622.1| CENP-C [Oryza sativa Japonica Group]
Length=117

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 61/85 (72%), Gaps = 4/85 (5%)
 Frame = +3

Query  2247  LKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPS--  2417
             L  R SLADAG  ++ GVRRS RI+S+PL+ W GER ++GR++ +M  ++GVK  SPS  
Sbjct  33    LNRRKSLADAGLTWQAGVRRSTRIRSKPLQHWLGERFIYGRIHGTMATVIGVKSFSPSQE  92

Query  2418  -LGNMKVKSYISDEYKEVVDLAARY  2489
               G ++VKS++ +++ +++  +A+Y
Sbjct  93    GKGPLRVKSFVPEQFSDLLAESAKY  117



>emb|CDM83393.1| unnamed protein product [Triticum aestivum]
Length=717

 Score = 84.0 bits (206),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 79/133 (59%), Gaps = 9/133 (7%)
 Frame = +3

Query  2112  QNHSVDMQSALPDINPEQHIMKQHPLTKKQPRKNSCMP-GNR--ERKALKFRPSLADAGT  2282
             +N   + Q ++ D N EQ  +       + P K      G R  +RK +  R SL   G 
Sbjct  587   ENCDTETQPSMQDTNIEQQTVDTR--VPRSPNKGKLQKEGQRRKKRKEVNRRKSLTAFGL  644

Query  2283  LFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSLGN---MKVKSYIS  2450
              +++GVRRS RI+SRPL+ W GERLL+GR++++M  ++GVK  SPS      ++VKS++ 
Sbjct  645   AWQSGVRRSTRIRSRPLQDWLGERLLYGRIHDTMATVIGVKSYSPSQDGKVELRVKSFVP  704

Query  2451  DEYKEVVDLAARY  2489
             ++Y ++V  AA+Y
Sbjct  705   EQYSDMVAQAAKY  717


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 106/235 (45%), Gaps = 37/235 (16%)
 Frame = +3

Query  591   RRPGLGRKRARFSMKPDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGV  770
             RRPGL RKRA   +       N+    +L +D   DPEEYFL  E+LE A +E+ +  G 
Sbjct  84    RRPGLDRKRAHNPV-------NVDFSQALSID---DPEEYFLTLERLEKADREIKKLRGE  133

Query  771   VADDSNINNLPTTARRRRPGILGKSVRYKHRFS---------SVPPDDNDTDMSSQETFK  923
             V   +   + P    ++RPG+  +   Y + FS           P     T   SQ T  
Sbjct  134   VPTKTANYDRPIQPPKKRPGMSRRKSVYSYNFSVGTDTSDGTEAPDSQMGTLPESQST--  191

Query  924   QDDLCALKSDLQK---ENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRV  1094
             QDD      +  K    +S+     +   T   +  +    A LD L+S   K+LD+ + 
Sbjct  192   QDDTPPSVPERTKPPVPSSSSQCDIQDVSTREDSFAKKDKGATLDSLMSA-FKNLDESKE  250

Query  1095  LSILQEQFQMKPPDLSALCMPEF-------PDART--DYMTLGERIPKARKSVLG  1232
              S+L+E+ Q+K  ++   C+P+        P  RT   Y+T  +R P+  + VLG
Sbjct  251   ESLLREKLQIKEINIGEACIPDLLNVPGDRPVRRTKQKYLT-SDRTPE--RPVLG  302



>gb|ABL64046.1| CENP-C [Arabidopsis halleri subsp. halleri]
Length=204

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +3

Query  2196  KQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVN  2375
             K+P KN+     RE K    R SLA AGT  E GVRRS RIKSRPLE+WKGER L+GR++
Sbjct  145   KKP-KNTRKSLTREGKLFSRRKSLAAAGTKMEGGVRRSTRIKSRPLEYWKGERFLYGRIH  203

Query  2376  E  2378
             E
Sbjct  204   E  204



>gb|ABL64045.1| CENP-C [Arabidopsis halleri subsp. gemmifera]
Length=204

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +3

Query  2196  KQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVN  2375
             K+P KN+     RE K    R SLA AGT  E GVRRS RIKSRPLE+WKGER L+GR++
Sbjct  145   KKP-KNTRKTLTREGKLFSRRKSLAAAGTKMEGGVRRSTRIKSRPLEYWKGERFLYGRIH  203

Query  2376  E  2378
             E
Sbjct  204   E  204



>gb|ABL64048.1| CENP-C [Arabidopsis lyrata subsp. lyrata]
Length=203

 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +3

Query  2196  KQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVN  2375
             K+P KN+     RE K    R SLA AGT  E GVRRS RIKSRPLE+WKGER L+GR++
Sbjct  144   KKP-KNTRKTLTREGKLFSRRKSLAAAGTKMEGGVRRSTRIKSRPLEYWKGERFLYGRIH  202

Query  2376  E  2378
             E
Sbjct  203   E  203



>gb|EMS60377.1| hypothetical protein TRIUR3_35356 [Triticum urartu]
Length=628

 Score = 77.0 bits (188),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 56/75 (75%), Gaps = 4/75 (5%)
 Frame = +3

Query  2277  GTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSLGN---MKVKSY  2444
             G  +++GVRRS RI+SRPL+ W GERLL+GR++++M  ++GVK  SPS      ++VKS+
Sbjct  554   GLAWQSGVRRSTRIRSRPLQDWLGERLLYGRIHDTMATVIGVKSYSPSQDGKVELRVKSF  613

Query  2445  ISDEYKEVVDLAARY  2489
             + ++Y ++V  AA+Y
Sbjct  614   VPEQYSDMVAQAAKY  628


 Score = 55.1 bits (131),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/195 (28%), Positives = 88/195 (45%), Gaps = 19/195 (10%)
 Frame = +3

Query  618   ARFSMKPDTSQP-NISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNIN  794
             A F +  D   P N+    +L +D   DPEEYFL  E+LE A +E+ +  G V   +   
Sbjct  70    AVFDLTGDRGNPVNVDFSKALSID---DPEEYFLTLERLEKADREIKKLRGEVPTKTANY  126

Query  795   NLPTTARRRRPGILGKSVRYKHRFS---------SVPPDDNDTDMSSQETFKQDDLCALK  947
             + P    ++RPG+  +   Y + FS           P     T   SQ T  QDD+    
Sbjct  127   DRPMEPPKKRPGMSRRKSVYSYNFSVGTDASDGTEAPDSQMGTLPESQST--QDDMPPSV  184

Query  948   SDLQK---ENSNDVeleeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQF  1118
              +  K    +S+     +   T   +  +    A LD L+S   K+LD+ +  S+L+E+ 
Sbjct  185   PERTKPPVPSSSSQCDIQDVSTREDSFAKKDKGATLDSLMSA-FKNLDESKEESLLREKL  243

Query  1119  QMKPPDLSALCMPEF  1163
             Q+K  ++   C+P+ 
Sbjct  244   QIKEINIGEACIPDL  258



>ref|XP_010232028.1| PREDICTED: uncharacterized protein LOC100845382 isoform X2 [Brachypodium 
distachyon]
Length=868

 Score = 77.0 bits (188),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 140/299 (47%), Gaps = 35/299 (12%)
 Frame = +3

Query  315   DPLRAFAGLP-LLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIVDN  491
             DPLRA A    LL QT+      S  +   + +   + +    L+ +++L+E++   +  
Sbjct  9     DPLRAVASATCLLFQTL------SPAAFAQSSSMAREALLGGSLKGSKELMEQASLTLKQ  62

Query  492   GSEILNANFPRFKASLDLDDHV---AAKVEKEMPRERRPGLGRKRARFSMK--PDTSQPN  656
               +I           L  +DHV   A   +K+  + RRPGL RKRARF++K  P  +  N
Sbjct  63    RGDI---------EKLYQEDHVEVAATGNDKKNQQGRRPGLDRKRARFTLKAPPSKTVQN  113

Query  657   ISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGIL  836
             +     L++   +DPEEYF   E+LE A +E+ R  G V   +   +      ++RPG+ 
Sbjct  114   VDFSQLLNI---EDPEEYFSTLEQLERADKEIKRLRGEVPTKAADYHRAIEPPKKRPGMA  170

Query  837   GKSVRYKHRFS--SVPPDDNDTDMSSQET-----FKQDDLCAL---KSDLQKENSNDVel  986
              +   + ++FS  +  PD  +   S  ET     F QDD+      +++L   +S+    
Sbjct  171   RRKSVFSYKFSVDADTPDVIEEPASQIETITEPQFTQDDMAPSVPERTELPVPSSSSQCD  230

Query  987   eeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEF  1163
                      +  E    A LD LLS   K+LD+    ++L+E+ Q+K   +  +C+P+ 
Sbjct  231   IPDVSMREDSFAEKDKCATLDSLLSA-FKNLDESEEENLLREKLQLKEISIGKVCLPDL  288


 Score = 67.0 bits (162),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 71/125 (57%), Gaps = 13/125 (10%)
 Frame = +3

Query  2145  PDINPEQHIMKQHPLTKKQPRKNSCMPGNRERK------ALKFRPSLADAGTLFENGVRR  2306
             P+I P      QH    + PR      G +E +       L  R SL+  G  +E+GVRR
Sbjct  747   PEIQPPN---DQHTDVTRDPRSPKKGKGQKEARRRSKTQELNGRKSLSAFGLAWESGVRR  803

Query  2307  SKRIKSRPLEFWKGERLLFGRVNESMK-LVGVKYVSPS---LGNMKVKSYISDEYKEVVD  2474
             S RI+SRPL+ W GER L+GR++ +M  ++GVK  SPS      ++VKS++ D+Y +VV 
Sbjct  804   SSRIRSRPLQDWLGERFLYGRIHGTMSTVIGVKSYSPSHDGKAALRVKSFVPDQYSDVVA  863

Query  2475  LAARY  2489
              A +Y
Sbjct  864   EAGKY  868



>ref|XP_002988563.1| hypothetical protein SELMODRAFT_427188 [Selaginella moellendorffii]
 gb|EFJ10359.1| hypothetical protein SELMODRAFT_427188 [Selaginella moellendorffii]
Length=356

 Score = 74.7 bits (182),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 57/85 (67%), Gaps = 10/85 (12%)
 Frame = +3

Query  2259  PSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSP-------  2414
             P L ++G  ++NG R S R +SRPLE+W+GE+LL+GRV+++M  L+G+K+ SP       
Sbjct  271   PWLKESGMEWKNGRRCSTRYRSRPLEYWRGEKLLYGRVHKTMPTLIGIKHSSPMPPHPKR  330

Query  2415  --SLGNMKVKSYISDEYKEVVDLAA  2483
                    KV+S++ D++K +V LAA
Sbjct  331   GEKPKEFKVESFVPDQFKHLVKLAA  355



>ref|XP_010232029.1| PREDICTED: uncharacterized protein LOC100845382 isoform X3 [Brachypodium 
distachyon]
Length=843

 Score = 76.3 bits (186),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 142/299 (47%), Gaps = 33/299 (11%)
 Frame = +3

Query  315   DPLRAFAGLP-LLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIVDN  491
             DPLRA A    LL QT+      +  ++ +++     L  S+  + +++L+E++   +  
Sbjct  9     DPLRAVASATCLLFQTL----SPAAFAQSSSMAREALLGGSLVQKGSKELMEQASLTLKQ  64

Query  492   GSEILNANFPRFKASLDLDDHV---AAKVEKEMPRERRPGLGRKRARFSMK--PDTSQPN  656
               +I           L  +DHV   A   +K+  + RRPGL RKRARF++K  P  +  N
Sbjct  65    RGDI---------EKLYQEDHVEVAATGNDKKNQQGRRPGLDRKRARFTLKAPPSKTVQN  115

Query  657   ISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGIL  836
             +     L++   +DPEEYF   E+LE A +E+ R  G V   +   +      ++RPG+ 
Sbjct  116   VDFSQLLNI---EDPEEYFSTLEQLERADKEIKRLRGEVPTKAADYHRAIEPPKKRPGMA  172

Query  837   GKSVRYKHRFS--SVPPDDNDTDMSSQET-----FKQDDLCAL---KSDLQKENSNDVel  986
              +   + ++FS  +  PD  +   S  ET     F QDD+      +++L   +S+    
Sbjct  173   RRKSVFSYKFSVDADTPDVIEEPASQIETITEPQFTQDDMAPSVPERTELPVPSSSSQCD  232

Query  987   eeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEF  1163
                      +  E    A LD LLS   K+LD+    ++L+E+ Q+K   +  +C+P+ 
Sbjct  233   IPDVSMREDSFAEKDKCATLDSLLSA-FKNLDESEEENLLREKLQLKEISIGKVCLPDL  290


 Score = 66.6 bits (161),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 71/125 (57%), Gaps = 13/125 (10%)
 Frame = +3

Query  2145  PDINPEQHIMKQHPLTKKQPRKNSCMPGNRERK------ALKFRPSLADAGTLFENGVRR  2306
             P+I P      QH    + PR      G +E +       L  R SL+  G  +E+GVRR
Sbjct  722   PEIQPPN---DQHTDVTRDPRSPKKGKGQKEARRRSKTQELNGRKSLSAFGLAWESGVRR  778

Query  2307  SKRIKSRPLEFWKGERLLFGRVNESMK-LVGVKYVSPS---LGNMKVKSYISDEYKEVVD  2474
             S RI+SRPL+ W GER L+GR++ +M  ++GVK  SPS      ++VKS++ D+Y +VV 
Sbjct  779   SSRIRSRPLQDWLGERFLYGRIHGTMSTVIGVKSYSPSHDGKAALRVKSFVPDQYSDVVA  838

Query  2475  LAARY  2489
              A +Y
Sbjct  839   EAGKY  843



>ref|XP_010232030.1| PREDICTED: uncharacterized protein LOC100845382 isoform X4 [Brachypodium 
distachyon]
Length=842

 Score = 76.3 bits (186),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 142/299 (47%), Gaps = 33/299 (11%)
 Frame = +3

Query  315   DPLRAFAGLP-LLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIVDN  491
             DPLRA A    LL QT+      +  ++ +++     L  S+  + +++L+E++   +  
Sbjct  9     DPLRAVASATCLLFQTL----SPAAFAQSSSMAREALLGGSLVQKGSKELMEQASLTLKQ  64

Query  492   GSEILNANFPRFKASLDLDDHV---AAKVEKEMPRERRPGLGRKRARFSMK--PDTSQPN  656
               +I           L  +DHV   A   +K+  + RRPGL RKRARF++K  P  +  N
Sbjct  65    RGDI---------EKLYQEDHVEVAATGNDKKNQQGRRPGLDRKRARFTLKAPPSKTVQN  115

Query  657   ISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGIL  836
             +     L++   +DPEEYF   E+LE A +E+ R  G V   +   +      ++RPG+ 
Sbjct  116   VDFSQLLNI---EDPEEYFSTLEQLERADKEIKRLRGEVPTKAADYHRAIEPPKKRPGMA  172

Query  837   GKSVRYKHRFS--SVPPDDNDTDMSSQET-----FKQDDLCAL---KSDLQKENSNDVel  986
              +   + ++FS  +  PD  +   S  ET     F QDD+      +++L   +S+    
Sbjct  173   RRKSVFSYKFSVDADTPDVIEEPASQIETITEPQFTQDDMAPSVPERTELPVPSSSSQCD  232

Query  987   eeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEF  1163
                      +  E    A LD LLS   K+LD+    ++L+E+ Q+K   +  +C+P+ 
Sbjct  233   IPDVSMREDSFAEKDKCATLDSLLSA-FKNLDESEEENLLREKLQLKEISIGKVCLPDL  290


 Score = 66.6 bits (161),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 71/125 (57%), Gaps = 13/125 (10%)
 Frame = +3

Query  2145  PDINPEQHIMKQHPLTKKQPRKNSCMPGNRERK------ALKFRPSLADAGTLFENGVRR  2306
             P+I P      QH    + PR      G +E +       L  R SL+  G  +E+GVRR
Sbjct  721   PEIQPPN---DQHTDVTRDPRSPKKGKGQKEARRRSKTQELNGRKSLSAFGLAWESGVRR  777

Query  2307  SKRIKSRPLEFWKGERLLFGRVNESMK-LVGVKYVSPS---LGNMKVKSYISDEYKEVVD  2474
             S RI+SRPL+ W GER L+GR++ +M  ++GVK  SPS      ++VKS++ D+Y +VV 
Sbjct  778   SSRIRSRPLQDWLGERFLYGRIHGTMSTVIGVKSYSPSHDGKAALRVKSFVPDQYSDVVA  837

Query  2475  LAARY  2489
              A +Y
Sbjct  838   EAGKY  842



>ref|XP_003566889.1| PREDICTED: uncharacterized protein LOC100845382 isoform X1 [Brachypodium 
distachyon]
Length=870

 Score = 75.9 bits (185),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 142/299 (47%), Gaps = 33/299 (11%)
 Frame = +3

Query  315   DPLRAFAGLP-LLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKAIVDN  491
             DPLRA A    LL QT+      +  ++ +++     L  S+  + +++L+E++   +  
Sbjct  9     DPLRAVASATCLLFQTL----SPAAFAQSSSMAREALLGGSLVQKGSKELMEQASLTLKQ  64

Query  492   GSEILNANFPRFKASLDLDDHV---AAKVEKEMPRERRPGLGRKRARFSMK--PDTSQPN  656
               +I           L  +DHV   A   +K+  + RRPGL RKRARF++K  P  +  N
Sbjct  65    RGDI---------EKLYQEDHVEVAATGNDKKNQQGRRPGLDRKRARFTLKAPPSKTVQN  115

Query  657   ISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRPGIL  836
             +     L++   +DPEEYF   E+LE A +E+ R  G V   +   +      ++RPG+ 
Sbjct  116   VDFSQLLNI---EDPEEYFSTLEQLERADKEIKRLRGEVPTKAADYHRAIEPPKKRPGMA  172

Query  837   GKSVRYKHRFS--SVPPDDNDTDMSSQET-----FKQDDLCAL---KSDLQKENSNDVel  986
              +   + ++FS  +  PD  +   S  ET     F QDD+      +++L   +S+    
Sbjct  173   RRKSVFSYKFSVDADTPDVIEEPASQIETITEPQFTQDDMAPSVPERTELPVPSSSSQCD  232

Query  987   eeleltglitekegRVNAILDELLSRDAKDLDDDRVLSILQEQFQMKPPDLSALCMPEF  1163
                      +  E    A LD LLS   K+LD+    ++L+E+ Q+K   +  +C+P+ 
Sbjct  233   IPDVSMREDSFAEKDKCATLDSLLSA-FKNLDESEEENLLREKLQLKEISIGKVCLPDL  290


 Score = 66.6 bits (161),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 71/125 (57%), Gaps = 13/125 (10%)
 Frame = +3

Query  2145  PDINPEQHIMKQHPLTKKQPRKNSCMPGNRERK------ALKFRPSLADAGTLFENGVRR  2306
             P+I P      QH    + PR      G +E +       L  R SL+  G  +E+GVRR
Sbjct  749   PEIQPPN---DQHTDVTRDPRSPKKGKGQKEARRRSKTQELNGRKSLSAFGLAWESGVRR  805

Query  2307  SKRIKSRPLEFWKGERLLFGRVNESMK-LVGVKYVSPS---LGNMKVKSYISDEYKEVVD  2474
             S RI+SRPL+ W GER L+GR++ +M  ++GVK  SPS      ++VKS++ D+Y +VV 
Sbjct  806   SSRIRSRPLQDWLGERFLYGRIHGTMSTVIGVKSYSPSHDGKAALRVKSFVPDQYSDVVA  865

Query  2475  LAARY  2489
              A +Y
Sbjct  866   EAGKY  870



>ref|XP_001781488.1| predicted protein [Physcomitrella patens]
 gb|EDQ53668.1| predicted protein [Physcomitrella patens]
Length=1109

 Score = 76.3 bits (186),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 65/102 (64%), Gaps = 17/102 (17%)
 Frame = +3

Query  2232  RERKALKFRP--SLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVK  2402
             R RK  K +   S  DAG+ + +G R+S RI+S+PL++W+GER+L+GRV+ S+  L+G+K
Sbjct  1008  RSRKGTKAKKVDSPLDAGSKWSDGKRKSTRIRSKPLDWWRGERMLYGRVHSSLNTLIGIK  1067

Query  2403  YVSPS--------------LGNMKVKSYISDEYKEVVDLAAR  2486
             ++SP                   KV S++SDE+KE++ LAA+
Sbjct  1068  HLSPDPVWPRPRDKKNKMVPPKFKVDSFVSDEHKELLRLAAQ  1109



>gb|ABL64047.1| CENP-C [Arabidopsis lyrata subsp. petraea]
Length=203

 Score = 70.5 bits (171),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +3

Query  2196  KQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVN  2375
             K+P KN+      E K    R SLA AGT  E GVRRS RIKSRPLEFWKGER L GR++
Sbjct  144   KKP-KNTRKTLTXEGKLFSRRKSLAAAGTKMEGGVRRSTRIKSRPLEFWKGERFLXGRIH  202

Query  2376  E  2378
             E
Sbjct  203   E  203



>ref|XP_002979260.1| hypothetical protein SELMODRAFT_110537, partial [Selaginella 
moellendorffii]
 gb|EFJ19668.1| hypothetical protein SELMODRAFT_110537, partial [Selaginella 
moellendorffii]
Length=86

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 57/85 (67%), Gaps = 10/85 (12%)
 Frame = +3

Query  2259  PSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSP-------  2414
             P  A++G  ++NG R S R +SRPLE+W+GE+LL+GRV+++M  L+G+K+ SP       
Sbjct  1     PVQAESGMEWKNGRRCSTRYRSRPLEYWRGEKLLYGRVHKTMPTLIGIKHSSPMPPHPKR  60

Query  2415  --SLGNMKVKSYISDEYKEVVDLAA  2483
                    KV+S++ D++K +V LAA
Sbjct  61    GEKPKEFKVESFVPDQFKHLVKLAA  85



>ref|NP_001104933.1| CENPCA protein [Zea mays]
 gb|AAD39434.2|AF129857_1 CENPCA protein [Zea mays]
 gb|ACN33243.1| unknown [Zea mays]
 tpg|DAA58576.1| TPA: CENPCA protein [Zea mays]
Length=701

 Score = 71.6 bits (174),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 66/118 (56%), Gaps = 4/118 (3%)
 Frame = +3

Query  2148  DINPEQHIMKQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSR  2327
             D+N E+  +    L+    +         + K    R  L DA    + GVR+S R +SR
Sbjct  584   DVNIEKQTITSSTLSPNGAKGQKGAQRRNQTKKRNQRKILGDADLACQPGVRKSSRTRSR  643

Query  2328  PLEFWKGERLLFGRVNESMK-LVGVKYVSPSLG---NMKVKSYISDEYKEVVDLAARY  2489
             PLE+W GERLL+G +++++   +G+K  SP      ++KVKS++ ++Y ++V  +ARY
Sbjct  644   PLEYWLGERLLYGPIHDNLHGAIGIKAYSPGQDGKRSLKVKSFVPEQYSDLVAKSARY  701


 Score = 57.4 bits (137),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 94/189 (50%), Gaps = 20/189 (11%)
 Frame = +3

Query  303  MDPPDPLRAFAGLP-LLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKA  479
            MD  DPL A +    LLP+T+      S PS P +   +  +  +  L+ +E+L++++  
Sbjct  1    MDAADPLCAISSTARLLPRTLGPAIGPS-PSNPRDA-LLEAIALARSLKGSEELVKQATM  58

Query  480  IVDNGSEILNANFPRFKASLDLDDHVA----AKVEKEMPRERRPGLGRKRARFSMKPDTS  647
            +     +I          +L  DD V     A   KE  + RRP L RKRARF+MK   S
Sbjct  59   VPKEHGDI---------QALYHDDGVKGWPPANGSKEQ-QGRRPALDRKRARFAMKDTGS  108

Query  648  QPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRP  827
            +P + +     +  + DP  +F+  ++LE A++E+ R  G  A+   +N  P     R+P
Sbjct  109  KP-VPVVDQSKLSNISDPITFFMTLDRLEEAEEEIKRLNG-EAEKRTLNFDPVDEPIRQP  166

Query  828  GILG-KSVR  851
            G+ G KSVR
Sbjct  167  GLRGRKSVR  175



>gb|EPS63000.1| hypothetical protein M569_11788, partial [Genlisea aurea]
Length=166

 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 86/163 (53%), Gaps = 17/163 (10%)
 Frame = +3

Query  735   NAKQELNRQMGVVADDSNINNL----PTTARRRRPGILGKSVRYKHRFSSVPPDDNDTDM  902
             +AK+E+ +Q+G      N++ L    P+   +RRPGILGKS  Y HR+++   + +DT  
Sbjct  8     DAKKEMQKQLG-----GNLDALDQQRPSLVHQRRPGILGKS--YVHRYTAPRIETDDTAK  60

Query  903   SSQETFKQDDLCALKSDLQKENSNDVeleeleltgli------tekegRVNAILDELLSR  1064
               QET +      +K    + NS  V  ++     +          +  ++ ILDELLS 
Sbjct  61    PFQETGELIKSITIKDQSLETNSFSVVDDQTGPLRISCDDLFGKAMDRNLSNILDELLSC  120

Query  1065  DAKDLDDDRVLSILQEQFQMKPPDLSALCMPEFPDARTDYMTL  1193
             + +DLD D  L +LQE+  +KP DL +L +P    AR+  +TL
Sbjct  121   NNEDLDGDGALYLLQERLNVKPLDLDSLSIPVLNVARSSALTL  163



>gb|AAU04626.1| CENP-C1 [Saccharum officinarum]
 gb|AAU04628.1| CENP-C1 [Saccharum officinarum]
Length=709

 Score = 70.1 bits (170),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 93/186 (50%), Gaps = 17/186 (9%)
 Frame = +3

Query  303  MDPPDPLRAFAG-LPLLPQTIRVQSEDSIPSEPNNLNS--IHQLMKSMGLRNAEKLLEES  473
            MD  DPL A +    LLP+T+      +  S P+      +  +  +  L+ +E+LL+++
Sbjct  1    MDAADPLCAISSPARLLPRTLGPAPASATGSSPSKARDALLEAIAVARSLKGSEELLKQA  60

Query  474  KAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRE---RRPGLGRKRARFSMKPDT  644
            K ++    +I          +L  DD V A+      +E   RRP L RKRARF+MK   
Sbjct  61   KMVLKEHGDI---------QALYHDDGVKARPPANGSKEQQGRRPALNRKRARFTMKDTA  111

Query  645  SQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRR  824
            S+P   +  S  +  + DP EYF+  ++LE A++E+ R  G  A+   +N  P    +R+
Sbjct  112  SKPMPVVDQS-KLTNISDPVEYFMTLDRLEEAQEEIQRLHG-GAEKRVLNFDPVDEPKRQ  169

Query  825  PGILGK  842
            PG  G+
Sbjct  170  PGFRGR  175


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 56/87 (64%), Gaps = 4/87 (5%)
 Frame = +3

Query  2241  KALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPS  2417
             K L  R  L DAG    + VRRS R +SRPLE W GERLL+G +N+++  ++G+K  SP 
Sbjct  623   KKLNQRKILGDAGLAQPSVVRRSTRTRSRPLEHWLGERLLYGPINDTLPAVIGIKAYSPG  682

Query  2418  LG---NMKVKSYISDEYKEVVDLAARY  2489
                   +KVKS++ D+Y ++V  +A+Y
Sbjct  683   QDGKRTLKVKSFVPDQYSDLVAKSAKY  709



>tpg|DAA43238.1| TPA: hypothetical protein ZEAMMB73_222077 [Zea mays]
Length=131

 Score = 65.9 bits (159),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 39/116 (34%), Positives = 65/116 (56%), Gaps = 9/116 (8%)
 Frame = +3

Query  2169  IMKQHPLTKKQPRKNSCMPGNR-----ERKALKFRPSLADAGTLFENGVRRSKRIKSRPL  2333
             + ++  +T   P  N      R     + K    R  L DA    + GVR+S R +SRPL
Sbjct  16    VFQKQTITSSTPSPNGAKGQKRAQRRNQTKKRNQRKILGDADLACQPGVRKSSRTRSRPL  75

Query  2334  EFWKGERLLFGRVNESMK-LVGVKYVSPSLG---NMKVKSYISDEYKEVVDLAARY  2489
             E+W GERLL+G +++++   +G+K  SP      ++KVKS++ ++Y ++V  +ARY
Sbjct  76    EYWLGERLLYGPIHDNLHGAIGIKAYSPGQDGKRSLKVKSFVPEQYSDLVAKSARY  131



>gb|EMT11913.1| hypothetical protein F775_31264 [Aegilops tauschii]
Length=718

 Score = 68.9 bits (167),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 51/69 (74%), Gaps = 4/69 (6%)
 Frame = +3

Query  2277  GTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPSLGN---MKVKSY  2444
             G  +++GVRRS RI+SRPL+ W GERLL+GR++++M  ++GVK  SPS      ++VKS+
Sbjct  601   GLAWQSGVRRSTRIRSRPLQDWLGERLLYGRIHDTMATVIGVKSYSPSQDGKVELRVKSF  660

Query  2445  ISDEYKEVV  2471
             + ++Y ++ 
Sbjct  661   VPEQYSDMA  669



>gb|AAU04623.1| CENP-C [Sorghum bicolor]
Length=694

 Score = 67.4 bits (163),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 67/118 (57%), Gaps = 4/118 (3%)
 Frame = +3

Query  2148  DINPEQHIMKQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSR  2327
             D N EQH +    L+    +         + K L  R  L DAG    +GVRRS R +SR
Sbjct  577   DQNIEQHTVLSSTLSPNHDKGQKGAQRTNKTKKLNQRKILGDAGLAQPSGVRRSTRTRSR  636

Query  2328  PLEFWKGERLLFGRVNESMKLV-GVKYVSPSL---GNMKVKSYISDEYKEVVDLAARY  2489
             PLE W GERLL+G +N+++ +V G+K  SP       +KVKS++ D+Y ++V  +A+Y
Sbjct  637   PLEHWLGERLLYGPINDTLPVVIGIKSYSPGQDGKKTLKVKSFVPDQYSDLVAKSAKY  694


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 93/189 (49%), Gaps = 18/189 (10%)
 Frame = +3

Query  303  MDPPDPLRAFAGLP--LLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESK  476
            M+  DPL A + LP  LLP+T+   S             +  +  S  L+ +E+L++++K
Sbjct  1    MNAADPLCAIS-LPARLLPRTLGPASATGPSPSKAGDALLETIAVSRSLKGSEELVKQAK  59

Query  477  AIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRER---RPGLGRKRARFSMKPDTS  647
             ++    +I           L  DD V  +      +E+   RP L RKRARF+MK   S
Sbjct  60   MVLKEHGDI---------QPLYHDDGVQVRPPVNGSKEQQGGRPALNRKRARFTMKDTAS  110

Query  648  QPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRP  827
            +P   +  S  +  + DP EYF+  ++LE A++E+ R  G  A+   +   P    +R+P
Sbjct  111  KPTPVVDQS-KLTNISDPVEYFMTLDQLEEAQEEIQRLNG-AAEKCVLKFDPVDQPKRQP  168

Query  828  GILG-KSVR  851
            G+ G KS+R
Sbjct  169  GLCGRKSIR  177



>gb|AAU04627.1| CENP-C2 [Saccharum officinarum]
Length=709

 Score = 66.2 bits (160),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 92/186 (49%), Gaps = 17/186 (9%)
 Frame = +3

Query  303  MDPPDPLRAFAG-LPLLPQTIRVQSEDSIPSEPNNLNS--IHQLMKSMGLRNAEKLLEES  473
            MD  DPL A +    LLP+T+      +    P+      +  +  +  L+ +E+LL+++
Sbjct  1    MDAADPLCAISSPARLLPRTLGPAHASATGPSPSKAGDALLEAIAVARSLKGSEELLKQA  60

Query  474  KAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRE---RRPGLGRKRARFSMKPDT  644
            K ++    +I          +L  DD V A+      +E   RRP L RKRARF+MK   
Sbjct  61   KMVLKEHGDI---------QALYHDDGVKARPPANGSKEQQGRRPALNRKRARFTMKDTA  111

Query  645  SQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRR  824
            S+P   +  S  +  + DP EYF+  ++LE A++E+ R  G  A+   +N  P    +R+
Sbjct  112  SKPMPVVDQS-KLMNISDPVEYFMTLDRLEEAQEEIQRLHG-GAEKRVLNFDPVDEPKRQ  169

Query  825  PGILGK  842
            PG  G+
Sbjct  170  PGFHGR  175


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 56/87 (64%), Gaps = 4/87 (5%)
 Frame = +3

Query  2241  KALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESMK-LVGVKYVSPS  2417
             K L  R  L DAG    + VRRS R +SRPLE W GERLL+G +N+++  ++G+K  SP 
Sbjct  623   KKLNQRKILGDAGLAQPSVVRRSTRTRSRPLEHWLGERLLYGPINDTLPAVIGIKAYSPG  682

Query  2418  LG---NMKVKSYISDEYKEVVDLAARY  2489
                   +KVKS++ D+Y ++V  +A+Y
Sbjct  683   QDGKRTLKVKSFVPDQYSDLVAKSAKY  709



>gb|AAU04624.1| CENP-C [Sorghum propinquum]
Length=758

 Score = 65.9 bits (159),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 67/118 (57%), Gaps = 4/118 (3%)
 Frame = +3

Query  2148  DINPEQHIMKQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGTLFENGVRRSKRIKSR  2327
             D+N EQ  +    L+    +         + K L  R  L DAG    +GVRRS R +SR
Sbjct  641   DLNIEQQTVLSSTLSPNHDKGQKGAQRTNKTKKLNQRKILGDAGLAQPSGVRRSTRTRSR  700

Query  2328  PLEFWKGERLLFGRVNESM-KLVGVKYVSP---SLGNMKVKSYISDEYKEVVDLAARY  2489
             PLE W GERLL+G +N+++  ++G+K  SP       +KVKS++ D+Y ++V  +A+Y
Sbjct  701   PLEHWLGERLLYGPINDTLPAVIGIKSYSPGQDGKKTLKVKSFVPDQYSDLVAKSAKY  758


 Score = 57.0 bits (136),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 57/193 (30%), Positives = 99/193 (51%), Gaps = 26/193 (13%)
 Frame = +3

Query  303  MDPPDPLRAFAGLP--LLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGL----RNAEKLL  464
            M+  DPL A + LP  LLP+T+   S     + P+   +   L++++ +    + +E+L+
Sbjct  1    MNAADPLCAIS-LPARLLPRTLGPAS----ATGPSPSKAGDALLEAIAVARSPKGSEELV  55

Query  465  EESKAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRE---RRPGLGRKRARFSMK  635
            +++K ++    +I           L  DD V  +      +E   RR  L RKRARF+MK
Sbjct  56   KQAKMVLKEHGDI---------QPLYHDDGVQVRPPVNDSKEQQGRRLALNRKRARFTMK  106

Query  636  PDTSQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTAR  815
               S+P   +  S  +  + DP EYF+  ++LE A++E+ R  G  A+   +   P   +
Sbjct  107  DTASKPTPVVDQS-KLTNISDPVEYFMTLDRLEEAQEEIQRLNG-AAEKCVLKFDPVDQQ  164

Query  816  RRRPGILG-KSVR  851
            +R+PG+ G KS+R
Sbjct  165  KRQPGLCGRKSIR  177



>gb|AAD39435.1|AF129858_1 CENPCB protein [Zea mays]
Length=451

 Score = 60.5 bits (145),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 57/87 (66%), Gaps = 4/87 (5%)
 Frame = +3

Query  2241  KALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPS  2417
             K L  R  L D     ++GVRRS RI+SRPLE+W GERLL+G V +++  ++G+K  SP 
Sbjct  365   KKLNQRKILGDVDLARQSGVRRSSRIRSRPLEYWLGERLLYGPVQDTLPAVIGIKAYSPG  424

Query  2418  L---GNMKVKSYISDEYKEVVDLAARY  2489
                   +KVKS++S++Y ++V   A+Y
Sbjct  425   QDGKKTLKVKSFVSEQYSDLVAQFAKY  451



>ref|XP_008656649.1| PREDICTED: uncharacterized protein LOC541778 [Zea mays]
 gb|AFW83276.1| CENPCB protein [Zea mays]
Length=687

 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 57/87 (66%), Gaps = 4/87 (5%)
 Frame = +3

Query  2241  KALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSP-  2414
             K L  R  L D     ++GVRRS RI+SRPLE+W GERLL+G + +++  ++G+K  SP 
Sbjct  601   KKLNQRKILGDVDLARQSGVRRSSRIRSRPLEYWLGERLLYGPIQDTLPAVIGIKAYSPG  660

Query  2415  --SLGNMKVKSYISDEYKEVVDLAARY  2489
                   +KVKS++S++Y ++V   A+Y
Sbjct  661   QDGKKTLKVKSFVSEQYSDLVAQFAKY  687



>gb|AFW83278.1| hypothetical protein ZEAMMB73_130673 [Zea mays]
Length=103

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 37/87 (43%), Positives = 57/87 (66%), Gaps = 4/87 (5%)
 Frame = +3

Query  2241  KALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPS  2417
             K L  R  L D     ++GVRRS RI+SRPLE+W GERLL+G + +++  ++G+K  SP 
Sbjct  17    KKLNQRKILGDVDLARQSGVRRSSRIRSRPLEYWLGERLLYGPIQDTLPAVIGIKAYSPG  76

Query  2418  LG---NMKVKSYISDEYKEVVDLAARY  2489
                   +KVKS++S++Y ++V   A+Y
Sbjct  77    QDGKKTLKVKSFVSEQYSDLVAQFAKY  103



>gb|AFW83277.1| hypothetical protein ZEAMMB73_130673 [Zea mays]
Length=109

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/87 (43%), Positives = 57/87 (66%), Gaps = 4/87 (5%)
 Frame = +3

Query  2241  KALKFRPSLADAGTLFENGVRRSKRIKSRPLEFWKGERLLFGRVNESM-KLVGVKYVSPS  2417
             K L  R  L D     ++GVRRS RI+SRPLE+W GERLL+G + +++  ++G+K  SP 
Sbjct  23    KKLNQRKILGDVDLARQSGVRRSSRIRSRPLEYWLGERLLYGPIQDTLPAVIGIKAYSPG  82

Query  2418  LG---NMKVKSYISDEYKEVVDLAARY  2489
                   +KVKS++S++Y ++V   A+Y
Sbjct  83    QDGKKTLKVKSFVSEQYSDLVAQFAKY  109



>tpg|DAA58575.1| TPA: CENPCC protein [Zea mays]
Length=677

 Score = 57.4 bits (137),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 94/189 (50%), Gaps = 20/189 (11%)
 Frame = +3

Query  303  MDPPDPLRAFAGLP-LLPQTIRVQSEDSIPSEPNNLNSIHQLMKSMGLRNAEKLLEESKA  479
            MD  DPL A +    LLP+T+      S PS P +   +  +  +  L+ +E+L++++  
Sbjct  1    MDAADPLCAISSTARLLPRTLGPAIGPS-PSNPRDA-LLEAIALARSLKGSEELVKQATM  58

Query  480  IVDNGSEILNANFPRFKASLDLDDHVA----AKVEKEMPRERRPGLGRKRARFSMKPDTS  647
            +     +I          +L  DD V     A   KE  + RRP L RKRARF+MK   S
Sbjct  59   VPKEHGDI---------QALYHDDGVKGWPPANGSKEQ-QGRRPALDRKRARFAMKDTGS  108

Query  648  QPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRRP  827
            +P + +     +  + DP  +F+  ++LE A++E+ R  G  A+   +N  P     R+P
Sbjct  109  KP-VPVVDQSKLSNISDPITFFMTLDRLEEAEEEIKRLNG-EAEKRTLNFDPVDEPIRQP  166

Query  828  GILG-KSVR  851
            G+ G KSVR
Sbjct  167  GLRGRKSVR  175



>ref|XP_003083681.1| CENP-C (ISS) [Ostreococcus tauri]
Length=642

 Score = 57.0 bits (136),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (55%), Gaps = 2/91 (2%)
 Frame = +3

Query  2127  DMQSALPDINPEQHIMKQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGT-LFENGVR  2303
             DM+    D+ P        P   ++ R  S +P  R R  ++ R SLA AGT   + GVR
Sbjct  209   DMEIGYDDVMPYDDDGFVEPAAPRK-RTTSGVPHKRLRAEMERRKSLALAGTQTVQGGVR  267

Query  2304  RSKRIKSRPLEFWKGERLLFGRVNESMKLVG  2396
             RS R +S+PLE+W+GE  ++ RV+ S+  V 
Sbjct  268   RSTRQRSKPLEYWRGETKVYQRVHSSLPTVA  298



>emb|CEG00421.1| unnamed product [Ostreococcus tauri]
Length=695

 Score = 57.0 bits (136),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (55%), Gaps = 2/91 (2%)
 Frame = +3

Query  2127  DMQSALPDINPEQHIMKQHPLTKKQPRKNSCMPGNRERKALKFRPSLADAGT-LFENGVR  2303
             DM+    D+ P        P   ++ R  S +P  R R  ++ R SLA AGT   + GVR
Sbjct  262   DMEIGYDDVMPYDDDGFVEPAAPRK-RTTSGVPHKRLRAEMERRKSLALAGTQTVQGGVR  320

Query  2304  RSKRIKSRPLEFWKGERLLFGRVNESMKLVG  2396
             RS R +S+PLE+W+GE  ++ RV+ S+  V 
Sbjct  321   RSTRQRSKPLEYWRGETKVYQRVHSSLPTVA  351



>tpg|DAA43237.1| TPA: hypothetical protein ZEAMMB73_222077 [Zea mays]
Length=505

 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 92/190 (48%), Gaps = 20/190 (11%)
 Frame = +3

Query  303  MDPPDPLRAFAGLP-LLPQTIRVQSEDSIPSEPNNLNS--IHQLMKSMGLRNAEKLLEES  473
            MD  DPL A +    LLP+T+      +I   P+      +  +  +  L+ +E+L++++
Sbjct  1    MDATDPLCAISSTARLLPRTL--GPAPAIGPSPSKARDALLEAIALARSLKGSEELVKQA  58

Query  474  KAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRE---RRPGLGRKRARFSMKPDT  644
              +     +I          +L  DD V  +      +E   RRP L RKRARF+MK   
Sbjct  59   TMVPKEHGDI---------QALYHDDGVKGRPPANGSKEQQGRRPALDRKRARFAMKDTG  109

Query  645  SQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRR  824
            S+P + +     +  + DP  +F+  ++LE A++E+ R  G  A+   +N  P     R+
Sbjct  110  SKP-VPVVDQSKLSNISDPITFFMTLDRLEEAEEEIKRLNG-EAEKRTLNFDPVDEPIRQ  167

Query  825  PGILG-KSVR  851
            PG+ G KSVR
Sbjct  168  PGLRGRKSVR  177



>tpg|DAA43236.1| TPA: hypothetical protein ZEAMMB73_222077 [Zea mays]
Length=507

 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 92/190 (48%), Gaps = 20/190 (11%)
 Frame = +3

Query  303  MDPPDPLRAFAGLP-LLPQTIRVQSEDSIPSEPNNLNS--IHQLMKSMGLRNAEKLLEES  473
            MD  DPL A +    LLP+T+      +I   P+      +  +  +  L+ +E+L++++
Sbjct  1    MDATDPLCAISSTARLLPRTL--GPAPAIGPSPSKARDALLEAIALARSLKGSEELVKQA  58

Query  474  KAIVDNGSEILNANFPRFKASLDLDDHVAAKVEKEMPRE---RRPGLGRKRARFSMKPDT  644
              +     +I          +L  DD V  +      +E   RRP L RKRARF+MK   
Sbjct  59   TMVPKEHGDI---------QALYHDDGVKGRPPANGSKEQQGRRPALDRKRARFAMKDTG  109

Query  645  SQPNISLQSSLDVDKLQDPEEYFLACEKLENAKQELNRQMGVVADDSNINNLPTTARRRR  824
            S+P + +     +  + DP  +F+  ++LE A++E+ R  G  A+   +N  P     R+
Sbjct  110  SKP-VPVVDQSKLSNISDPITFFMTLDRLEEAEEEIKRLNG-EAEKRTLNFDPVDEPIRQ  167

Query  825  PGILG-KSVR  851
            PG+ G KSVR
Sbjct  168  PGLRGRKSVR  177



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9002518616520