BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18407_g1_i1 len=2150 path=[2128:0-1310 3439:1311-1540
3669:1541-2149]

Length=2150
                                                                      Score     E

ref|XP_006354767.1|  PREDICTED: uncharacterized protein LOC102581330    103   3e-19   
ref|XP_004242178.1|  PREDICTED: uncharacterized protein LOC101260058    101   1e-18   
ref|XP_009626284.1|  PREDICTED: uncharacterized protein LOC104117013  93.6    2e-16   
ref|XP_009800355.1|  PREDICTED: uncharacterized protein LOC104246272  78.2    1e-11   
ref|XP_009604799.1|  PREDICTED: uncharacterized protein LOC104099...  75.1    1e-10   
ref|XP_009604798.1|  PREDICTED: uncharacterized protein LOC104099...  75.1    1e-10   
ref|XP_006345167.1|  PREDICTED: dentin sialophosphoprotein-like       72.4    9e-10   
ref|XP_009795938.1|  PREDICTED: uncharacterized protein LOC104242560  72.0    1e-09   
ref|XP_004235976.1|  PREDICTED: uncharacterized protein LOC101257...  65.5    2e-07   
ref|XP_004235977.1|  PREDICTED: uncharacterized protein LOC101257...  65.5    2e-07   
emb|CDP19451.1|  unnamed protein product                              64.7    2e-07   
ref|XP_011087293.1|  PREDICTED: uncharacterized protein LOC105168834  64.7    2e-07   
ref|XP_010678438.1|  PREDICTED: uncharacterized protein LOC104893989  58.5    2e-05   
ref|XP_010106635.1|  hypothetical protein L484_015234                 57.4    4e-05   
gb|KEH31979.1|  DUF863 family protein                                 57.0    6e-05   
ref|XP_004508706.1|  PREDICTED: uncharacterized protein LOC101495925  56.2    7e-05   
ref|XP_008374587.1|  PREDICTED: uncharacterized protein LOC103437859  55.8    1e-04   
ref|XP_008239884.1|  PREDICTED: uncharacterized protein LOC103338458  55.1    2e-04   
ref|XP_007037462.1|  Uncharacterized protein isoform 6                55.1    3e-04   
ref|XP_007037459.1|  Uncharacterized protein isoform 3                54.7    3e-04   
gb|KDP31303.1|  hypothetical protein JCGZ_11679                       54.7    3e-04   
ref|XP_007037460.1|  Uncharacterized protein isoform 4                54.7    3e-04   
ref|XP_007037457.1|  Uncharacterized protein isoform 1                54.7    3e-04   
ref|XP_007037461.1|  Uncharacterized protein isoform 5                54.7    3e-04   
ref|XP_007037458.1|  Uncharacterized protein isoform 2                54.7    3e-04   
ref|XP_007138150.1|  hypothetical protein PHAVU_009G184400g           53.9    6e-04   



>ref|XP_006354767.1| PREDICTED: uncharacterized protein LOC102581330 [Solanum tuberosum]
Length=805

 Score =   103 bits (256),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 93/283 (33%), Positives = 126/283 (45%), Gaps = 73/283 (26%)
 Frame = +2

Query  869   PTEQQKYDTERDLKAPISPENRECSPPRADSQETRLDRSIGLSKEGGDEEVS--DRLAAD  1042
             P+E  K   ERDLK P+SPEN+ECSPPR DS++  +  SI L + G D+ +   D +AAD
Sbjct  535   PSEATKSTAERDLKGPVSPENKECSPPRGDSEDINIRTSIHLPRRGHDDPIEEPDTVAAD  594

Query  1043  TLVLILSSGVHKYSKTGIEQP-EVSIGCLDWFAGIASTLVNDQ-NDL-------------  1177
              L+ I SS VH+YSK  I +P E S  CL   A +A++L + Q N++             
Sbjct  595   ILIFISSSVVHRYSKNAIGEPSETSSNCLRGLAEVATSLASSQENEVEQSMEVHFGRDVL  654

Query  1178  -------------LRSGVHD----CIEARKKN----VANSKAKHCARKVK----------  1264
                          LR G  D     ++  KK     V+N   +  A + K          
Sbjct  655   LSERTASSRMKLNLRKGHMDNSLSYLKVAKKKEKGIVSNQPRRGQAWRTKDQKDLQADVL  714

Query  1265  ------VENVKETVDASLPCRLKKTKSEPETKDRACSGRRKARSGHAKGMRSSKALKTSA  1426
                   +  V ET  AS P   KKT S       +C GRR++  G           + + 
Sbjct  715   PAVESLLHQVNETSVASKPSPWKKTPSR-----TSCRGRRRSNDG-----------ERTM  758

Query  1427  CSHFKQQNDGKKLSSAERRLEVWGSKKKRM-ARRATS--TPLF  1546
             CS   Q     K    +R L+ WG  KKR   RRA S  +PLF
Sbjct  759   CSLLLQHTLDNKHGITDRFLKGWGVTKKRQRTRRAKSYVSPLF  801


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 87/290 (30%), Positives = 126/290 (43%), Gaps = 56/290 (19%)
 Frame = +2

Query  2    RMLDLELPGDLYIDSE--EENEVQVPKTPITN-----LWPVNESKLASFYPEGSSMSDSS  160
            RMLDLELP +  I++E  E+ E + P    TN     L P   SK+       SS S SS
Sbjct  187  RMLDLELPAEKAINNEYREQFEEENPAAKKTNILISELQPQCSSKVNLVASGNSSNSPSS  246

Query  161  CRKTNLLFDLNEPAQpdesefpssssllesdssQHDIANQNQDLSEKEKSNADCSLPNKE  340
            CR T LLFDLNEP QP ESE P+S+    +   +  +     DL     + A+CS  NKE
Sbjct  247  CRGTFLLFDLNEPVQPFESECPNSAFESNNIHEEIRVG----DLDLSGMARAECSTLNKE  302

Query  341  TLLDITVGEGHYDACKISPLLEKDKENGLLPCNTEAGGNRSDLNQFAEESCCLTPSNECK  520
                                                G + S+L  F E S        C 
Sbjct  303  ------------------------------------GRDESNLKSFDEVSSVGRALLPCN  326

Query  521  RRRTLDSKISEKNCGEASIDVPSFVSSLGKSINDSEEFPILVQALPCIN-DTSLNKCHKS  697
            +  +L  +  +K   E + D    +SS      + ++ P+ VQAL C N D S +K  +S
Sbjct  327  QPASLPLENVDKIHAETTTDKSLVISSW----REFKQIPVAVQALSCFNTDASFSKSTES  382

Query  698  SISKPRLSRRKFNLNKIKPAGSRSTRDADSVNTSGPNDKVTDSSGKYEAA  847
            S+    L+ +K N++     G  ST  + S+ +       +DS+G++ AA
Sbjct  383  SVRNSSLTAKKLNMD----LGPASTPTSGSLTSCFMQHDASDSTGEHIAA  428



>ref|XP_004242178.1| PREDICTED: uncharacterized protein LOC101260058 [Solanum lycopersicum]
 ref|XP_010322573.1| PREDICTED: uncharacterized protein LOC101260058 [Solanum lycopersicum]
Length=790

 Score =   101 bits (251),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 90/260 (35%), Positives = 125/260 (48%), Gaps = 40/260 (15%)
 Frame = +2

Query  869   PTEQQKYDTERDLKAPISPENRECSPPRADSQETRLDRSIGLSKEGGDEEVS--DRLAAD  1042
             P+E  K   ERDLK P+SPEN+ECSPPR DSQ+  +  SI LS+ G D+ +   D +AAD
Sbjct  534   PSEATKSTAERDLKGPVSPENKECSPPRGDSQDISIRTSIDLSRGGHDDPIKEPDTVAAD  593

Query  1043  TLVLILSSGVHKYSKTGIEQP-EVSIGCLDWFAGIASTLVNDQNDLLRSG--VH---DCI  1204
             TLV I SS VH++SK  I +P E S  CL   A +A++L + Q + +     VH   D +
Sbjct  594   TLVYISSSVVHRFSKNAIGEPSESSSNCLRKLAEVATSLESIQENEVEESMEVHFKRDVL  653

Query  1205  EARKKNVANSKAKHCARKVKVENVKETVDASLPCRLKKTKSEPETKDRACSGRRKARSGH  1384
               R +  A+S+ K   RK  ++N +    + L    KK K     + R    RR     +
Sbjct  654   --RSERTASSRMKLNLRKGHIDNSR----SYLKVAKKKGKGIVCNQTRRGQARRTKEQKN  707

Query  1385  AKGMRSSKALKTSA-----------------------CSHFKQQNDGKKLSSAERRLEVW  1495
              +   ++ A K+ A                       CS   Q     K     R L+ W
Sbjct  708   LQTDETNVASKSGAWKKTPSRTSSRGRRRSSDEERTMCSLLLQHTLDNKHGITGRFLKGW  767

Query  1496  GSKKKRMA-RRATS--TPLF  1546
             G  KKR + RRA S  +PLF
Sbjct  768   GMTKKRQSTRRAKSCVSPLF  787



>ref|XP_009626284.1| PREDICTED: uncharacterized protein LOC104117013 [Nicotiana tomentosiformis]
 ref|XP_009626285.1| PREDICTED: uncharacterized protein LOC104117013 [Nicotiana tomentosiformis]
Length=626

 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 80/238 (34%), Positives = 122/238 (51%), Gaps = 16/238 (7%)
 Frame = +2

Query  869   PTEQQKYDTERDLKA--PISPENRECSPPRADSQETRLDRSIGLSKEGGDEEVS--DRLA  1036
             P+E      ERD++   P+SPEN+ECSPPR DSQ+  +  S+ LSK G  + V   D++A
Sbjct  394   PSEATMPTAERDMEVEGPVSPENKECSPPRGDSQDIMIGTSLHLSKGGHSDLVEELDKVA  453

Query  1037  ADTLVLILSSGVHKYSKTGI-EQPEVSIGCLDWFAGIASTLVN-DQNDL-LRSGVHDCIE  1207
             AD L+ I SS V  YSKT I E  E S   L W A +A+ L    +N++  R  VH    
Sbjct  454   ADILIFISSSAVQGYSKTAISESSEASNNYLGWLAEVAAALARFPENEVEQRMEVH----  509

Query  1208  ARKKNVANSKAKHCARKVKVENVKETVDASLPCRLKKTKSEPETKDRACSGRRKARSGHA  1387
               +++++ S    C+R VK+ N++E+V A     L    +E +   + C+ R+      +
Sbjct  510   -FERDISLSDRNDCSRTVKL-NLRESVPAV--DSLLHQANEKDISPKTCTWRKTPSRMSS  565

Query  1388  KGMRSSKALKTSACSHFKQQNDGKKLSSAERRLEVWGSKKKRMARRATSTPLFSVQVF  1561
             +  R S   K + CS  +   D K     +R L+ WG  K+R   R   + ++S   F
Sbjct  566   RARRRSNDGKRTMCSLLQHTLDTKH-GITDRFLKGWGLTKRRQRARRAQSYIWSSFSF  622


 Score = 59.3 bits (142),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 47/74 (64%), Gaps = 9/74 (12%)
 Frame = +2

Query  2    RMLDLELPGDLYIDSE------EENEVQVPKTPITNLWPVNESKLASFYPEGSSMSDSSC  163
            RMLDLE+P + YID+E      EEN V+ P   I  L P   SK+ +F    SS+S SSC
Sbjct  185  RMLDLEVPAEEYIDNEDGEPFEEENPVKKPNIMIAELQPQCYSKV-NF--GDSSISLSSC  241

Query  164  RKTNLLFDLNEPAQ  205
            R T+LLFDLNEP Q
Sbjct  242  RGTSLLFDLNEPVQ  255



>ref|XP_009800355.1| PREDICTED: uncharacterized protein LOC104246272 [Nicotiana sylvestris]
Length=626

 Score = 78.2 bits (191),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 114/220 (52%), Gaps = 15/220 (7%)
 Frame = +2

Query  896   ERDLKA--PISPENRECSPPRADSQETRLDRSIGLSKEGGDEEVS--DRLAADTLVLILS  1063
             ERDL+   P+SPEN+ECSPPR DSQ+  +  S+ LSK G  + V   D++AAD L+ I S
Sbjct  403   ERDLEVEGPVSPENKECSPPRGDSQDIIIGTSLHLSKGGHSDLVEEIDKVAADILIFISS  462

Query  1064  SGVHKYSKTGIEQP-EVSIGCLDWFAGIASTLVNDQNDLLRSGVHDCIEAR-KKNVANSK  1237
             S V +YSKT I +P E S  C     G+ + +         + V   +E   +++V  S 
Sbjct  463   SAVGEYSKTAISEPSEASNKC----LGLLAEVAAALARFPENEVEQHMEVHFERDVPLSD  518

Query  1238  AKHCARKVKVENVKETVDASLPCRLKKTKSEPETKDRACSGRRKARSGHAKGMRSSKALK  1417
                C+R +K+ N++++V A     L    +E     +A + R+      ++  R S   +
Sbjct  519   RNDCSRTMKL-NLRDSVPAV--DSLLHQANEKNISPKASTWRKTPSRTSSRARRRSNDGE  575

Query  1418  TSACSHFKQQNDGKKLSSAERRLEVWG-SKKKRMARRATS  1534
              + CS  +   D       +R L+ WG +KK++ ARRA S
Sbjct  576   KTVCSLLQHTLDNTN-GITDRFLKGWGLTKKRQRARRAQS  614


 Score = 59.7 bits (143),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 47/74 (64%), Gaps = 9/74 (12%)
 Frame = +2

Query  2    RMLDLELPGDLYIDSEE------ENEVQVPKTPITNLWPVNESKLASFYPEGSSMSDSSC  163
            RMLDLE+P + YID+EE      EN V+ P   I  L P   SK+ +F    SS+S SSC
Sbjct  185  RMLDLEVPAEEYIDNEEGEPFEVENPVKRPNIMIAELQPQCYSKV-NF--GDSSISLSSC  241

Query  164  RKTNLLFDLNEPAQ  205
            R T+LLFDLNEP Q
Sbjct  242  RGTSLLFDLNEPVQ  255



>ref|XP_009604799.1| PREDICTED: uncharacterized protein LOC104099493 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009604800.1| PREDICTED: uncharacterized protein LOC104099493 isoform X2 [Nicotiana 
tomentosiformis]
Length=748

 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 106/241 (44%), Gaps = 29/241 (12%)
 Frame = +2

Query  872   TEQQKYDTERDLKAPISPENRECSPPRADSQETRLDRSIGLSKEGGDEEV-------SDR  1030
             +E      +RDL+AP+SPEN+ECSPPR DS    LD  IG S +    +        +DR
Sbjct  520   SEATMTSVDRDLEAPVSPENKECSPPRGDS----LDNPIGTSAQWCKRDRMSDYTGETDR  575

Query  1031  LAADTLVLILSSGVHKYSKTGIEQP-EVSIGCLDWFAGIASTLV-NDQNDLLRSGVHDCI  1204
              AA+TL+ I SS V   SKT   +P E S   L W A IA++L  N +N++         
Sbjct  576   AAAETLLFISSSAVKARSKTLTGEPSEASHDSLGWLADIAASLASNLENEVGSRSRSRSS  635

Query  1205  EARKKN---VANSKAKHCARKVKVENVKETVDASLPCRLKKTKSEPETKDRAC---SGRR  1366
               RK+N   V  ++    A  V +  + E + A    +L    +    + R     +  R
Sbjct  636   RPRKRNYQRVLQTEVLPAAASVPLRQLNEDLLAIEGLKLPANAASESGRCRKTLRKTSSR  695

Query  1367  KARSGHAKGMRSSKALKTSACSHFKQQNDGKKLSSAERRLEVWGSKKKRM-ARRATSTPL  1543
               R  H  G       +T +  H    ND  K S  ER    WG  K R   RRA S   
Sbjct  696   SRRWSHFGG-------RTGSLLHPHPSND--KHSVTERFWRDWGVTKGRQNGRRARSISS  746

Query  1544  F  1546
             F
Sbjct  747   F  747


 Score = 70.9 bits (172),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 113/265 (43%), Gaps = 75/265 (28%)
 Frame = +2

Query  2    RMLDLELPGDLYIDSE------EENEVQVPKTPITNLWPVNESKLASFYPEGSSMSDSSC  163
            +  DLELP + Y+D E      EE+ VQ P   I+ + P + SK+   YP  SS+S+S+ 
Sbjct  187  KTFDLELPAEEYVDIEDGEQCVEESPVQGPNILISEIQPQHSSKVNFVYPGDSSISNSTP  246

Query  164  RKTNLLFDLNEPAQpdesefpssssllesdssQHDIANQNQDLSEKEKSNADCSLPNKET  343
            R T LLFDLNEP Q    E    +S LES     +I+  +QDLS     +A+CS   KE 
Sbjct  247  RGTFLLFDLNEPIQ--PDETGCPNSALESMDVHEEISEMDQDLS--GTGHAECSTLKKE-  301

Query  344  LLDITVGEGHYDACKISPLLEKDKENGLLPCNTEAGGNRSDLNQFAEESCCLTPSNECKR  523
                                               GG  S+LN          PS+E   
Sbjct  302  -----------------------------------GGGVSNLN----------PSDEVSS  316

Query  524  -RRTLDSKISEKNCGEASIDVPSFV--SSLGKSINDS---------EEFPILVQALPC-I  664
              RTL        C + +   P FV  S  G   N S         +E P  VQALPC I
Sbjct  317  VERTL------LQCNQTASSPPRFVDKSRNGNKTNKSLLVSPRKKIKEIPFAVQALPCFI  370

Query  665  NDTSLNKCHKSSISKPRLSRRKFNL  739
             + SL+K  KSS+    L+  K +L
Sbjct  371  TNASLSKSPKSSVGNSNLTGMKSDL  395



>ref|XP_009604798.1| PREDICTED: uncharacterized protein LOC104099493 isoform X1 [Nicotiana 
tomentosiformis]
Length=758

 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 106/241 (44%), Gaps = 29/241 (12%)
 Frame = +2

Query  872   TEQQKYDTERDLKAPISPENRECSPPRADSQETRLDRSIGLSKEGGDEEV-------SDR  1030
             +E      +RDL+AP+SPEN+ECSPPR DS    LD  IG S +    +        +DR
Sbjct  530   SEATMTSVDRDLEAPVSPENKECSPPRGDS----LDNPIGTSAQWCKRDRMSDYTGETDR  585

Query  1031  LAADTLVLILSSGVHKYSKTGIEQP-EVSIGCLDWFAGIASTLV-NDQNDLLRSGVHDCI  1204
              AA+TL+ I SS V   SKT   +P E S   L W A IA++L  N +N++         
Sbjct  586   AAAETLLFISSSAVKARSKTLTGEPSEASHDSLGWLADIAASLASNLENEVGSRSRSRSS  645

Query  1205  EARKKN---VANSKAKHCARKVKVENVKETVDASLPCRLKKTKSEPETKDRAC---SGRR  1366
               RK+N   V  ++    A  V +  + E + A    +L    +    + R     +  R
Sbjct  646   RPRKRNYQRVLQTEVLPAAASVPLRQLNEDLLAIEGLKLPANAASESGRCRKTLRKTSSR  705

Query  1367  KARSGHAKGMRSSKALKTSACSHFKQQNDGKKLSSAERRLEVWGSKKKRM-ARRATSTPL  1543
               R  H  G       +T +  H    ND  K S  ER    WG  K R   RRA S   
Sbjct  706   SRRWSHFGG-------RTGSLLHPHPSND--KHSVTERFWRDWGVTKGRQNGRRARSISS  756

Query  1544  F  1546
             F
Sbjct  757   F  757


 Score = 70.9 bits (172),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 113/265 (43%), Gaps = 75/265 (28%)
 Frame = +2

Query  2    RMLDLELPGDLYIDSE------EENEVQVPKTPITNLWPVNESKLASFYPEGSSMSDSSC  163
            +  DLELP + Y+D E      EE+ VQ P   I+ + P + SK+   YP  SS+S+S+ 
Sbjct  197  KTFDLELPAEEYVDIEDGEQCVEESPVQGPNILISEIQPQHSSKVNFVYPGDSSISNSTP  256

Query  164  RKTNLLFDLNEPAQpdesefpssssllesdssQHDIANQNQDLSEKEKSNADCSLPNKET  343
            R T LLFDLNEP Q    E    +S LES     +I+  +QDLS     +A+CS   KE 
Sbjct  257  RGTFLLFDLNEPIQ--PDETGCPNSALESMDVHEEISEMDQDLS--GTGHAECSTLKKE-  311

Query  344  LLDITVGEGHYDACKISPLLEKDKENGLLPCNTEAGGNRSDLNQFAEESCCLTPSNECKR  523
                                               GG  S+LN          PS+E   
Sbjct  312  -----------------------------------GGGVSNLN----------PSDEVSS  326

Query  524  -RRTLDSKISEKNCGEASIDVPSFV--SSLGKSINDS---------EEFPILVQALPC-I  664
              RTL        C + +   P FV  S  G   N S         +E P  VQALPC I
Sbjct  327  VERTL------LQCNQTASSPPRFVDKSRNGNKTNKSLLVSPRKKIKEIPFAVQALPCFI  380

Query  665  NDTSLNKCHKSSISKPRLSRRKFNL  739
             + SL+K  KSS+    L+  K +L
Sbjct  381  TNASLSKSPKSSVGNSNLTGMKSDL  405



>ref|XP_006345167.1| PREDICTED: dentin sialophosphoprotein-like [Solanum tuberosum]
Length=798

 Score = 72.4 bits (176),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 100/226 (44%), Gaps = 48/226 (21%)
 Frame = +2

Query  5    MLDLELPGDLYIDSEE------ENEVQVPKTPITNLWPVNESKLASFYPEGSSMSDSSCR  166
            MLDLELP + Y+D E+      E+ VQ P   I+ L P + SK+    P   S+S+SS R
Sbjct  189  MLDLELPAEEYMDIEDGEQFVRESSVQGPNIVISELQPQDSSKVNFANPGDPSISNSSPR  248

Query  167  KTNLLFDLNEPAQpdesefpssssllesdssQHDIANQNQDLSEKEKSNADCSLPNKETL  346
             + LLFDLNEP Q    E    +S LES +   +I+N +QDLS     +ADCS   KE  
Sbjct  249  GSFLLFDLNEPIQ--LDETGYPNSALESVNIHEEISNMDQDLS--GTVHADCSTLEKEV-  303

Query  347  LDITVGEGHYDACKISPLLEKDKENGLLPCNTEAGGNRSDLNQFAEESCCLTPSNECKRR  526
                                              GG+ S++N   E S   T   +C + 
Sbjct  304  ---------------------------------TGGDISNMNSSDEVSSVETTLLQCNQT  330

Query  527  RTLDSKISEKNCGEASIDVPSFVSSLGKSINDSEEFPILVQALPCI  664
             +L     +K+     ID    VSS  K     +E P  VQALPC 
Sbjct  331  ASLSPGFVDKSHNGTRIDKSLLVSSRKK----MKEIPFAVQALPCF  372


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 59/116 (51%), Gaps = 18/116 (16%)
 Frame = +2

Query  818   TDSSGKYEAADSNLDLIPTEQQKYDTERDLKAPISPENRECSPPRADSQETRLDRSIGLS  997
             T SSG  EA  + +D            RDL+API PEN+E SPPR DS +  + +S+  S
Sbjct  532   TFSSGHSEATMTPVD------------RDLEAPIGPENKEYSPPRGDSLDKTIGKSVQWS  579

Query  998   K---EGGDEEVSDRLAADTLVLILSS-GVHKYSKTGIEQPEVSIGCLDWFAGIAST  1153
             K          +DR AA+ L+ I SS G  K +K G    E S   L W A IA++
Sbjct  580   KIYHMNDHAGKTDRAAAEILLFISSSRGNSKTAKGG--PSEASHDTLGWLADIATS  633



>ref|XP_009795938.1| PREDICTED: uncharacterized protein LOC104242560 [Nicotiana sylvestris]
 ref|XP_009795945.1| PREDICTED: uncharacterized protein LOC104242560 [Nicotiana sylvestris]
Length=751

 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 71/239 (30%), Positives = 103/239 (43%), Gaps = 22/239 (9%)
 Frame = +2

Query  872   TEQQKYDTERDLKAPISPENRECSPPRADSQETRLDRSIGLSKEGGDEEV-------SDR  1030
             +E      +R+L+AP+SPEN+ECSPPR DS    LD  IG S +             +DR
Sbjct  522   SEATMTSVDRELEAPVSPENKECSPPRGDS----LDNPIGTSAQWSKRNRMSDYTGETDR  577

Query  1031  LAADTLVLILSSGVHKYSKTGIEQP-EVSIGCLDWFAGIASTLV----NDQNDLLRSGVH  1195
              AA+TL+ I SS V   SKT   +P E S   L W A IA++L     N+     R+   
Sbjct  578   AAAETLLFISSSAVKARSKTLTGEPSEASHDSLGWLADIATSLASNLENEVGSRSRARSS  637

Query  1196  DCIEARKKNVANSKAKHCARKVKVENVKETVDASLPCRLKKTKSEPETKDRACSGRRKAR  1375
                  + + V  ++    A  V +  + E +   L     K  +   ++   C  R+  R
Sbjct  638   RPRRRKYQKVLQTEVLPAAASVPLHQLNEDL---LTIGGLKLPANAASESGPC--RKTLR  692

Query  1376  SGHAKGMRSSKALKTSACSHFKQQNDGKKLSSAERRLEVWGSKKKRM-ARRATSTPLFS  1549
                ++  + S     + CS     +   K    ER  + WG  K R   RRA S   FS
Sbjct  693   KTSSRSRKWSHIGGRTTCSRLHPNSCNNKQGITERFCKGWGVTKGRQNGRRARSISTFS  751


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 94/290 (32%), Positives = 129/290 (44%), Gaps = 64/290 (22%)
 Frame = +2

Query  2    RMLDLELPGDLYIDSE------EENEVQVPKTPITNLWPVNESKLASFYPEGSSMSDSSC  163
            R  DLELP + Y+D E      EE+ VQ P   I+ L P + SK+    P  SS+S+S+ 
Sbjct  187  RTFDLELPAEEYVDIEDREHCVEESPVQGPNILISELQPQHSSKVNFVNPGDSSISNSTP  246

Query  164  RKTNLLFDLNEPAQpdesefpssssllesdssQHDIANQNQDLSEKEKSNADCSLPNKET  343
            R T LLFDLNEP Q    E    +S LES +   +I++ +QDLS      A+CS   KE 
Sbjct  247  RGTFLLFDLNEPIQ--TDETGCPNSALESMNVHEEISDIDQDLSGTVY--AECSTLKKEA  302

Query  344  LLDITVGEGHYDACKISPLLEKDK----ENGLLPCNTEAGGNRSDLNQFAEESCCLTPSN  511
                           +S L   DK    E   L CN  A    S   +F ++S   T +N
Sbjct  303  -----------TGADVSNLNSSDKVSSVERTCLQCNQTA----SSPPRFVDKSRNGTKTN  347

Query  512  ECKRRRTLDSKISEKNCGEASIDVPSFVSSLGKSINDSEEFPILVQALPC-INDTSLNKC  688
            +                        S + S  K I   +E P  VQALPC I++ SL+K 
Sbjct  348  K------------------------SLLVSPRKKI---KEIPFAVQALPCFISNASLSKS  380

Query  689  HKSSISKPRLSRRK---FNLNKIKP----AGSRSTRDADSVNTSGPNDKV  817
             KSS+    L+ +    +N +   P    +GS   +  D+  TSG  D V
Sbjct  381  PKSSVGNSSLTGKNSDLYNSSASSPTSGASGSCLMKCGDNDPTSGQTDAV  430



>ref|XP_004235976.1| PREDICTED: uncharacterized protein LOC101257550 isoform X1 [Solanum 
lycopersicum]
Length=803

 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 72/227 (32%), Positives = 96/227 (42%), Gaps = 49/227 (22%)
 Frame = +2

Query  2    RMLDLELPGDLYIDSEE------ENEVQVPKTPITNLWPVNESKLASFYPEGSSMSDSSC  163
            RMLDLELP + Y+D E+      E+ VQ P   I+ L P + SK+    P  SS+S+SS 
Sbjct  193  RMLDLELPAEEYMDIEDGEQFVRESFVQGPNIVISELQPQDSSKVNFANPGDSSISNSSP  252

Query  164  RKTNLLFDLNEPAQpdesefpssssllesdssQHDIANQNQDLSEKEKSNADCSLPNKET  343
            R + LLFDLNEP Q    E    +  LES +    I+N +QDLS     +A+CS   KE 
Sbjct  253  RGSFLLFDLNEPIQ--LDETEYPNYALESVNIHEGISNMDQDLS--GTVHAECSTLKKEA  308

Query  344  LLDITVGEGHYDACKISPLLEKDKENGLLPCNTEAGGNRSDLNQFAEESCCLTPSNECKR  523
                                               GG+ S++N   E S       +C +
Sbjct  309  ----------------------------------TGGDISNMNSSDEVSSVEMTLPQCNQ  334

Query  524  RRTLDSKISEKNCGEASIDVPSFVSSLGKSINDSEEFPILVQALPCI  664
              +      +K+      D    VSS  K      E P  VQALPC 
Sbjct  335  TASSSPGFVDKSNNGTRTDKSLLVSSRKKM-----EIPFAVQALPCF  376



>ref|XP_004235977.1| PREDICTED: uncharacterized protein LOC101257550 isoform X2 [Solanum 
lycopersicum]
Length=798

 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 72/227 (32%), Positives = 96/227 (42%), Gaps = 49/227 (22%)
 Frame = +2

Query  2    RMLDLELPGDLYIDSEE------ENEVQVPKTPITNLWPVNESKLASFYPEGSSMSDSSC  163
            RMLDLELP + Y+D E+      E+ VQ P   I+ L P + SK+    P  SS+S+SS 
Sbjct  188  RMLDLELPAEEYMDIEDGEQFVRESFVQGPNIVISELQPQDSSKVNFANPGDSSISNSSP  247

Query  164  RKTNLLFDLNEPAQpdesefpssssllesdssQHDIANQNQDLSEKEKSNADCSLPNKET  343
            R + LLFDLNEP Q    E    +  LES +    I+N +QDLS     +A+CS   KE 
Sbjct  248  RGSFLLFDLNEPIQ--LDETEYPNYALESVNIHEGISNMDQDLS--GTVHAECSTLKKEA  303

Query  344  LLDITVGEGHYDACKISPLLEKDKENGLLPCNTEAGGNRSDLNQFAEESCCLTPSNECKR  523
                                               GG+ S++N   E S       +C +
Sbjct  304  ----------------------------------TGGDISNMNSSDEVSSVEMTLPQCNQ  329

Query  524  RRTLDSKISEKNCGEASIDVPSFVSSLGKSINDSEEFPILVQALPCI  664
              +      +K+      D    VSS  K      E P  VQALPC 
Sbjct  330  TASSSPGFVDKSNNGTRTDKSLLVSSRKKM-----EIPFAVQALPCF  371



>emb|CDP19451.1| unnamed protein product [Coffea canephora]
Length=847

 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 60/109 (55%), Gaps = 9/109 (8%)
 Frame = +2

Query  833   KYEAADSNLDLIPTEQQKYDTERDLKAPISPENRECSPPRADSQETRLDRSIGLSKEGGD  1012
             ++   D     + TE     T  DL+APISP+N+E SPPR +S++ + +   G  KE   
Sbjct  558   RFSNTDQKYSQVLTETTAVGT--DLQAPISPDNKEHSPPREESEDNQSENHEGTVKE---  612

Query  1013  EEVSDRLAADTLVLILSSGVHKYSKTGIEQ-PEVSIGCLDWFAGIASTL  1156
                 DR+AA+ ++ I+ SG  +     + Q  EVS  CL WFAGIA T+
Sbjct  613   ---LDRIAAEVILSIMFSGKKQSLNASMSQLLEVSADCLGWFAGIACTV  658



>ref|XP_011087293.1| PREDICTED: uncharacterized protein LOC105168834 [Sesamum indicum]
 ref|XP_011087294.1| PREDICTED: uncharacterized protein LOC105168834 [Sesamum indicum]
 ref|XP_011087295.1| PREDICTED: uncharacterized protein LOC105168834 [Sesamum indicum]
Length=658

 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 62/216 (29%), Positives = 92/216 (43%), Gaps = 38/216 (18%)
 Frame = +2

Query  902   DLKAPISPENRECSPPRADSQETRLDRSIGLS--KEGGDEEVSDRLAADTLVLILSSGVH  1075
             DL+ P+SPEN ECSPPR  S++ +L+    LS  +EG      D +AA TLV I    V 
Sbjct  422   DLEGPVSPENEECSPPRGKSEDIQLETPPLLSEQREGEQSMKLDTIAAQTLVTISCCRVQ  481

Query  1076  KYSKTGIEQPEVSI-GCLDWFAGIASTLVNDQNDLLRSGVHDCIEARKKNVANSKAKHCA  1252
             +Y K  I +P  S    L WFA I S+  +D  + +          + +N     A + +
Sbjct  482   EYMKAAIPEPLESFRNHLYWFAEIVSSTRDDLENKV---------TKLQNNTTDTAVNLS  532

Query  1253  RKVKVENVKETVDASLPCRLKKTKSEPETKDRACSGRRKARSGHAKGMRSSKALKTSACS  1432
               VK E  KET D S                       ++  GH +G R  K ++T    
Sbjct  533   HVVKKE--KETGDLS----------------------SRSMKGHPRGTRQQKDIRTEVLP  568

Query  1433  HFKQQNDGKKLSSAERRLEVWGSKKKRMARRATSTP  1540
                  + G  L + E    +  SK+K   ++  + P
Sbjct  569   SLSSLSKG--LHTIEGCPRIGSSKRKNSGKKTHAKP  602



>ref|XP_010678438.1| PREDICTED: uncharacterized protein LOC104893989 [Beta vulgaris 
subsp. vulgaris]
Length=762

 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 86/159 (54%), Gaps = 20/159 (13%)
 Frame = +2

Query  884   KYDTERDLKAPISPENRECSPPRADSQETRLDRSIGLSKEGGD--EEVSDRLAADTLVLI  1057
             K  +E DL+APISPE  E SPPR DS+E +       S+E G+  EE++ ++AA+ ++ I
Sbjct  508   KTPSEVDLEAPISPEVEERSPPRGDSEENQ-------SEEDGNHFEELA-KIAAEAIISI  559

Query  1058  LSSGVHKYSKTG-IEQPEVSIGC-LDWFAGIASTLVND-QNDLL------RSGVHDCIEA  1210
               S    Y+ +  +++ E S G  L+WFAG+  +  +D +ND         S + D  EA
Sbjct  560   SLSKSPSYTASMCLQKCEPSDGGNLEWFAGLICSFSSDPENDFEVINCKNTSNIDD-YEA  618

Query  1211  RKKNVANSKAKHCARKVKVENVKETVDASLPCRLKKTKS  1327
                 +  +K +    ++ V+N  +T    LPC+ +K ++
Sbjct  619   MTLELTETKVEDYCCRISVQNASDTCSMLLPCQTRKGRT  657



>ref|XP_010106635.1| hypothetical protein L484_015234 [Morus notabilis]
 gb|EXC11014.1| hypothetical protein L484_015234 [Morus notabilis]
Length=972

 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 76/165 (46%), Gaps = 19/165 (12%)
 Frame = +2

Query  872   TEQQKYDTERDLKAPISPENRECSPPRADSQETRLDRSI-GLSKEGGDEEVS-DRLAADT  1045
             T++     E DL AP SPEN+E SPPR +S E + +  +  L +EG D++    ++AA+ 
Sbjct  677   TQKSSLLAEIDLDAPASPENKESSPPRGESDENQAETPVLLLGQEGADQQDELAKIAAEA  736

Query  1046  LV-LILSSGVHKYSKTGIEQPEVS-IGCLDWFAGIASTLV---------------NDQND  1174
             L+ +          K   E+ EVS +  L WFAG+ S++                N+  +
Sbjct  737   LISISSFKSSTSLQKPSFERLEVSLLDSLHWFAGVVSSVASNPESEFGLVLTDKNNNNFE  796

Query  1175  LLRSGVHDCIEARKKNVANSKAKHCARKVKVENVKETVDASLPCR  1309
              L     D  EA    +  +K + C  K  V   +ET  +S P +
Sbjct  797   ELFPDEMDYFEAMTLKLTEAKLEECCYKTNVSKEEETGTSSSPSQ  841



>gb|KEH31979.1| DUF863 family protein [Medicago truncatula]
Length=832

 Score = 57.0 bits (136),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 65/146 (45%), Gaps = 33/146 (23%)
 Frame = +2

Query  902   DLKAPISPENRECSPPRADSQETRLDRSIGLSKEG--GDEEVSDRLAADTLVLILSSGVH  1075
             DL AP SPEN+ECSPPR +S E +L      +++     +E   R AA+ L+ I      
Sbjct  553   DLHAPSSPENKECSPPRGESDENQLVTPFQFAEQEDLHVQEEQTRYAAEALISISGFAPQ  612

Query  1076  K--------YSKTGIEQPEVSIGCLDWFAGIASTL---------------VNDQNDLLRS  1186
             K         SK+ +  P      L WFAGI ST                VN+  + L S
Sbjct  613   KDIQMTPCSPSKSFVNSP------LHWFAGIVSTTMYHPENDNETDFNGKVNNLEEFL-S  665

Query  1187  GVHDCIEARKKNVANSKAK-HCARKV  1261
             G  D  E    N+ ++KA  HC + +
Sbjct  666   GEMDYFEFMTLNLTDTKAPDHCCKSM  691



>ref|XP_004508706.1| PREDICTED: uncharacterized protein LOC101495925 [Cicer arietinum]
Length=536

 Score = 56.2 bits (134),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 57/119 (48%), Gaps = 18/119 (15%)
 Frame = +2

Query  839   EAADSNLDLIPTEQQKYDTERDLKAPISPENRECSPPRADSQETRLDRSIGLSKEGGDEE  1018
             +  D N  +I  E    D   D  AP SPEN+ECSPPR +S E +L      +     E+
Sbjct  253   DIIDLNSSMIEDENMPIDV--DFHAPASPENKECSPPRGESDENQLVTPFQFA-----EQ  305

Query  1019  VSDRLAADTLVLILSSGVHKYSKTGIEQPEVSI------GCLDWFAGIASTLV-NDQND  1174
                R+AA+ LV I  SG    S+  I+    S         L WFAGI ST V N +ND
Sbjct  306   EQTRIAAEALVSI--SGF--VSQKDIQMTTCSSSESFMNSPLHWFAGIVSTTVDNPEND  360



>ref|XP_008374587.1| PREDICTED: uncharacterized protein LOC103437859 [Malus domestica]
 ref|XP_008374588.1| PREDICTED: uncharacterized protein LOC103437859 [Malus domestica]
 ref|XP_008374589.1| PREDICTED: uncharacterized protein LOC103437859 [Malus domestica]
Length=985

 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/167 (29%), Positives = 68/167 (41%), Gaps = 53/167 (32%)
 Frame = +2

Query  905   LKAPISPENRECSPPRADSQETRLDRSIGLSKEGG-------------------------  1009
             L+AP SPEN+ECSPPR +S E +++    L  +                           
Sbjct  673   LEAPASPENKECSPPRGESDENQVETPFLLPGQNDPENNERFPPVGESDQNQVETPFRLS  732

Query  1010  -----------------DEEVSDRLAADTLVLILSSGVHKYSKTGIEQP-EVSIGCLDWF  1135
                              DE   D  AA++LV I SS +H    +  ++P E S   L WF
Sbjct  733   GQEDPGNNVCPLPILEFDENQVDSTAAESLVSISSSKLHTCIVSTTDKPLETSCASLCWF  792

Query  1136  AGIASTLVNDQ---------NDLLRSGVHDCIEARKKNVANSKAKHC  1249
             AGIAS++V  Q          +LL  G+ D  E    N+  +K + C
Sbjct  793   AGIASSVVGGQENEGRVVISEELLPDGM-DYFEVMSLNLTETKVEEC  838



>ref|XP_008239884.1| PREDICTED: uncharacterized protein LOC103338458 [Prunus mume]
Length=797

 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 72/264 (27%), Positives = 105/264 (40%), Gaps = 61/264 (23%)
 Frame = +2

Query  926   ENRECSPPRADSQETRLDRSIGLSKEGGD----EEVSDRLAADTLVLILSSGVHK-YSKT  1090
             EN+EC  P  +S E +++R    S + G     EE   R AA++L  I SSG+H   ++T
Sbjct  529   ENKECFVPTRESDENQIERPFPSSGDSGQKVDLEEELIRTAAESLASISSSGLHTCIART  588

Query  1091  GIEQPEVSIGCLDWFAGIASTLVND---------QNDLLRSGVHDCIEARKKNVANSKAK  1243
               +  + S   L WFAGIAS +V             DLL  G+ D  E    N+  +K +
Sbjct  589   TNKLLKTSCDSLHWFAGIASAVVGGPENKAGVVMSEDLLPDGM-DYFEVMTLNLTETKVE  647

Query  1244  HCARKVKVENVKETVDAS-----------------------LPCRLKKTKSE--------  1330
              C  +      +ET   S                       LP     ++ E        
Sbjct  648   ECRCRSNSHKDEETGTTSSPNQPRKGRKRRGRQRKDFQSEILPSLASLSRYEVTEDLQTL  707

Query  1331  ----PETKDRACSG--RRKARSGHAKGMRSSKALKTSAC------SHFKQQNDGKKLSSA  1474
                   + DR  +G  R  A+ G A+G R S ++ TS        S  KQ     +    
Sbjct  708   GGLVESSGDRLETGSARYAAKLGLARGRRRS-SISTSTVTENTLESLLKQIGSKSQFGKE  766

Query  1475  ERRLEVWG--SKKKRMARRATSTP  1540
             ERRL  WG  ++++R  R   S P
Sbjct  767   ERRLIAWGEVTRRRRGQRFPVSKP  790



>ref|XP_007037462.1| Uncharacterized protein isoform 6 [Theobroma cacao]
 gb|EOY21963.1| Uncharacterized protein isoform 6 [Theobroma cacao]
Length=954

 Score = 55.1 bits (131),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 8/105 (8%)
 Frame = +2

Query  863   LIPTEQQKYDTERDLKAPISPENRECSPPRADSQETRLDRSIGLS-KEGGD-EEVSDRLA  1036
             LIP+    +  E DL+ P SPEN+E SPPR +S E +L+  +  S +E GD +E   R+A
Sbjct  662   LIPS----HSNEIDLEPPASPENKERSPPRGESDENQLETPLVSSGQEDGDLQEALVRIA  717

Query  1037  ADTLVLILSSGVHKYSKTGIEQPEVSI--GCLDWFAGIASTLVND  1165
             A+ +V I SS +    ++   +P  +     L WFA +AS++V+D
Sbjct  718   AEAIVSISSSEIQTCKESTSCEPFKASWNNSLYWFARVASSVVDD  762



>ref|XP_007037459.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY21960.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=928

 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 8/105 (8%)
 Frame = +2

Query  863   LIPTEQQKYDTERDLKAPISPENRECSPPRADSQETRLDRSIGLS-KEGGD-EEVSDRLA  1036
             LIP+    +  E DL+ P SPEN+E SPPR +S E +L+  +  S +E GD +E   R+A
Sbjct  636   LIPS----HSNEIDLEPPASPENKERSPPRGESDENQLETPLVSSGQEDGDLQEALVRIA  691

Query  1037  ADTLVLILSSGVHKYSKTGIEQPEVSI--GCLDWFAGIASTLVND  1165
             A+ +V I SS +    ++   +P  +     L WFA +AS++V+D
Sbjct  692   AEAIVSISSSEIQTCKESTSCEPFKASWNNSLYWFARVASSVVDD  736



>gb|KDP31303.1| hypothetical protein JCGZ_11679 [Jatropha curcas]
Length=891

 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +2

Query  893   TERDLKAPISPENRECSPPRADSQETRLDRSIGL-SKEGGDEEVSDRLAADTLVLILSSG  1069
             TE +L+AP SPEN+E SPPR +S E +L+    L  +E    E    +AA+ +V I  S 
Sbjct  612   TEINLQAPASPENKESSPPRGESDENQLEMLCQLPGQENNLLEDLITVAAEAIVSISLSQ  671

Query  1070  VHKYSKTGIEQPEVS--IGCLDWFAGIASTLVND  1165
             V  Y +T   +P  +     L WFA IAS +V+D
Sbjct  672   VQGYKETEAFKPCAASQSDSLYWFAKIASNIVDD  705


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 84/297 (28%), Positives = 117/297 (39%), Gaps = 66/297 (22%)
 Frame = +2

Query  2    RMLDLELPGDLYIDSEEE----NEVQVPKTPITNLWPVNESKLAS-------------FY  130
            ++LDLELP D YIDSE+E     E   P  P  ++  + +    S              +
Sbjct  194  KILDLELPADEYIDSEQEESLAGETVPPDVPGYHMKSIADDVQKSEVEPSRGIDDGNLVF  253

Query  131  PEGSSMSDSSCRKTNLLFDLNEPAQpdesefpssssllesdssQHDIANQNQDLSEKEKS  310
             +G +   S  RKTN L DLNEP + +E     S+  L       D  N  QDLS K   
Sbjct  254  QDGDTRPASFSRKTNCLADLNEPIKLEEETNLESNVFLGPVPC--DRENTCQDLSGKR--  309

Query  311  NADCSLPNKETLLDITVGEGHYDACKISPLLEKDKENGLLPC---NTEAGGNRSDLNQFA  481
            N+D  +  K+T+      E        S +L+ +K   +  C   N EAG + S +N F 
Sbjct  310  NSDLRVQLKQTIQGTQTREDPEIPEAFSNVLDLEKSKSMPECLSDNDEAGQSSSGMNSFP  369

Query  482  EESCCLTPSNEC------------------------KRRRTLDSK---ISEKNCGEASI-  577
            E  C  T S+                          K+R+  D +   + +  C   S  
Sbjct  370  ERICTETLSSSSEDDEIEQDHDISTSHLNLNRRMPKKKRKDFDLESYPVVKAACTATSSE  429

Query  578  -----DVPSFVSSLGKSINDSEEFPILVQALPCINDTSLNKCHKSSISKPRLSRRKF  733
                 DV +  SS  K   D    PI VQALPC N         S++   R S+ KF
Sbjct  430  LIPLDDVMTCDSSWKKHTRDFVRAPIAVQALPCFN---------SAVRLKRRSKPKF  477



>ref|XP_007037460.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOY21961.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=1016

 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 8/105 (8%)
 Frame = +2

Query  863   LIPTEQQKYDTERDLKAPISPENRECSPPRADSQETRLDRSIGLS-KEGGD-EEVSDRLA  1036
             LIP+    +  E DL+ P SPEN+E SPPR +S E +L+  +  S +E GD +E   R+A
Sbjct  724   LIPS----HSNEIDLEPPASPENKERSPPRGESDENQLETPLVSSGQEDGDLQEALVRIA  779

Query  1037  ADTLVLILSSGVHKYSKTGIEQPEVSI--GCLDWFAGIASTLVND  1165
             A+ +V I SS +    ++   +P  +     L WFA +AS++V+D
Sbjct  780   AEAIVSISSSEIQTCKESTSCEPFKASWNNSLYWFARVASSVVDD  824



>ref|XP_007037457.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY21958.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1025

 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 8/105 (8%)
 Frame = +2

Query  863   LIPTEQQKYDTERDLKAPISPENRECSPPRADSQETRLDRSIGLS-KEGGD-EEVSDRLA  1036
             LIP+    +  E DL+ P SPEN+E SPPR +S E +L+  +  S +E GD +E   R+A
Sbjct  733   LIPS----HSNEIDLEPPASPENKERSPPRGESDENQLETPLVSSGQEDGDLQEALVRIA  788

Query  1037  ADTLVLILSSGVHKYSKTGIEQPEVSI--GCLDWFAGIASTLVND  1165
             A+ +V I SS +    ++   +P  +     L WFA +AS++V+D
Sbjct  789   AEAIVSISSSEIQTCKESTSCEPFKASWNNSLYWFARVASSVVDD  833



>ref|XP_007037461.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 gb|EOY21962.1| Uncharacterized protein isoform 5 [Theobroma cacao]
Length=999

 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 8/105 (8%)
 Frame = +2

Query  863   LIPTEQQKYDTERDLKAPISPENRECSPPRADSQETRLDRSIGLS-KEGGD-EEVSDRLA  1036
             LIP+    +  E DL+ P SPEN+E SPPR +S E +L+  +  S +E GD +E   R+A
Sbjct  707   LIPS----HSNEIDLEPPASPENKERSPPRGESDENQLETPLVSSGQEDGDLQEALVRIA  762

Query  1037  ADTLVLILSSGVHKYSKTGIEQPEVSI--GCLDWFAGIASTLVND  1165
             A+ +V I SS +    ++   +P  +     L WFA +AS++V+D
Sbjct  763   AEAIVSISSSEIQTCKESTSCEPFKASWNNSLYWFARVASSVVDD  807



>ref|XP_007037458.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY21959.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=990

 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 8/105 (8%)
 Frame = +2

Query  863   LIPTEQQKYDTERDLKAPISPENRECSPPRADSQETRLDRSIGLS-KEGGD-EEVSDRLA  1036
             LIP+    +  E DL+ P SPEN+E SPPR +S E +L+  +  S +E GD +E   R+A
Sbjct  698   LIPS----HSNEIDLEPPASPENKERSPPRGESDENQLETPLVSSGQEDGDLQEALVRIA  753

Query  1037  ADTLVLILSSGVHKYSKTGIEQPEVSI--GCLDWFAGIASTLVND  1165
             A+ +V I SS +    ++   +P  +     L WFA +AS++V+D
Sbjct  754   AEAIVSISSSEIQTCKESTSCEPFKASWNNSLYWFARVASSVVDD  798



>ref|XP_007138150.1| hypothetical protein PHAVU_009G184400g [Phaseolus vulgaris]
 ref|XP_007138151.1| hypothetical protein PHAVU_009G184400g [Phaseolus vulgaris]
 gb|ESW10144.1| hypothetical protein PHAVU_009G184400g [Phaseolus vulgaris]
 gb|ESW10145.1| hypothetical protein PHAVU_009G184400g [Phaseolus vulgaris]
Length=930

 Score = 53.9 bits (128),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 61/119 (51%), Gaps = 13/119 (11%)
 Frame = +2

Query  833   KYEAADSNLDLIPTEQQKYDTERDLKAPISPENRECSPPRADSQETRLDRSIGLSKEGGD  1012
             K+ +   +L+    E +    + DL+AP SPEN+ECSPPR +S E +L+      +E  D
Sbjct  624   KHSSGIIDLNSCTNEDENMPVDIDLQAPQSPENKECSPPRGESDENQLEMLQLAGQEQED  683

Query  1013  EEVSD---RLAADTLVLILSSGVHKYSKTGIEQP------EVSIGCLDWFAGIASTLVN  1162
              E  +   R+AA+ L+ I S  V   +  GI+          S   L W AGI ST+V+
Sbjct  684   PEAREEQTRIAAEALISI-SEAV---TYNGIQMTNCPSSEPSSSSSLHWLAGIVSTVVD  738



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6668976352545