BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18360_g1_i2 len=374 path=[2541:0-48 2590:49-235 2777:236-373]

Length=374
                                                                      Score     E

ref|XP_009617279.1|  PREDICTED: pentatricopeptide repeat-containi...    230   7e-68   
ref|XP_004233766.1|  PREDICTED: pentatricopeptide repeat-containi...    229   1e-67   
ref|XP_006363206.1|  PREDICTED: pentatricopeptide repeat-containi...    226   2e-66   
ref|XP_009762740.1|  PREDICTED: pentatricopeptide repeat-containi...    222   4e-65   
ref|XP_011100606.1|  PREDICTED: pentatricopeptide repeat-containi...    217   3e-63   
gb|KDP43143.1|  hypothetical protein JCGZ_26676                         206   3e-63   
emb|CBI27235.3|  unnamed protein product                                215   4e-63   
ref|XP_002275546.2|  PREDICTED: pentatricopeptide repeat-containi...    215   1e-62   Vitis vinifera
ref|XP_006468579.1|  PREDICTED: pentatricopeptide repeat-containi...    214   2e-62   
gb|KDO77215.1|  hypothetical protein CISIN_1g002772mg                   214   2e-62   
emb|CDP18169.1|  unnamed protein product                                214   3e-62   
ref|XP_006448595.1|  hypothetical protein CICLE_v10014221mg             214   4e-62   
ref|XP_008223593.1|  PREDICTED: pentatricopeptide repeat-containi...    214   4e-62   
ref|XP_007223989.1|  hypothetical protein PRUPE_ppa014757mg             213   5e-62   
gb|EYU35938.1|  hypothetical protein MIMGU_mgv1a001219mg                212   1e-61   
ref|XP_007040995.1|  Tetratricopeptide repeat (TPR)-like superfam...    212   2e-61   
ref|XP_010100626.1|  hypothetical protein L484_011557                   212   2e-61   
ref|XP_004487896.1|  PREDICTED: pentatricopeptide repeat-containi...    211   2e-61   
ref|XP_004295518.1|  PREDICTED: pentatricopeptide repeat-containi...    210   6e-61   
ref|XP_007138858.1|  hypothetical protein PHAVU_009G243400g             210   7e-61   
ref|XP_010516359.1|  PREDICTED: pentatricopeptide repeat-containi...    209   2e-60   
ref|XP_010504671.1|  PREDICTED: pentatricopeptide repeat-containi...    209   2e-60   
ref|XP_010051803.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    209   2e-60   
emb|CAB66100.1|  putative protein                                       208   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427617.1|  PREDICTED: pentatricopeptide repeat-containi...    208   3e-60   
ref|NP_191302.2|  protein ORGANELLE TRANSCRIPT PROCESSING 84            208   3e-60   Arabidopsis thaliana [mouse-ear cress]
gb|AAP40452.1|  unknown protein                                         208   3e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KDP43137.1|  hypothetical protein JCGZ_26670                         207   1e-59   
emb|CDX72037.1|  BnaC08g28370D                                          206   2e-59   
ref|XP_010684483.1|  PREDICTED: pentatricopeptide repeat-containi...    206   2e-59   
ref|XP_006402877.1|  hypothetical protein EUTSA_v10005782mg             206   3e-59   
gb|KHN47734.1|  Pentatricopeptide repeat-containing protein, chlo...    204   5e-59   
ref|XP_002878152.1|  hypothetical protein ARALYDRAFT_486188             205   6e-59   
ref|XP_009116445.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    205   6e-59   
ref|XP_006597752.1|  PREDICTED: pentatricopeptide repeat-containi...    204   6e-59   
ref|XP_011008234.1|  PREDICTED: pentatricopeptide repeat-containi...    204   7e-59   
ref|XP_002299387.2|  pentatricopeptide repeat-containing family p...    204   9e-59   Populus trichocarpa [western balsam poplar]
ref|XP_009340266.1|  PREDICTED: pentatricopeptide repeat-containi...    204   1e-58   
ref|XP_010260746.1|  PREDICTED: pentatricopeptide repeat-containi...    204   1e-58   
ref|XP_010260747.1|  PREDICTED: pentatricopeptide repeat-containi...    204   2e-58   
emb|CDY06106.1|  BnaA09g36740D                                          202   4e-58   
ref|XP_006290586.1|  hypothetical protein CARUB_v10016675mg             202   4e-58   
gb|KFK34979.1|  hypothetical protein AALP_AA5G218700                    202   4e-58   
ref|XP_008383264.1|  PREDICTED: pentatricopeptide repeat-containi...    202   6e-58   
gb|AES65119.2|  PPR containing plant protein                            202   8e-58   
ref|XP_010529313.1|  PREDICTED: pentatricopeptide repeat-containi...    200   3e-57   
ref|XP_010920366.1|  PREDICTED: pentatricopeptide repeat-containi...    195   2e-55   
ref|XP_008781925.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    187   2e-52   
ref|XP_009413784.1|  PREDICTED: pentatricopeptide repeat-containi...    182   5e-51   
gb|KCW75636.1|  hypothetical protein EUGRSUZ_D00005                     182   5e-51   
ref|XP_003580964.1|  PREDICTED: pentatricopeptide repeat-containi...    163   5e-44   
ref|XP_004965512.1|  PREDICTED: pentatricopeptide repeat-containi...    162   6e-44   
dbj|BAJ91522.1|  predicted protein                                      162   2e-43   
ref|XP_008649170.1|  PREDICTED: pentatricopeptide repeat-containi...    159   2e-42   
ref|XP_008809450.1|  PREDICTED: pentatricopeptide repeat-containi...    155   3e-41   
ref|XP_003594868.1|  Pentatricopeptide repeat protein                   152   5e-40   
ref|XP_010089431.1|  hypothetical protein L484_002732                   150   6e-40   
ref|XP_010920084.1|  PREDICTED: pentatricopeptide repeat-containi...    150   1e-39   
emb|CAN63659.1|  hypothetical protein VITISV_008415                     147   3e-38   Vitis vinifera
gb|ADE76509.1|  unknown                                                 140   4e-38   
ref|XP_011087742.1|  PREDICTED: putative pentatricopeptide repeat...    144   1e-37   
gb|ADE76547.1|  unknown                                                 137   2e-37   
ref|XP_010088958.1|  hypothetical protein L484_013537                   139   3e-37   
ref|XP_004292932.1|  PREDICTED: pentatricopeptide repeat-containi...    144   3e-37   
ref|XP_008387907.1|  PREDICTED: pentatricopeptide repeat-containi...    144   4e-37   
ref|XP_009400341.1|  PREDICTED: pentatricopeptide repeat-containi...    144   4e-37   
ref|XP_010241184.1|  PREDICTED: putative pentatricopeptide repeat...    142   5e-37   
ref|XP_008233430.1|  PREDICTED: pentatricopeptide repeat-containi...    139   7e-37   
ref|XP_002284744.1|  PREDICTED: pentatricopeptide repeat-containi...    142   8e-37   Vitis vinifera
ref|XP_008456075.1|  PREDICTED: pentatricopeptide repeat-containi...    142   1e-36   
ref|XP_004156102.1|  PREDICTED: putative pentatricopeptide repeat...    141   1e-36   
ref|XP_008356987.1|  PREDICTED: putative pentatricopeptide repeat...    141   1e-36   
ref|XP_009800009.1|  PREDICTED: pentatricopeptide repeat-containi...    141   1e-36   
ref|XP_009616454.1|  PREDICTED: pentatricopeptide repeat-containi...    141   1e-36   
ref|XP_008787969.1|  PREDICTED: pentatricopeptide repeat-containi...    141   1e-36   
ref|XP_008379537.1|  PREDICTED: putative pentatricopeptide repeat...    140   1e-36   
ref|XP_007017888.1|  Pentatricopeptide repeat (PPR) superfamily p...    142   1e-36   
ref|XP_009334614.1|  PREDICTED: pentatricopeptide repeat-containi...    142   2e-36   
gb|KHN24542.1|  Pentatricopeptide repeat-containing protein             140   2e-36   
ref|XP_004140278.1|  PREDICTED: pentatricopeptide repeat-containi...    141   2e-36   
ref|XP_010255012.1|  PREDICTED: pentatricopeptide repeat-containi...    141   2e-36   
ref|XP_007152607.1|  hypothetical protein PHAVU_004G144300g             140   2e-36   
gb|AEX12049.1|  hypothetical protein 0_18789_01                         133   2e-36   
gb|AEX12062.1|  hypothetical protein 0_18789_01                         133   2e-36   
ref|XP_008783875.1|  PREDICTED: pentatricopeptide repeat-containi...    140   2e-36   
gb|ACE80748.1|  pentatricopeptide repeat protein                        132   3e-36   Lepidogyna hodgsoniae
ref|XP_010923157.1|  PREDICTED: pentatricopeptide repeat-containi...    142   3e-36   
gb|EYU26534.1|  hypothetical protein MIMGU_mgv1a024701mg                139   3e-36   
ref|XP_010257783.1|  PREDICTED: putative pentatricopeptide repeat...    141   4e-36   
ref|XP_003549191.1|  PREDICTED: pentatricopeptide repeat-containi...    140   4e-36   
ref|XP_010915642.1|  PREDICTED: pentatricopeptide repeat-containi...    140   4e-36   
gb|AEX12054.1|  hypothetical protein 0_18789_01                         132   5e-36   
ref|XP_004511479.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    140   6e-36   
ref|XP_004515286.1|  PREDICTED: pentatricopeptide repeat-containi...    140   6e-36   
gb|ACE80749.1|  pentatricopeptide repeat protein                        131   7e-36   Lepidogyna hodgsoniae
ref|XP_010685014.1|  PREDICTED: pentatricopeptide repeat-containi...    139   1e-35   
ref|XP_010657692.1|  PREDICTED: pentatricopeptide repeat-containi...    139   1e-35   
ref|XP_007218862.1|  hypothetical protein PRUPE_ppa002838mg             138   1e-35   
gb|KHN30207.1|  Pentatricopeptide repeat-containing protein             138   1e-35   
ref|XP_004231338.2|  PREDICTED: pentatricopeptide repeat-containi...    138   1e-35   
ref|XP_008221208.1|  PREDICTED: pentatricopeptide repeat-containi...    139   1e-35   
gb|AEX12061.1|  hypothetical protein 0_18789_01                         130   1e-35   
emb|CBI23791.3|  unnamed protein product                                138   1e-35   
gb|AEX12050.1|  hypothetical protein 0_18789_01                         130   1e-35   
ref|XP_004308755.1|  PREDICTED: pentatricopeptide repeat-containi...    138   1e-35   
emb|CBI24272.3|  unnamed protein product                                139   2e-35   
gb|ABK26521.1|  unknown                                                 135   2e-35   Picea sitchensis
ref|XP_009615068.1|  PREDICTED: pentatricopeptide repeat-containi...    140   2e-35   
ref|XP_010242634.1|  PREDICTED: pentatricopeptide repeat-containi...    140   2e-35   
ref|XP_007150279.1|  hypothetical protein PHAVU_005G140500g             138   2e-35   
ref|XP_010278235.1|  PREDICTED: pentatricopeptide repeat-containi...    138   2e-35   
ref|XP_007051907.1|  Tetratricopeptide repeat-like superfamily pr...    139   2e-35   
ref|XP_010278229.1|  PREDICTED: pentatricopeptide repeat-containi...    138   2e-35   
ref|XP_007227203.1|  hypothetical protein PRUPE_ppa019251mg             138   2e-35   
ref|XP_009781104.1|  PREDICTED: putative pentatricopeptide repeat...    137   3e-35   
emb|CDP07349.1|  unnamed protein product                                139   3e-35   
ref|XP_009800457.1|  PREDICTED: pentatricopeptide repeat-containi...    139   3e-35   
ref|XP_002265253.2|  PREDICTED: pentatricopeptide repeat-containi...    139   3e-35   Vitis vinifera
emb|CDO97555.1|  unnamed protein product                                136   4e-35   
ref|XP_010647496.1|  PREDICTED: pentatricopeptide repeat-containi...    131   4e-35   
ref|XP_009408591.1|  PREDICTED: pentatricopeptide repeat-containi...    137   4e-35   
emb|CAN61868.1|  hypothetical protein VITISV_002466                     135   4e-35   Vitis vinifera
ref|XP_010090626.1|  hypothetical protein L484_003942                   138   4e-35   
gb|ACE80799.1|  pentatricopeptide repeat protein                        129   5e-35   Isoetes engelmannii
gb|KHN43676.1|  Pentatricopeptide repeat-containing protein             134   5e-35   
ref|XP_006653119.1|  PREDICTED: pentatricopeptide repeat-containi...    137   5e-35   
ref|XP_010271776.1|  PREDICTED: pentatricopeptide repeat-containi...    138   6e-35   
ref|XP_003542017.1|  PREDICTED: pentatricopeptide repeat-containi...    137   6e-35   
gb|KDP31879.1|  hypothetical protein JCGZ_12340                         136   6e-35   
ref|XP_009413734.1|  PREDICTED: putative pentatricopeptide repeat...    137   6e-35   
ref|XP_008645807.1|  PREDICTED: pentatricopeptide repeat-containi...    138   7e-35   
ref|XP_010928853.1|  PREDICTED: putative pentatricopeptide repeat...    135   7e-35   
ref|XP_009781103.1|  PREDICTED: putative pentatricopeptide repeat...    137   7e-35   
ref|XP_002269269.2|  PREDICTED: pentatricopeptide repeat-containi...    137   7e-35   Vitis vinifera
gb|ABR17838.1|  unknown                                                 137   8e-35   Picea sitchensis
ref|XP_010098084.1|  hypothetical protein L484_026217                   136   9e-35   
ref|XP_010260583.1|  PREDICTED: pentatricopeptide repeat-containi...    137   9e-35   
gb|ABN08240.1|  Tetratricopeptide-like helical                          136   1e-34   Medicago truncatula
ref|XP_008350050.1|  PREDICTED: pentatricopeptide repeat-containi...    132   1e-34   
ref|XP_011016756.1|  PREDICTED: pentatricopeptide repeat-containi...    132   1e-34   
ref|XP_006651199.1|  PREDICTED: pentatricopeptide repeat-containi...    135   1e-34   
ref|XP_003622422.1|  Pentatricopeptide repeat-containing protein        137   1e-34   
ref|XP_003623854.1|  Pentatricopeptide repeat-containing protein        137   1e-34   
ref|XP_008782896.1|  PREDICTED: putative pentatricopeptide repeat...    135   1e-34   
ref|XP_008797547.1|  PREDICTED: pentatricopeptide repeat-containi...    137   1e-34   
gb|AES80072.2|  pentatricopeptide (PPR) repeat protein                  137   1e-34   
gb|AEB39780.1|  pentatricopeptide repeat protein 45                     137   1e-34   
gb|ADE77782.1|  unknown                                                 129   1e-34   
ref|XP_010680447.1|  PREDICTED: pentatricopeptide repeat-containi...    136   1e-34   
gb|ADE77588.1|  unknown                                                 132   1e-34   
ref|XP_009402626.1|  PREDICTED: pentatricopeptide repeat-containi...    136   2e-34   
ref|XP_009402026.1|  PREDICTED: pentatricopeptide repeat-containi...    135   2e-34   
gb|KDP31422.1|  hypothetical protein JCGZ_11798                         134   2e-34   
gb|KHN27741.1|  Pentatricopeptide repeat-containing protein, chlo...    133   2e-34   
ref|XP_010939958.1|  PREDICTED: pentatricopeptide repeat-containi...    135   2e-34   
emb|CDP02463.1|  unnamed protein product                                136   2e-34   
gb|EAZ44271.1|  hypothetical protein OsJ_28890                          135   2e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002438491.1|  hypothetical protein SORBIDRAFT_10g020540          136   2e-34   Sorghum bicolor [broomcorn]
ref|XP_010097473.1|  hypothetical protein L484_024678                   136   2e-34   
emb|CBI25911.3|  unnamed protein product                                131   2e-34   
ref|XP_004987089.1|  PREDICTED: pentatricopeptide repeat-containi...    135   2e-34   
emb|CBI27939.3|  unnamed protein product                                136   2e-34   
ref|XP_010426426.1|  PREDICTED: pentatricopeptide repeat-containi...    136   2e-34   
ref|XP_004959800.1|  PREDICTED: pentatricopeptide repeat-containi...    136   3e-34   
ref|NP_001062888.2|  Os09g0327200                                       135   3e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010261461.1|  PREDICTED: putative pentatricopeptide repeat...    135   3e-34   
gb|AEB39776.1|  pentatricopeptide repeat protein 78                     136   3e-34   
ref|XP_009621680.1|  PREDICTED: putative pentatricopeptide repeat...    135   3e-34   
ref|XP_010927442.1|  PREDICTED: pentatricopeptide repeat-containi...    135   3e-34   
ref|XP_006587447.1|  PREDICTED: pentatricopeptide repeat-containi...    134   3e-34   
ref|XP_010087050.1|  hypothetical protein L484_012294                   135   3e-34   
ref|XP_006829281.1|  hypothetical protein AMTR_s00001p00272900          135   3e-34   
ref|XP_011032628.1|  PREDICTED: pentatricopeptide repeat-containi...    136   3e-34   
ref|XP_004961436.1|  PREDICTED: pentatricopeptide repeat-containi...    135   3e-34   
ref|XP_009421324.1|  PREDICTED: pentatricopeptide repeat-containi...    136   3e-34   
dbj|BAD23598.1|  putative pentatricopeptide (PPR) repeat-containi...    135   4e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004961435.1|  PREDICTED: pentatricopeptide repeat-containi...    135   4e-34   
gb|EAZ08632.1|  hypothetical protein OsI_30906                          135   4e-34   Oryza sativa Indica Group [Indian rice]
gb|KEH26815.1|  pentatricopeptide (PPR) repeat protein                  135   4e-34   
ref|XP_002463110.1|  hypothetical protein SORBIDRAFT_02g037960          135   4e-34   Sorghum bicolor [broomcorn]
ref|XP_008652556.1|  PREDICTED: pentatricopeptide repeat-containi...    135   4e-34   
ref|XP_002441185.1|  hypothetical protein SORBIDRAFT_09g021880          135   4e-34   Sorghum bicolor [broomcorn]
ref|XP_002263297.1|  PREDICTED: pentatricopeptide repeat-containi...    135   4e-34   Vitis vinifera
emb|CBI38763.3|  unnamed protein product                                135   4e-34   
gb|AEB39781.1|  pentatricopeptide repeat protein 79                     135   4e-34   
ref|XP_008802335.1|  PREDICTED: pentatricopeptide repeat-containi...    134   4e-34   
ref|XP_010104766.1|  hypothetical protein L484_021456                   135   5e-34   
ref|XP_004961923.1|  PREDICTED: pentatricopeptide repeat-containi...    135   5e-34   
ref|XP_004301257.1|  PREDICTED: pentatricopeptide repeat-containi...    135   5e-34   
ref|XP_006290593.1|  hypothetical protein CARUB_v10016682mg             135   5e-34   
ref|XP_008804906.1|  PREDICTED: pentatricopeptide repeat-containi...    133   6e-34   
ref|XP_010661558.1|  PREDICTED: putative pentatricopeptide repeat...    135   6e-34   
ref|XP_010250314.1|  PREDICTED: putative pentatricopeptide repeat...    134   6e-34   
ref|XP_010279265.1|  PREDICTED: pentatricopeptide repeat-containi...    135   7e-34   
ref|XP_003633097.1|  PREDICTED: pentatricopeptide repeat-containi...    135   7e-34   
ref|XP_001775099.1|  predicted protein                                  135   7e-34   
ref|XP_011079980.1|  PREDICTED: pentatricopeptide repeat-containi...    135   7e-34   
ref|XP_010942245.1|  PREDICTED: putative pentatricopeptide repeat...    134   7e-34   
ref|XP_002462229.1|  hypothetical protein SORBIDRAFT_02g022150          134   7e-34   Sorghum bicolor [broomcorn]
ref|XP_003563798.2|  PREDICTED: pentatricopeptide repeat-containi...    134   7e-34   
tpg|DAA61049.1|  TPA: hypothetical protein ZEAMMB73_995105              135   7e-34   
ref|XP_010653819.1|  PREDICTED: putative pentatricopeptide repeat...    134   8e-34   
emb|CBI31710.3|  unnamed protein product                                133   9e-34   
ref|XP_009417773.1|  PREDICTED: pentatricopeptide repeat-containi...    133   1e-33   
dbj|BAP69206.1|  pentatricopeptide repeat protein                       135   1e-33   
emb|CAN74558.1|  hypothetical protein VITISV_014799                     131   1e-33   Vitis vinifera
ref|XP_009391885.1|  PREDICTED: putative pentatricopeptide repeat...    133   1e-33   
ref|XP_001785902.1|  predicted protein                                  134   1e-33   
ref|XP_007015858.1|  Tetratricopeptide repeat (TPR)-like superfam...    134   1e-33   
ref|XP_008785452.1|  PREDICTED: pentatricopeptide repeat-containi...    135   1e-33   
ref|XP_007029874.1|  Tetratricopeptide repeat (TPR)-like superfam...    134   1e-33   
ref|XP_002306801.2|  pentatricopeptide repeat-containing family p...    134   1e-33   Populus trichocarpa [western balsam poplar]
ref|XP_008779860.1|  PREDICTED: pentatricopeptide repeat-containi...    133   1e-33   
dbj|BAC83258.1|  pentatricopeptide (PPR) repeat-containing protei...    134   1e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004234215.1|  PREDICTED: putative pentatricopeptide repeat...    133   1e-33   
ref|XP_010515261.1|  PREDICTED: pentatricopeptide repeat-containi...    134   1e-33   
gb|KGN59332.1|  hypothetical protein Csa_3G810560                       132   1e-33   
gb|KDP25707.1|  hypothetical protein JCGZ_24008                         133   1e-33   
ref|XP_010465240.1|  PREDICTED: putative pentatricopeptide repeat...    132   1e-33   
gb|EYU24286.1|  hypothetical protein MIMGU_mgv1a025107mg                133   1e-33   
ref|XP_009149759.1|  PREDICTED: pentatricopeptide repeat-containi...    134   1e-33   
ref|XP_003545909.1|  PREDICTED: pentatricopeptide repeat-containi...    134   1e-33   
gb|ACE80747.1|  pentatricopeptide repeat protein                        125   2e-33   Lepidogyna hodgsoniae
ref|XP_009347240.1|  PREDICTED: pentatricopeptide repeat-containi...    133   2e-33   
ref|XP_008653295.1|  PREDICTED: pentatricopeptide repeat-containi...    134   2e-33   
ref|XP_002324099.1|  hypothetical protein POPTR_0017s12720g             133   2e-33   Populus trichocarpa [western balsam poplar]
gb|EAY92839.1|  hypothetical protein OsI_14639                          133   2e-33   Oryza sativa Indica Group [Indian rice]
gb|KDP40584.1|  hypothetical protein JCGZ_24583                         134   2e-33   
ref|XP_007036762.1|  Tetratricopeptide repeat (TPR)-like superfam...    133   2e-33   
gb|EEE67500.1|  hypothetical protein OsJ_24934                          134   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009348084.1|  PREDICTED: pentatricopeptide repeat-containi...    133   2e-33   
gb|EAY98286.1|  hypothetical protein OsI_20194                          134   2e-33   Oryza sativa Indica Group [Indian rice]
ref|NP_001055727.1|  Os05g0455900                                       134   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002977518.1|  hypothetical protein SELMODRAFT_107192             132   2e-33   
ref|XP_011085507.1|  PREDICTED: pentatricopeptide repeat-containi...    133   2e-33   
ref|XP_011029025.1|  PREDICTED: pentatricopeptide repeat-containi...    133   2e-33   
ref|XP_008653491.1|  PREDICTED: pentatricopeptide repeat-containi...    132   2e-33   
ref|XP_010255945.1|  PREDICTED: pentatricopeptide repeat-containi...    133   2e-33   
ref|XP_004161498.1|  PREDICTED: putative pentatricopeptide repeat...    132   2e-33   
ref|XP_001774871.1|  predicted protein                                  134   2e-33   
gb|EMT13464.1|  Pentatricopeptide repeat-containing protein             133   2e-33   
gb|KCW57176.1|  hypothetical protein EUGRSUZ_I02804                     131   2e-33   
gb|KHN44977.1|  Putative pentatricopeptide repeat-containing protein    132   2e-33   
ref|XP_002268784.1|  PREDICTED: pentatricopeptide repeat-containi...    132   2e-33   Vitis vinifera
ref|XP_006342434.1|  PREDICTED: pentatricopeptide repeat-containi...    132   2e-33   
ref|XP_007028899.1|  Pentatricopeptide repeat superfamily protein       133   3e-33   
ref|XP_011005831.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    131   3e-33   
emb|CDY08114.1|  BnaA06g16120D                                          133   3e-33   
ref|XP_008454056.1|  PREDICTED: pentatricopeptide repeat-containi...    132   3e-33   
gb|KCW57075.1|  hypothetical protein EUGRSUZ_I02728                     131   3e-33   
ref|XP_010503566.1|  PREDICTED: pentatricopeptide repeat-containi...    133   3e-33   
ref|XP_010239337.1|  PREDICTED: pentatricopeptide repeat-containi...    133   3e-33   
emb|CBI29893.3|  unnamed protein product                                133   3e-33   
emb|CAE01289.2|  OSJNBa0020P07.6                                        133   3e-33   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66009.1|  H0613H07.7                                             133   3e-33   Oryza sativa [red rice]
ref|NP_001052059.2|  Os04g0118700                                       133   3e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010272254.1|  PREDICTED: pentatricopeptide repeat-containi...    133   3e-33   
ref|XP_010113218.1|  hypothetical protein L484_000327                   131   3e-33   
ref|XP_008348710.1|  PREDICTED: pentatricopeptide repeat-containi...    128   3e-33   
ref|XP_002322694.1|  pentatricopeptide repeat-containing family p...    131   3e-33   Populus trichocarpa [western balsam poplar]
ref|XP_002284011.2|  PREDICTED: pentatricopeptide repeat-containi...    133   3e-33   Vitis vinifera
ref|XP_004253182.1|  PREDICTED: pentatricopeptide repeat-containi...    132   3e-33   
ref|XP_004136743.1|  PREDICTED: putative pentatricopeptide repeat...    132   3e-33   
ref|XP_008811370.1|  PREDICTED: pentatricopeptide repeat-containi...    132   3e-33   
ref|XP_008443096.1|  PREDICTED: putative pentatricopeptide repeat...    132   3e-33   
ref|XP_004301849.1|  PREDICTED: pentatricopeptide repeat-containi...    132   3e-33   
emb|CBI36131.3|  unnamed protein product                                131   3e-33   
emb|CAN82070.1|  hypothetical protein VITISV_010010                     133   3e-33   Vitis vinifera
gb|KDP23741.1|  hypothetical protein JCGZ_23574                         133   4e-33   
ref|XP_011028950.1|  PREDICTED: pentatricopeptide repeat-containi...    133   4e-33   
gb|KDO57236.1|  hypothetical protein CISIN_1g006705mg                   132   4e-33   
gb|EYU28903.1|  hypothetical protein MIMGU_mgv1a018770mg                132   4e-33   
ref|XP_006490046.1|  PREDICTED: putative pentatricopeptide repeat...    132   4e-33   
ref|XP_010091655.1|  hypothetical protein L484_026509                   132   4e-33   
emb|CDX69260.1|  BnaC01g01930D                                          131   4e-33   
ref|XP_008804267.1|  PREDICTED: putative pentatricopeptide repeat...    132   4e-33   
ref|XP_010265006.1|  PREDICTED: putative pentatricopeptide repeat...    132   4e-33   
ref|XP_002301973.2|  pentatricopeptide repeat-containing family p...    132   4e-33   Populus trichocarpa [western balsam poplar]
ref|XP_002283735.1|  PREDICTED: pentatricopeptide repeat-containi...    130   4e-33   Vitis vinifera
ref|XP_008790066.1|  PREDICTED: pentatricopeptide repeat-containi...    133   4e-33   
gb|ADE77505.1|  unknown                                                 130   4e-33   
ref|XP_010536431.1|  PREDICTED: pentatricopeptide repeat-containi...    132   4e-33   
ref|XP_002468177.1|  hypothetical protein SORBIDRAFT_01g041070          131   4e-33   
ref|XP_004490231.1|  PREDICTED: pentatricopeptide repeat-containi...    132   4e-33   
ref|XP_011033281.1|  PREDICTED: putative pentatricopeptide repeat...    131   4e-33   
ref|XP_003541343.1|  PREDICTED: putative pentatricopeptide repeat...    132   4e-33   
ref|XP_010924258.1|  PREDICTED: pentatricopeptide repeat-containi...    131   4e-33   
ref|XP_006658718.1|  PREDICTED: pentatricopeptide repeat-containi...    132   5e-33   
ref|XP_010272256.1|  PREDICTED: pentatricopeptide repeat-containi...    133   5e-33   
ref|XP_008241553.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    132   5e-33   
ref|XP_007203614.1|  hypothetical protein PRUPE_ppa002292mg             132   5e-33   
emb|CAN84077.1|  hypothetical protein VITISV_032319                     126   5e-33   
ref|XP_010057662.1|  PREDICTED: putative pentatricopeptide repeat...    131   5e-33   
ref|XP_008389362.1|  PREDICTED: putative pentatricopeptide repeat...    132   5e-33   
ref|XP_002975120.1|  hypothetical protein SELMODRAFT_102603             130   5e-33   
ref|XP_004288921.1|  PREDICTED: pentatricopeptide repeat-containi...    126   5e-33   
ref|XP_010030239.1|  PREDICTED: pentatricopeptide repeat-containi...    132   5e-33   
gb|EMT12987.1|  hypothetical protein F775_06874                         131   5e-33   
ref|NP_001141725.1|  hypothetical protein                               131   6e-33   
ref|XP_010087106.1|  hypothetical protein L484_012535                   132   6e-33   
ref|XP_007138310.1|  hypothetical protein PHAVU_009G197900g             132   6e-33   
ref|XP_011083605.1|  PREDICTED: pentatricopeptide repeat-containi...    131   6e-33   
ref|XP_010030937.1|  PREDICTED: pentatricopeptide repeat-containi...    131   6e-33   
ref|XP_010246245.1|  PREDICTED: pentatricopeptide repeat-containi...    130   6e-33   
gb|EYU19608.1|  hypothetical protein MIMGU_mgv1a003193mg                130   7e-33   
ref|XP_010521175.1|  PREDICTED: pentatricopeptide repeat-containi...    132   7e-33   
ref|XP_006465624.1|  PREDICTED: pentatricopeptide repeat-containi...    131   7e-33   
ref|XP_008383032.1|  PREDICTED: pentatricopeptide repeat-containi...    131   7e-33   
ref|XP_006421479.1|  hypothetical protein CICLE_v10006760mg             131   7e-33   
ref|XP_002284545.2|  PREDICTED: putative pentatricopeptide repeat...    131   7e-33   
gb|EMT21127.1|  hypothetical protein F775_09199                         132   7e-33   
ref|XP_011035853.1|  PREDICTED: pentatricopeptide repeat-containi...    131   7e-33   
ref|XP_006466653.1|  PREDICTED: pentatricopeptide repeat-containi...    131   8e-33   
ref|XP_004488881.1|  PREDICTED: pentatricopeptide repeat-containi...    131   8e-33   
ref|XP_006660540.1|  PREDICTED: pentatricopeptide repeat-containi...    131   8e-33   
ref|XP_007213606.1|  hypothetical protein PRUPE_ppa002332mg             131   8e-33   
ref|XP_002972228.1|  hypothetical protein SELMODRAFT_97343              129   8e-33   
ref|XP_006435103.1|  hypothetical protein CICLE_v10000322mg             132   8e-33   
ref|XP_002984141.1|  hypothetical protein SELMODRAFT_119895             129   8e-33   
gb|KCW90262.1|  hypothetical protein EUGRSUZ_A02412                     131   8e-33   
emb|CDP20634.1|  unnamed protein product                                127   9e-33   
ref|XP_003610927.1|  Pentatricopeptide repeat-containing protein        132   9e-33   
ref|XP_003632466.2|  PREDICTED: pentatricopeptide repeat-containi...    131   9e-33   
gb|KDP41925.1|  hypothetical protein JCGZ_26943                         131   9e-33   
ref|XP_011003872.1|  PREDICTED: pentatricopeptide repeat-containi...    132   9e-33   
gb|KDO84746.1|  hypothetical protein CISIN_1g0038681mg                  129   1e-32   
ref|XP_006351408.1|  PREDICTED: pentatricopeptide repeat-containi...    129   1e-32   
ref|XP_008226293.1|  PREDICTED: pentatricopeptide repeat-containi...    131   1e-32   
gb|KDP21121.1|  hypothetical protein JCGZ_21592                         125   1e-32   
gb|AES93885.2|  pentatricopeptide (PPR) repeat protein                  132   1e-32   
ref|XP_004290638.1|  PREDICTED: pentatricopeptide repeat-containi...    132   1e-32   
emb|CBI29860.3|  unnamed protein product                                130   1e-32   
ref|XP_009632022.1|  PREDICTED: pentatricopeptide repeat-containi...    131   1e-32   
ref|XP_004503293.1|  PREDICTED: pentatricopeptide repeat-containi...    131   1e-32   
ref|XP_006366638.1|  PREDICTED: putative pentatricopeptide repeat...    130   1e-32   
ref|XP_004956593.1|  PREDICTED: pentatricopeptide repeat-containi...    131   1e-32   
gb|KDP32439.1|  hypothetical protein JCGZ_13364                         131   1e-32   
ref|XP_007149271.1|  hypothetical protein PHAVU_005G056200g             129   1e-32   
ref|XP_004288922.1|  PREDICTED: putative pentatricopeptide repeat...    132   1e-32   
ref|XP_006425825.1|  hypothetical protein CICLE_v10024955mg             131   1e-32   
ref|XP_002302000.2|  pentatricopeptide repeat-containing family p...    131   1e-32   
ref|XP_010908711.1|  PREDICTED: pentatricopeptide repeat-containi...    130   1e-32   
ref|XP_011087320.1|  PREDICTED: pentatricopeptide repeat-containi...    132   1e-32   
ref|XP_011087319.1|  PREDICTED: pentatricopeptide repeat-containi...    132   1e-32   
ref|XP_007210320.1|  hypothetical protein PRUPE_ppa002162mg             130   1e-32   
ref|XP_009356472.1|  PREDICTED: putative pentatricopeptide repeat...    131   1e-32   
gb|EMT07616.1|  hypothetical protein F775_11615                         129   1e-32   
ref|XP_010062302.1|  PREDICTED: pentatricopeptide repeat-containi...    130   1e-32   
ref|XP_006841418.1|  hypothetical protein AMTR_s00003p00032470          131   1e-32   
ref|XP_011087317.1|  PREDICTED: pentatricopeptide repeat-containi...    132   1e-32   
ref|XP_010518772.1|  PREDICTED: pentatricopeptide repeat-containi...    131   1e-32   
ref|XP_009771285.1|  PREDICTED: putative pentatricopeptide repeat...    130   1e-32   
ref|XP_007148792.1|  hypothetical protein PHAVU_005G014700g             131   1e-32   
ref|XP_008813688.1|  PREDICTED: pentatricopeptide repeat-containi...    130   1e-32   
ref|XP_008240171.1|  PREDICTED: pentatricopeptide repeat-containi...    131   2e-32   
gb|AFG65812.1|  hypothetical protein 2_9455_01                          123   2e-32   
ref|XP_009414778.1|  PREDICTED: pentatricopeptide repeat-containi...    130   2e-32   
ref|XP_006369868.1|  hypothetical protein POPTR_0001s34330g             130   2e-32   
gb|EYU25211.1|  hypothetical protein MIMGU_mgv1a001568mg                131   2e-32   
ref|XP_010241372.1|  PREDICTED: pentatricopeptide repeat-containi...    130   2e-32   
gb|KDO70236.1|  hypothetical protein CISIN_1g006388mg                   130   2e-32   
gb|KDP35384.1|  hypothetical protein JCGZ_10368                         130   2e-32   
ref|XP_010501153.1|  PREDICTED: putative pentatricopeptide repeat...    130   2e-32   
gb|EMT01370.1|  hypothetical protein F775_14713                         130   2e-32   
emb|CBI21289.3|  unnamed protein product                                129   2e-32   
emb|CAN62238.1|  hypothetical protein VITISV_014689                     131   2e-32   
ref|XP_006371982.1|  hypothetical protein POPTR_0018s06910g             131   2e-32   
emb|CBI31172.3|  unnamed protein product                                130   2e-32   
ref|XP_010052618.1|  PREDICTED: pentatricopeptide repeat-containi...    131   2e-32   
ref|XP_006349730.1|  PREDICTED: pentatricopeptide repeat-containi...    131   2e-32   
ref|XP_010067671.1|  PREDICTED: pentatricopeptide repeat-containi...    130   2e-32   
ref|XP_010646134.1|  PREDICTED: pentatricopeptide repeat-containi...    131   2e-32   
ref|XP_010942915.1|  PREDICTED: pentatricopeptide repeat-containi...    130   2e-32   
ref|XP_010243611.1|  PREDICTED: pentatricopeptide repeat-containi...    130   2e-32   
ref|XP_011088090.1|  PREDICTED: putative pentatricopeptide repeat...    129   2e-32   
gb|KCW65849.1|  hypothetical protein EUGRSUZ_G03194                     130   2e-32   
ref|XP_008783966.1|  PREDICTED: pentatricopeptide repeat-containi...    131   2e-32   
ref|XP_008338226.1|  PREDICTED: pentatricopeptide repeat-containi...    130   2e-32   
ref|XP_007025201.1|  Pentatricopeptide repeat (PPR) superfamily p...    130   2e-32   
gb|ABE80149.1|  Tetratricopeptide-like helical                          130   2e-32   
ref|XP_002960895.1|  hypothetical protein SELMODRAFT_74842              131   2e-32   
ref|XP_010646133.1|  PREDICTED: pentatricopeptide repeat-containi...    131   2e-32   
ref|XP_009605003.1|  PREDICTED: pentatricopeptide repeat-containi...    129   2e-32   
ref|XP_009771284.1|  PREDICTED: putative pentatricopeptide repeat...    130   2e-32   
ref|XP_010906775.1|  PREDICTED: putative pentatricopeptide repeat...    130   2e-32   
emb|CBI15551.3|  unnamed protein product                                130   2e-32   
ref|XP_003526349.1|  PREDICTED: pentatricopeptide repeat-containi...    130   2e-32   
ref|XP_010512750.1|  PREDICTED: pentatricopeptide repeat-containi...    131   2e-32   
ref|XP_002882843.1|  pentatricopeptide repeat-containing protein        129   2e-32   
ref|XP_006655248.1|  PREDICTED: pentatricopeptide repeat-containi...    129   2e-32   
ref|XP_010468855.1|  PREDICTED: pentatricopeptide repeat-containi...    131   2e-32   
ref|XP_010939340.1|  PREDICTED: pentatricopeptide repeat-containi...    130   2e-32   
gb|KDO56926.1|  hypothetical protein CISIN_1g0431421mg                  127   2e-32   
ref|XP_009800948.1|  PREDICTED: pentatricopeptide repeat-containi...    130   3e-32   
gb|KFK43240.1|  hypothetical protein AALP_AA1G098000                    129   3e-32   
ref|XP_010532658.1|  PREDICTED: putative pentatricopeptide repeat...    130   3e-32   
ref|XP_009790955.1|  PREDICTED: pentatricopeptide repeat-containi...    129   3e-32   
emb|CDY36110.1|  BnaA08g19380D                                          128   3e-32   
ref|XP_003634283.1|  PREDICTED: pentatricopeptide repeat-containi...    130   3e-32   
ref|XP_004167293.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    130   3e-32   
ref|XP_006437829.1|  hypothetical protein CICLE_v10033304mg             130   3e-32   
gb|KCW53694.1|  hypothetical protein EUGRSUZ_J02956                     128   3e-32   
ref|XP_007226966.1|  hypothetical protein PRUPE_ppa025241mg             130   3e-32   
gb|AFW77609.1|  hypothetical protein ZEAMMB73_798524                    129   3e-32   
ref|XP_004147314.1|  PREDICTED: putative pentatricopeptide repeat...    130   3e-32   
ref|XP_008649501.1|  PREDICTED: pentatricopeptide repeat-containi...    129   3e-32   
ref|XP_008811403.1|  PREDICTED: pentatricopeptide repeat-containi...    130   3e-32   
ref|XP_006473595.1|  PREDICTED: pentatricopeptide repeat-containi...    130   3e-32   
ref|XP_010920594.1|  PREDICTED: pentatricopeptide repeat-containi...    130   3e-32   
ref|XP_003631084.1|  Pentatricopeptide repeat-containing protein        130   3e-32   
ref|XP_008810189.1|  PREDICTED: pentatricopeptide repeat-containi...    130   3e-32   
gb|EAY96962.1|  hypothetical protein OsI_18881                          130   3e-32   
ref|XP_002876719.1|  pentatricopeptide repeat-containing protein        130   3e-32   
ref|XP_006838936.1|  hypothetical protein AMTR_s00002p00270380          130   3e-32   
ref|XP_004247331.1|  PREDICTED: pentatricopeptide repeat-containi...    130   3e-32   
ref|XP_010916743.1|  PREDICTED: pentatricopeptide repeat-containi...    130   4e-32   
ref|XP_003560023.1|  PREDICTED: pentatricopeptide repeat-containi...    130   4e-32   
ref|XP_004965520.1|  PREDICTED: pentatricopeptide repeat-containi...    129   4e-32   
ref|XP_010255496.1|  PREDICTED: pentatricopeptide repeat-containi...    130   4e-32   
emb|CAN70248.1|  hypothetical protein VITISV_032008                     129   4e-32   
gb|AFG65800.1|  hypothetical protein 2_9455_01                          122   4e-32   
dbj|BAJ89940.1|  predicted protein                                      129   4e-32   
gb|EPS69874.1|  hypothetical protein M569_04890                         130   4e-32   
ref|XP_009398744.1|  PREDICTED: putative pentatricopeptide repeat...    129   4e-32   
ref|XP_010660692.1|  PREDICTED: pentatricopeptide repeat-containi...    129   4e-32   
gb|KDP36860.1|  hypothetical protein JCGZ_08151                         129   4e-32   
ref|XP_006299919.1|  hypothetical protein CARUB_v10016128mg             129   4e-32   
ref|XP_010326767.1|  PREDICTED: putative pentatricopeptide repeat...    129   4e-32   
ref|XP_008358264.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    128   4e-32   
gb|AFG65804.1|  hypothetical protein 2_9455_01                          122   4e-32   
gb|KDP29911.1|  hypothetical protein JCGZ_18480                         124   4e-32   
ref|XP_008801174.1|  PREDICTED: pentatricopeptide repeat-containi...    129   4e-32   
ref|XP_002980348.1|  hypothetical protein SELMODRAFT_112174             130   4e-32   
ref|XP_002962744.1|  hypothetical protein SELMODRAFT_78092              130   4e-32   
ref|XP_003570784.1|  PREDICTED: putative pentatricopeptide repeat...    129   4e-32   
gb|KHN26409.1|  Pentatricopeptide repeat-containing protein             130   4e-32   
gb|AEW08424.1|  hypothetical protein 2_9455_01                          121   5e-32   
ref|XP_008649898.1|  PREDICTED: pentatricopeptide repeat-containi...    130   5e-32   
gb|KEH20172.1|  PPR containing plant-like protein                       129   5e-32   
gb|KHN12612.1|  Pentatricopeptide repeat-containing protein             126   5e-32   
gb|AET03186.2|  PPR containing plant-like protein                       129   5e-32   
ref|XP_010662778.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    130   5e-32   
gb|AFG65806.1|  hypothetical protein 2_9455_01                          121   5e-32   
ref|XP_006648309.1|  PREDICTED: pentatricopeptide repeat-containi...    130   5e-32   
ref|XP_003628710.1|  Pentatricopeptide repeat-containing protein        129   5e-32   
gb|AEB39774.1|  pentatricopeptide repeat protein 65                     129   5e-32   
ref|XP_008787226.1|  PREDICTED: pentatricopeptide repeat-containi...    129   5e-32   
ref|XP_011078866.1|  PREDICTED: putative pentatricopeptide repeat...    129   5e-32   
ref|XP_008243776.1|  PREDICTED: putative pentatricopeptide repeat...    129   5e-32   
ref|XP_010653129.1|  PREDICTED: putative pentatricopeptide repeat...    129   5e-32   
emb|CBI39605.3|  unnamed protein product                                128   5e-32   
ref|XP_006445136.1|  hypothetical protein CICLE_v10018890mg             129   5e-32   
ref|XP_002321443.2|  hypothetical protein POPTR_0015s02060g             130   5e-32   
ref|XP_002992002.1|  hypothetical protein SELMODRAFT_134463             128   5e-32   
ref|XP_010033857.1|  PREDICTED: pentatricopeptide repeat-containi...    128   5e-32   
gb|KDO86035.1|  hypothetical protein CISIN_1g003584mg                   129   5e-32   
ref|XP_009356059.1|  PREDICTED: pentatricopeptide repeat-containi...    129   5e-32   
ref|XP_011085291.1|  PREDICTED: pentatricopeptide repeat-containi...    129   5e-32   
ref|XP_010915655.1|  PREDICTED: pentatricopeptide repeat-containi...    129   5e-32   
ref|XP_010418549.1|  PREDICTED: pentatricopeptide repeat-containi...    129   5e-32   
gb|EYU18955.1|  hypothetical protein MIMGU_mgv1a022111mg                129   6e-32   
gb|EMT04179.1|  hypothetical protein F775_20607                         129   6e-32   
gb|EEE56309.1|  hypothetical protein OsJ_05395                          130   6e-32   
ref|NP_001172804.1|  Os02g0151000                                       130   6e-32   
ref|XP_008231609.1|  PREDICTED: pentatricopeptide repeat-containi...    129   6e-32   
emb|CAB86438.1|  putative protein                                       130   6e-32   
ref|XP_006304494.1|  hypothetical protein CARUB_v10011264mg             129   6e-32   
ref|XP_009388285.1|  PREDICTED: pentatricopeptide repeat-containi...    128   6e-32   
ref|XP_007145648.1|  hypothetical protein PHAVU_007G256700g             128   6e-32   
ref|XP_006283244.1|  hypothetical protein CARUB_v10004277mg             129   6e-32   
ref|XP_004293078.1|  PREDICTED: pentatricopeptide repeat-containi...    129   6e-32   
gb|AFW78806.1|  hypothetical protein ZEAMMB73_634908                    130   6e-32   
ref|XP_004168907.1|  PREDICTED: pentatricopeptide repeat-containi...    129   6e-32   
ref|XP_006426947.1|  hypothetical protein CICLE_v10027522mg             127   6e-32   
ref|XP_009598079.1|  PREDICTED: putative pentatricopeptide repeat...    129   6e-32   
ref|XP_006407172.1|  hypothetical protein EUTSA_v10020299mg             128   6e-32   
ref|XP_004147126.1|  PREDICTED: pentatricopeptide repeat-containi...    129   7e-32   
ref|XP_010091324.1|  hypothetical protein L484_012217                   129   7e-32   
ref|NP_195434.1|  pentatricopeptide repeat-containing protein           129   7e-32   
ref|XP_004308197.1|  PREDICTED: pentatricopeptide repeat-containi...    129   7e-32   
ref|XP_008386412.1|  PREDICTED: pentatricopeptide repeat-containi...    129   7e-32   
ref|NP_187990.1|  pentatricopeptide repeat-containing protein           128   7e-32   
ref|XP_009419424.1|  PREDICTED: pentatricopeptide repeat-containi...    128   7e-32   
ref|XP_010102252.1|  hypothetical protein L484_024533                   129   7e-32   
ref|XP_008218306.1|  PREDICTED: pentatricopeptide repeat-containi...    129   7e-32   
emb|CDO98371.1|  unnamed protein product                                129   7e-32   
ref|XP_004963823.1|  PREDICTED: pentatricopeptide repeat-containi...    128   7e-32   
ref|XP_002967118.1|  hypothetical protein SELMODRAFT_87370              129   7e-32   
gb|KDP25879.1|  hypothetical protein JCGZ_22909                         129   8e-32   
emb|CDY23639.1|  BnaC05g39550D                                          125   8e-32   
ref|XP_007047157.1|  Pentatricopeptide repeat (PPR) superfamily p...    128   8e-32   
ref|XP_002869013.1|  pentatricopeptide repeat-containing protein        128   8e-32   
ref|XP_010938946.1|  PREDICTED: pentatricopeptide repeat-containi...    129   8e-32   
emb|CAN61593.1|  hypothetical protein VITISV_030555                     128   8e-32   
ref|XP_008785768.1|  PREDICTED: pentatricopeptide repeat-containi...    129   8e-32   
ref|XP_007026426.1|  Tetratricopeptide repeat-like superfamily pr...    128   8e-32   
ref|XP_010523919.1|  PREDICTED: pentatricopeptide repeat-containi...    128   8e-32   
ref|NP_001183681.1|  uncharacterized protein LOC100502275               129   8e-32   
sp|Q9M1V3.2|PP296_ARATH  RecName: Full=Pentatricopeptide repeat-c...    129   8e-32   
ref|XP_002281942.1|  PREDICTED: pentatricopeptide repeat-containi...    128   9e-32   



>ref|XP_009617279.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic [Nicotiana tomentosiformis]
Length=889

 Score =   230 bits (586),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEISA+NLFELEP+VASHYVLLSNIYSSAG+WEKAN VRRNMK++GVRKEPGCSWIEFG+
Sbjct  705  GEISARNLFELEPHVASHYVLLSNIYSSAGIWEKANMVRRNMKKIGVRKEPGCSWIEFGD  764

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E LY FL+ LSEKMK+EGYVPDTSCVLHNVN++EKENLLCGHSE+
Sbjct  765  EVHKFVAGDASHPQSEQLYGFLETLSEKMKKEGYVPDTSCVLHNVNEEEKENLLCGHSEK  824

Query  12   LAIA  1
            LAIA
Sbjct  825  LAIA  828



>ref|XP_004233766.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic [Solanum lycopersicum]
Length=889

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEISA+NLFEL+P+VASHYVLLSNIYSSAG+WEKAN VRRNMK++GVRKEPGCSWIEFG+
Sbjct  705  GEISARNLFELDPHVASHYVLLSNIYSSAGIWEKANMVRRNMKKVGVRKEPGCSWIEFGD  764

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E LY +L+ LSEKMK+EGYVPDTSCVLHNVN+DEKENLLCGHSE+
Sbjct  765  EVHKFVAGDASHPQSEQLYGYLETLSEKMKKEGYVPDTSCVLHNVNEDEKENLLCGHSEK  824

Query  12   LAIA  1
            LAIA
Sbjct  825  LAIA  828



>ref|XP_006363206.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic-like [Solanum tuberosum]
Length=889

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEISA+NLFEL+ +VASHYVLLSNIYSSAG+WEKAN VRRNMK++GVRKEPGCSWIEFG+
Sbjct  705  GEISARNLFELDSHVASHYVLLSNIYSSAGIWEKANMVRRNMKKVGVRKEPGCSWIEFGD  764

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E LY +L+ LSEKMK+EGYVPDTSCVLHNVN+DEKENLLCGHSE+
Sbjct  765  EVHKFVAGDASHPQSEQLYGYLETLSEKMKKEGYVPDTSCVLHNVNEDEKENLLCGHSEK  824

Query  12   LAIA  1
            LAIA
Sbjct  825  LAIA  828



>ref|XP_009762740.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic [Nicotiana sylvestris]
Length=889

 Score =   222 bits (566),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEISA+NL ELEPNVASHYVLLSNIYSSAG+WEKAN VR NMK++GVRKEPGCSWIEFG+
Sbjct  705  GEISARNLLELEPNVASHYVLLSNIYSSAGIWEKANMVRHNMKKIGVRKEPGCSWIEFGD  764

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E LY FL  LS+KMK+EGYVPDTSCVLHNV++ EKENLLCGHSE+
Sbjct  765  EVHKFVAGDASHPQSEQLYGFLKTLSDKMKKEGYVPDTSCVLHNVSEGEKENLLCGHSEK  824

Query  12   LAIA  1
            LAIA
Sbjct  825  LAIA  828



>ref|XP_011100606.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic [Sesamum indicum]
Length=877

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEISA  L E EP VASHYVLLSNIYSS GLWEKAN+VR+NMKEMGVRKEPGCSWIE G+
Sbjct  693  GEISALKLLEFEPTVASHYVLLSNIYSSVGLWEKANEVRKNMKEMGVRKEPGCSWIECGD  752

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E LY+FL DL  +MK+EGYVPDTSCVLHNV++ EKENLLCGHSER
Sbjct  753  EVHKFLAGDTSHPQSEQLYEFLSDLFTRMKKEGYVPDTSCVLHNVDEQEKENLLCGHSER  812

Query  12   LAIA  1
            LAIA
Sbjct  813  LAIA  816



>gb|KDP43143.1| hypothetical protein JCGZ_26676 [Jatropha curcas]
Length=301

 Score =   206 bits (524),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A++L +L+PNVASHYVLLSNIYSSAGLW++A DVRR MKE+GV+KEPGCSWI  G+
Sbjct  117  GEIAAQHLIKLQPNVASHYVLLSNIYSSAGLWDRATDVRRKMKEIGVKKEPGCSWIVHGD  176

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            E+HKF AGD  HPQ+E L+DFLD LSE+MK+EGYVPDTSCVLHNV +DEKE LLCGHSE+
Sbjct  177  EIHKFLAGDLMHPQSEKLHDFLDTLSERMKKEGYVPDTSCVLHNVEEDEKEALLCGHSEK  236

Query  12   LAIA  1
            LAIA
Sbjct  237  LAIA  240



>emb|CBI27235.3| unnamed protein product [Vitis vinifera]
Length=696

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE++AKNL  LEPNVASHYVLLSNIYSSAGLW KA +VR+NM++MGV+KEPGCSWIEF +
Sbjct  512  GEVAAKNLLHLEPNVASHYVLLSNIYSSAGLWNKAMEVRKNMRQMGVKKEPGCSWIEFRD  571

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E L+ FL+ LSEKM++EGYVPDTSCVLHNV++DEKENLLCGHSE+
Sbjct  572  EVHKFMAGDVSHPQSEQLHGFLETLSEKMRKEGYVPDTSCVLHNVDEDEKENLLCGHSEK  631

Query  12   LAIA  1
            LAIA
Sbjct  632  LAIA  635



>ref|XP_002275546.2| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic [Vitis vinifera]
Length=896

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE++AKNL  LEPNVASHYVLLSNIYSSAGLW KA +VR+NM++MGV+KEPGCSWIEF +
Sbjct  712  GEVAAKNLLHLEPNVASHYVLLSNIYSSAGLWNKAMEVRKNMRQMGVKKEPGCSWIEFRD  771

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E L+ FL+ LSEKM++EGYVPDTSCVLHNV++DEKENLLCGHSE+
Sbjct  772  EVHKFMAGDVSHPQSEQLHGFLETLSEKMRKEGYVPDTSCVLHNVDEDEKENLLCGHSEK  831

Query  12   LAIA  1
            LAIA
Sbjct  832  LAIA  835



>ref|XP_006468579.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic-like [Citrus sinensis]
Length=882

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+NLF LEP+VASHYVLLSNIYSSA LW+KA DVR+ MKEMGVRKEPGCSWIEFG+
Sbjct  698  GEIAAQNLFLLEPDVASHYVLLSNIYSSAQLWDKAMDVRKKMKEMGVRKEPGCSWIEFGD  757

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            E+HKF AGDGSH Q+E L+ FL++LSE+M++EGYVPDTSCVLHNVN++EKE LLCGHSE+
Sbjct  758  EIHKFLAGDGSHQQSEQLHGFLENLSERMRKEGYVPDTSCVLHNVNEEEKETLLCGHSEK  817

Query  12   LAIA  1
            LAIA
Sbjct  818  LAIA  821



>gb|KDO77215.1| hypothetical protein CISIN_1g002772mg [Citrus sinensis]
Length=882

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+NLF LEP+VASHYVLLSNIYSSA LW+KA DVR+ MKEMGVRKEPGCSWIEFG+
Sbjct  698  GEIAAQNLFLLEPDVASHYVLLSNIYSSAQLWDKAMDVRKKMKEMGVRKEPGCSWIEFGD  757

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            E+HKF AGDGSH Q+E L+ FL++LSE+M++EGYVPDTSCVLHNVN++EKE LLCGHSE+
Sbjct  758  EIHKFLAGDGSHQQSEQLHGFLENLSERMRKEGYVPDTSCVLHNVNEEEKETLLCGHSEK  817

Query  12   LAIA  1
            LAIA
Sbjct  818  LAIA  821



>emb|CDP18169.1| unnamed protein product [Coffea canephora]
Length=905

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             EISA NL +LEP+VASHYVLLSNIYSSAGLWEKAN+VR+NMKE GVRKEPG SWIEFG+
Sbjct  721  AEISANNLIQLEPDVASHYVLLSNIYSSAGLWEKANNVRKNMKEKGVRKEPGSSWIEFGD  780

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E LY F+D+LS+KMKEEGY PDTSCVLHNV++++KENLLCGHSER
Sbjct  781  EVHKFLAGDISHPQSEQLYSFIDELSDKMKEEGYEPDTSCVLHNVDEEQKENLLCGHSER  840

Query  12   LAIA  1
            LA+A
Sbjct  841  LAMA  844



>ref|XP_006448595.1| hypothetical protein CICLE_v10014221mg [Citrus clementina]
 gb|ESR61835.1| hypothetical protein CICLE_v10014221mg [Citrus clementina]
Length=882

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI A+NLF LEP+VASHYVLLSNIYSSA LW+KA DVR+ MKEMGVRKEPGCSWIEFG+
Sbjct  698  GEIGAQNLFLLEPDVASHYVLLSNIYSSAQLWDKAMDVRKKMKEMGVRKEPGCSWIEFGD  757

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            E+HKF AGDGSH Q+E L+ FL++LSE+M++EGYVPDTSCVLHNVN++EKE LLCGHSE+
Sbjct  758  EIHKFLAGDGSHQQSEQLHGFLENLSERMRKEGYVPDTSCVLHNVNEEEKETLLCGHSEK  817

Query  12   LAIA  1
            LAIA
Sbjct  818  LAIA  821



>ref|XP_008223593.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic [Prunus mume]
Length=901

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A  L ELEP+VASHYVLLSNIYSS+GLW+KA DVRR MKEMGV+KEPGCSWIEFG+
Sbjct  717  GEIAANQLLELEPSVASHYVLLSNIYSSSGLWDKAMDVRRKMKEMGVKKEPGCSWIEFGD  776

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E L++FL+ LSEKMK+EGYVPDTSCVLHNV+++EKE LLCGHSE+
Sbjct  777  EVHKFLAGDLSHPQSEQLHEFLETLSEKMKKEGYVPDTSCVLHNVDEEEKETLLCGHSEK  836

Query  12   LAIA  1
            LA+A
Sbjct  837  LALA  840



>ref|XP_007223989.1| hypothetical protein PRUPE_ppa014757mg [Prunus persica]
 gb|EMJ25188.1| hypothetical protein PRUPE_ppa014757mg [Prunus persica]
Length=901

 Score =   213 bits (543),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A  L ELEP+VASHYVLLSNIYSS+GLW+KA DVRR MKEMGV+KEPGCSWIEFG+
Sbjct  717  GEIAANQLLELEPSVASHYVLLSNIYSSSGLWDKAMDVRRKMKEMGVKKEPGCSWIEFGD  776

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E L++FL+ LSEKMK+EGYVPDTSCVLHNV+++EKE LLCGHSE+
Sbjct  777  EVHKFLAGDLSHPQSEQLHEFLETLSEKMKKEGYVPDTSCVLHNVDEEEKETLLCGHSEK  836

Query  12   LAIA  1
            LA+A
Sbjct  837  LALA  840



>gb|EYU35938.1| hypothetical protein MIMGU_mgv1a001219mg [Erythranthe guttata]
Length=863

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEISA  L ELEPNVASHYVLLSNIYSSAGLWEKAN VR+NMKE GVRKEPGCSWIE GE
Sbjct  679  GEISAMKLLELEPNVASHYVLLSNIYSSAGLWEKANKVRKNMKETGVRKEPGCSWIESGE  738

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VHKF AGD SHPQ+E LY +L+DL  +MK EGYV DTSCVLHNV++ EKENLLCGHSER
Sbjct  739  KVHKFLAGDTSHPQSEQLYGYLNDLFGRMKREGYVADTSCVLHNVDEQEKENLLCGHSER  798

Query  12   LAIA  1
            LAIA
Sbjct  799  LAIA  802



>ref|XP_007040995.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
 gb|EOX96826.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
Length=955

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+NLF LEP+VASHYVLLSNIYSSA LW+KANDVR+ MKEMGVRKEPGCSWIEFG+
Sbjct  771  GEIAARNLFYLEPDVASHYVLLSNIYSSAQLWDKANDVRKKMKEMGVRKEPGCSWIEFGD  830

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SH Q+  L+ FL+ LSEKM++EGYVPDTSCVLHNV+++EKE LLCGHSE+
Sbjct  831  EVHKFLAGDASHAQSGQLHKFLETLSEKMRKEGYVPDTSCVLHNVDEEEKETLLCGHSEK  890

Query  12   LAIA  1
            LAIA
Sbjct  891  LAIA  894



>ref|XP_010100626.1| hypothetical protein L484_011557 [Morus notabilis]
 gb|EXB83263.1| hypothetical protein L484_011557 [Morus notabilis]
Length=877

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+NL ++EPNVASHYVLLSNIYSSAGLW++A DVRR MKEMGVRKEPGCSWIEFG+
Sbjct  693  GEIAAENLLQVEPNVASHYVLLSNIYSSAGLWDEAMDVRRRMKEMGVRKEPGCSWIEFGD  752

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGDGSHPQ+E L++FL++L+ +MK+ GYVPDTSCVLH+V+++ KE LLCGHSE+
Sbjct  753  EVHKFLAGDGSHPQSEKLHEFLENLAMRMKKAGYVPDTSCVLHDVDEEAKETLLCGHSEK  812

Query  12   LAIA  1
            LAIA
Sbjct  813  LAIA  816



>ref|XP_004487896.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic-like isoform X1 [Cicer arietinum]
 ref|XP_004487897.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic-like isoform X2 [Cicer arietinum]
Length=872

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+AK+LF LEPNVASHYVLLSNIYSSAGLW+KA DVR+ MKEMGVRKEPGCSWIE G+
Sbjct  688  GEIAAKHLFVLEPNVASHYVLLSNIYSSAGLWDKAMDVRKKMKEMGVRKEPGCSWIEHGD  747

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ++ L+++L+ LS++MK+EGYVPDTSCVLHNV+++EKE++LCGHSER
Sbjct  748  EVHKFLAGDTSHPQSKELHEYLETLSQRMKKEGYVPDTSCVLHNVDEEEKESMLCGHSER  807

Query  12   LAIA  1
            LAIA
Sbjct  808  LAIA  811



>ref|XP_004295518.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=893

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A +L +LEP+VASHYVLLSNIYSS+GLWEKA D+RR MKEMGVRKEPGCSWIEF +
Sbjct  709  GEIAAHHLLQLEPDVASHYVLLSNIYSSSGLWEKAMDIRRKMKEMGVRKEPGCSWIEFED  768

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E L+++L+ LSE+MK+EGYVPDTSCVLHNV++DEKE LLCGHSE+
Sbjct  769  EVHKFLAGDMSHPQSEQLHEYLETLSERMKKEGYVPDTSCVLHNVDEDEKETLLCGHSEK  828

Query  12   LAIA  1
            LA+A
Sbjct  829  LAMA  832



>ref|XP_007138858.1| hypothetical protein PHAVU_009G243400g [Phaseolus vulgaris]
 gb|ESW10852.1| hypothetical protein PHAVU_009G243400g [Phaseolus vulgaris]
Length=882

 Score =   210 bits (535),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+AKNL  LEPNVASHYVLLSNIYSSAGLWE+A +VR+ MKEMGVRKEPGCSWIE G+
Sbjct  698  GEIAAKNLLVLEPNVASHYVLLSNIYSSAGLWEQAIEVRKKMKEMGVRKEPGCSWIEHGD  757

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ++ L+++++ LS++M++EGYVPDTSCVLHNV+D+EKE +LCGHSER
Sbjct  758  EVHKFLAGDASHPQSKELHEYIETLSQRMRKEGYVPDTSCVLHNVDDEEKETMLCGHSER  817

Query  12   LAIA  1
            LAIA
Sbjct  818  LAIA  821



>ref|XP_010516359.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic-like [Camelina sativa]
Length=880

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI A+NL +LEPNVASHYVLL+NIYSSAGLW+KA +VRRNMKE GVRKEPGCSWIE G+
Sbjct  696  GEIVAQNLIQLEPNVASHYVLLANIYSSAGLWDKATEVRRNMKERGVRKEPGCSWIEHGD  755

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E L+ +L+ L EKM++EGYVPDTSCVLHNV +DEKE LLCGHSE+
Sbjct  756  EVHKFVAGDSSHPQSEKLHGYLETLWEKMRKEGYVPDTSCVLHNVEEDEKEVLLCGHSEK  815

Query  12   LAIA  1
            LAIA
Sbjct  816  LAIA  819



>ref|XP_010504671.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic-like [Camelina sativa]
Length=883

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI A+NL +LEPNVASHYVLL+NIYSSAGLW+KA +VRRNMKE GVRKEPGCSWIE G+
Sbjct  699  GEIVAQNLIQLEPNVASHYVLLANIYSSAGLWDKATEVRRNMKERGVRKEPGCSWIEHGD  758

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E L+ +L+ L EKM++EGYVPDTSCVLHNV +DEKE LLCGHSE+
Sbjct  759  EVHKFVAGDSSHPQSEKLHGYLETLWEKMRKEGYVPDTSCVLHNVEEDEKEVLLCGHSEK  818

Query  12   LAIA  1
            LAIA
Sbjct  819  LAIA  822



>ref|XP_010051803.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At3g57430, chloroplastic-like [Eucalyptus grandis]
Length=893

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A NL ELEP+VASHYVLLSNIYSSAGLW+KA D+RR MKE GVRKEPGCSWIEFG+
Sbjct  709  GEIAAMNLLELEPDVASHYVLLSNIYSSAGLWDKAMDIRRKMKEKGVRKEPGCSWIEFGD  768

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AG+ SHPQ++ L+ FL+ LS++M++EGYVPDTSCVLHNV ++EKE LLCGHSE+
Sbjct  769  EVHKFIAGESSHPQSQELHRFLETLSDRMRKEGYVPDTSCVLHNVXEEEKEALLCGHSEK  828

Query  12   LAIA  1
            LAIA
Sbjct  829  LAIA  832



>emb|CAB66100.1| putative protein [Arabidopsis thaliana]
Length=803

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+NL +LEPNVASHYVLL+NIYSSAGLW+KA +VRRNMKE GVRKEPGCSWIE G+
Sbjct  619  GEIAAQNLIQLEPNVASHYVLLANIYSSAGLWDKATEVRRNMKEQGVRKEPGCSWIEHGD  678

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E L  +L+ L E+M++EGYVPDTSCVLHNV +DEKE LLCGHSE+
Sbjct  679  EVHKFVAGDSSHPQSEKLSGYLETLWERMRKEGYVPDTSCVLHNVEEDEKEILLCGHSEK  738

Query  12   LAIA  1
            LAIA
Sbjct  739  LAIA  742



>ref|XP_010427617.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic isoform X1 [Camelina sativa]
 ref|XP_010427618.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic isoform X2 [Camelina sativa]
Length=883

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI A+NL +LEPNVASHYVLL+NIYSSAGLW+KA +VRRNMKE GVRKEPGCSWIE G+
Sbjct  699  GEIVAQNLIQLEPNVASHYVLLANIYSSAGLWDKATEVRRNMKERGVRKEPGCSWIEHGD  758

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E L+ +L+ L EKM++EGYVPDTSCVLHNV +DEKE LLCGHSE+
Sbjct  759  EVHKFVAGDSSHPQSEKLHGYLETLWEKMRKEGYVPDTSCVLHNVEEDEKEVLLCGHSEK  818

Query  12   LAIA  1
            LAIA
Sbjct  819  LAIA  822



>ref|NP_191302.2| protein ORGANELLE TRANSCRIPT PROCESSING 84 [Arabidopsis thaliana]
 sp|Q7Y211.2|PP285_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE79654.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=890

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+NL +LEPNVASHYVLL+NIYSSAGLW+KA +VRRNMKE GVRKEPGCSWIE G+
Sbjct  706  GEIAAQNLIQLEPNVASHYVLLANIYSSAGLWDKATEVRRNMKEQGVRKEPGCSWIEHGD  765

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E L  +L+ L E+M++EGYVPDTSCVLHNV +DEKE LLCGHSE+
Sbjct  766  EVHKFVAGDSSHPQSEKLSGYLETLWERMRKEGYVPDTSCVLHNVEEDEKEILLCGHSEK  825

Query  12   LAIA  1
            LAIA
Sbjct  826  LAIA  829



>gb|AAP40452.1| unknown protein [Arabidopsis thaliana]
Length=890

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+NL +LEPNVASHYVLL+NIYSSAGLW+KA +VRRNMKE GVRKEPGCSWIE G+
Sbjct  706  GEIAAQNLIQLEPNVASHYVLLANIYSSAGLWDKATEVRRNMKEQGVRKEPGCSWIEHGD  765

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E L  +L+ L E+M++EGYVPDTSCVLHNV +DEKE LLCGHSE+
Sbjct  766  EVHKFVAGDSSHPQSEKLSGYLETLWERMRKEGYVPDTSCVLHNVEEDEKEILLCGHSEK  825

Query  12   LAIA  1
            LAIA
Sbjct  826  LAIA  829



>gb|KDP43137.1| hypothetical protein JCGZ_26670 [Jatropha curcas]
Length=889

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A++L +L+PNVASHYVLLSNIYSSAGLW++A DVRR MKE+GV+KEPGCSWI  G+
Sbjct  705  GEIAAQHLIKLQPNVASHYVLLSNIYSSAGLWDRATDVRRKMKEIGVKKEPGCSWIVHGD  764

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            E+HKF AGD  HPQ+E L+DFLD LSE+MK+EGYVPDTSCVLHNV +DEKE LLCGHSE+
Sbjct  765  EMHKFLAGDLMHPQSEELHDFLDTLSERMKKEGYVPDTSCVLHNVEEDEKEALLCGHSEK  824

Query  12   LAIA  1
            LAIA
Sbjct  825  LAIA  828



>emb|CDX72037.1| BnaC08g28370D [Brassica napus]
Length=881

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+NL +LEP+VASHYVLL+NIYSSAGLWEKA +VRR MKE GVRKEPGCSWIE G+
Sbjct  697  GEIAAQNLVQLEPDVASHYVLLANIYSSAGLWEKATEVRRKMKEKGVRKEPGCSWIEHGD  756

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E L+ +L+ L EKM++EGYVPDTSCVLHNV +DEKE LLCGHSE+
Sbjct  757  EVHKFIAGDSSHPQSEKLHGYLEALWEKMRKEGYVPDTSCVLHNVEEDEKEVLLCGHSEK  816

Query  12   LAIA  1
            LAIA
Sbjct  817  LAIA  820



>ref|XP_010684483.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=899

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+ L +LEP++ SHYVLLSNIYSSAGLWEKA  +R NMK+MGV+KEPGCSWIEFGE
Sbjct  715  GEIAARTLIQLEPHIDSHYVLLSNIYSSAGLWEKAMGIRNNMKQMGVKKEPGCSWIEFGE  774

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VHKF AGD  HPQ+E L+ F++DLSE+MK+EGYVPDTSCVLHN+++ EKE+LLCGHSE+
Sbjct  775  KVHKFLAGDTLHPQSEQLHGFIEDLSERMKKEGYVPDTSCVLHNIDEGEKESLLCGHSEK  834

Query  12   LAIA  1
            LAIA
Sbjct  835  LAIA  838



>ref|XP_006402877.1| hypothetical protein EUTSA_v10005782mg [Eutrema salsugineum]
 gb|ESQ44330.1| hypothetical protein EUTSA_v10005782mg [Eutrema salsugineum]
Length=888

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+NL +LEP VASHYVLL+NIYSSAGLW+KA +VRR MKE GVRKEPGCSWIE+G+
Sbjct  704  GEIAAQNLIQLEPKVASHYVLLANIYSSAGLWDKATEVRRKMKEQGVRKEPGCSWIEYGD  763

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VHKF AGD SHPQ+E L+ +L+ L EKM++EGYVPDTSCVLHNV +DEKE LLCGHSE+
Sbjct  764  GVHKFVAGDSSHPQSEKLHGYLESLWEKMRKEGYVPDTSCVLHNVEEDEKEVLLCGHSEK  823

Query  12   LAIA  1
            LAIA
Sbjct  824  LAIA  827



>gb|KHN47734.1| Pentatricopeptide repeat-containing protein, chloroplastic, partial 
[Glycine soja]
Length=751

 Score =   204 bits (520),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+AK+LF LEPNVASHYVL+SNIYSSAGLW++A  VR+ MKEMGVRKEPGCSWIE G+
Sbjct  567  GEIAAKHLFVLEPNVASHYVLMSNIYSSAGLWDQALGVRKKMKEMGVRKEPGCSWIEHGD  626

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF +GD SHPQ++ L+++L+ LS++M++EGYVPD SCVLHNV+D+EKE +LCGHSER
Sbjct  627  EVHKFLSGDASHPQSKELHEYLETLSQRMRKEGYVPDISCVLHNVDDEEKETMLCGHSER  686

Query  12   LAIA  1
            LAIA
Sbjct  687  LAIA  690



>ref|XP_002878152.1| hypothetical protein ARALYDRAFT_486188 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54411.1| hypothetical protein ARALYDRAFT_486188 [Arabidopsis lyrata subsp. 
lyrata]
Length=886

 Score =   205 bits (521),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+NL +LEPNVASHYVLL+NIYSSAGLW KA +VRRNMK  GVRKEPGCSWIE G+
Sbjct  702  GEIAAQNLIQLEPNVASHYVLLANIYSSAGLWYKATEVRRNMKAQGVRKEPGCSWIEHGD  761

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E L  +L+ L E+M++EGY+PDTSCVLHNV +DEKE LLCGHSE+
Sbjct  762  EVHKFVAGDSSHPQSEKLRGYLETLWERMRKEGYIPDTSCVLHNVEEDEKEILLCGHSEK  821

Query  12   LAIA  1
            LAIA
Sbjct  822  LAIA  825



>ref|XP_009116445.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At3g57430, chloroplastic [Brassica rapa]
Length=887

 Score =   205 bits (521),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+NL  LEP+VASHYVLL+NIYSSAGLWEKA +VRR M+E GVRKEPGCSWIE G+
Sbjct  703  GEIAAQNLVRLEPDVASHYVLLANIYSSAGLWEKATEVRRKMREKGVRKEPGCSWIEHGD  762

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E L+ +L+ L EKM++EGYVPDTSCVLHNV +DEKE LLCGHSE+
Sbjct  763  EVHKFIAGDSSHPQSEKLHGYLETLWEKMRKEGYVPDTSCVLHNVEEDEKEVLLCGHSEK  822

Query  12   LAIA  1
            LAIA
Sbjct  823  LAIA  826



>ref|XP_006597752.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic-like [Glycine max]
Length=880

 Score =   204 bits (520),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+AK+LF LEPNVASHYVL+SNIYSSAGLW++A  VR+ MKEMGVRKEPGCSWIE G+
Sbjct  696  GEIAAKHLFVLEPNVASHYVLMSNIYSSAGLWDQALGVRKKMKEMGVRKEPGCSWIEHGD  755

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF +GD SHPQ++ L+++L+ LS++M++EGYVPD SCVLHNV+D+EKE +LCGHSER
Sbjct  756  EVHKFLSGDASHPQSKELHEYLETLSQRMRKEGYVPDISCVLHNVDDEEKETMLCGHSER  815

Query  12   LAIA  1
            LAIA
Sbjct  816  LAIA  819



>ref|XP_011008234.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic [Populus euphratica]
Length=886

 Score =   204 bits (520),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+NLF+ +P+VASHYVLLSNIYSSAGLW+KA ++RR MK MGV+KEPGCSWIE+G+
Sbjct  702  GEIAAENLFQFQPDVASHYVLLSNIYSSAGLWDKAMNLRRRMKVMGVKKEPGCSWIEYGD  761

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E L+DFL+ LSE++K+EGYVPDT+CVLH+++++EKE +LCGHSE+
Sbjct  762  EVHKFLAGDLSHPQSEKLHDFLETLSERLKKEGYVPDTACVLHDIDEEEKETILCGHSEK  821

Query  12   LAIA  1
            LAIA
Sbjct  822  LAIA  825



>ref|XP_002299387.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE84192.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=894

 Score =   204 bits (519),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+NL +L+P+VASHYVLLSNIYSSAGLW+KA ++RR MK MGV+KEPGCSWIE+G+
Sbjct  710  GEIAAENLLQLQPDVASHYVLLSNIYSSAGLWDKAMNLRRRMKAMGVKKEPGCSWIEYGD  769

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E L+DFL+ LSE++K+EGYVPDT+CVLH+++++EKE +LCGHSE+
Sbjct  770  EVHKFLAGDLSHPQSEKLHDFLETLSERLKKEGYVPDTACVLHDIDEEEKETILCGHSEK  829

Query  12   LAIA  1
            LAIA
Sbjct  830  LAIA  833



>ref|XP_009340266.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic [Pyrus x bretschneideri]
Length=904

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE++A +L +LEP+VASHYVLLSNIYSS+GLWEKA DVRR M+E+GVRKEPG SWIEFG+
Sbjct  720  GEVAANHLLQLEPDVASHYVLLSNIYSSSGLWEKAMDVRRKMRELGVRKEPGYSWIEFGD  779

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SH Q++ L++FL+ LSEKMK+EGYVPDTSCVLHNV+++EKE LLCGHSE+
Sbjct  780  EVHKFLAGDLSHQQSKQLHEFLETLSEKMKKEGYVPDTSCVLHNVDEEEKETLLCGHSEK  839

Query  12   LAIA  1
            LAIA
Sbjct  840  LAIA  843



>ref|XP_010260746.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic isoform X1 [Nelumbo nucifera]
Length=902

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A++L  LEPNVASHYVLLSNIYSSAGLW+KA +VR+NMKEMGVRKEPGCSWIE G 
Sbjct  712  GEIAAESLLRLEPNVASHYVLLSNIYSSAGLWDKAMEVRKNMKEMGVRKEPGCSWIELGN  771

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            E+HKF +GD  HPQ+  L+ FL++LSE++++EGYVPDTSCVLHNV+++EKE LLCGHSER
Sbjct  772  ELHKFLSGDILHPQSAQLHAFLEELSERLRKEGYVPDTSCVLHNVDEEEKEYLLCGHSER  831

Query  12   LAIA  1
            LAIA
Sbjct  832  LAIA  835



>ref|XP_010260747.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic isoform X2 [Nelumbo nucifera]
Length=896

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A++L  LEPNVASHYVLLSNIYSSAGLW+KA +VR+NMKEMGVRKEPGCSWIE G 
Sbjct  712  GEIAAESLLRLEPNVASHYVLLSNIYSSAGLWDKAMEVRKNMKEMGVRKEPGCSWIELGN  771

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            E+HKF +GD  HPQ+  L+ FL++LSE++++EGYVPDTSCVLHNV+++EKE LLCGHSER
Sbjct  772  ELHKFLSGDILHPQSAQLHAFLEELSERLRKEGYVPDTSCVLHNVDEEEKEYLLCGHSER  831

Query  12   LAIA  1
            LAIA
Sbjct  832  LAIA  835



>emb|CDY06106.1| BnaA09g36740D [Brassica napus]
Length=876

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+NL  LEP+VASHYVLL+NIYSSAGLWEK  +VRR MKE GVRKEPGCSWIE G+
Sbjct  692  GEIAAQNLVRLEPDVASHYVLLANIYSSAGLWEKGTEVRRKMKEKGVRKEPGCSWIEHGD  751

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ++ L+ +L+ L EKM++EGYVPDTSCVLHNV +DEKE LLCGHSE+
Sbjct  752  EVHKFIAGDSSHPQSKKLHGYLETLWEKMRKEGYVPDTSCVLHNVEEDEKEVLLCGHSEK  811

Query  12   LAIA  1
            LAIA
Sbjct  812  LAIA  815



>ref|XP_006290586.1| hypothetical protein CARUB_v10016675mg [Capsella rubella]
 gb|EOA23484.1| hypothetical protein CARUB_v10016675mg [Capsella rubella]
Length=882

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE+ A+NL +LEP VASHYVLL+NIYSSAG W+KA +VRR MKE GVRKEPGCSWIE G+
Sbjct  698  GEVVAQNLIQLEPKVASHYVLLANIYSSAGHWDKATEVRRKMKEQGVRKEPGCSWIEHGD  757

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E L+ +L+ L EKM+EEGYVPDTSCVLHNV +DEKE LLCGHSE+
Sbjct  758  EVHKFVAGDSSHPQSEKLHGYLETLWEKMREEGYVPDTSCVLHNVEEDEKEVLLCGHSEK  817

Query  12   LAIA  1
            LAIA
Sbjct  818  LAIA  821



>gb|KFK34979.1| hypothetical protein AALP_AA5G218700 [Arabis alpina]
Length=885

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+NL ELEPNVASHYVLL+NIYSSA LW+KA +VRR MKE GVRKEPGCSWIE G 
Sbjct  701  GEIAAQNLIELEPNVASHYVLLANIYSSADLWDKATEVRRKMKEKGVRKEPGCSWIEHGG  760

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ+E L+ +L+ L EKM++EGY+PDTSCVLHNV +DEKE LLCGHSE+
Sbjct  761  EVHKFIAGDSSHPQSEKLHGYLETLWEKMRKEGYIPDTSCVLHNVEEDEKEVLLCGHSEK  820

Query  12   LAIA  1
            LA+A
Sbjct  821  LALA  824



>ref|XP_008383264.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic [Malus domestica]
Length=905

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE++A +L +LEP+VASHYVLLSNIYSS+G WEKA DVRR M+E+GVRKEPG SWIEFG+
Sbjct  721  GEVAANHLLQLEPDVASHYVLLSNIYSSSGFWEKAMDVRRKMRELGVRKEPGYSWIEFGD  780

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SH Q+  L++FL+ LSEKMK EGYVPDTSCVLHNV+++EKE LLCGHSE+
Sbjct  781  EVHKFLAGDLSHQQSRQLHEFLETLSEKMKREGYVPDTSCVLHNVDEEEKETLLCGHSEK  840

Query  12   LAIA  1
            LAIA
Sbjct  841  LAIA  844



>gb|AES65119.2| PPR containing plant protein [Medicago truncatula]
Length=887

 Score =   202 bits (513),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+AKNLF L+PNVAS+YVLLSNIYSSAGLW++A DVR+ MKE GVRKEPGCSWIE G+
Sbjct  703  GEIAAKNLFVLDPNVASYYVLLSNIYSSAGLWDQAIDVRKKMKEKGVRKEPGCSWIEHGD  762

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ++ ++++L+ LS +MK+EGYVPDTSCVLHNV ++EKE +LCGHSER
Sbjct  763  EVHKFLAGDVSHPQSKEVHEYLETLSLRMKKEGYVPDTSCVLHNVGEEEKETMLCGHSER  822

Query  12   LAIA  1
            LAIA
Sbjct  823  LAIA  826



>ref|XP_010529313.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic [Tarenaya hassleriana]
Length=889

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A NL  LEP+VASHYVLL+NIYSSAGLW+KA ++RR MKE GVRKEPGCSWIE G+
Sbjct  705  GEIAAGNLLRLEPDVASHYVLLANIYSSAGLWDKATEIRRKMKEQGVRKEPGCSWIECGD  764

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AG+ SHPQ+E L+ FL++L +K++ EGYVPDTSCVLHNV +DEKE LLCGHSE+
Sbjct  765  EVHKFIAGESSHPQSEKLHGFLENLWKKLRNEGYVPDTSCVLHNVEEDEKEVLLCGHSEK  824

Query  12   LAIA  1
            LAIA
Sbjct  825  LAIA  828



>ref|XP_010920366.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic [Elaeis guineensis]
Length=889

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+AK+LFELEP+VASHYVLLSNIY++AGLWEKA +VR+NMK MGVRK+PGCSWIE G+
Sbjct  705  GEIAAKHLFELEPDVASHYVLLSNIYAAAGLWEKAMEVRKNMKLMGVRKDPGCSWIEVGD  764

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F AGD +HPQ+  LY FL+ L ++M++EGY PDTSCVLH+V +DEKE LL GHSE+
Sbjct  765  DVHGFMAGDSAHPQSPQLYSFLETLWDRMRKEGYKPDTSCVLHDVEEDEKEVLLRGHSEK  824

Query  12   LAIA  1
            LAIA
Sbjct  825  LAIA  828



>ref|XP_008781925.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At3g57430, chloroplastic-like [Phoenix dactylifera]
Length=882

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G I+A++LFELEP+VASHYVLLSNIY++AGLWEK+++VR+ MK MGVRKEPGCSWIE G+
Sbjct  698  GAIAAEHLFELEPDVASHYVLLSNIYAAAGLWEKSSEVRKKMKLMGVRKEPGCSWIEVGD  757

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVH+F AGD  HPQ+  LY FL+ L ++M++EGY PDTSCVLH+V ++EKE LLCGHSE+
Sbjct  758  EVHRFMAGDSLHPQSRQLYSFLETLWDRMRKEGYKPDTSCVLHDVEEEEKEVLLCGHSEK  817

Query  12   LAIA  1
            LAIA
Sbjct  818  LAIA  821



>ref|XP_009413784.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=862

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+AK+LFELEP+ +SHYVLLSNIY+++G W ++ +VR+NMK MGVRKEPGCSWIE G+
Sbjct  678  GEIAAKHLFELEPDESSHYVLLSNIYAASGQWGRSMEVRKNMKSMGVRKEPGCSWIEVGD  737

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH+FT GD +HPQ+  ++ FL+ L  +MK+EGYVPDTSCVLH+V + EKE LL GHSE+
Sbjct  738  DVHRFTVGDSAHPQSTQIHSFLETLWTRMKKEGYVPDTSCVLHDVEEKEKEVLLRGHSEK  797

Query  12   LAIA  1
            LAIA
Sbjct  798  LAIA  801



>gb|KCW75636.1| hypothetical protein EUGRSUZ_D00005 [Eucalyptus grandis]
Length=753

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A NL ELEP+VASHYVLLSNIYSSAGLW+KA D+RR MKE GVRKEPGCSWIEFG+
Sbjct  632  GEIAAMNLLELEPDVASHYVLLSNIYSSAGLWDKAMDIRRKMKEKGVRKEPGCSWIEFGD  691

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKE  40
            EVHKF AG+ SHPQ++ L+ FL+ LS++M++EGYVPDTSCVLHNV   ++ 
Sbjct  692  EVHKFIAGESSHPQSQELHRFLETLSDRMRKEGYVPDTSCVLHNVTRRKRR  742



>ref|XP_003580964.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic [Brachypodium distachyon]
Length=861

 Score =   163 bits (413),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 72/124 (58%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G I+A+ LFELEP+ ASHYVLL NIYS+AGLWE + +VR  M++ GV KEPGCSWIE   
Sbjct  677  GRIAAERLFELEPDEASHYVLLCNIYSAAGLWENSTEVRGMMRQRGVAKEPGCSWIELDG  736

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             +H+F AG+ +HP++  ++  +D L E+M+ EGYVPDTSCVLH+V++ EK  +L  HSE+
Sbjct  737  AIHRFMAGESAHPESAQVHAHMDALWERMRREGYVPDTSCVLHDVDEAEKAAMLRYHSEK  796

Query  12   LAIA  1
            LAIA
Sbjct  797  LAIA  800



>ref|XP_004965512.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic-like [Setaria italica]
Length=748

 Score =   162 bits (410),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 71/124 (57%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+ LFELEP+ ASHYVLL NIYS+AGLWEK+++VR  M++ GV KEPGCSWIE   
Sbjct  564  GEIAAERLFELEPDEASHYVLLCNIYSAAGLWEKSSEVRSRMRQRGVSKEPGCSWIELDG  623

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             +H+F AG+ +HP++  ++  +D L E+M+ +GY PDTSCVLH++ + EK  +L  HSE+
Sbjct  624  AIHRFMAGESAHPESAVVHAHMDALWERMRGQGYAPDTSCVLHDIEEGEKAAILRYHSEK  683

Query  12   LAIA  1
            LAIA
Sbjct  684  LAIA  687



>dbj|BAJ91522.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=878

 Score =   162 bits (410),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 72/124 (58%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE++A+ LFELEP  ASHYVLL NIYS+AG+W+K+  VR  M+  GV KEPGCSWIE   
Sbjct  694  GEVAAERLFELEPGEASHYVLLCNIYSAAGMWDKSVAVRVRMRRQGVAKEPGCSWIELDG  753

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             +H+F AG+ SHP +  ++  +D L E+M+ EGY PDTSCVLH+V++DEK  +L  HSE+
Sbjct  754  AIHRFMAGESSHPASAEVHAHMDALWERMRREGYAPDTSCVLHDVDEDEKAAMLRYHSEK  813

Query  12   LAIA  1
            LAIA
Sbjct  814  LAIA  817



>ref|XP_008649170.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic [Zea mays]
 gb|AFW76575.1| hypothetical protein ZEAMMB73_444227 [Zea mays]
Length=869

 Score =   159 bits (401),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 69/124 (56%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+ LF+LEP+ ASHYVLL NIYS+AGLWEK+++VR  M++ GV KEPGCSWIE   
Sbjct  685  GEIAAERLFQLEPDEASHYVLLCNIYSAAGLWEKSSEVRNRMRQRGVSKEPGCSWIELDG  744

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             +H+F AG+ +HP++  ++  +D L E+M+ +GY PDTS VLH++ + EK  +L  HSE+
Sbjct  745  VIHRFMAGESAHPESTLVHAHMDALWERMRNQGYTPDTSSVLHDIEESEKAAILRYHSEK  804

Query  12   LAIA  1
            LAIA
Sbjct  805  LAIA  808



>ref|XP_008809450.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 
[Phoenix dactylifera]
Length=755

 Score =   155 bits (391),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 71/124 (57%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+ LFELEP  A +YVLLSNIY++ G+W+  + VR  MK MGVRK PGCSWIE   
Sbjct  571  GEIAAEKLFELEPGNAGNYVLLSNIYAAKGMWDGVDKVRDMMKSMGVRKNPGCSWIEIKN  630

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH   AGD SHPQ   + D L+ LS +MK  GY+P T  VL +V + +KE +LCGHSE+
Sbjct  631  KVHMMLAGDKSHPQMNQIADRLEKLSVEMKRLGYLPSTDFVLQDVEEQDKEQILCGHSEK  690

Query  12   LAIA  1
            LAIA
Sbjct  691  LAIA  694



>ref|XP_003594868.1| Pentatricopeptide repeat protein [Medicago truncatula]
Length=874

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 93/124 (75%), Gaps = 13/124 (10%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+AKNLF L+PNV  +               K + + R MKE GVRKEPGCSWIE G+
Sbjct  703  GEIAAKNLFVLDPNVLDY-------------GTKQSMLGRKMKEKGVRKEPGCSWIEHGD  749

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SHPQ++ ++++L+ LS +MK+EGYVPDTSCVLHNV ++EKE +LCGHSER
Sbjct  750  EVHKFLAGDVSHPQSKEVHEYLETLSLRMKKEGYVPDTSCVLHNVGEEEKETMLCGHSER  809

Query  12   LAIA  1
            LAIA
Sbjct  810  LAIA  813



>ref|XP_010089431.1| hypothetical protein L484_002732 [Morus notabilis]
 gb|EXB37797.1| hypothetical protein L484_002732 [Morus notabilis]
Length=672

 Score =   150 bits (380),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 67/124 (54%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E++AK LF LEP  +++YV LSN+Y+ AG+W++  ++R  +K  G+RK PGCSWIE   
Sbjct  488  AEVAAKKLFVLEPYSSANYVHLSNMYAEAGMWKEVANLRDLLKYRGIRKTPGCSWIEVNG  547

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            + H F  GD SHPQT  +Y FL+ L EKMK+ GYVPDTS VLH+++++EKE+ L  HSE+
Sbjct  548  KAHMFLGGDTSHPQTREIYMFLESLPEKMKQAGYVPDTSPVLHDLSEEEKEHNLTSHSEK  607

Query  12   LAIA  1
            LAIA
Sbjct  608  LAIA  611



>ref|XP_010920084.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 
[Elaeis guineensis]
Length=755

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+ LFELEP  A +YVLLSNIY++ G+W+  + VR  MK MGVRK PGCSWIE   
Sbjct  571  GEIAAEKLFELEPGNAGNYVLLSNIYAAKGMWDGVDKVRDIMKSMGVRKNPGCSWIEIKN  630

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH   AGD SHPQ   + D L+ LS +MK  GY+P T  VL +V + +KE +LCGHSE+
Sbjct  631  KVHMMLAGDKSHPQMNQIADRLEKLSVEMKRLGYLPSTDFVLQDVEEQDKEQILCGHSEK  690

Query  12   LAIA  1
            LAIA
Sbjct  691  LAIA  694



>emb|CAN63659.1| hypothetical protein VITISV_008415 [Vitis vinifera]
Length=760

 Score =   147 bits (370),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 65/123 (53%), Positives = 88/123 (72%), Gaps = 0/123 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE++A+ LFELEP+   +Y+LLSNIY+S G+W + N VR  MK  G+RK PGCSWIE   
Sbjct  574  GEVAAEKLFELEPSNPGNYILLSNIYASKGMWNEVNRVRDMMKNKGLRKNPGCSWIEVKN  633

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH   AGD SHPQ   + + LD LS +MK+ GY P+ + VL +V + +KE +LCGHSE+
Sbjct  634  KVHMLLAGDKSHPQMTQIIENLDKLSMEMKKLGYFPEINFVLQDVEEQDKEQILCGHSEK  693

Query  12   LAI  4
            LA+
Sbjct  694  LAV  696



>gb|ADE76509.1| unknown [Picea sitchensis]
Length=246

 Score =   140 bits (352),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G+ +A+ LF+LEP+ A+ YVLLSNIY++AG W+    VR+ MK+ GV+K+PGCSWIE   
Sbjct  62   GKHAAECLFQLEPHNAAKYVLLSNIYAAAGRWDDVAKVRKIMKDRGVQKQPGCSWIEVKN  121

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F   D SHPQTE +Y  L++L+ +M+  GYVPDT+ VLH+V  ++KE+ L  HSE+
Sbjct  122  KVHTFMVEDKSHPQTEEIYSTLEELARQMEAAGYVPDTNFVLHDVEMEQKEHSLYHHSEK  181

Query  12   LAIA  1
            LAIA
Sbjct  182  LAIA  185



>ref|XP_011087742.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g49142 [Sesamum indicum]
Length=639

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E++AK LF LEP  + +YV+LSN+Y+ AG+WE+ N +R  +K   V+K PGCSWIE   
Sbjct  455  AELAAKKLFILEPENSGNYVILSNMYAEAGMWEEVNHLRALLKSQNVKKNPGCSWIEIKG  514

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            + H F  GD SHPQT+ +Y  L++L EKMK  GYVPDTS  LH+V+++EKE  L  HSE+
Sbjct  515  KAHLFLGGDASHPQTKQIYLLLEELPEKMKAAGYVPDTSFALHDVSEEEKEYSLTTHSEK  574

Query  12   LAIA  1
            LAIA
Sbjct  575  LAIA  578



>gb|ADE76547.1| unknown [Picea sitchensis]
Length=210

 Score =   137 bits (344),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G+++A+ LF+L P+ A  YV LSNIYS+AG W++A  +RR M + GV+KEPG SW++   
Sbjct  26   GKLAAERLFKLRPDRAGTYVALSNIYSAAGRWDEAAKLRRLMNDRGVKKEPGYSWVQVKN  85

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F+ GD SHPQ E +Y  LD L+ +MK  G+VP+T+  LH+V+D++KE  L  HSE+
Sbjct  86   MVHTFSVGDISHPQIEDIYAMLDKLAGQMKTAGHVPNTNFALHDVDDEQKERTLYHHSEK  145

Query  12   LAIA  1
            LAIA
Sbjct  146  LAIA  149



>ref|XP_010088958.1| hypothetical protein L484_013537 [Morus notabilis]
 gb|EXB37173.1| hypothetical protein L484_013537 [Morus notabilis]
Length=312

 Score =   139 bits (351),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E +AK+LFELEP  + +Y+LL+NIYS+AG WE A  +R  MKE GV K PGCSWIE   
Sbjct  128  AEYAAKHLFELEPQSSGNYILLANIYSAAGRWEDAAKIRGLMKERGVTKSPGCSWIEVKR  187

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F AGD SHP  E + + ++ L  ++K+ GYVP+T  VL  V + EKE  LCGHSE+
Sbjct  188  KVHSFIAGDASHPSMEAISEKMESLYVQIKKLGYVPETGFVLRKVEEGEKEFNLCGHSEK  247

Query  12   LAIA  1
            LA+A
Sbjct  248  LALA  251



>ref|XP_004292932.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like 
[Fragaria vesca subsp. vesca]
Length=755

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +AK LF LEP    +Y+LLSNIY+S G+W + + VR  MK +G+RK PGCSWIEF  
Sbjct  571  GESTAKKLFNLEPGNPGNYILLSNIYASKGMWTEVDRVRDTMKSLGLRKNPGCSWIEFKN  630

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH   AGD +HPQ   + + L+ LS +MK+ GY+P T  VL +V + EKE +LCGHSE+
Sbjct  631  NVHMLLAGDKTHPQMNKITEKLNTLSSEMKKSGYLPSTHFVLQDVEEQEKEQILCGHSEK  690

Query  12   LAIA  1
            LA+ 
Sbjct  691  LAVV  694



>ref|XP_008387907.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 
[Malus domestica]
Length=757

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE  AK LF +EP    +Y+LLSNIY+S G+W + + VR  MK +G+RK PGCSWIE   
Sbjct  573  GESVAKKLFNMEPKNPGNYILLSNIYASKGMWTEVDRVRDTMKSLGLRKNPGCSWIELEN  632

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH   AGD  HPQ   + D LD LS +MK+ GY P+T  VL +V + +KE++LCGHSE+
Sbjct  633  KVHMLLAGDTGHPQMNQIIDKLDQLSSEMKKSGYFPNTHFVLQDVEEQDKEHILCGHSEK  692

Query  12   LAIA  1
            LA+A
Sbjct  693  LAVA  696



>ref|XP_009400341.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 
[Musa acuminata subsp. malaccensis]
Length=746

 Score =   144 bits (362),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             EI+A+ LF+LEP  A  YVLLSNIY++ G+ E  + +R  MK MGVRK+PGCSWIE   
Sbjct  562  AEIAAEKLFQLEPGNAGSYVLLSNIYAAKGMLEGVDRMRDVMKNMGVRKDPGCSWIEIKN  621

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH   AGD SHPQ   + + L+ LS +MK  GY+P T  VL +V + +KE +LCGHSE+
Sbjct  622  KVHMLLAGDKSHPQMSQIAERLEKLSVEMKRLGYLPSTDFVLQDVEEQDKEQILCGHSEK  681

Query  12   LAIA  1
            LA+A
Sbjct  682  LAVA  685



>ref|XP_010241184.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g49142 [Nelumbo nucifera]
Length=641

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+AK LF LEP  + +Y+LLSN+Y+  G WE+ N++R  +K  GV+K PGCSW E   
Sbjct  457  GEIAAKQLFILEPENSGNYILLSNMYAEVGRWEEVNNLRALLKNQGVKKSPGCSWTEING  516

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            + H F  GD SHPQ + +Y  L DL +K+K  GY+PDTS VLH+V+++EKE+ L  HSE+
Sbjct  517  KCHLFLGGDTSHPQMKEIYMLLGDLPKKIKAAGYIPDTSFVLHDVSEEEKEHNLTMHSEK  576

Query  12   LAIA  1
            LAIA
Sbjct  577  LAIA  580



>ref|XP_008233430.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like 
[Prunus mume]
Length=372

 Score =   139 bits (351),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 93/125 (74%), Gaps = 1/125 (1%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             EI+A+ LF LEP+ + +YVLLSNIY+ AG+W++ +D+R  +K  G++K PGCSWIE   
Sbjct  187  AEIAARKLFILEPDNSGNYVLLSNIYADAGMWKEVDDLRALLKSQGMKKNPGCSWIEVNG  246

Query  192  EVHKFTAGDGSHPQTEHLYD-FLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSE  16
            + H F  GD SHPQ + +Y+  L++L  K+K  GYVPDTS VLH+V+++EKE+ L  HSE
Sbjct  247  KAHLFLGGDTSHPQAKEIYEVLLEELPNKIKAAGYVPDTSFVLHDVSEEEKEHNLTTHSE  306

Query  15   RLAIA  1
            +LAIA
Sbjct  307  KLAIA  311



>ref|XP_002284744.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 
[Vitis vinifera]
 ref|XP_010664142.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 
[Vitis vinifera]
 ref|XP_010664143.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 
[Vitis vinifera]
 ref|XP_010664144.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 
[Vitis vinifera]
Length=758

 Score =   142 bits (359),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE++A+ LFELEP+   +Y+LLSNIY+S G+W + N VR  MK  G+RK PGCSWIE   
Sbjct  574  GEVAAEKLFELEPSNPGNYILLSNIYASKGMWNEVNRVRDMMKNKGLRKNPGCSWIEVKN  633

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH   AGD SHPQ   + + LD LS +MK+ GY P+ + VL +V + +KE +LCGHSE+
Sbjct  634  KVHMLLAGDKSHPQMTQIIEKLDKLSMEMKKLGYFPEINFVLQDVEEQDKEQILCGHSEK  693

Query  12   LAIA  1
            LA+ 
Sbjct  694  LAVV  697



>ref|XP_008456075.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like 
[Cucumis melo]
Length=679

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             EI+A+ LF LEP  + +YVLLSN+Y+ AG W++ + +R  +K  G +K PGCSWIE   
Sbjct  495  AEIAARKLFVLEPENSGNYVLLSNMYAEAGRWQEVDKLRAIVKSQGTKKSPGCSWIEING  554

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            + H F  GD SHPQ + +Y FL+ L EKMK  GYVPDTS VLH+++++EKE  L  HSE+
Sbjct  555  KAHMFLGGDTSHPQAKEIYMFLEALPEKMKAAGYVPDTSYVLHDISEEEKEFNLIAHSEK  614

Query  12   LAIA  1
            LA+A
Sbjct  615  LAVA  618



>ref|XP_004156102.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g23330-like [Cucumis sativus]
Length=642

 Score =   141 bits (355),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 63/124 (51%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E +A+ LF LEP    +YVLLSN+Y+ AG W++ + +R  +K  G +K PGCSWIE   
Sbjct  458  AETAARKLFVLEPENTGNYVLLSNMYAEAGRWQEVDKLRAIVKSQGTKKSPGCSWIEING  517

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            + H F  GD SHPQ + +Y FL+ L EKMK  GY PDTS VLH+++++EKE  L  HSE+
Sbjct  518  KAHMFLGGDTSHPQGKEIYMFLEALPEKMKAAGYFPDTSYVLHDISEEEKEFNLIAHSEK  577

Query  12   LAIA  1
            LA+A
Sbjct  578  LAVA  581



>ref|XP_008356987.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g49142 [Malus domestica]
Length=626

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 94/125 (75%), Gaps = 1/125 (1%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             EI+A++LF LEP  + +YV+LSNIY+ AG+W++ +++R  +K  GV+K PGCSW E   
Sbjct  441  AEIAARSLFILEPENSGNYVMLSNIYAEAGMWKEVDNLRVLLKAQGVKKNPGCSWTEVNG  500

Query  192  EVHKFTAGDGSHPQTEHLYDF-LDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSE  16
            + H F  GD SHPQ + +Y+F LD+L +K+K  GYVPDTS VLH+V+++EKE+ L  HSE
Sbjct  501  KAHLFLGGDTSHPQAKEIYEFLLDELPKKIKAAGYVPDTSFVLHDVSEEEKEHSLTTHSE  560

Query  15   RLAIA  1
            +LAIA
Sbjct  561  KLAIA  565



>ref|XP_009800009.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like 
[Nicotiana sylvestris]
Length=625

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E++AK LF LEP+ + +YV+LSN+Y+ AG+WE+ N +R  +K   + K PGCSWIEF  
Sbjct  441  AELAAKKLFILEPDNSGNYVVLSNMYAEAGMWEEVNYLRIQLKSQRIMKNPGCSWIEFEG  500

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            + H F  GD SHPQ E +Y FL+ L  K++  GY+PDT+  LH+V+++EKE  L  HSER
Sbjct  501  KAHLFLGGDTSHPQAEQIYMFLEALPAKIRAAGYIPDTTFALHDVSEEEKEQNLSSHSER  560

Query  12   LAIA  1
            LAIA
Sbjct  561  LAIA  564



>ref|XP_009616454.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like 
[Nicotiana tomentosiformis]
Length=625

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E++AK LF LEP+ + +YV+LSN+Y+ AG+WE+ ND+R  +K   + K PGCSWIEF  
Sbjct  441  AELAAKKLFILEPDNSGNYVVLSNMYAEAGMWEEVNDLRIQLKSQRIMKNPGCSWIEFEG  500

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            + H F  GD SHPQ E +Y FL+ L  K++  GY+PDT+  LH+V+++EK   L  HSER
Sbjct  501  KAHLFLGGDTSHPQAEQIYMFLEALPAKIRAAGYMPDTTFALHDVSEEEKVQNLSSHSER  560

Query  12   LAIA  1
            LAIA
Sbjct  561  LAIA  564



>ref|XP_008787969.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Phoenix dactylifera]
Length=694

 Score =   141 bits (356),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 65/121 (54%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = -3

Query  363  SAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGEEVH  184
            +A+ LFELEP  A+ YV L+NIY+S+GLW++   +R+ M   GV K+PG SWIE    VH
Sbjct  513  AAEALFELEPENAATYVTLANIYASSGLWDEVEKIRKTMDSRGVVKKPGSSWIEVKRRVH  572

Query  183  KFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSERLAI  4
             F  GD SHPQ + +Y  +D L  ++KEEGYVPDT  VLH+V D++KE  L  HSERLA+
Sbjct  573  VFLVGDKSHPQAQEIYACMDKLYARLKEEGYVPDTDFVLHDVEDEQKEEDLAHHSERLAV  632

Query  3    A  1
            A
Sbjct  633  A  633



>ref|XP_008379537.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g49142 [Malus domestica]
Length=585

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 94/125 (75%), Gaps = 1/125 (1%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             EI+A++LF LEP  + +YV+LSNIY+ AG+W++ +++R  +K  GV+K PGCSW E   
Sbjct  400  AEIAARSLFILEPENSGNYVMLSNIYAEAGMWKEVDNLRVLLKAQGVKKNPGCSWTEVNG  459

Query  192  EVHKFTAGDGSHPQTEHLYDF-LDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSE  16
            + H F  GD SHPQ + +Y+F LD+L +K+K  GYVPDTS VLH+V+++EKE+ L  HSE
Sbjct  460  KAHLFLGGDTSHPQAKEIYEFLLDELPKKIKAAGYVPDTSFVLHDVSEEEKEHSLTTHSE  519

Query  15   RLAIA  1
            +LAIA
Sbjct  520  KLAIA  524



>ref|XP_007017888.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
 gb|EOY15113.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
Length=758

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+NLF+LEP+   +Y+LLSNIY+S G+W++ + VR  M+  G++K PGCSWIE   
Sbjct  574  GEIAAQNLFKLEPSNPGNYILLSNIYASKGMWDEVDAVRDVMRSRGMKKNPGCSWIEIKN  633

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH   AGD SHPQ   + + +  LS  MK+ GY+P+T  VL +V++ +KE +LCGHSE+
Sbjct  634  QVHMLLAGDKSHPQMTEIIEKIYKLSMDMKKAGYLPNTDFVLQDVDEQDKEQILCGHSEK  693

Query  12   LAIA  1
            LA+A
Sbjct  694  LAVA  697



>ref|XP_009334614.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 
[Pyrus x bretschneideri]
Length=731

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE  AK LF +EP    +Y+LLSNIY+S G+W + + VR  MK +G+RK PGCSWIE   
Sbjct  584  GESVAKKLFNMEPKNPGNYILLSNIYASKGMWTEVDRVRDTMKSLGLRKNPGCSWIELKN  643

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +V+   AGD  HPQ   + D LD LS +MK+ GY P+T  VL +V + +KE++LCGHSE+
Sbjct  644  KVNMLLAGDKGHPQMNQIIDKLDQLSSEMKKSGYFPNTHFVLQDVEEQDKEHILCGHSEK  703

Query  12   LAIA  1
            LA+A
Sbjct  704  LAVA  707



>gb|KHN24542.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=598

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+ LF LEP    +Y+LLSNIY+S GLW++ N +R  MK  G+RK PG SWIE G 
Sbjct  414  GEIAAEKLFFLEPTNPGNYILLSNIYASKGLWDEENRIREVMKSKGLRKNPGYSWIEVGH  473

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH   AGD SHPQ + + + LD L+ +MK+ GY+P T+ VL +V + +KE +LCGHSE+
Sbjct  474  KVHMLLAGDQSHPQMKDILEKLDKLNMQMKKSGYLPKTNFVLQDVEEQDKEQILCGHSEK  533

Query  12   LAIA  1
            LA+ 
Sbjct  534  LAVV  537



>ref|XP_004140278.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like 
[Cucumis sativus]
 gb|KGN48088.1| hypothetical protein Csa_6G430650 [Cucumis sativus]
Length=679

 Score =   141 bits (355),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 63/124 (51%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E +A+ LF LEP    +YVLLSN+Y+ AG W++ + +R  +K  G +K PGCSWIE   
Sbjct  495  AETAARKLFVLEPENTGNYVLLSNMYAEAGRWQEVDKLRAIVKSQGTKKSPGCSWIEING  554

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            + H F  GD SHPQ + +Y FL+ L EKMK  GY PDTS VLH+++++EKE  L  HSE+
Sbjct  555  KAHMFLGGDTSHPQGKEIYMFLEALPEKMKAAGYFPDTSYVLHDISEEEKEFNLIAHSEK  614

Query  12   LAIA  1
            LA+A
Sbjct  615  LAVA  618



>ref|XP_010255012.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like 
[Nelumbo nucifera]
Length=686

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G+++A  LFE+EP    +Y+LLSNI+ SA +W  A+ +R+ M++ GV K PGCSW++   
Sbjct  502  GQVAANKLFEIEPENPGNYILLSNIFVSAKMWLDASKIRKLMRDRGVTKAPGCSWVQVKN  561

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F  GD  + Q+  +Y FLD+L EKM+  GY+PDT  VL +V+ +EKE LLC HSER
Sbjct  562  RVHTFVVGDKRNEQSNEIYRFLDELREKMRLAGYLPDTGFVLQDVDQEEKEELLCNHSER  621

Query  12   LAIA  1
            LA+A
Sbjct  622  LAVA  625



>ref|XP_007152607.1| hypothetical protein PHAVU_004G144300g [Phaseolus vulgaris]
 gb|ESW24601.1| hypothetical protein PHAVU_004G144300g [Phaseolus vulgaris]
Length=601

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+ LF LEP    +YVLLSNIY+S GLW++ N +R  MK  G+RK PG SWIE G 
Sbjct  417  GEIAAEKLFPLEPANPGNYVLLSNIYASKGLWDEENRIREMMKSKGLRKNPGYSWIEVGH  476

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH   AGD SHPQ + + + LD L+ +MK+ GY+P T+ VL +V + +KE +LCGHSE+
Sbjct  477  KVHMLLAGDQSHPQMKDILEKLDKLNMEMKKSGYLPKTNFVLQDVEEQDKEQILCGHSEK  536

Query  12   LAIA  1
            LA+ 
Sbjct  537  LAVV  540



>gb|AEX12049.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12052.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12056.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12057.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12058.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12065.1| hypothetical protein 0_18789_01 [Pinus radiata]
Length=161

 Score =   133 bits (334),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE  AK+LFEL+   AS+YVLLSN+Y++   W+    VR+ MK+ G++K PG SWIE   
Sbjct  18   GERVAKSLFELDSKNASYYVLLSNLYAACSRWDDVKRVRKIMKDQGIQKMPGSSWIEVNG  77

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +V+ F  GD SHPQ+E +YD L+ L  KM + GYVP+    LH+V +++KEN+L  HSE+
Sbjct  78   KVYAFLVGDKSHPQSEKIYDMLEKLFGKMMDAGYVPEIDFALHDVEEEQKENILGHHSEK  137

Query  12   LAIA  1
            LAIA
Sbjct  138  LAIA  141



>gb|AEX12062.1| hypothetical protein 0_18789_01 [Pinus taeda]
Length=161

 Score =   133 bits (334),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE  AK+LFEL+   AS+YVLLSN+Y++   W+    VR+ MK+ G++K PG SWIE   
Sbjct  18   GERVAKSLFELDSKNASYYVLLSNLYAACSRWDDVKRVRKIMKDQGIQKMPGSSWIEVNG  77

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +V+ F  GD SHPQ+E +YD L+ L  KM + GYVP+    LH+V +++KEN+L  HSE+
Sbjct  78   KVYAFLVGDKSHPQSEKIYDMLEKLFGKMMDAGYVPEIDFALHDVEEEQKENILGHHSEK  137

Query  12   LAIA  1
            LAIA
Sbjct  138  LAIA  141



>ref|XP_008783875.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Phoenix dactylifera]
Length=648

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE++ + L ELEPN A +YVLLSNIY+ AG WE+A  VR+ M + G++K   CSWIE   
Sbjct  464  GELALQKLIELEPNDAGNYVLLSNIYAQAGKWEEAARVRKLMTDRGLKKSIACSWIEVKG  523

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F  GD SHP++E +Y  L+ L   MKE GYVPDT  V H+V DDEK+N++  HSER
Sbjct  524  TVHAFLVGDLSHPRSEEIYAELEILEGLMKEAGYVPDTMSVFHDVEDDEKQNMVRSHSER  583

Query  12   LAIA  1
            LAIA
Sbjct  584  LAIA  587



>gb|ACE80748.1| pentatricopeptide repeat protein, partial [Lepidogyna hodgsoniae]
Length=143

 Score =   132 bits (332),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE  A+ + EL+P  AS YV+LSNIY++AG W+++ D+++   E GV+K+PGC+WI   +
Sbjct  5    GERIARKVLELDPQNASGYVMLSNIYAAAGKWDRSADIQQLRMERGVKKQPGCTWIAVDD  64

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F   D +HPQ   ++  L+ LS++MKE GYVPDT  VLH+V+++EK   LC HSE+
Sbjct  65   LVHSFIVDDETHPQIVEIHTELERLSQEMKESGYVPDTGFVLHDVDEEEKLGRLCHHSEK  124

Query  12   LAIA  1
            LAI 
Sbjct  125  LAIG  128



>ref|XP_010923157.1| PREDICTED: pentatricopeptide repeat-containing protein At2g39620 
[Elaeis guineensis]
Length=1006

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+  +L  LEP  A+HYV+L+NIYS AG W  A  VR  M   G+ K PGCSW+E   
Sbjct  822  GEIAVDHLVRLEPENAAHYVVLANIYSQAGRWADARKVRVAMNHTGLNKTPGCSWVEINN  881

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             +H F AGD SHPQ + + D  + L EKM++ GYVPDTS VLHNV ++EK + L GHSER
Sbjct  882  AIHAFRAGDQSHPQYKSMCDVWNGLFEKMEKMGYVPDTSSVLHNVEEEEKLSFLHGHSER  941

Query  12   LAIA  1
            LAI+
Sbjct  942  LAIS  945



>gb|EYU26534.1| hypothetical protein MIMGU_mgv1a024701mg, partial [Erythranthe 
guttata]
Length=518

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E++AK LF LEP  + +YV+LSN+Y+ AG+WE+ + +R  +K   V+K PGCSWIE   
Sbjct  334  AELAAKKLFVLEPENSGNYVILSNMYAEAGMWEEVDSLRGVLKSKCVKKNPGCSWIEMNG  393

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            + H F  GD SH QT  +Y FL++L EKMK  GYVPDT   LH+++++EKE  L  HSE+
Sbjct  394  KAHLFLGGDASHAQTREIYSFLEELPEKMKAAGYVPDTRFALHDISEEEKEFSLTTHSEK  453

Query  12   LAIA  1
            LAIA
Sbjct  454  LAIA  457



>ref|XP_010257783.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g13770, mitochondrial [Nelumbo nucifera]
Length=782

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE  A  LFE+EP+ A +YV+LSN+Y+SAG W     +R+ M E  V KEPG SWI  G+
Sbjct  458  GEYVAHRLFEIEPHNAGNYVILSNLYASAGRWADVTYIRQLMTEKSVAKEPGRSWINLGQ  517

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             +H F A D SHP+ E +++ + +LS K+KE GYVPD SCVLH+V++++KE +L GHSE+
Sbjct  518  TIHTFHASDRSHPRREEIFEKVRELSAKIKEAGYVPDLSCVLHDVDEEQKEKILLGHSEK  577

Query  12   LAIA  1
            LA+A
Sbjct  578  LALA  581



>ref|XP_003549191.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like 
isoform X1 [Glycine max]
Length=748

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+ LF LEP    +Y+LLSNIY+S GLW++ N +R  MK  G+RK PG SWIE G 
Sbjct  564  GEIAAEKLFFLEPTNPGNYILLSNIYASKGLWDEENRIREVMKSKGLRKNPGYSWIEVGH  623

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH   AGD SHPQ + + + LD L+ +MK+ GY+P T+ VL +V + +KE +LCGHSE+
Sbjct  624  KVHMLLAGDQSHPQMKDILEKLDKLNMQMKKSGYLPKTNFVLQDVEEQDKEQILCGHSEK  683

Query  12   LAIA  1
            LA+ 
Sbjct  684  LAVV  687



>ref|XP_010915642.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Elaeis guineensis]
Length=650

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE++ + L ELEPN A +YVLLSNIY+ AG WE+A  VR+ M + G++K   CSWIE   
Sbjct  466  GELALQKLIELEPNDAGNYVLLSNIYAQAGKWEEAAKVRKLMTDRGLKKSIACSWIEVKG  525

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F  GD SHP++E +Y  L+ L   MKE GYVPDT  V H+V DDEK N++  HSER
Sbjct  526  TVHAFLVGDSSHPRSEEIYTELELLEGLMKEAGYVPDTMPVFHDVEDDEKHNMVRSHSER  585

Query  12   LAIA  1
            LAIA
Sbjct  586  LAIA  589



>gb|AEX12054.1| hypothetical protein 0_18789_01 [Pinus taeda]
Length=161

 Score =   132 bits (331),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE  AK+LFEL+    S+YVLLSNIY++   W+    VR+ MK+ G++K PG SWIE   
Sbjct  18   GERVAKSLFELDSKNPSYYVLLSNIYAACSRWDDVKRVRKIMKDQGIQKMPGSSWIEVNG  77

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +V+ F  GD SHPQ+E +YD L+ L  KM + GYVP+    LH+V +++KEN+L  HSE+
Sbjct  78   KVYAFLVGDKSHPQSEKIYDMLEKLFGKMMDAGYVPEIDFALHDVEEEQKENILGHHSEK  137

Query  12   LAIA  1
            LAIA
Sbjct  138  LAIA  141



>ref|XP_004511479.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At4g37170-like [Cicer arietinum]
Length=700

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E +AK LFE+EP   + Y+ L+NIY++AGLW K   VR++M+  G+ K+PG SWIE   
Sbjct  481  AERAAKALFEIEPENPATYITLANIYANAGLWTKVAKVRKDMENRGIVKKPGKSWIEIKR  540

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F  GD SHP+T  +++FL +LS KMKEEGYVPDT+ VLH+V +++KE  L  HSE+
Sbjct  541  QVHVFLVGDKSHPKTSDIHEFLGELSTKMKEEGYVPDTNFVLHDVEEEQKEQNLFYHSEK  600

Query  12   LAIA  1
            LA+A
Sbjct  601  LAVA  604



>ref|XP_004515286.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like 
[Cicer arietinum]
Length=730

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+ LF LEP+   +YVLLSNIY+S G+W + N +R  MK  G+RK PGCSWIE G 
Sbjct  546  GEIAAEKLFVLEPDNPGNYVLLSNIYASKGMWGEENRIRNMMKNKGLRKNPGCSWIEIGR  605

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH   +GD SHPQ + + +  D LS ++K+ GY+P T+ VL +V + +KE +LCGHSE+
Sbjct  606  RVHTLLSGDKSHPQMKEILEKSDKLSIEIKKSGYLPMTNTVLQDVEEQDKEQILCGHSEK  665

Query  12   LAIA  1
            LA+ 
Sbjct  666  LAVV  669



>gb|ACE80749.1| pentatricopeptide repeat protein, partial [Lepidogyna hodgsoniae]
Length=143

 Score =   131 bits (329),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE  AK L +L+P  A  YVL+SNIY+++G WE +  V+    + GV+K+PGCSWIE  +
Sbjct  5    GERVAKQLLQLDPGNAGAYVLMSNIYAASGKWESSASVQELRLQRGVKKQPGCSWIEVNK  64

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            ++H F AGD SHPQ   + + L+ L   +K  GYVPDTS VLH+V++++KE  LC HSE+
Sbjct  65   QLHSFAAGDLSHPQKAGILEELERLFGLIKVAGYVPDTSFVLHDVDENKKEVRLCHHSEK  124

Query  12   LAIA  1
            LAIA
Sbjct  125  LAIA  128



>ref|XP_010685014.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010685015.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010685016.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Beta vulgaris subsp. vulgaris]
Length=653

 Score =   139 bits (349),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 62/124 (50%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+ + L ELEPN + +YV+LSNIY+ AG W+    VRR M + G++K   CSWIEF  
Sbjct  469  GEIALEKLVELEPNDSGNYVILSNIYAQAGQWDGVARVRRLMIDRGIKKSIACSWIEFKN  528

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVH F +GD SHP  + +Y  L+ +++ + E GYVP    V H++ DDEK +++C HSER
Sbjct  529  EVHAFLSGDTSHPMCDAIYAELERVTKLVTEAGYVPTIGTVFHDIEDDEKTSMVCSHSER  588

Query  12   LAIA  1
            LAIA
Sbjct  589  LAIA  592



>ref|XP_010657692.1| PREDICTED: pentatricopeptide repeat-containing protein ELI1, 
chloroplastic-like [Vitis vinifera]
Length=686

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E++A+ LF LEP+ + +YVLLSN+Y+ AG+WE+   +R  +K  G++K PGCSWIE   
Sbjct  502  AELAARRLFVLEPDNSGNYVLLSNLYAEAGMWEEVKKLRALLKYQGMKKSPGCSWIEING  561

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            + H F   D SHPQ + +Y FL+ L EK+K  GY+PDTS VLH+++++EKE  L  HSE+
Sbjct  562  KSHLFMGADKSHPQAKEIYKFLEALPEKIKMAGYIPDTSFVLHDISEEEKEYNLTTHSEK  621

Query  12   LAIA  1
            LAIA
Sbjct  622  LAIA  625



>ref|XP_007218862.1| hypothetical protein PRUPE_ppa002838mg [Prunus persica]
 gb|EMJ20061.1| hypothetical protein PRUPE_ppa002838mg [Prunus persica]
Length=628

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 92/125 (74%), Gaps = 1/125 (1%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             EI+A+ LF LEP+ + +YVLLSNIY+ AG+W++ +D+R  +K  G++K PGCSWIE   
Sbjct  443  AEIAARKLFILEPDNSGNYVLLSNIYADAGMWKEVDDLRALLKSQGMKKNPGCSWIEVNG  502

Query  192  EVHKFTAGDGSHPQTEHLYD-FLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSE  16
            + H F  GD  HPQ + +Y+  L++L  K+K  GYVPDTS VLH+V+++EKE+ L  HSE
Sbjct  503  KAHLFLGGDTCHPQAKEIYEVLLEELPNKIKAAGYVPDTSFVLHDVSEEEKEHNLTTHSE  562

Query  15   RLAIA  1
            +LAIA
Sbjct  563  KLAIA  567



>gb|KHN30207.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=636

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 91/121 (75%), Gaps = 0/121 (0%)
 Frame = -3

Query  363  SAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGEEVH  184
            +AK L+E+EP   + Y+ L+NIY++AGLW +  +VR++M  MG+ K+PG SWIE   +VH
Sbjct  455  AAKALYEIEPENPATYITLANIYANAGLWSEVANVRKDMDNMGIVKKPGKSWIEIKRQVH  514

Query  183  KFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSERLAI  4
             F  GD SHP+T  +++FL  LS+K+KEEGYVPDT+ VLH+V +++KE  L  HSE+LA+
Sbjct  515  VFLVGDTSHPKTSDIHEFLGKLSKKIKEEGYVPDTNFVLHDVEEEQKEQNLVYHSEKLAV  574

Query  3    A  1
            A
Sbjct  575  A  575



>ref|XP_004231338.2| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like 
[Solanum lycopersicum]
Length=626

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E++AK LF LEP+ + +Y++LSN+Y+ AG+WE+   +R   K   + K PGCSWIEF  
Sbjct  442  AELAAKKLFILEPDNSGNYIVLSNMYAEAGMWEEVTHLRIQQKSRRIMKSPGCSWIEFDG  501

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            + H F  GD SHPQ E +Y FL+ L  K+K  GY+PDT+  LH+V+++EKE  L  HSER
Sbjct  502  KAHLFLGGDTSHPQAEQIYLFLEALPAKIKAAGYMPDTTFALHDVSEEEKEQNLSSHSER  561

Query  12   LAIA  1
            LAIA
Sbjct  562  LAIA  565



>ref|XP_008221208.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 
[Prunus mume]
Length=756

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G+  AK LF LEP    +Y+LLSNIY+S G+W + + VR  MK +G+RK PGCSWIE   
Sbjct  572  GKYVAKKLFNLEPKNPGNYILLSNIYASKGMWSEVDRVRDKMKSLGLRKNPGCSWIEVKN  631

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH   AGD +HPQ   + + L++LS +MK+ GY P+T  VL +V + +KE +LCGHSE+
Sbjct  632  KVHMLLAGDKAHPQMNQIIEKLNELSSEMKKSGYFPNTHFVLQDVEEQDKEQILCGHSEK  691

Query  12   LAIA  1
            LA+ 
Sbjct  692  LAVV  695



>gb|AEX12061.1| hypothetical protein 0_18789_01 [Pinus taeda]
Length=161

 Score =   130 bits (328),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE  AK+LFEL+    S+YVLLSNIY++   W+    VR+ MK+ G++K PG SWIE   
Sbjct  18   GERVAKSLFELDSKNPSYYVLLSNIYAACSRWDDVKRVRKIMKDEGIQKMPGSSWIEVNG  77

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +V+ F  GD SHPQ+E +YD L+ L  KM + GYVP+    LH+V +++KEN+L  HSE+
Sbjct  78   KVYAFLVGDKSHPQSEKIYDMLEKLFGKMMDAGYVPEIDFALHDVEEEQKENILGHHSEK  137

Query  12   LAIA  1
            LAIA
Sbjct  138  LAIA  141



>emb|CBI23791.3| unnamed protein product [Vitis vinifera]
Length=615

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E++A+ LF LEP+ + +YVLLSN+Y+ AG+WE+   +R  +K  G++K PGCSWIE   
Sbjct  431  AELAARRLFVLEPDNSGNYVLLSNLYAEAGMWEEVKKLRALLKYQGMKKSPGCSWIEING  490

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            + H F   D SHPQ + +Y FL+ L EK+K  GY+PDTS VLH+++++EKE  L  HSE+
Sbjct  491  KSHLFMGADKSHPQAKEIYKFLEALPEKIKMAGYIPDTSFVLHDISEEEKEYNLTTHSEK  550

Query  12   LAIA  1
            LAIA
Sbjct  551  LAIA  554



>gb|AEX12050.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12051.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12053.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12055.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12059.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12060.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12063.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12064.1| hypothetical protein 0_18789_01 [Pinus taeda]
Length=161

 Score =   130 bits (328),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE  AK+LFEL+    S+YVLLSNIY++   W+    VR+ MK+ G++K PG SWIE   
Sbjct  18   GERVAKSLFELDSKNPSYYVLLSNIYAACSRWDDVKRVRKIMKDEGIQKMPGSSWIEVNG  77

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +V+ F  GD SHPQ+E +YD L+ L  KM + GYVP+    LH+V +++KEN+L  HSE+
Sbjct  78   KVYAFLVGDKSHPQSEKIYDMLEKLFGKMMDAGYVPEIDFALHDVEEEQKENILGHHSEK  137

Query  12   LAIA  1
            LAIA
Sbjct  138  LAIA  141



>ref|XP_004308755.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like 
[Fragaria vesca subsp. vesca]
Length=631

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E +A+NLF LEP+ + +YVLLSNIY+ AG+W++ + +R  +K  G++K PGCSWIE   
Sbjct  385  AETAARNLFILEPDNSGNYVLLSNIYAEAGMWKEVDKLRILLKSQGMKKSPGCSWIEVNG  444

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            + H F  GD SHPQ + +Y  L++L +KMK  GYVPDT   LH+V+++EKE+ L  HSE+
Sbjct  445  KAHLFLGGDTSHPQAKEVYMLLEELPKKMKAAGYVPDTRFSLHDVSEEEKEHNLTTHSEK  504

Query  12   LAIA  1
            LAIA
Sbjct  505  LAIA  508



>emb|CBI24272.3| unnamed protein product [Vitis vinifera]
Length=729

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E +A+ LFELEP  + +YVL++NIYS+AG WE A  +R  MKE GV K PGCSWIE   
Sbjct  545  AEYAARYLFELEPQSSGNYVLMANIYSAAGRWEDAAKIRCLMKERGVTKPPGCSWIEVKR  604

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            ++H F  GD SHP  E +   ++ L   +KE GYVPDT+ VL +V++DEKE  LCGHSE+
Sbjct  605  KLHSFVVGDTSHPLMEQISAKMESLYFDIKEIGYVPDTNFVLQDVDEDEKEFSLCGHSEK  664

Query  12   LAIA  1
            +A+A
Sbjct  665  IALA  668



>gb|ABK26521.1| unknown [Picea sitchensis]
Length=370

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E + + L EL P     YVLLSNIY++AG W+ A  VR+ MK+  V+KEPGCSWIE   
Sbjct  186  AERAVEQLIELTPENPGTYVLLSNIYAAAGRWDDAGKVRKMMKDRSVKKEPGCSWIEVQN  245

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F  GD SHPQ E +Y+ L+ L+ +MK  GY+P+T+ VLH+V +++KE +L  HSE+
Sbjct  246  KVHPFIVGDSSHPQIEEIYETLETLTLQMKAAGYIPNTNFVLHDVEEEQKEWILGHHSEK  305

Query  12   LAIA  1
            LAIA
Sbjct  306  LAIA  309



>ref|XP_009615068.1| PREDICTED: pentatricopeptide repeat-containing protein At3g63370 
[Nicotiana tomentosiformis]
Length=956

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 87/125 (70%), Gaps = 1/125 (1%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+AK L ELEP    +YVL+SN+Y++   W+   DVR  MK  G++K+P CSWIE G+
Sbjct  771  GEIAAKKLLELEPKNPGNYVLVSNVYAAIDRWDDVEDVRVTMKGKGLKKDPACSWIEVGD  830

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKM-KEEGYVPDTSCVLHNVNDDEKENLLCGHSE  16
            +VH F A D SHP+ + +Y+ L  L+EK+ KE GYV  T CVL NV + EK  LL GHSE
Sbjct  831  KVHTFVAQDKSHPECDRIYEKLAHLTEKLEKEAGYVAQTKCVLQNVEEKEKVKLLKGHSE  890

Query  15   RLAIA  1
            RLAIA
Sbjct  891  RLAIA  895



>ref|XP_010242634.1| PREDICTED: pentatricopeptide repeat-containing protein At2g39620 
[Nelumbo nucifera]
Length=1005

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE++  NL  LEP   +HYV+LSNIY+ +  W    ++R  M   G++K PGCSW+E  +
Sbjct  821  GEVALNNLVRLEPQNPAHYVVLSNIYAQSSRWADVGEMRTKMNSKGLKKTPGCSWVEIKD  880

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F  GD +HPQ E + +  + L +KM++ GYVPDT+CVLHNV ++EKE+ L  HSER
Sbjct  881  TVHAFRVGDQTHPQLESMNEIWNGLLDKMEKMGYVPDTTCVLHNVEEEEKESFLYSHSER  940

Query  12   LAIA  1
            LAIA
Sbjct  941  LAIA  944



>ref|XP_007150279.1| hypothetical protein PHAVU_005G140500g [Phaseolus vulgaris]
 gb|ESW22273.1| hypothetical protein PHAVU_005G140500g [Phaseolus vulgaris]
Length=681

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 91/121 (75%), Gaps = 0/121 (0%)
 Frame = -3

Query  363  SAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGEEVH  184
            +AK L+++EP   + Y+ L+NIY++AGLW +   VR++M   G+ K+PG SWIE   +VH
Sbjct  500  AAKALYDIEPENPATYITLANIYANAGLWTEVAKVRKDMDNRGIVKKPGKSWIEIKRQVH  559

Query  183  KFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSERLAI  4
             F  GD SHP+T H+++FL +LS+KMKEEGYVPDT+ VLH+V +++KE  L  HSE+LA+
Sbjct  560  VFLVGDTSHPKTSHIHEFLVELSKKMKEEGYVPDTNFVLHDVEEEQKEQNLVYHSEKLAV  619

Query  3    A  1
            A
Sbjct  620  A  620



>ref|XP_010278235.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
isoform X2 [Nelumbo nucifera]
Length=710

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = -3

Query  363  SAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGEEVH  184
            +A+ LFE+EP  A+ YV L+NIY++AG+W++   VR+ M   GV K+PG SWI+   +VH
Sbjct  529  AAEALFEIEPENAATYVTLANIYATAGMWDEVAKVRKIMDNRGVVKKPGSSWIKIKRDVH  588

Query  183  KFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSERLAI  4
             F  GD SHP+T+ +Y+FL+ LS+++KEEGYVPDT+ VLH+V +++KE  L  HSE+LA+
Sbjct  589  VFLVGDKSHPKTKEIYEFLEKLSKRIKEEGYVPDTNFVLHDVEEEQKEQNLSHHSEKLAV  648

Query  3    A  1
            A
Sbjct  649  A  649



>ref|XP_007051907.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
 gb|EOX96064.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
Length=809

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +AKNLFELEP  A  Y++LSN+YS++G WE+A  +RR MK  G+ KEPGCSWIE   
Sbjct  625  GERAAKNLFELEPWNAVPYIMLSNMYSASGKWEEAARIRRTMKSRGINKEPGCSWIEVNS  684

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH+F + D  HP+T  +Y  +D++  ++KE GYVPD S  LHN +++ KE  L  HSE+
Sbjct  685  RVHRFMSEDRGHPRTGEIYSKIDEMMLQIKEAGYVPDISFALHNTDEEGKELGLAYHSEK  744

Query  12   LAIA  1
            LAIA
Sbjct  745  LAIA  748



>ref|XP_010278229.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
isoform X1 [Nelumbo nucifera]
 ref|XP_010278231.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
isoform X1 [Nelumbo nucifera]
 ref|XP_010278232.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
isoform X1 [Nelumbo nucifera]
 ref|XP_010278233.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
isoform X1 [Nelumbo nucifera]
 ref|XP_010278234.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
isoform X1 [Nelumbo nucifera]
Length=713

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = -3

Query  363  SAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGEEVH  184
            +A+ LFE+EP  A+ YV L+NIY++AG+W++   VR+ M   GV K+PG SWI+   +VH
Sbjct  532  AAEALFEIEPENAATYVTLANIYATAGMWDEVAKVRKIMDNRGVVKKPGSSWIKIKRDVH  591

Query  183  KFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSERLAI  4
             F  GD SHP+T+ +Y+FL+ LS+++KEEGYVPDT+ VLH+V +++KE  L  HSE+LA+
Sbjct  592  VFLVGDKSHPKTKEIYEFLEKLSKRIKEEGYVPDTNFVLHDVEEEQKEQNLSHHSEKLAV  651

Query  3    A  1
            A
Sbjct  652  A  652



>ref|XP_007227203.1| hypothetical protein PRUPE_ppa019251mg [Prunus persica]
 gb|EMJ28402.1| hypothetical protein PRUPE_ppa019251mg [Prunus persica]
Length=654

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G+  AK LF LEP    +Y+LLSNIY+S G+W + + VR  MK +G+RK PGCSWIE   
Sbjct  470  GKYVAKKLFNLEPKNPGNYILLSNIYASKGMWSEVDKVRDKMKSLGLRKNPGCSWIEVKN  529

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH   AGD +HPQ   + + L+ LS +MK+ GY P+T  VL +V + +KE +LCGHSE+
Sbjct  530  KVHMLLAGDKAHPQMNQIIEKLNKLSSEMKKLGYFPNTHFVLQDVEEQDKEQILCGHSEK  589

Query  12   LAIA  1
            LA+ 
Sbjct  590  LAVV  593



>ref|XP_009781104.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g49142 isoform X2 [Nicotiana sylvestris]
Length=537

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G ++A NLFEL P  + +YVLLSNIY+ AG WE    VR  MK  G++K PG S IE   
Sbjct  353  GLVAADNLFELSPKQSGYYVLLSNIYAKAGRWEDVTTVRSIMKGRGIKKMPGISNIELNN  412

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F AGD SHPQ++ +Y+ LD L  KMKEEGYVP+T   LH+V +++KEN L  HSE+
Sbjct  413  MVHTFLAGDTSHPQSKKIYEELDILIGKMKEEGYVPETDAALHDVEEEDKENHLVVHSEK  472

Query  12   LAIA  1
            LAI 
Sbjct  473  LAIV  476



>emb|CDP07349.1| unnamed protein product [Coffea canephora]
Length=760

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE++A  LF LEP    +Y+LLSNIY++ G W + + VR  MK  G++K PGCSWIE   
Sbjct  576  GEVAANRLFALEPKNPGNYILLSNIYAARGKWTEMDKVRDMMKRAGLKKNPGCSWIEVKN  635

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH   AGD SHPQ   + + L+ LS +MK+ GY+PDT  VL +V + EKE++LCGHSE+
Sbjct  636  RVHMLLAGDKSHPQMAQILEKLNKLSMEMKKSGYLPDTDFVLQDVEEQEKEHILCGHSEK  695

Query  12   LAIA  1
            LA+ 
Sbjct  696  LAVV  699



>ref|XP_009800457.1| PREDICTED: pentatricopeptide repeat-containing protein At3g63370 
[Nicotiana sylvestris]
Length=956

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 87/125 (70%), Gaps = 1/125 (1%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+AK L ELEP    +Y+L+SN+Y++   W+   DVR  MK  G++K+P CSWIE G+
Sbjct  771  GEIAAKKLLELEPKNPGNYILVSNVYAAIDRWDDVEDVRVTMKGKGLKKDPACSWIEVGD  830

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKM-KEEGYVPDTSCVLHNVNDDEKENLLCGHSE  16
            +VH F A D SHP+ + +Y+ L  L+EK+ KE GYV  T CVL NV + EK  LL GHSE
Sbjct  831  KVHAFVAQDKSHPECDRIYEKLAHLTEKLEKEAGYVAQTKCVLQNVEEKEKVKLLKGHSE  890

Query  15   RLAIA  1
            RLAIA
Sbjct  891  RLAIA  895



>ref|XP_002265253.2| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial-like [Vitis vinifera]
Length=977

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E +A+ LFELEP  + +YVL++NIYS+AG WE A  +R  MKE GV K PGCSWIE   
Sbjct  793  AEYAARYLFELEPQSSGNYVLMANIYSAAGRWEDAAKIRCLMKERGVTKPPGCSWIEVKR  852

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            ++H F  GD SHP  E +   ++ L   +KE GYVPDT+ VL +V++DEKE  LCGHSE+
Sbjct  853  KLHSFVVGDTSHPLMEQISAKMESLYFDIKEIGYVPDTNFVLQDVDEDEKEFSLCGHSEK  912

Query  12   LAIA  1
            +A+A
Sbjct  913  IALA  916



>emb|CDO97555.1| unnamed protein product [Coffea canephora]
Length=585

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E++AK LF LEP  A +YV+LSN+Y+ A +WE+ N +R   K  GV+K PGCSW E   
Sbjct  401  AELAAKKLFVLEPANAGNYVMLSNMYAKADMWEEVNSLRTLFKSKGVKKTPGCSWTEVNG  460

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            + H F  GD SH QT+ +Y  L++L EK+K  GY+PDTS  LH+V+++EKE+ L  HSE+
Sbjct  461  KAHLFRCGDTSHLQTKEIYSLLEELPEKIKAAGYMPDTSFALHDVSEEEKEHYLATHSEK  520

Query  12   LAIA  1
            LA+A
Sbjct  521  LAVA  524



>ref|XP_010647496.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like 
[Vitis vinifera]
Length=210

 Score =   131 bits (329),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 87/121 (72%), Gaps = 0/121 (0%)
 Frame = -3

Query  363  SAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGEEVH  184
            +A+ LFE+EP   + Y  L+NIY++AGLW    +VR+ M   GV K+PG SWIE   EVH
Sbjct  29   AAEALFEIEPENPATYTTLANIYATAGLWGGVAEVRKVMDARGVVKKPGLSWIEIKREVH  88

Query  183  KFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSERLAI  4
             F  GD SH +++ +++FL  LS++MKEEGYVPDT+ VLH+V +++KE  L  HSE+LA+
Sbjct  89   VFLVGDTSHAKSKEIHEFLGKLSKRMKEEGYVPDTNFVLHDVEEEQKEQNLSYHSEKLAV  148

Query  3    A  1
            A
Sbjct  149  A  149



>ref|XP_009408591.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Musa acuminata subsp. malaccensis]
Length=665

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +++ LFE+EP  A+ YV L+NIY+SAGLW++   VR+ M    V K+PG SWIE   
Sbjct  481  GEQASEALFEIEPENAATYVTLANIYASAGLWDEVEKVRKTMDRRRVVKKPGSSWIEVKR  540

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F  GD SHP+TE ++  L+ L ++MKEEGYVPDT  VLH+V D++KE  L  HSER
Sbjct  541  RVHVFLVGDKSHPRTEDIHAQLEKLYKRMKEEGYVPDTEFVLHDVEDEQKEESLAYHSER  600

Query  12   LAIA  1
            LA+A
Sbjct  601  LAVA  604



>emb|CAN61868.1| hypothetical protein VITISV_002466 [Vitis vinifera]
Length=440

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +A NLFELEP  A  YVLLSN+YS+AG WE+A   RR MK  GV KEPGCSWIE   
Sbjct  256  GERAANNLFELEPKNAVPYVLLSNLYSAAGKWEEAAKTRRLMKLRGVSKEPGCSWIEMSS  315

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH+F + D SHP+T  +Y  +D++   +KE GYVPD +  LH+++++ KE  L  HSE+
Sbjct  316  KVHRFMSEDRSHPRTAEIYSKVDEIMILIKEAGYVPDMNFALHDMDEEGKELGLAYHSEK  375

Query  12   LAIA  1
            LA+A
Sbjct  376  LAVA  379



>ref|XP_010090626.1| hypothetical protein L484_003942 [Morus notabilis]
 gb|EXB40230.1| hypothetical protein L484_003942 [Morus notabilis]
Length=810

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +AKNL ELEP+ A  YVLLSN+YS+AG WE A  +RR MK +G+ KEPGCSWIE   
Sbjct  626  GERAAKNLLELEPSNAVPYVLLSNMYSAAGRWEDAARIRRLMKSVGISKEPGCSWIEMNS  685

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH+F + D  HP+T+ +Y  +D++   +KE GYVPD +  LH+V+D+ K   L  HSE+
Sbjct  686  QVHRFMSEDRGHPRTDEIYSKVDEVMILIKEAGYVPDMNFALHDVDDEGKLLGLAYHSEK  745

Query  12   LAIA  1
            LAIA
Sbjct  746  LAIA  749



>gb|ACE80799.1| pentatricopeptide repeat protein, partial [Isoetes engelmannii]
Length=143

 Score =   129 bits (323),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE++A+ + +L+P   + YV+LSNIY+ AG W     +R+ M E G++KEPGCS IE G 
Sbjct  5    GEVAAEQVLKLDPGNPAAYVVLSNIYARAGRWVDVARIRKLMVERGIKKEPGCSSIEIGN  64

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F  GD SHP  E +Y  L  L+ +++  GYVPDTS VLH+++++ KE LL  HSE+
Sbjct  65   QVHTFLIGDNSHPMKEAIYARLKLLNTQLEACGYVPDTSSVLHDLDEETKETLLGYHSEK  124

Query  12   LAIA  1
            LAI+
Sbjct  125  LAIS  128



>gb|KHN43676.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=385

 Score =   134 bits (338),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+ LF LEP    +Y++LSNIY+S GLW++ N +R  MK  G+RK PG SWIE G 
Sbjct  201  GEITAEKLFLLEPTNPGNYIILSNIYASKGLWDEENRIREVMKSKGLRKNPGYSWIEVGH  260

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            ++H   AGD SHPQ + + + LD L+ +MK+ GY+P ++ V  +V + +KE +LCGHSE+
Sbjct  261  KIHMLLAGDQSHPQMKDILEKLDKLNMEMKKSGYLPKSNFVWQDVEEHDKEQILCGHSEK  320

Query  12   LAIA  1
            LA+ 
Sbjct  321  LAVV  324



>ref|XP_006653119.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic-like [Oryza brachyantha]
Length=703

 Score =   137 bits (345),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 67/124 (54%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+ L ELEP  ASHY LL NIYS+AG W K+ +VR  M+  GV KEPGCSWIE   
Sbjct  519  GEIAAERLLELEPEEASHYALLCNIYSAAGEWSKSAEVRSRMRRRGVAKEPGCSWIELDG  578

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             +H+FTAG+ +HP +  +++ +  L E+M+ +GY PDTSCVLH+++D +K  +L  HSE+
Sbjct  579  AIHRFTAGESAHPASAEVHERMGALWEEMRRQGYAPDTSCVLHDMDDGDKAAVLRCHSEK  638

Query  12   LAIA  1
            LAIA
Sbjct  639  LAIA  642



>ref|XP_010271776.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Nelumbo nucifera]
Length=975

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E +A  LFELEP  + +Y+LL+NIYS+AG WE A  +RR MKE GV K PGCSWIE   
Sbjct  791  AEYAAGYLFELEPQNSGNYILLANIYSAAGRWEDAARIRRLMKERGVTKPPGCSWIEVKR  850

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F  GD SHP  + +   ++ L  ++KE GYVPDT+ VL +V +DEKE  LC HSE+
Sbjct  851  RVHSFIVGDTSHPLMDAISAKMESLYSEIKEIGYVPDTNFVLQDVEEDEKEYSLCEHSEK  910

Query  12   LAIA  1
            LAIA
Sbjct  911  LAIA  914



>ref|XP_003542017.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like 
[Glycine max]
Length=693

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 91/121 (75%), Gaps = 0/121 (0%)
 Frame = -3

Query  363  SAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGEEVH  184
            +AK L+E+EP   + Y+ L+NIY++AGLW +  +VR++M  MG+ K+PG SWIE   +VH
Sbjct  512  AAKALYEIEPENPATYITLANIYANAGLWSEVANVRKDMDNMGIVKKPGKSWIEIKRQVH  571

Query  183  KFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSERLAI  4
             F  GD SHP+T  +++FL +LS+K+KEEGYVPDT+ VLH+V +++KE  L  HSE+LA+
Sbjct  572  VFLVGDTSHPKTSDIHEFLGELSKKIKEEGYVPDTNFVLHDVEEEQKEQNLVYHSEKLAV  631

Query  3    A  1
             
Sbjct  632  V  632



>gb|KDP31879.1| hypothetical protein JCGZ_12340 [Jatropha curcas]
Length=575

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = -3

Query  363  SAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGEEVH  184
            +A+ LFE+EP   + YV ++NIY++AG+W +   +R+ M E GV K+PG SWIE   EVH
Sbjct  394  AAEALFEIEPENPATYVTMANIYATAGMWSEVAKIRKTMDERGVVKKPGLSWIEIKREVH  453

Query  183  KFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSERLAI  4
             F  GD SHP+++ +++FL  LS+KMKEEG+VPDT+ VLH+V +++KE  L  HSE+LA+
Sbjct  454  VFLVGDTSHPRSKDIHEFLGKLSKKMKEEGFVPDTNFVLHDVEEEQKEENLSYHSEKLAV  513

Query  3    A  1
            A
Sbjct  514  A  514



>ref|XP_009413734.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g23330 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009413735.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g23330 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009413736.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g23330 isoform X1 [Musa acuminata subsp. malaccensis]
Length=725

 Score =   137 bits (345),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 61/124 (49%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E  A  +F++EP     +VL+SNIYS+AG W +A  +R  MK+ G++K+P CSWIE   
Sbjct  541  AEKVAAKIFDIEPKNMGSHVLMSNIYSAAGRWNEAAKLRMTMKDKGMKKQPACSWIEIKN  600

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            E+H F A D SHP    + + L  L E+M+ EGYVP+T  VLH++ +++K N+LCGHSER
Sbjct  601  ELHAFVAHDTSHPCYNKIINALKVLLEQMEREGYVPNTEDVLHDIEEEQKRNMLCGHSER  660

Query  12   LAIA  1
            LAIA
Sbjct  661  LAIA  664



>ref|XP_008645807.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 
[Zea mays]
 ref|XP_008645808.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 
[Zea mays]
 ref|XP_008645809.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 
[Zea mays]
 ref|XP_008645810.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 
[Zea mays]
 ref|XP_008645811.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 
[Zea mays]
 gb|AFW71819.1| putative pentatricopeptide repeat family protein [Zea mays]
Length=830

 Score =   138 bits (347),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 64/124 (52%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G+++A+ L  LEP  ++ YVLLSNIYS+AG W++ ++VR+ M    VRKE GCSWI+   
Sbjct  646  GKLAAEKLLSLEPLDSATYVLLSNIYSAAGKWKEKDEVRKLMDTKKVRKEAGCSWIQIKN  705

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F A D SHP +E +Y  L  ++ K+K+EGY PDTS V H+V +D+KE +L  HSER
Sbjct  706  KVHFFIASDKSHPLSEQIYAKLRAMTAKLKQEGYCPDTSFVPHDVAEDQKEAMLAMHSER  765

Query  12   LAIA  1
            LA+A
Sbjct  766  LALA  769



>ref|XP_010928853.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g13770, mitochondrial [Elaeis guineensis]
Length=583

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE  A+ L E+EP  A +YV+LSNIY++AG WE    VR +MKE  V KEPG SW+    
Sbjct  399  GEFVAQRLLEIEPENAGNYVILSNIYAAAGRWEDVVRVRESMKEKTVMKEPGRSWLNLDR  458

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             +H F + D SHPQ E +   L +L  K+KE GYVPD SCVLH+V+D++KE +L GHSE+
Sbjct  459  IIHTFHSSDRSHPQKEAIDAKLKELCVKIKEAGYVPDLSCVLHDVDDEQKERMLLGHSEK  518

Query  12   LAIA  1
            LAI 
Sbjct  519  LAIT  522



>ref|XP_009781103.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g49142 isoform X1 [Nicotiana sylvestris]
Length=677

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G ++A NLFEL P  + +YVLLSNIY+ AG WE    VR  MK  G++K PG S IE   
Sbjct  493  GLVAADNLFELSPKQSGYYVLLSNIYAKAGRWEDVTTVRSIMKGRGIKKMPGISNIELNN  552

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F AGD SHPQ++ +Y+ LD L  KMKEEGYVP+T   LH+V +++KEN L  HSE+
Sbjct  553  MVHTFLAGDTSHPQSKKIYEELDILIGKMKEEGYVPETDAALHDVEEEDKENHLVVHSEK  612

Query  12   LAIA  1
            LAI 
Sbjct  613  LAIV  616



>ref|XP_002269269.2| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Vitis vinifera]
Length=725

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE   K L EL+PN    YVLLSNIY++ G W++  ++RR M+E  V K PGCS+I+ G+
Sbjct  456  GEQVGKRLLELDPNHGGRYVLLSNIYAACGRWDRVAELRRMMRERQVSKTPGCSFIDLGD  515

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             +H+F AGD SHPQ E +Y  L ++S+++K  GY PDT  VL +++++EKE  LC HSE+
Sbjct  516  TIHEFVAGDSSHPQLEMIYAKLGEMSQELKAAGYKPDTGQVLLDMDEEEKETALCHHSEK  575

Query  12   LAIA  1
            LAIA
Sbjct  576  LAIA  579



>gb|ABR17838.1| unknown [Picea sitchensis]
Length=795

 Score =   137 bits (345),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 62/124 (50%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +AK+LFEL+P+ A +YVLLSNIY+ A  WE    +R+ MKE GV+K+PGCS +    
Sbjct  611  GEQAAKHLFELDPDNAGYYVLLSNIYAEAQRWEDVAKLRKMMKEKGVKKQPGCSVVAVHR  670

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +V  F  GD +HPQ+E +Y  L+ L E+M++ GYVP+T+  L +V ++ KEN+L  HSE+
Sbjct  671  DVQTFLVGDRTHPQSEQIYAMLEILYEQMRKAGYVPNTNLALQDVEEEAKENILSSHSEK  730

Query  12   LAIA  1
            LAI+
Sbjct  731  LAIS  734



>ref|XP_010098084.1| hypothetical protein L484_026217 [Morus notabilis]
 gb|EXB74521.1| hypothetical protein L484_026217 [Morus notabilis]
Length=651

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 82/124 (66%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E++ + L ELEP+ A HYV+LSNIY+ AG+WE    +R+ M + G++K   CSWIE   
Sbjct  467  AELAVEKLMELEPDEAGHYVILSNIYAQAGMWEGVARLRKLMIDKGIKKSIACSWIEVRN  526

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F +GD SHP +  +Y  L  L   M E GYVP T  V H+V DDEK N++C HSER
Sbjct  527  KVHAFLSGDTSHPNSAAIYAELKRLGGLMAEAGYVPSTDSVFHDVEDDEKTNMVCSHSER  586

Query  12   LAIA  1
            LAIA
Sbjct  587  LAIA  590



>ref|XP_010260583.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, 
mitochondrial [Nelumbo nucifera]
Length=721

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE+SA+ LFEL+P+   +YVLLSNIY+ AG WE    +R  MK+ G+ K PG S +E   
Sbjct  537  GEVSARKLFELDPSNCGYYVLLSNIYADAGRWEDVERMRVFMKDRGLIKPPGFSLVEVKG  596

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F  GD  HPQ + +YD+L+ LS KM+E GY+PDT+ VLH+V+ +EKE++L  HSE+
Sbjct  597  RVHVFLVGDREHPQHDEIYDYLEKLSVKMQEVGYIPDTTSVLHDVDQEEKESILRIHSEK  656

Query  12   LAIA  1
            LA+A
Sbjct  657  LAVA  660



>gb|ABN08240.1| Tetratricopeptide-like helical [Medicago truncatula]
Length=687

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             +ISAK LFE+EPN   +YV L NI  +A +W +A+ VR  MKE G+ K PGCSW++ G 
Sbjct  503  AKISAKKLFEIEPNNPGNYVSLFNILVTAKMWSEASQVRILMKERGITKTPGCSWLQVGN  562

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F  GD S+ +++ +Y+FLD+L EKMK  GY PDT  VL +++ +EK   LC HSE+
Sbjct  563  KVHTFVVGDKSNIESDKIYNFLDELVEKMKMAGYKPDTDYVLQDIDQEEKAESLCNHSEK  622

Query  12   LAIA  1
            LA+A
Sbjct  623  LAVA  626



>ref|XP_008350050.1| PREDICTED: pentatricopeptide repeat-containing protein At3g63370-like 
[Malus domestica]
Length=282

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 91/125 (73%), Gaps = 1/125 (1%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+AK + EL+P    +YVL+SN+++++G W+  ++VR  MK  G++K PGCSWIEFG 
Sbjct  97   GEIAAKKILELDPENPGNYVLVSNVFAASGRWKDVDEVRLRMKGSGLKKNPGCSWIEFGN  156

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKM-KEEGYVPDTSCVLHNVNDDEKENLLCGHSE  16
            +VH FTA + SHPQ++ +Y  L  ++EK+ ++  YV  T  VLHNV ++E+  +L GHSE
Sbjct  157  KVHTFTAREKSHPQSDDIYLKLAQITEKLERQVDYVAQTKFVLHNVEEEERVKMLYGHSE  216

Query  15   RLAIA  1
            RLAIA
Sbjct  217  RLAIA  221



>ref|XP_011016756.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46460, 
mitochondrial-like [Populus euphratica]
Length=281

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E +AK++ +LEPN ++ YVLLSNIY+SAG W   + +R  MK+ G+ K+PG SW+    
Sbjct  97   AERAAKHILDLEPNCSAAYVLLSNIYASAGRWADVSRMRVKMKQGGLAKQPGSSWVVLRG  156

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            + H+F + D SHP +E +YD LD L +K+KE GYVPD    LH+V D++KE +L  HSER
Sbjct  157  KKHEFLSADRSHPLSERIYDKLDWLGKKLKEFGYVPDQKFALHDVEDEQKEEMLSFHSER  216

Query  12   LAIA  1
            LAIA
Sbjct  217  LAIA  220



>ref|XP_006651199.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like 
[Oryza brachyantha]
Length=637

 Score =   135 bits (341),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 65/121 (54%), Positives = 83/121 (69%), Gaps = 0/121 (0%)
 Frame = -3

Query  363  SAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGEEVH  184
            +A+ LFE+EP   + YV L+NIY+S GL+++  DVRR M+  GV K P  SWIE G  VH
Sbjct  456  AAEVLFEIEPENPATYVTLANIYASVGLFDEVEDVRRIMESKGVTKMPASSWIEVGRRVH  515

Query  183  KFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSERLAI  4
             F  GD SHPQ + +Y  L  LS KM+EEGYV DT  VLH+V D++KE  +  HSERLA+
Sbjct  516  VFLVGDKSHPQADEIYALLKKLSVKMREEGYVADTEFVLHDVEDEQKEQDIGYHSERLAV  575

Query  3    A  1
            A
Sbjct  576  A  576



>ref|XP_003622422.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES78640.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=952

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             +ISAK LFE++PN +++YV L NI  +A LW +A+ +R+ MKE G+ K PGCSW   G 
Sbjct  768  AKISAKKLFEIDPNGSANYVTLFNILVTAKLWSEASKIRKLMKERGITKTPGCSWFHVGN  827

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F AGD S+ +++ +Y+FLD+L  K+K  GY PDT  VLH+++ +EK   LC HSE+
Sbjct  828  RVHTFVAGDKSNMESDKIYNFLDELFAKIKAAGYKPDTDYVLHDIDQEEKAESLCNHSEK  887

Query  12   LAIA  1
            LA+A
Sbjct  888  LAVA  891



>ref|XP_003623854.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=865

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             +ISAK LFE+EPN   +YV L NI  +A +W +A+ VR  MKE G+ K PGCSW++ G 
Sbjct  589  AKISAKKLFEIEPNNPGNYVSLFNILVTAKMWSEASQVRILMKERGITKTPGCSWLQVGN  648

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F  GD S+ +++ +Y+FLD+L EKMK  GY PDT  VL +++ +EK   LC HSE+
Sbjct  649  KVHTFVVGDKSNIESDKIYNFLDELVEKMKMAGYKPDTDYVLQDIDQEEKAESLCNHSEK  708

Query  12   LAIA  1
            LA+A
Sbjct  709  LAVA  712



>ref|XP_008782896.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g13770, mitochondrial [Phoenix dactylifera]
Length=632

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 84/124 (68%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE  A+ L E+E   A +YV+LSNIY++AG WE    VR  MKE  V KEPG SWI    
Sbjct  448  GEFVAQRLLEIESENAGNYVILSNIYAAAGRWEDVVRVRELMKEKTVMKEPGRSWINLDR  507

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             +H F +GD SHPQ E +   L +L  K+KE GYVPD SCVLH+V+D++KE +L GHSE+
Sbjct  508  TIHTFHSGDRSHPQKEAMDSKLKELFVKIKEAGYVPDLSCVLHDVDDEQKERMLLGHSEK  567

Query  12   LAIA  1
            LAI 
Sbjct  568  LAIT  571



>ref|XP_008797547.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Phoenix dactylifera]
Length=778

 Score =   137 bits (344),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 64/124 (52%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +A+ +FE+EP+ A  YVLLSN+Y+S+G W   + +R  M+E GVRK PG SWIE   
Sbjct  594  GERAAERIFEMEPDNAGMYVLLSNLYASSGKWTDVDKMRVMMQERGVRKVPGFSWIEVKN  653

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F+ GD  HP  E +Y FL++L  KMK+ GYV  T  VLH+V ++EKE++L  HSE+
Sbjct  654  KVHTFSVGDSVHPDKEKIYSFLEELDVKMKKAGYVSATEMVLHDVEEEEKEHMLKYHSEK  713

Query  12   LAIA  1
            LA+A
Sbjct  714  LAVA  717



>gb|AES80072.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=786

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             +ISAK LFE+EPN   +YV L NI  +A +W +A+ VR  MKE G+ K PGCSW++ G 
Sbjct  503  AKISAKKLFEIEPNNPGNYVSLFNILVTAKMWSEASQVRILMKERGITKTPGCSWLQVGN  562

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F  GD S+ +++ +Y+FLD+L EKMK  GY PDT  VL +++ +EK   LC HSE+
Sbjct  563  KVHTFVVGDKSNIESDKIYNFLDELVEKMKMAGYKPDTDYVLQDIDQEEKAESLCNHSEK  622

Query  12   LAIA  1
            LA+A
Sbjct  623  LAVA  626



>gb|AEB39780.1| pentatricopeptide repeat protein 45 [Funaria hygrometrica]
Length=1097

 Score =   137 bits (346),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 63/123 (51%), Positives = 83/123 (67%), Gaps = 0/123 (0%)
 Frame = -3

Query  372   GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
              E +AK   +L+P  AS YVLLSNIY++ G WE+   VR  M+  G+RKEPG SWIE   
Sbjct  913   AEFAAKERLKLKPKSASTYVLLSNIYAATGKWEQKLLVRSMMQRKGIRKEPGRSWIEVDN  972

Query  192   EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
              +H F  GD SHP+++ +Y  L+DL E++K +GYVPDT  VL N + + KE  LC HSE+
Sbjct  973   RIHSFVVGDTSHPESKEIYAQLNDLIERLKAKGYVPDTRLVLRNTDQEHKEQALCSHSEK  1032

Query  12    LAI  4
             LAI
Sbjct  1033  LAI  1035



>gb|ADE77782.1| unknown [Picea sitchensis]
Length=210

 Score =   129 bits (325),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = -3

Query  360  AKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGEEVHK  181
            A++L  +E  +A  YVLLSNIY++AG W+ A  VR+ MK+ GV K+PG SWIE    +H 
Sbjct  30   AEHLLGMEVQIAGIYVLLSNIYAAAGQWDDAAKVRKLMKDRGVMKQPGYSWIEVKTIMHA  89

Query  180  FTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSERLAIA  1
            F AG+ SHPQ + +++FL+ LS KMK  GYVP+ + VL +V DDEKE  L  HSE+LAIA
Sbjct  90   FVAGETSHPQLKEIHEFLESLSRKMKAAGYVPNKNFVLQDVEDDEKELSLSHHSEKLAIA  149



>ref|XP_010680447.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010680448.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010680449.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Beta vulgaris subsp. vulgaris]
Length=726

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E +AK LF++EP  A+ Y  L NIY++AG WE+   VRR M   GV K+PG SWIE   
Sbjct  542  AEQAAKALFKIEPENAATYTTLGNIYATAGRWEELAKVRRMMDNRGVVKKPGLSWIEVKR  601

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VHKF  GD SHP    ++ FL ++S+KM++EGYVPDT+ VLH+V +++KE  L  HSE+
Sbjct  602  QVHKFLVGDTSHPNYNEIHTFLQEISKKMRQEGYVPDTNFVLHDVEEEQKEQNLSYHSEK  661

Query  12   LAIA  1
            LA+A
Sbjct  662  LAVA  665



>gb|ADE77588.1| unknown [Picea sitchensis]
Length=312

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE  A+ L  L+P+ A +YVLLSNIY++AG W+    VR+ MKE  V+K PGCS IE   
Sbjct  128  GERVAELLLNLDPDNAGYYVLLSNIYAAAGRWDDVAKVRKMMKEKDVKKSPGCSLIEVNN  187

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            ++H F  GD SHPQTE +Y  L+ L+ +M+  GYVP T  VLH+V ++ KEN+L  HSE+
Sbjct  188  KLHSFVVGDISHPQTEAIYAMLETLARQMEAVGYVPCTDFVLHDVEEEIKENMLFAHSEK  247

Query  12   LAIA  1
            LAIA
Sbjct  248  LAIA  251



>ref|XP_009402626.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Musa acuminata subsp. malaccensis]
Length=772

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +AK +FE+EP+ A  YVLLSNIY+++G W   N +R  M+E GV+K PG SWIE   
Sbjct  588  GEKAAKRIFEMEPDNAGMYVLLSNIYATSGKWANVNKMRVMMRERGVKKVPGFSWIEANN  647

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F+ GD  HP+ + +Y FL++L+ KMK+EGYV  T  VLH+V ++EKE++L  HSE+
Sbjct  648  KVHTFSVGDMLHPEKDKIYAFLEELNLKMKKEGYVSATEMVLHDVEEEEKEHMLKYHSEK  707

Query  12   LAIA  1
            LA+A
Sbjct  708  LAVA  711



>ref|XP_009402026.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Musa acuminata subsp. malaccensis]
Length=652

 Score =   135 bits (341),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 64/125 (51%), Positives = 90/125 (72%), Gaps = 1/125 (1%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
              I+A +LFELEP+   +Y+LLSN Y+SAG+W++ + VR+ M+  G++K P  SW E  +
Sbjct  467  ARIAANHLFELEPDRIGNYMLLSNTYASAGMWDEVSKVRKLMRARGLKKNPSASWTEDKD  526

Query  192  -EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSE  16
              VH+F AGDG HP+T  + D L+DL  K+K EGY P  S VL+++ND+EKE LL GHSE
Sbjct  527  GSVHEFFAGDGLHPRTHEIKDTLEDLLGKLKLEGYDPVLSSVLYDINDNEKEKLLKGHSE  586

Query  15   RLAIA  1
            +LA+A
Sbjct  587  KLALA  591



>gb|KDP31422.1| hypothetical protein JCGZ_11798 [Jatropha curcas]
Length=558

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +A++L ELEP   + Y+LL +IY++ G W     +RR M+E GVRKEPGCSWI++  
Sbjct  374  GEWAAQSLLELEPQNPAGYILLLSIYAAKGKWNDVAHLRRGMREKGVRKEPGCSWIKYKS  433

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F+A D S P +  +Y  LD L++KM EEGYVPD   VLHNV + EK  +L  HSE+
Sbjct  434  KVHIFSANDQSSPFSNQIYAELDKLNQKMIEEGYVPDARSVLHNVVESEKIQMLNYHSEK  493

Query  12   LAIA  1
            LAIA
Sbjct  494  LAIA  497



>gb|KHN27741.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=397

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             +ISA  LFE+EPN   +YV L NI  +A LW +A++ R  MKE G+ K PGCSW++ G+
Sbjct  213  AKISANKLFEIEPNNPGNYVSLFNILVTAKLWSEASEARILMKERGITKTPGCSWLQVGD  272

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F  GD ++ +++ +Y+FLD+L EKMK  GY PDT  VL +++ +EK   LC HSE+
Sbjct  273  RVHTFVVGDKNNMESDKIYNFLDELGEKMKSAGYKPDTDYVLQDIDQEEKAESLCSHSEK  332

Query  12   LAIA  1
            LA+A
Sbjct  333  LAVA  336



>ref|XP_010939958.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Elaeis guineensis]
Length=690

 Score =   135 bits (341),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 64/121 (53%), Positives = 83/121 (69%), Gaps = 0/121 (0%)
 Frame = -3

Query  363  SAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGEEVH  184
            +A+ LFE+EP  A+ YV L+NIY+S GLW++   +R+ M    V K+PG SWIE    VH
Sbjct  509  AAEALFEIEPENAATYVTLANIYASCGLWDEVEKIRKTMDNRRVVKKPGSSWIEVKRRVH  568

Query  183  KFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSERLAI  4
             F  GD SHPQ + +Y  LD L  +MKEEGYVPDT+ VLH+V D++K   L  HSERLA+
Sbjct  569  VFLVGDKSHPQAKEIYARLDKLYTRMKEEGYVPDTNFVLHDVEDEQKVENLAYHSERLAV  628

Query  3    A  1
            A
Sbjct  629  A  629



>emb|CDP02463.1| unnamed protein product [Coffea canephora]
Length=711

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = -3

Query  363  SAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGEEVH  184
            +A+ LFE+EP  A+ YV L+N+Y++AG W +   +R+ M E  V K+PG SWIE   + H
Sbjct  530  AAEALFEIEPEDAASYVTLANVYATAGKWSEVAKIRKMMDEKRVVKKPGMSWIEMKRKTH  589

Query  183  KFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSERLAI  4
             F  GD SHP+++ +YDFL ++S+KMKEEGYVPDT  VLH+V +++KE  L  HSE+LAI
Sbjct  590  IFLVGDQSHPRSKEIYDFLGEISKKMKEEGYVPDTEYVLHDVGEEQKEQSLFYHSEKLAI  649

Query  3    A  1
            A
Sbjct  650  A  650



>gb|EAZ44271.1| hypothetical protein OsJ_28890 [Oryza sativa Japonica Group]
Length=630

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G  +A+ +FELEP  A  YVLLSNIY+S+G W  A  +R  M+E GV+K PG SWIE   
Sbjct  446  GRSAAEKIFELEPENAGMYVLLSNIYASSGKWRDARKMRVMMEERGVKKVPGFSWIEVQN  505

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F+AGD  HP+ E +Y FL+DL  +MK+ GYV  T  VLH+V ++EKE++L  HSE+
Sbjct  506  KVHTFSAGDCVHPEKEKIYAFLEDLDMRMKKAGYVSATDMVLHDVEEEEKEHMLKYHSEK  565

Query  12   LAIA  1
            LA+A
Sbjct  566  LAVA  569



>ref|XP_002438491.1| hypothetical protein SORBIDRAFT_10g020540 [Sorghum bicolor]
 gb|EER89858.1| hypothetical protein SORBIDRAFT_10g020540 [Sorghum bicolor]
Length=794

 Score =   136 bits (343),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 56/101 (55%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+ LFELEP+ ASHYVLL NIYS+AGLWEK+++VR  M++ GV KEPGCSWIE   
Sbjct  683  GEIAAERLFELEPDEASHYVLLCNIYSAAGLWEKSSEVRSRMRQRGVSKEPGCSWIELDG  742

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCV  70
             +H+F AG+ +HP++  ++  +D L E+M+++GY PDT+ +
Sbjct  743  VIHRFMAGESAHPESTLVHAHMDALWERMRDQGYTPDTTLI  783



>ref|XP_010097473.1| hypothetical protein L484_024678 [Morus notabilis]
 gb|EXB68664.1| hypothetical protein L484_024678 [Morus notabilis]
Length=728

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE++A+ LFELEP    +YV+LSNIY S G+W + + VR  M + G+RK PGCSWIE   
Sbjct  544  GEVAAEKLFELEPRNPGNYVILSNIYGSKGMWSQVDRVRDMMNQKGLRKNPGCSWIEVKN  603

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVH   AGD SHPQ   +   L+ LS +MK  GY P+ + VL +V + +K ++LCGHSE+
Sbjct  604  EVHMLLAGDKSHPQRIQIIGKLNKLSMEMKNSGYFPNFTFVLQDVEEQDKVHILCGHSEK  663

Query  12   LAIA  1
            LA+A
Sbjct  664  LAVA  667



>emb|CBI25911.3| unnamed protein product [Vitis vinifera]
Length=288

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 87/121 (72%), Gaps = 0/121 (0%)
 Frame = -3

Query  363  SAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGEEVH  184
            +A+ LFE+EP   + Y  L+NIY++AGLW    +VR+ M   GV K+PG SWIE   EVH
Sbjct  107  AAEALFEIEPENPATYTTLANIYATAGLWGGVAEVRKVMDARGVVKKPGLSWIEIKREVH  166

Query  183  KFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSERLAI  4
             F  GD SH +++ +++FL  LS++MKEEGYVPDT+ VLH+V +++KE  L  HSE+LA+
Sbjct  167  VFLVGDTSHAKSKEIHEFLGKLSKRMKEEGYVPDTNFVLHDVEEEQKEQNLSYHSEKLAV  226

Query  3    A  1
            A
Sbjct  227  A  227



>ref|XP_004987089.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like 
[Setaria italica]
Length=636

 Score =   135 bits (339),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 64/121 (53%), Positives = 84/121 (69%), Gaps = 0/121 (0%)
 Frame = -3

Query  363  SAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGEEVH  184
            +A+ LFE+EP   + YV L+NIY+S GL+++  +VRR M+  G+ K P  SWIE G+ VH
Sbjct  455  AAEALFEIEPENPATYVTLANIYASVGLFDEVENVRRIMESKGITKMPASSWIEAGKRVH  514

Query  183  KFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSERLAI  4
             F  GD SHPQ E +Y FL  L  KM+EEGYV DT  VLH+V D++KE  +  HSERLA+
Sbjct  515  VFLVGDKSHPQAEEIYAFLKKLYVKMREEGYVADTGFVLHDVEDEQKEQDIGYHSERLAV  574

Query  3    A  1
            A
Sbjct  575  A  575



>emb|CBI27939.3| unnamed protein product [Vitis vinifera]
Length=764

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +A  LFELEP + S+Y+LLSN++++ G+W+   +VR  M   GV+KEPGCSW+E   
Sbjct  580  GERAAMKLFELEPEIDSNYILLSNMFAAKGMWDDVTNVRALMSTRGVKKEPGCSWVEVNG  639

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F + DGSHP+   ++  L DL +K+   GY P+T  VLHNV+D EK+ LL  HSER
Sbjct  640  QVHVFLSHDGSHPKIREIHLKLQDLHQKLMSVGYTPNTDHVLHNVSDREKQELLFYHSER  699

Query  12   LAIA  1
            LA+A
Sbjct  700  LALA  703



>ref|XP_010426426.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, 
chloroplastic-like [Camelina sativa]
Length=865

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 91/129 (71%), Gaps = 5/129 (4%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G+++A+ + EL+PN  + Y+ LSNIY+SAG WE++ ++R+ MKE  + KE GCSWIE G+
Sbjct  676  GKMAARKILELDPNEPAAYIQLSNIYASAGKWEESTEMRKKMKERNLVKEGGCSWIEVGD  735

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDE-----KENLLC  28
            +VHKF  GD SHP   H+YD LD L  ++K  GYVPDT  VLH + +D+     KE LL 
Sbjct  736  KVHKFYVGDTSHPNAHHIYDELDRLITEIKRCGYVPDTDLVLHKLEEDDDNNAKKEKLLY  795

Query  27   GHSERLAIA  1
             HSE++A+A
Sbjct  796  HHSEKIAVA  804



>ref|XP_004959800.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Setaria italica]
Length=943

 Score =   136 bits (343),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 60/124 (48%), Positives = 83/124 (67%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G  +A  LF++ P     Y+LLSN YS+AG W  A  VR+ M++ GV+KEPGCSWIE G 
Sbjct  759  GAYAADQLFKMTPQHDGTYILLSNTYSAAGRWVDAAKVRKLMRDRGVKKEPGCSWIEVGN  818

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F  GD  HP+   +Y FL+ +  KM++ GY+PDT  VLH++   +KE++L  HSER
Sbjct  819  KVHVFLVGDTKHPEAHEVYHFLEMVGAKMRKLGYLPDTKVVLHDMEPHQKEHILFAHSER  878

Query  12   LAIA  1
            LA+ 
Sbjct  879  LAVG  882



>ref|NP_001062888.2| Os09g0327200 [Oryza sativa Japonica Group]
 dbj|BAF24802.2| Os09g0327200 [Oryza sativa Japonica Group]
Length=739

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G  +A+ +FELEP  A  YVLLSNIY+S+G W  A  +R  M+E GV+K PG SWIE   
Sbjct  571  GRSAAEKIFELEPENAGMYVLLSNIYASSGKWRDARKMRVMMEERGVKKVPGFSWIEVQN  630

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F+AGD  HP+ E +Y FL+DL  +MK+ GYV  T  VLH+V ++EKE++L  HSE+
Sbjct  631  KVHTFSAGDCVHPEKEKIYAFLEDLDMRMKKAGYVSATDMVLHDVEEEEKEHMLKYHSEK  690

Query  12   LAIA  1
            LA+A
Sbjct  691  LAVA  694



>ref|XP_010261461.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g49142 [Nelumbo nucifera]
Length=680

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 83/124 (67%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G I+A  LFEL P  A +YVLLSNIY+ AG W     VR  MK  G++K PGCS +E  +
Sbjct  496  GLIAADKLFELVPEQAGYYVLLSNIYAKAGRWNDVTTVRSMMKSRGIKKLPGCSNVELSD  555

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F AGD SHPQ++ +Y  LD L  KMKE GYVP+T   LH+V +++KE  L  HSE+
Sbjct  556  RVHTFLAGDNSHPQSKEIYAELDVLLGKMKEAGYVPETDSALHDVEEEDKEGHLVVHSEK  615

Query  12   LAIA  1
            LAIA
Sbjct  616  LAIA  619



>gb|AEB39776.1| pentatricopeptide repeat protein 78 [Funaria hygrometrica]
Length=1020

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E +A++  +L+P+ A+ YV LS++Y++AG+W+ A  +R+ M++ GV KEPG SWIE G+
Sbjct  836  AERAAESSLKLDPDNAAVYVALSHMYAAAGMWDSAAKLRKLMEQRGVTKEPGRSWIEVGD  895

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            ++H F A D SHP++E +Y  LD L+  MK EGYVPDT  V+H+V++ EKEN +C HSER
Sbjct  896  KLHYFVAEDRSHPESEKIYAELDKLTHAMKMEGYVPDTRSVMHDVDEGEKENAVCHHSER  955

Query  12   LAIA  1
            LAIA
Sbjct  956  LAIA  959



>ref|XP_009621680.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g49142 [Nicotiana tomentosiformis]
Length=677

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G ++A NLFEL P  + +YVLLSNIY+ AG WE    VR  MK  G++K PG S +E   
Sbjct  493  GLVAADNLFELSPKQSGYYVLLSNIYAKAGRWEDVTTVRSIMKGRGIKKMPGISNVEINN  552

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F AGD SHPQ++ +Y+ LD +  KMKEEGYVP+T+  LH+V +++KEN L  HSE+
Sbjct  553  MVHTFLAGDTSHPQSKKIYEELDIVIGKMKEEGYVPETNAALHDVEEEDKENHLVVHSEK  612

Query  12   LAIA  1
            LAI 
Sbjct  613  LAIV  616



>ref|XP_010927442.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Elaeis guineensis]
Length=777

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +A+ +FE+EP+ A  YVLLSN+Y+S+G W   + +R  M+E GVRK PG SWIE   
Sbjct  593  GERAAERIFEMEPDNAGMYVLLSNLYASSGKWTDVDKMRVMMRERGVRKVPGFSWIEVKN  652

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F+ GD  HP  E +Y FL++L  KMK+ GYV  T+ VLH+V ++EKE++L  HSE+
Sbjct  653  KVHTFSVGDSVHPDKEKIYSFLEELDMKMKKAGYVSATAMVLHDVEEEEKEHMLKYHSEK  712

Query  12   LAIA  1
            LA+A
Sbjct  713  LAVA  716



>ref|XP_006587447.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like 
[Glycine max]
Length=601

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+ LF LEP    +Y++LSNIY+S GLW++ N +R  MK  G+RK PG SWIE G 
Sbjct  417  GEITAEKLFLLEPTNPGNYIILSNIYASKGLWDEENRIREVMKSKGLRKNPGYSWIEVGH  476

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            ++H   AGD SHPQ + + + LD L+ +MK+ GY+P ++ V  +V + +KE +LCGHSE+
Sbjct  477  KIHMLLAGDQSHPQMKDILEKLDKLNMEMKKSGYLPKSNFVWQDVEEHDKEQILCGHSEK  536

Query  12   LAIA  1
            LA+ 
Sbjct  537  LAVV  540



>ref|XP_010087050.1| hypothetical protein L484_012294 [Morus notabilis]
 ref|XP_010113226.1| hypothetical protein L484_000356 [Morus notabilis]
 gb|EXB25868.1| hypothetical protein L484_012294 [Morus notabilis]
 gb|EXC75162.1| hypothetical protein L484_000356 [Morus notabilis]
Length=773

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +AK +FELEP  A  YVLLSN+Y+++G W     +R  M++ GV+K PG SW+E   
Sbjct  589  GEKAAKIIFELEPENAGMYVLLSNLYAASGRWTDVRKMRLKMRDTGVKKVPGYSWVEVQN  648

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F+ GD  HP+ + +Y FL++L  KMK EGYV  T  VLH+V ++EKEN+L  HSE+
Sbjct  649  KVHTFSVGDSVHPEKDRIYAFLEELDLKMKREGYVSSTKLVLHDVEEEEKENMLKYHSEK  708

Query  12   LAIA  1
            LA+A
Sbjct  709  LAVA  712



>ref|XP_006829281.1| hypothetical protein AMTR_s00001p00272900 [Amborella trichopoda]
 gb|ERM96697.1| hypothetical protein AMTR_s00001p00272900 [Amborella trichopoda]
Length=762

 Score =   135 bits (341),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 59/124 (48%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E++A+ +FE+EP+ +  YVLLSN+Y+ AG W   + +R  M+E GV+K PG SWIE+  
Sbjct  578  AEMAAEKVFEMEPDNSGMYVLLSNLYAEAGRWADVDRLRVMMREKGVKKVPGFSWIEYKN  637

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F+ GD  HPQ E +Y FL++L  +MK+ G+V +T  VLH+V ++EKE+++  HSE+
Sbjct  638  KVHAFSVGDSDHPQKEKIYAFLEELDLRMKQAGHVSETKMVLHDVEEEEKEHMVKHHSEK  697

Query  12   LAIA  1
            LA+A
Sbjct  698  LAVA  701



>ref|XP_011032628.1| PREDICTED: pentatricopeptide repeat-containing protein At3g63370 
[Populus euphratica]
 ref|XP_011032629.1| PREDICTED: pentatricopeptide repeat-containing protein At3g63370 
[Populus euphratica]
 ref|XP_011032630.1| PREDICTED: pentatricopeptide repeat-containing protein At3g63370 
[Populus euphratica]
 ref|XP_011032631.1| PREDICTED: pentatricopeptide repeat-containing protein At3g63370 
[Populus euphratica]
Length=957

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 87/125 (70%), Gaps = 1/125 (1%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+ L EL+P     YVL+SN+++++G W+   +VR  MK  G++K PGCSWIE G 
Sbjct  772  GEIAAQKLLELDPESPGSYVLISNVFAASGRWKDVEEVRMRMKGGGLKKNPGCSWIEVGN  831

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKM-KEEGYVPDTSCVLHNVNDDEKENLLCGHSE  16
            +VH F A D SHP++  +Y  L  ++EK+ KE GYVP T  VLHNV  +EK  +L GHSE
Sbjct  832  KVHTFLARDKSHPESYKIYQKLAQITEKLEKEGGYVPQTKFVLHNVGKEEKVQMLYGHSE  891

Query  15   RLAIA  1
            RLAIA
Sbjct  892  RLAIA  896



>ref|XP_004961436.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
isoform X2 [Setaria italica]
Length=799

 Score =   135 bits (341),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 60/124 (48%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G  +A+ LF +EP+ A +YV+LSNIYSS G+W++   VR+ MKE GV KEPGCSW++   
Sbjct  615  GRRAAEKLFSIEPSNAGNYVMLSNIYSSQGMWDEVAKVRKLMKEQGVNKEPGCSWMQIKN  674

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             +H F  GD  H Q + +Y  L +L   +K  GYVPDT  VLH++++++KE+ L  HSE+
Sbjct  675  RMHSFVTGDEEHEQIQDIYATLQELYTLLKATGYVPDTEFVLHDIDEEQKESSLLYHSEK  734

Query  12   LAIA  1
            LA+A
Sbjct  735  LAVA  738



>ref|XP_009421324.1| PREDICTED: pentatricopeptide repeat-containing protein At2g39620 
[Musa acuminata subsp. malaccensis]
Length=1005

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 84/123 (68%), Gaps = 0/123 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+  +L +LEP   +H+V+LSNIY+  G W     +R  +  +GV K PGCSW++   
Sbjct  821  GEIALDHLVKLEPQNVAHHVVLSNIYAQVGRWTDVRRMRSAINHIGVNKTPGCSWVDIRN  880

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             +H F+ GD SHPQ + + D  +DL EKM++ GYVPDTS V+HNV ++EKE+ L  HSER
Sbjct  881  TIHAFSVGDQSHPQYDKMRDIWNDLREKMEKMGYVPDTSSVMHNVEEEEKESFLSSHSER  940

Query  12   LAI  4
            LAI
Sbjct  941  LAI  943



>dbj|BAD23598.1| putative pentatricopeptide (PPR) repeat-containing protein [Oryza 
sativa Japonica Group]
Length=755

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G  +A+ +FELEP  A  YVLLSNIY+S+G W  A  +R  M+E GV+K PG SWIE   
Sbjct  571  GRSAAEKIFELEPENAGMYVLLSNIYASSGKWRDARKMRVMMEERGVKKVPGFSWIEVQN  630

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F+AGD  HP+ E +Y FL+DL  +MK+ GYV  T  VLH+V ++EKE++L  HSE+
Sbjct  631  KVHTFSAGDCVHPEKEKIYAFLEDLDMRMKKAGYVSATDMVLHDVEEEEKEHMLKYHSEK  690

Query  12   LAIA  1
            LA+A
Sbjct  691  LAVA  694



>ref|XP_004961435.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
isoform X1 [Setaria italica]
Length=843

 Score =   135 bits (341),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 60/124 (48%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G  +A+ LF +EP+ A +YV+LSNIYSS G+W++   VR+ MKE GV KEPGCSW++   
Sbjct  659  GRRAAEKLFSIEPSNAGNYVMLSNIYSSQGMWDEVAKVRKLMKEQGVNKEPGCSWMQIKN  718

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             +H F  GD  H Q + +Y  L +L   +K  GYVPDT  VLH++++++KE+ L  HSE+
Sbjct  719  RMHSFVTGDEEHEQIQDIYATLQELYTLLKATGYVPDTEFVLHDIDEEQKESSLLYHSEK  778

Query  12   LAIA  1
            LA+A
Sbjct  779  LAVA  782



>gb|EAZ08632.1| hypothetical protein OsI_30906 [Oryza sativa Indica Group]
Length=755

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G  +A+ +FELEP  A  YVLLSNIY+S+G W  A  +R  M+E GV+K PG SWIE   
Sbjct  571  GRSAAEKIFELEPENAGMYVLLSNIYASSGKWRDARKMRVMMEERGVKKVPGFSWIEVQN  630

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F+AGD  HP+ E +Y FL+DL  +MK+ GYV  T  VLH+V ++EKE++L  HSE+
Sbjct  631  KVHTFSAGDCVHPEKEKIYAFLEDLDMRMKKAGYVSATDMVLHDVEEEEKEHMLKYHSEK  690

Query  12   LAIA  1
            LA+A
Sbjct  691  LAVA  694



>gb|KEH26815.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=684

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+ LF LEP+   +Y+LLSNIY+S G+W++ N VR  MK  G++K PGCSWIE G 
Sbjct  423  GEIAAEKLFVLEPDNPGNYILLSNIYASKGMWDEENRVRDMMKSKGLQKNPGCSWIEIGH  482

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH   +GD SHPQ + + +  + LS ++KE G +P T  VL +V + +KE +LCGHSE+
Sbjct  483  RVHTLVSGDKSHPQMKEILEKSEKLSIEIKESGCLPMTKSVLQDVEEQDKEQILCGHSEK  542

Query  12   LAIA  1
            LA+ 
Sbjct  543  LAVV  546



>ref|XP_002463110.1| hypothetical protein SORBIDRAFT_02g037960 [Sorghum bicolor]
 gb|EER99631.1| hypothetical protein SORBIDRAFT_02g037960 [Sorghum bicolor]
Length=802

 Score =   135 bits (340),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 60/124 (48%), Positives = 83/124 (67%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G  +A  LF++ P     Y+LLSN YS+AG W  A  VR+ M++ GV+KEPGCSWIE G 
Sbjct  618  GAHAADQLFKMTPQHDGTYILLSNTYSAAGRWVDAARVRKLMRDRGVKKEPGCSWIEAGN  677

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F  GD  HP+   +Y FL+ +  +M++ GYVPDT  VLH++   +KE++L  HSER
Sbjct  678  KVHVFVVGDTKHPEAHKVYKFLEMVGARMRKLGYVPDTKVVLHDMEPHQKEHILFAHSER  737

Query  12   LAIA  1
            LA+ 
Sbjct  738  LAVG  741



>ref|XP_008652556.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Zea mays]
 ref|XP_008652557.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Zea mays]
 ref|XP_008652558.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Zea mays]
 ref|XP_008652559.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Zea mays]
 ref|XP_008652560.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Zea mays]
 ref|XP_008652561.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Zea mays]
 ref|XP_008652562.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Zea mays]
 ref|XP_008652563.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Zea mays]
 ref|XP_008652564.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Zea mays]
 ref|XP_008652565.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Zea mays]
Length=752

 Score =   135 bits (340),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 64/124 (52%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G  +A+ +FELEP  A  YVLLSNIY+S+G W   + +R  M E GV+K PG SWIE   
Sbjct  568  GRNAAEKIFELEPENAGMYVLLSNIYASSGKWRDVDKMRHIMHERGVKKVPGFSWIEVQN  627

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F+ GD  HP+ E +Y FL+DL  +MK+ GYV  T  VLH+V ++EKE++L  HSE+
Sbjct  628  KVHTFSVGDSVHPEREDIYAFLEDLDIRMKKAGYVSATDMVLHDVEEEEKEHMLKYHSEK  687

Query  12   LAIA  1
            LA+A
Sbjct  688  LAVA  691



>ref|XP_002441185.1| hypothetical protein SORBIDRAFT_09g021880 [Sorghum bicolor]
 gb|EES19615.1| hypothetical protein SORBIDRAFT_09g021880 [Sorghum bicolor]
Length=878

 Score =   135 bits (341),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 62/124 (50%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G+++A+ L  LEP  ++ YVLLSNIYS+AG W++ ++VR+ M    V+KE GCSWI+   
Sbjct  694  GKLAAEKLLSLEPFDSATYVLLSNIYSAAGKWKEKDEVRKLMDTKKVKKEAGCSWIQIKN  753

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F A D SHP +E +Y  L  ++ K+K+EGY PDTS  LH V +++KE +L  HSER
Sbjct  754  KVHSFIASDKSHPLSEQIYAKLRAMTTKLKQEGYCPDTSFALHEVAEEQKEAMLAMHSER  813

Query  12   LAIA  1
            LA+A
Sbjct  814  LALA  817



>ref|XP_002263297.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 
[Vitis vinifera]
 ref|XP_010645112.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 
[Vitis vinifera]
 ref|XP_003634818.2| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 
[Vitis vinifera]
 ref|XP_010645113.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 
[Vitis vinifera]
 ref|XP_010645114.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 
[Vitis vinifera]
 emb|CBI24171.3| unnamed protein product [Vitis vinifera]
Length=687

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G I+A  LFE+E +   +YVLLSNI  SA LW +A++ R+ M++ GV K PGCSWI+   
Sbjct  503  GRIAANRLFEIESDNPGNYVLLSNILVSAKLWSEASETRKLMRDRGVTKNPGCSWIQVRN  562

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F  GD S+ Q++ +Y FLD + EKM+  GY+P+T  VL +V+ +EKE +LC HSE+
Sbjct  563  RVHTFVVGDKSNDQSDEIYRFLDYMGEKMRIAGYLPNTDFVLQDVDQEEKEEVLCNHSEK  622

Query  12   LAIA  1
            LA+A
Sbjct  623  LAVA  626



>emb|CBI38763.3| unnamed protein product [Vitis vinifera]
Length=719

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +A NLFELEP  A  YVLLSN+YS+AG WE+A   RR MK  GV KEPGCSWIE   
Sbjct  535  GERAANNLFELEPKNAVPYVLLSNLYSAAGKWEEAAKTRRLMKLRGVSKEPGCSWIEMSS  594

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH+F + D SHP+T  +Y  +D++   +KE GYVPD +  LH+++++ KE  L  HSE+
Sbjct  595  KVHRFMSEDRSHPRTAEIYSKVDEIMILIKEAGYVPDMNFALHDMDEEGKELGLAYHSEK  654

Query  12   LAIA  1
            LA+A
Sbjct  655  LAVA  658



>gb|AEB39781.1| pentatricopeptide repeat protein 79 [Funaria hygrometrica]
Length=820

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +A+   +LEP  A  YV LS IY++AG+W     +R+ MKE GV+KEPG SWIE   
Sbjct  636  GEQAAEQCLKLEPQNAGTYVSLSFIYAAAGMWRDVAKLRKLMKERGVKKEPGRSWIEVAG  695

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVH F AGD SHP+TE +Y  L+ L++++K  GYVPDT  V+H+++ + KE  +C HSE+
Sbjct  696  EVHSFVAGDQSHPRTEEIYSELEALTKQIKSLGYVPDTRFVMHDLDQEGKERAVCHHSEK  755

Query  12   LAIA  1
            LAIA
Sbjct  756  LAIA  759



>ref|XP_008802335.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, 
chloroplastic-like [Phoenix dactylifera]
Length=678

 Score =   134 bits (338),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 64/124 (52%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE++AK LF LEP  + +YVLLSN+Y+  G WE+   VR   K+ G+RK   CSWIE   
Sbjct  494  GEVAAKKLFVLEPENSGNYVLLSNMYAEFGRWEEVKKVRGLSKDRGIRKSLSCSWIEING  553

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +V+ F  GD SHPQ   +Y  L+DL +K+K  GYVPDTS VL +V+++EKE  L  HSE+
Sbjct  554  KVNAFLCGDRSHPQATRIYMLLEDLPKKIKNAGYVPDTSFVLQDVSEEEKECNLTTHSEK  613

Query  12   LAIA  1
            LA+A
Sbjct  614  LAVA  617



>ref|XP_010104766.1| hypothetical protein L484_021456 [Morus notabilis]
 gb|EXC01816.1| hypothetical protein L484_021456 [Morus notabilis]
Length=709

 Score =   135 bits (339),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 62/120 (52%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = -3

Query  360  AKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGEEVHK  181
            A+ +F ++P     YV+LSNIY++A  W+    +R +MK+ G+RK+P CSWIE G +VH 
Sbjct  529  AEKIFTVDPGNMGAYVILSNIYAAARRWKDVARLRVSMKKRGMRKKPACSWIEVGNKVHA  588

Query  180  FTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSERLAIA  1
            F AGD SHP  + + + L  L EKM+ EGYVPDT+ VLH+V++++K+ LL GHSERLAIA
Sbjct  589  FVAGDESHPFYDRINETLKVLLEKMEREGYVPDTNEVLHDVDEEQKKALLSGHSERLAIA  648



>ref|XP_004961923.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like 
[Setaria italica]
Length=872

 Score =   135 bits (341),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 61/124 (49%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G+++A+ L  LEP  ++ YVLLSNIYS+AG W++ ++VR+ M    V+KE GCSWI+   
Sbjct  688  GKLAAEKLLSLEPLDSATYVLLSNIYSAAGKWKEKDEVRKLMDTRKVKKEAGCSWIQIKN  747

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F A D SHP +E +Y  L  ++ ++K+EGY PDTS VLH   +++KE +L  HSER
Sbjct  748  KVHSFIASDKSHPLSEQIYAKLKAMTARLKKEGYCPDTSFVLHETAEEQKEAMLAMHSER  807

Query  12   LAIA  1
            LA+A
Sbjct  808  LALA  811



>ref|XP_004301257.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
[Fragaria vesca subsp. vesca]
Length=780

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +AK +FE+EP  A  YVLLSN+Y+S+G W     +R  M+++GVRK PG SWIE   
Sbjct  596  GEKAAKIIFEMEPENAGMYVLLSNLYASSGRWGDVGKMRLKMRDIGVRKVPGYSWIEVQN  655

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            ++H F+ GD  HP+ +++Y FL++L  KMK EGYV  T  VLH+V ++EKE++L  HSE+
Sbjct  656  KIHTFSVGDSVHPEKDNIYAFLEELDLKMKREGYVSSTKLVLHDVEEEEKEHMLRHHSEK  715

Query  12   LAIA  1
            LA+A
Sbjct  716  LAVA  719



>ref|XP_006290593.1| hypothetical protein CARUB_v10016682mg [Capsella rubella]
 gb|EOA23491.1| hypothetical protein CARUB_v10016682mg [Capsella rubella]
Length=850

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 90/128 (70%), Gaps = 4/128 (3%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G+++A+ + EL+PN  + Y+ LSNIY+SAG WE++ ++R+ MKE  + KE GCSWIE G+
Sbjct  662  GKMAARKILELDPNEPAAYIQLSNIYASAGKWEESTEMRKKMKERNLVKEGGCSWIEVGD  721

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDE----KENLLCG  25
            +VHKF  GD SHP    +YD LD L  ++K  GYVPDT  VLH + +D+    KE LL  
Sbjct  722  KVHKFYVGDTSHPNAHQIYDELDRLITEIKRCGYVPDTDLVLHKLEEDDDDAKKERLLSQ  781

Query  24   HSERLAIA  1
            HSE++A+A
Sbjct  782  HSEKIAVA  789



>ref|XP_008804906.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Phoenix dactylifera]
Length=519

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 94/125 (75%), Gaps = 1/125 (1%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             +I+A +LF LEP+   +YVLLSNIY+SAG+WE+ + VR+ M+  G+RK P  SW+E  +
Sbjct  334  AKIAADHLFVLEPDGIGNYVLLSNIYASAGMWEEVSKVRKLMRGRGLRKNPAASWVEAKD  393

Query  192  E-VHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSE  16
              VH+F AGDG HP++  + + L++L  ++K++GYVP  S V+++V+DDEKE LL GHSE
Sbjct  394  GLVHEFFAGDGLHPRSREIKEALEELLRRLKQDGYVPVLSSVVYDVSDDEKERLLKGHSE  453

Query  15   RLAIA  1
            +LA+A
Sbjct  454  KLALA  458



>ref|XP_010661558.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g15130 [Vitis vinifera]
 ref|XP_010661559.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g15130 [Vitis vinifera]
 ref|XP_010661560.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g15130 [Vitis vinifera]
Length=814

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +A NLFELEP  A  YVLLSN+YS+AG WE+A   RR MK  GV KEPGCSWIE   
Sbjct  630  GERAANNLFELEPKNAVPYVLLSNLYSAAGKWEEAAKTRRLMKLRGVSKEPGCSWIEMSS  689

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH+F + D SHP+T  +Y  +D++   +KE GYVPD +  LH+++++ KE  L  HSE+
Sbjct  690  KVHRFMSEDRSHPRTAEIYSKVDEIMILIKEAGYVPDMNFALHDMDEEGKELGLAYHSEK  749

Query  12   LAIA  1
            LA+A
Sbjct  750  LAVA  753



>ref|XP_010250314.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Nelumbo nucifera]
 ref|XP_010250315.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Nelumbo nucifera]
Length=743

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G+ +A +LFELEP   + Y+LLS+IY+S G W+    +RR M++ GVRKEPG SWI++  
Sbjct  559  GKWAADSLFELEPQNPAGYILLSSIYASKGKWDDVAKLRRGMRDKGVRKEPGFSWIKYKN  618

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +V+ F+A D S+P +E +Y  L+ L+ KM EEGYVPD S VLH+V++ EK  LL  HSE+
Sbjct  619  KVYIFSADDRSNPYSEQIYTELEKLNSKMIEEGYVPDMSSVLHDVDEAEKRKLLSHHSEK  678

Query  12   LAIA  1
            LAIA
Sbjct  679  LAIA  682



>ref|XP_010279265.1| PREDICTED: pentatricopeptide repeat-containing protein At3g63370 
[Nelumbo nucifera]
Length=952

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 88/125 (70%), Gaps = 1/125 (1%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A  L EL+P    +YVL+SN+++S G W+  ++VR  MK MG++K P C+WIE G 
Sbjct  767  GEIAAHKLLELDPENPGNYVLVSNVFASMGKWKDVDEVRMRMKGMGLKKNPACTWIEVGN  826

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEE-GYVPDTSCVLHNVNDDEKENLLCGHSE  16
            +VH FTA D  HPQT+ +Y  LD ++E ++ E GYV DT  VL NV ++EK  +L GHSE
Sbjct  827  KVHAFTARDRCHPQTQEIYLKLDQMTEILESEGGYVADTKFVLQNVQEEEKLKMLHGHSE  886

Query  15   RLAIA  1
            RLAIA
Sbjct  887  RLAIA  891



>ref|XP_003633097.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial-like [Vitis vinifera]
 ref|XP_010656220.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial-like [Vitis vinifera]
 ref|XP_010656221.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, 
mitochondrial-like [Vitis vinifera]
Length=1005

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +A  LFELEP + S+Y+LLSN++++ G+W+   +VR  M   GV+KEPGCSW+E   
Sbjct  821  GERAAMKLFELEPEIDSNYILLSNMFAAKGMWDDVTNVRALMSTRGVKKEPGCSWVEVNG  880

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F + DGSHP+   ++  L DL +K+   GY P+T  VLHNV+D EK+ LL  HSER
Sbjct  881  QVHVFLSHDGSHPKIREIHLKLQDLHQKLMSVGYTPNTDHVLHNVSDREKQELLFYHSER  940

Query  12   LAIA  1
            LA+A
Sbjct  941  LALA  944



>ref|XP_001775099.1| predicted protein [Physcomitrella patens]
 gb|EDQ60071.1| predicted protein [Physcomitrella patens]
Length=804

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +A++  +LEP  A  YV LS IY++AG+W     +R+ MKE GV+KEPG SWIE   
Sbjct  620  GERAAEHCLKLEPQNAGLYVSLSAIYAAAGMWRDVAKLRKFMKERGVKKEPGRSWIEIAG  679

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVH F A D SHP+T+ +Y  L+ L ++MK  GYVPDT  V+H+++D+ KE  +C HSE+
Sbjct  680  EVHSFVARDQSHPRTQEIYAELETLKKQMKSLGYVPDTRFVMHDLDDEGKERAVCHHSEK  739

Query  12   LAIA  1
            LAIA
Sbjct  740  LAIA  743



>ref|XP_011079980.1| PREDICTED: pentatricopeptide repeat-containing protein At3g63370 
[Sesamum indicum]
Length=936

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 87/125 (70%), Gaps = 1/125 (1%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +A+ L E++P    +YVL+SN+Y++AG WE A  VR  MK  G++K+PGCSWIE G 
Sbjct  751  GETAARKLLEMDPENPGNYVLISNVYAAAGRWEDAEQVRMRMKVRGLKKDPGCSWIEVGN  810

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEE-GYVPDTSCVLHNVNDDEKENLLCGHSE  16
            +VH F   D SHPQ + +YD L  ++EK++ E GY   TS VLHNV + EK  +L GHSE
Sbjct  811  KVHIFITRDRSHPQYDEIYDQLSQITEKLETEGGYKAQTSYVLHNVEEKEKMKMLHGHSE  870

Query  15   RLAIA  1
            RLA+A
Sbjct  871  RLALA  875



>ref|XP_010942245.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Elaeis guineensis]
 ref|XP_010942246.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Elaeis guineensis]
Length=744

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G+ +A+NL EL+P   + YVLLSN+Y++ G W++   +RR MK+  VRKEPGCSWI++  
Sbjct  560  GKWAAENLLELDPQSPASYVLLSNMYAARGKWDEVAQLRRGMKDRRVRKEPGCSWIKYKN  619

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +V+ F+A D SHP  E +Y  L+ L  KM EEGY PD S VLH+V + EK N+L  HSE+
Sbjct  620  KVYIFSADDQSHPYLERIYAELEKLHLKMVEEGYKPDMSSVLHDVGEAEKMNMLSHHSEK  679

Query  12   LAIA  1
            LAIA
Sbjct  680  LAIA  683



>ref|XP_002462229.1| hypothetical protein SORBIDRAFT_02g022150 [Sorghum bicolor]
 gb|EER98750.1| hypothetical protein SORBIDRAFT_02g022150 [Sorghum bicolor]
Length=686

 Score =   134 bits (337),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 64/124 (52%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G  +A+ +FELEP  A  YVLLSNIY+S+G W   + +R  M E GV+K PG SWIE   
Sbjct  520  GRNAAEKIFELEPENAGMYVLLSNIYASSGKWRDVDKMRLMMHERGVKKVPGFSWIEVQN  579

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F+ GD  HP+ E +Y FL+DL  +MK+ GYV  T  VLH+V ++EKE++L  HSE+
Sbjct  580  KVHTFSVGDSVHPEREDIYGFLEDLDIRMKKAGYVSATDMVLHDVEEEEKEHMLKYHSEK  639

Query  12   LAIA  1
            LA+A
Sbjct  640  LAVA  643



>ref|XP_003563798.2| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 
[Brachypodium distachyon]
Length=654

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 84/124 (68%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE++ + L ELEP  A +YVLLSNIY+ +G WEKA  VR+ M   G++K  GCSWIE   
Sbjct  470  GELALQKLIELEPEDAGNYVLLSNIYAQSGKWEKAARVRKLMTNRGLKKIIGCSWIELKG  529

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            + H F  GD SHP++  +Y+ L+ L   M + GY+PDT  V H+V DDEK N++  HSER
Sbjct  530  KTHGFLVGDASHPRSAEIYEELERLEGLMSDAGYMPDTMPVFHDVGDDEKRNMMRSHSER  589

Query  12   LAIA  1
            LAIA
Sbjct  590  LAIA  593



>tpg|DAA61049.1| TPA: hypothetical protein ZEAMMB73_995105 [Zea mays]
Length=824

 Score =   135 bits (339),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 64/124 (52%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G  +A+ +FELEP  A  YVLLSNIY+S+G W   + +R  M E GV+K PG SWIE   
Sbjct  640  GRNAAEKIFELEPENAGMYVLLSNIYASSGKWRDVDKMRHIMHERGVKKVPGFSWIEVQN  699

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F+ GD  HP+ E +Y FL+DL  +MK+ GYV  T  VLH+V ++EKE++L  HSE+
Sbjct  700  KVHTFSVGDSVHPEREDIYAFLEDLDIRMKKAGYVSATDMVLHDVEEEEKEHMLKYHSEK  759

Query  12   LAIA  1
            LA+A
Sbjct  760  LAVA  763



>ref|XP_010653819.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g13770, mitochondrial [Vitis vinifera]
Length=642

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE  A+ L E+E   A +YV+LSN+Y+SAG W+    VR  MKE  V KEPG SWIE  +
Sbjct  458  GEFVARRLLEIESENAGNYVILSNLYASAGRWDDVRTVRELMKEKAVIKEPGRSWIELDQ  517

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             +H F A D SHP+ E ++  + +LS K+KE GYVP+ SCVL++V+D++KE +L GHSE+
Sbjct  518  TLHTFHASDRSHPRKEEVFAKVRELSIKIKEAGYVPELSCVLYDVDDEQKEKILQGHSEK  577

Query  12   LAIA  1
            LA+A
Sbjct  578  LALA  581



>emb|CBI31710.3| unnamed protein product [Vitis vinifera]
Length=649

 Score =   133 bits (335),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 84/124 (68%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE++  +L +LEP   +H+V+LS+IY+ +G W  A   R  M ++G++K PGCSW+E   
Sbjct  465  GEVALDHLVKLEPRNPAHFVVLSSIYAQSGRWADAGKARSKMNDLGLKKTPGCSWVELKN  524

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F  GD SHPQ E ++   + L EKM++ GYVPD SCVL NV +++KE  L  HSER
Sbjct  525  KVHAFRVGDKSHPQLESMHLLWNTLLEKMEKIGYVPDRSCVLQNVEEEDKEMFLYSHSER  584

Query  12   LAIA  1
            LAI 
Sbjct  585  LAIT  588



>ref|XP_009417773.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Musa acuminata subsp. malaccensis]
Length=625

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE   + + EL+P  +  YVLL+N+++SAG W+ A +VRR M + GV KEPGCS IE G 
Sbjct  441  GEQIGRRVIELDPLNSGRYVLLANLFASAGRWDDAAEVRRLMNDRGVNKEPGCSMIEMGG  500

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             V +F AG  SHPQ   +Y  +D++ E++K EGY PDTS VLH+++++EKEN L  HSE+
Sbjct  501  VVSEFIAGGKSHPQAREIYVMVDEMLERIKAEGYAPDTSGVLHDIDEEEKENPLYYHSEK  560

Query  12   LAIA  1
            LAIA
Sbjct  561  LAIA  564



>dbj|BAP69206.1| pentatricopeptide repeat protein [Physcomitrella patens]
Length=1097

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 83/124 (67%), Gaps = 0/124 (0%)
 Frame = -3

Query  372   GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
              E +AK   +L+P  AS YVLLSNIY++ G WE+   VR  M+  G+RKEPG SWIE   
Sbjct  913   AEFAAKERLKLKPKSASTYVLLSNIYAATGNWEQKLLVRSMMQRRGIRKEPGRSWIEVDN  972

Query  192   EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             ++H F  GD SHP+++ +Y  L DL +++K EGYVPDT  VL N + + KE  LC HSE+
Sbjct  973   QIHSFVVGDTSHPESKEIYAKLKDLIKRLKAEGYVPDTRLVLRNTDQEYKEQALCSHSEK  1032

Query  12    LAIA  1
             LAI 
Sbjct  1033  LAIV  1036



>emb|CAN74558.1| hypothetical protein VITISV_014799 [Vitis vinifera]
Length=405

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +AK +FE+EP+ +  YVLLSN+Y+++G W     +R  M++ GV+K PG SW+E   
Sbjct  209  GEKAAKMIFEMEPDNSGMYVLLSNLYAASGRWGDVGRMRLRMRDRGVKKVPGYSWVEVQN  268

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            ++H FT GD  HP+ + +Y FL++L  KMK+EGYV  T  VLH+V ++EK ++L  HSE+
Sbjct  269  KIHTFTVGDSVHPERDRIYTFLEELDLKMKKEGYVSSTKLVLHDVEEEEKVHMLKYHSEK  328

Query  12   LAIA  1
            LA+A
Sbjct  329  LAVA  332



>ref|XP_009391885.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g13770, mitochondrial [Musa acuminata subsp. malaccensis]
Length=637

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE  A+ L ++EP  + ++V+LSNIY++AG W+    VR  MKE  V KEPG SWI   +
Sbjct  453  GEFVAQKLLDIEPENSGNFVILSNIYAAAGRWQDVARVRELMKERTVTKEPGRSWINLDK  512

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             +H F + D SHPQ E +   + ++ E++KE GYVPD SCVLH+V+D++KE++L GHSE+
Sbjct  513  TMHTFYSSDRSHPQREQINAKIMEVYERIKEAGYVPDLSCVLHDVDDEQKESMLLGHSEK  572

Query  12   LAIA  1
            LAIA
Sbjct  573  LAIA  576



>ref|XP_001785902.1| predicted protein [Physcomitrella patens]
 gb|EDQ49285.1| predicted protein [Physcomitrella patens]
Length=908

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 83/124 (67%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E +AK   +L+P  AS YVLLSNIY++ G WE+   VR  M+  G+RKEPG SWIE   
Sbjct  724  AEFAAKERLKLKPKSASTYVLLSNIYAATGNWEQKLLVRSMMQRRGIRKEPGRSWIEVDN  783

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            ++H F  GD SHP+++ +Y  L DL +++K EGYVPDT  VL N + + KE  LC HSE+
Sbjct  784  QIHSFVVGDTSHPESKEIYAKLKDLIKRLKAEGYVPDTRLVLRNTDQEYKEQALCSHSEK  843

Query  12   LAIA  1
            LAI 
Sbjct  844  LAIV  847



>ref|XP_007015858.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
 gb|EOY33477.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
Length=875

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G+++A+ L  L+P  ++ YVLLSNIY++ G W++   VR+ M++  VRKEPG SWIE   
Sbjct  691  GKLAAEQLISLQPQDSAAYVLLSNIYAATGNWQERTKVRKLMEKRKVRKEPGYSWIEVKN  750

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            + H F AGD SHP ++H+Y  LD+L  ++K+ GY PDT+ VL +++D+ KE +L  HSER
Sbjct  751  KTHSFLAGDLSHPMSDHIYSKLDELKTRLKDMGYQPDTNYVLQDIDDEHKETILSQHSER  810

Query  12   LAIA  1
            LAIA
Sbjct  811  LAIA  814



>ref|XP_008785452.1| PREDICTED: pentatricopeptide repeat-containing protein At2g39620 
[Phoenix dactylifera]
Length=1007

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 82/124 (66%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE++   L  LEP  A+HYV+L+NIY+ AG W  A  VR  M + G+ K PGCSW+E   
Sbjct  823  GEMAVDRLVRLEPKNAAHYVVLANIYAQAGRWADARKVRVAMNQTGLNKTPGCSWVEINN  882

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             +H F  GD SHPQ + + +  + L EKM+  GYV DTS VLHNV ++EK + L GHSER
Sbjct  883  AIHAFRVGDQSHPQYKSMCNLWNGLLEKMENMGYVADTSSVLHNVEEEEKLSFLHGHSER  942

Query  12   LAIA  1
            LAI+
Sbjct  943  LAIS  946



>ref|XP_007029874.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
 gb|EOY10376.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
Length=720

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E  AK LFE++P     YVL+SNIY++A  W+ A  +R ++K+ G+RKEP CSWIE   
Sbjct  536  AEKVAKRLFEVDPENVGAYVLMSNIYAAAQRWKDAAKMRSSLKKKGIRKEPACSWIEVKN  595

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F +GD SHP  E +Y    DL E+M+ EGY+PDTS V H+V +++K+ LL  HSER
Sbjct  596  RVHTFMSGDKSHPLYERIYKAWKDLLEQMEREGYIPDTSEVCHDVEEEQKKYLLFSHSER  655

Query  12   LAIA  1
            LA+A
Sbjct  656  LALA  659



>ref|XP_002306801.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE93797.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=818

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 87/125 (70%), Gaps = 1/125 (1%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+A+ L +L+P+    YVL+SN+++++G W+   +VR  MK  G++K PGCSWIE G 
Sbjct  633  GEIAAQKLLDLDPDSPGSYVLISNVFAASGRWKDVEEVRMRMKGGGLKKNPGCSWIEVGN  692

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKM-KEEGYVPDTSCVLHNVNDDEKENLLCGHSE  16
            +VH F   D SHP++  +Y  L  ++EK+ KE GYVP T  VLHNV  +EK  +L GHSE
Sbjct  693  KVHTFLVRDKSHPESYKIYQKLAQITEKLEKEGGYVPQTKLVLHNVGKEEKVQMLYGHSE  752

Query  15   RLAIA  1
            RLAIA
Sbjct  753  RLAIA  757



>ref|XP_008779860.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like, 
partial [Phoenix dactylifera]
Length=685

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +AK   EL P  +  YVLLSNIY+SAGLW+  + +R  MKE GVRK+PG S +E G 
Sbjct  507  GEFAAKRAIELAPEASGCYVLLSNIYASAGLWDSVSKMRGLMKERGVRKDPGSSMVEHGG  566

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH+F  GD SHPQTE +Y+ L+++ +++K  GY+PDTS VL  + + +KE  L  HSER
Sbjct  567  VVHEFAVGDTSHPQTEAIYNKLNEMGKRLKCAGYIPDTSQVLLCIEERDKEAELALHSER  626

Query  12   LAIA  1
            LAIA
Sbjct  627  LAIA  630



>dbj|BAC83258.1| pentatricopeptide (PPR) repeat-containing protein-like protein 
[Oryza sativa Japonica Group]
 dbj|BAD30928.1| pentatricopeptide (PPR) repeat-containing protein-like protein 
[Oryza sativa Japonica Group]
Length=808

 Score =   134 bits (337),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 59/124 (48%), Positives = 82/124 (66%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G  +A  LF + P     Y+LLSN YS+AG W  A  VR+ M++ GV+KEPGCSWIE G 
Sbjct  624  GAYAADQLFRMIPQHDGTYILLSNTYSAAGRWVDAARVRKLMRDRGVKKEPGCSWIEVGS  683

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            ++H F  GD  HP+ + +Y FL+ +  +M++ GYVPDT  VLH++   EKE +L  HSE+
Sbjct  684  KIHVFLVGDTKHPEAQEVYQFLEVIGARMRKLGYVPDTKFVLHDMEPHEKEYILFAHSEK  743

Query  12   LAIA  1
            LA+ 
Sbjct  744  LAVG  747



>ref|XP_004234215.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g49142 [Solanum lycopersicum]
Length=695

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 84/124 (68%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G ++A NLFEL P  + +YVLLSNIY+ AG W+    VR  MK  G++K PG S +E   
Sbjct  511  GLVAADNLFELAPKQSGYYVLLSNIYAKAGRWKDVTTVRSIMKGKGIKKMPGVSNVELNN  570

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F AGD SHPQ++ +Y+ LD L  KMKEEGYVP+    LH+V ++EKEN L  HSE+
Sbjct  571  MVHTFLAGDTSHPQSKEIYEELDILIGKMKEEGYVPEIDSALHDVEEEEKENHLVVHSEK  630

Query  12   LAIA  1
            LAI 
Sbjct  631  LAIV  634



>ref|XP_010515261.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, 
chloroplastic [Camelina sativa]
Length=851

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 90/129 (70%), Gaps = 5/129 (4%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G+++A+ + EL+PN  + Y+ LSNIY+SAG WE++ ++R+ MKE  + KE GCSWIE G+
Sbjct  662  GKMAARKILELDPNEPAAYIQLSNIYASAGKWEESTEMRKKMKERNLVKEGGCSWIEVGD  721

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDE-----KENLLC  28
            +VHKF  GD SHP    +YD LD L  ++K  GYVPDT  VLH + +D+     KE LL 
Sbjct  722  KVHKFYVGDTSHPNAHQIYDELDRLITEIKRCGYVPDTDLVLHKLEEDDDDEGKKERLLY  781

Query  27   GHSERLAIA  1
             HSE++A+A
Sbjct  782  QHSEKIAVA  790



>gb|KGN59332.1| hypothetical protein Csa_3G810560 [Cucumis sativus]
Length=486

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G I  + L ELEP  A +YV+LSN+Y+SAG WE   ++R  M+E  V KEPG SW+E  +
Sbjct  302  GIIVGQKLLELEPENAGNYVILSNLYASAGKWEDMRNIRDLMQEKAVTKEPGRSWVELDQ  361

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F A D +HP+ E +   + +LS K KE+GYVPD SCVL++V++++KE +L GHSE+
Sbjct  362  IVHTFHASDHTHPRREEVAKKVKELSIKFKEDGYVPDLSCVLYDVDEEQKEKVLLGHSEK  421

Query  12   LAIA  1
            LA+A
Sbjct  422  LALA  425



>gb|KDP25707.1| hypothetical protein JCGZ_24008 [Jatropha curcas]
Length=648

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 82/124 (66%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+AK LF LEP    +Y+LLSNIY+S G+W + N VR  M   G+RK PGCSWIE   
Sbjct  464  GEIAAKELFALEPKNPGNYILLSNIYASKGMWIEVNVVRDMMNSRGLRKNPGCSWIEVKS  523

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH   AGD SHPQ   + + L +L  +MK+ G   DT  VL +V + +KE +LCGHSE+
Sbjct  524  KVHMLMAGDNSHPQMTQIIEKLAELRMEMKKSGCFLDTDFVLQDVEEQDKEQILCGHSEK  583

Query  12   LAIA  1
            LA+ 
Sbjct  584  LAVV  587



>ref|XP_010465240.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g13770, mitochondrial [Camelina sativa]
Length=586

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE   + L E+EP  A +YV+LSN+Y+SAG WE  N++R  M +  V KEPG SWI+  +
Sbjct  402  GESVGRKLIEIEPENAGNYVILSNLYASAGRWEDVNNLRALMTQKAVTKEPGRSWIQLEQ  461

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             +H F A D +HP+ E + D + ++S KMK+ GYVPD SCVL++V++++KE +L GHSE+
Sbjct  462  TLHYFHANDRTHPRREEVLDKMKEISIKMKQAGYVPDLSCVLYDVDEEQKEKMLLGHSEK  521

Query  12   LAIA  1
            LA+ 
Sbjct  522  LALT  525



>gb|EYU24286.1| hypothetical protein MIMGU_mgv1a025107mg [Erythranthe guttata]
Length=654

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE++A+ LFELEP    +Y+L+SNIY+S G +++ + +R  M++ G+RK PGCSWIE   
Sbjct  470  GEVAARKLFELEPMNPGNYILMSNIYASKGRYKEVDKIRDIMRDKGLRKNPGCSWIEVKN  529

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH   AGD S PQ   + D L+ LS +MK+ GY P+T  VL +V + EKE++LCGHSE+
Sbjct  530  KVHMLLAGDKSLPQMAQIMDKLNRLSIEMKKAGYSPNTDYVLQDVEEQEKEHILCGHSEK  589

Query  12   LAIA  1
            LA+ 
Sbjct  590  LAVV  593



>ref|XP_009149759.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, 
chloroplastic [Brassica rapa]
Length=850

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 89/128 (70%), Gaps = 4/128 (3%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEIS++ + EL+PN  + Y+ LSNIY+S G WE++ ++R+ MKE  + KE GCSWIE G+
Sbjct  662  GEISSRKILELDPNEPAAYIQLSNIYASTGKWEESAEMRKKMKERNLVKEGGCSWIEVGD  721

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDD----EKENLLCG  25
            + HKF  GD SHP T  +YD LD L  ++K  GYVPDT  VLH + ++    EKE LL  
Sbjct  722  KFHKFYVGDTSHPNTHRIYDELDRLIREIKRCGYVPDTDLVLHKLEEEDDVAEKERLLFQ  781

Query  24   HSERLAIA  1
            HSE++A+A
Sbjct  782  HSEKIAVA  789



>ref|XP_003545909.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like 
[Glycine max]
Length=741

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             +ISA  LFE+EPN   +YV L NI  +A LW +A++ R  MKE G+ K PGCSW++ G+
Sbjct  557  AKISANKLFEIEPNNPGNYVSLFNILVTAKLWSEASEARILMKERGITKTPGCSWLQVGD  616

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F  GD ++ +++ +Y+FLD+L EKMK  GY PDT  VL +++ +EK   LC HSE+
Sbjct  617  RVHTFVVGDKNNMESDKIYNFLDELGEKMKSAGYKPDTDYVLQDIDQEEKAESLCSHSEK  676

Query  12   LAIA  1
            LA+A
Sbjct  677  LAVA  680



>gb|ACE80747.1| pentatricopeptide repeat protein, partial [Lepidogyna hodgsoniae]
Length=143

 Score =   125 bits (313),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE  A+ + +L+P  A+ YVLLSNIY+++G W+++ D++R   E GVRK+PG +WIE   
Sbjct  5    GEHVAELVLDLDPGNAAGYVLLSNIYAASGKWDRSADLQRQRLERGVRKQPGRTWIEVNN  64

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVH FT  D  HPQ   ++  L+ L  +M   G VPDTS VLH+V+++EK N LC HSE+
Sbjct  65   EVHSFTVDDQDHPQINDIHGELNRLLGQMMVIGCVPDTSLVLHDVDEEEKINRLCHHSEK  124

Query  12   LAIA  1
            LAIA
Sbjct  125  LAIA  128



>ref|XP_009347240.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like 
[Pyrus x bretschneideri]
Length=692

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = -3

Query  363  SAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGEEVH  184
            +A  LFE+EP   + Y+ L+NIY++AG+W    +VR+ M E G+ K+PG SWIE   EVH
Sbjct  511  AADALFEIEPENPTTYITLANIYATAGMWGDVTEVRKMMDERGLIKKPGLSWIEIKREVH  570

Query  183  KFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSERLAI  4
             F  GD SHP+ + ++ +L +LS++MKEEGYVPDT+ VLH+V +++KE  L  HSE+LA+
Sbjct  571  VFLVGDTSHPRYDEIHHYLHELSKRMKEEGYVPDTNFVLHDVEEEQKEQNLSYHSEKLAV  630

Query  3    A  1
            A
Sbjct  631  A  631



>ref|XP_008653295.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Zea mays]
 ref|XP_008653296.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Zea mays]
 ref|XP_008653297.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Zea mays]
 tpg|DAA63384.1| TPA: hypothetical protein ZEAMMB73_689576 [Zea mays]
Length=802

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 83/123 (67%), Gaps = 0/123 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G  +A  LF++ P     Y+LLSN YS+AG W  A  VR+ M++ GV+KEPGCSWIE G 
Sbjct  618  GAHAADQLFKMTPQHDGTYILLSNTYSAAGCWVDAARVRKLMRDRGVKKEPGCSWIEAGN  677

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F  GD  HP+   +Y FL+ +  KM++ GYVPDT  VLH++   +KE++L  HSER
Sbjct  678  KVHVFLVGDTKHPEAHEVYKFLEMVGAKMRKLGYVPDTKVVLHDMEPHQKEHILFAHSER  737

Query  12   LAI  4
            LA+
Sbjct  738  LAV  740



>ref|XP_002324099.1| hypothetical protein POPTR_0017s12720g [Populus trichocarpa]
 gb|EEF04232.1| hypothetical protein POPTR_0017s12720g [Populus trichocarpa]
Length=676

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = -3

Query  363  SAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGEEVH  184
            +A+ LFE+EP   + YV L+NIY++AG+W +   +R+ M + GV K+PG SWI    +VH
Sbjct  495  AAEALFEIEPENPATYVTLANIYATAGMWSEVAKIRKTMDDRGVVKKPGLSWIAIKRDVH  554

Query  183  KFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSERLAI  4
             F  GD SHP+++ + +FL  LS++MKEEG+VPDT+ VLH+V D++KE  L  HSE+LA+
Sbjct  555  VFLVGDDSHPKSKEINEFLGKLSKRMKEEGFVPDTNFVLHDVEDEQKEQNLSYHSEKLAV  614

Query  3    A  1
            A
Sbjct  615  A  615



>gb|EAY92839.1| hypothetical protein OsI_14639 [Oryza sativa Indica Group]
Length=702

 Score =   133 bits (335),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 66/124 (53%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+ + L ELEP  ASHYVLL NIYS+AG W +A +VR  M+  GV KEPGCSWIE   
Sbjct  518  GEIAGERLLELEPEEASHYVLLCNIYSAAGQWTRAAEVRSRMRRRGVAKEPGCSWIEVDG  577

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             +H+F AG+ +HP +E ++  ++ L  +M   GY PDTSCVLH+++D +K  +L  HSE+
Sbjct  578  AIHRFMAGESAHPASEEVHAHMEALWGEMVARGYTPDTSCVLHDMDDGDKAAVLRCHSEK  637

Query  12   LAIA  1
            LAIA
Sbjct  638  LAIA  641



>gb|KDP40584.1| hypothetical protein JCGZ_24583 [Jatropha curcas]
Length=815

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +A  LFEL P+   ++VLL+NIY++A +WEK  +VR  M++ G++K PGCS +E   
Sbjct  632  GEKAANKLFELNPDEGGYHVLLANIYATASMWEKLAEVRTMMRKKGLQKTPGCSLVELRN  691

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            E+H F +G  SHPQ++ +Y FL+ L  K+K  GYVPDTS + H+V DD KE LL  HSE+
Sbjct  692  EIHSFYSGGISHPQSKEIYAFLETLVGKIKAAGYVPDTSSI-HDVEDDVKEQLLNTHSEK  750

Query  12   LAIA  1
            LAIA
Sbjct  751  LAIA  754



>ref|XP_007036762.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 ref|XP_007036763.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 ref|XP_007036764.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY21263.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY21264.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY21265.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
Length=768

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E++A+ +FE+EP  A  YVLLSN+Y+++G W   + +R  M++ GV+K PGCSW+E   
Sbjct  584  AEMAAQLIFEMEPENAGMYVLLSNLYAASGRWADVSRMRLQMRDTGVKKVPGCSWLEVQS  643

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            ++H F+ GD  HP  + +Y +L++L  KMK+EGYV  T+ +LH+V+++EKE++L  HSE+
Sbjct  644  KIHTFSVGDSCHPDRDKIYAYLEELDLKMKQEGYVSSTNLILHDVDNEEKEHMLKYHSEK  703

Query  12   LAIA  1
            LA+A
Sbjct  704  LAVA  707



>gb|EEE67500.1| hypothetical protein OsJ_24934 [Oryza sativa Japonica Group]
Length=830

 Score =   134 bits (336),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 59/124 (48%), Positives = 82/124 (66%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G  +A  LF + P     Y+LLSN YS+AG W  A  VR+ M++ GV+KEPGCSWIE G 
Sbjct  622  GAYAADQLFRMIPQHDGTYILLSNTYSAAGRWVDAARVRKLMRDRGVKKEPGCSWIEVGS  681

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            ++H F  GD  HP+ + +Y FL+ +  +M++ GYVPDT  VLH++   EKE +L  HSE+
Sbjct  682  KIHVFLVGDTKHPEAQEVYQFLEVIGARMRKLGYVPDTKFVLHDMEPHEKEYILFAHSEK  741

Query  12   LAIA  1
            LA+ 
Sbjct  742  LAVG  745



>ref|XP_009348084.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like 
[Pyrus x bretschneideri]
Length=692

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = -3

Query  363  SAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGEEVH  184
            +A  LFE+EP   + Y+ L+NIY++AG+W    +VR+ M E G+ K+PG SWIE   EVH
Sbjct  511  AADALFEIEPENPTTYITLANIYATAGMWGDVTEVRKMMDERGLIKKPGLSWIEIKREVH  570

Query  183  KFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSERLAI  4
             F  GD SHP+ + ++ +L +LS++MKEEGYVPDT+ VLH+V +++KE  L  HSE+LA+
Sbjct  571  VFLVGDTSHPRYDEIHHYLHELSKRMKEEGYVPDTNFVLHDVEEEQKEQNLSYHSEKLAV  630

Query  3    A  1
            A
Sbjct  631  A  631



>gb|EAY98286.1| hypothetical protein OsI_20194 [Oryza sativa Indica Group]
Length=874

 Score =   134 bits (336),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 60/124 (48%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G+ SA  L  LEP+ +S YVLLSNIY++AG W++ ++VR+ M    V+KE GCSWI+   
Sbjct  690  GKFSADKLLSLEPHDSSTYVLLSNIYAAAGKWKERDEVRKLMDYRKVKKEAGCSWIQIKN  749

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F A D SHP ++ +Y  L  +  ++K++GY P+TS VLH++ +D+KE +L  HSER
Sbjct  750  KVHSFIAFDKSHPMSDQIYKKLKVIITRLKQDGYSPNTSFVLHDIAEDQKEAMLVAHSER  809

Query  12   LAIA  1
            LA+A
Sbjct  810  LALA  813



>ref|NP_001055727.1| Os05g0455900 [Oryza sativa Japonica Group]
 gb|AAU90217.1| unknow protein [Oryza sativa Japonica Group]
 dbj|BAF17641.1| Os05g0455900 [Oryza sativa Japonica Group]
 gb|EEE63958.1| hypothetical protein OsJ_18783 [Oryza sativa Japonica Group]
Length=874

 Score =   134 bits (336),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 60/124 (48%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G+ SA  L  LEP+ +S YVLLSNIY++AG W++ ++VR+ M    V+KE GCSWI+   
Sbjct  690  GKFSADKLLSLEPHDSSTYVLLSNIYAAAGKWKERDEVRKLMDYRKVKKEAGCSWIQIKN  749

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F A D SHP ++ +Y  L  +  ++K++GY P+TS VLH++ +D+KE +L  HSER
Sbjct  750  KVHSFIAFDKSHPMSDQIYKKLKVIITRLKQDGYSPNTSFVLHDIAEDQKEAMLVAHSER  809

Query  12   LAIA  1
            LA+A
Sbjct  810  LALA  813



>ref|XP_002977518.1| hypothetical protein SELMODRAFT_107192 [Selaginella moellendorffii]
 gb|EFJ21522.1| hypothetical protein SELMODRAFT_107192 [Selaginella moellendorffii]
Length=652

 Score =   132 bits (333),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE +A+ +FEL+P  +S Y+ L+NIYS+A   + A  +R+ M+E G++K+PGCSWIE  +
Sbjct  468  GEAAAEVVFELDPENSSPYITLANIYSAAKRPKDAARIRKLMEERGIKKKPGCSWIEVLD  527

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH+F AGD  HPQ + +Y  +  L  +MKE GY  DT  VL +V +DEKENLL  HSE+
Sbjct  528  RVHEFIAGDKMHPQRDEIYAEIQRLGRQMKEAGYFQDTKVVLQDVEEDEKENLLWYHSEK  587

Query  12   LAIA  1
            LAIA
Sbjct  588  LAIA  591



>ref|XP_011085507.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Sesamum indicum]
Length=697

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E +AK LF++EP  A+ YV L+NIY++AG W +   VR+ M E GV K+PG SWI   +
Sbjct  513  AERAAKALFQIEPENAATYVTLANIYATAGKWSEVAKVRKLMDERGVVKKPGMSWININK  572

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F  GD SHP+++ +++FL  +S++MKEEGYVP T+ VLH+V +++KE  L  HSE+
Sbjct  573  KVHIFLVGDQSHPRSKEIFNFLGKVSKRMKEEGYVPHTNYVLHDVEEEQKEQNLSYHSEK  632

Query  12   LAIA  1
            LA+A
Sbjct  633  LAVA  636



>ref|XP_011029025.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 
[Populus euphratica]
Length=712

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 84/124 (68%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+AK +FELEP    +Y+LLSNIY+S  +W + + VR  M+  G++K PG SWIE   
Sbjct  528  GEIAAKRVFELEPRNPGNYILLSNIYASKAMWVEVDTVRDMMRSRGLKKNPGYSWIEIKN  587

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH   AGD SHPQ   + + L  L+ +MK+ GYVP T  VL +V + +KE +LCGHSE+
Sbjct  588  KVHMLLAGDSSHPQMPQIIEKLAKLTVEMKKSGYVPHTDFVLQDVEEQDKEQILCGHSEK  647

Query  12   LAIA  1
            LA+ 
Sbjct  648  LAVV  651



>ref|XP_008653491.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Zea mays]
 tpg|DAA44381.1| TPA: hypothetical protein ZEAMMB73_039747 [Zea mays]
Length=645

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E++ + L ELEP  A +YVLLSNIY+ +G WE+A  VR+ M   G++K   CSWIE   
Sbjct  461  AELALQKLIELEPEDAGNYVLLSNIYAESGKWEEAARVRKLMTNRGLKKIIACSWIELKG  520

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            + H F  GD SHP+++ +Y+ L+ L   + + GYVPDT+ V HNV DDEK N++ GHSER
Sbjct  521  KFHGFLVGDASHPRSDDIYEELERLEGLISQTGYVPDTTPVFHNVEDDEKRNMVWGHSER  580

Query  12   LAIA  1
            LAIA
Sbjct  581  LAIA  584



>ref|XP_010255945.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 
[Nelumbo nucifera]
Length=756

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G+ +A  LF+LEP+   +YVLLSNIY++ G+W + + VR  MK+MG+RK PGCSWIE   
Sbjct  572  GKTAADKLFKLEPSNPGNYVLLSNIYAAKGMWSEVDRVRDMMKDMGLRKNPGCSWIEVKN  631

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH   AGD SHPQ   +   L+ L+ +MK+ G +P T+ VL +V + +KE  LCGHSE+
Sbjct  632  KVHMLLAGDKSHPQITQIIMRLERLTIEMKKSGQLPITNFVLQDVEEHDKEQFLCGHSEK  691

Query  12   LAIA  1
            LAI 
Sbjct  692  LAIG  695



>ref|XP_004161498.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g13770, mitochondrial-like [Cucumis sativus]
Length=638

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G I  + L ELEP  A +YV+LSN+Y+SAG WE   ++R  M+E  V KEPG SW+E  +
Sbjct  454  GIIVGQKLLELEPENAGNYVILSNLYASAGKWEDMRNIRDLMQEKAVTKEPGRSWVELDQ  513

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             VH F A D +HP+ E + + + +LS K KE+GYVPD SCVL++V++++KE +L GHSE+
Sbjct  514  IVHTFHASDHTHPRREEVANKVKELSIKFKEDGYVPDLSCVLYDVDEEQKEKVLLGHSEK  573

Query  12   LAIA  1
            LA+A
Sbjct  574  LALA  577



>ref|XP_001774871.1| predicted protein [Physcomitrella patens]
 gb|EDQ60283.1| predicted protein [Physcomitrella patens]
Length=902

 Score =   134 bits (336),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/124 (50%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E +A++  +L+ + A  YV LS++Y++AG+W+ A  +R+ M++ GV KEPG SWI+ G+
Sbjct  718  AERAAESSLKLDLDNAVVYVALSHMYAAAGMWDSAAKLRKLMEQRGVTKEPGRSWIQVGD  777

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            ++H F A D SHPQ+E +Y  LD L+  MK +GYVPDT  V+H+V++ EKEN +C HSER
Sbjct  778  KLHYFVAEDRSHPQSEKIYAELDRLTHAMKMKGYVPDTRSVMHDVDEGEKENAVCHHSER  837

Query  12   LAIA  1
            LAIA
Sbjct  838  LAIA  841



>gb|EMT13464.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii]
Length=750

 Score =   133 bits (334),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 62/124 (50%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G+ +A+ +FELEP  A  YVLLSNIY+S+G W     +R  M++ GV+K PG SW+E   
Sbjct  566  GKSAAEKIFELEPENAGMYVLLSNIYASSGKWRDVGKMRVMMEDRGVKKVPGFSWMEVQN  625

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F+ GD  HP+ E +Y FL+DL  ++K+ GYV  T  VLH+V D+EKE++L  HSE+
Sbjct  626  KVHTFSVGDCVHPEKEKIYAFLEDLDMRIKKAGYVSATEMVLHDVEDEEKEHMLKYHSEK  685

Query  12   LAIA  1
            LA+A
Sbjct  686  LAVA  689



>gb|KCW57176.1| hypothetical protein EUGRSUZ_I02804 [Eucalyptus grandis]
Length=576

 Score =   131 bits (330),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 61/123 (50%), Positives = 85/123 (69%), Gaps = 0/123 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E++A  LFE+EPN + +YVLLSNIY+ AG WE  + VRR M++ GV K  G SW+E G 
Sbjct  392  AEMAAYGLFEIEPNNSGNYVLLSNIYAQAGRWEDVDRVRRMMRKRGVMKATGWSWVEHGG  451

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            EVHKF AGD SH +   +Y  L +L  +M+  GYV D SCVL +V ++++E ++  HSE+
Sbjct  452  EVHKFIAGDRSHERCSEIYHLLANLRRRMERSGYVADGSCVLRDVVEEDREEMVGVHSEK  511

Query  12   LAI  4
            LA+
Sbjct  512  LAV  514



>gb|KHN44977.1| Putative pentatricopeptide repeat-containing protein [Glycine 
soja]
Length=654

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            G+ +A++L +LEP+  + Y+LLS+IY++ G WE+  ++R+ M++ G+RKEPGCSWI++  
Sbjct  470  GKWAAESLLKLEPHNTASYILLSSIYAAKGKWEEVANLRKGMRDKGLRKEPGCSWIKYKN  529

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            +VH F+A D S+P ++ +Y  L+ L+ KM +EGYVPD + VLH+V+D EK  +L  HSE+
Sbjct  530  QVHIFSADDQSNPFSDQIYSELEKLNYKMVQEGYVPDMNSVLHDVDDSEKIKMLNHHSEK  589

Query  12   LAIA  1
            LAIA
Sbjct  590  LAIA  593



>ref|XP_002268784.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Vitis vinifera]
Length=647

 Score =   132 bits (332),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 60/126 (48%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             +I+A +LFELEPN   +Y+LLSNIY+SAG W+  + VR+ M+  G++K PGCSW+E G+
Sbjct  462  AQIAASHLFELEPNGIGNYILLSNIYASAGRWDDVSKVRKLMRAKGLKKNPGCSWVE-GK  520

Query  192  E--VHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHS  19
            +  +H+F AGD SHP++  +   L+DL +++K  GY P+ S V ++++D+EK+ LL  HS
Sbjct  521  KGIIHEFFAGDMSHPKSREIKQALEDLLDRLKYLGYQPNLSSVAYDISDEEKKRLLMSHS  580

Query  18   ERLAIA  1
            E+LA+A
Sbjct  581  EKLALA  586



>ref|XP_006342434.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like isoform X1 [Solanum tuberosum]
Length=654

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E +AK + +L+P+ A  Y+LLSNIY+    WE   D+RR+MKE GV+KEPGCSWIE  +
Sbjct  470  AEYAAKQIIKLDPSDAGTYILLSNIYARTQKWEDVMDLRRSMKERGVKKEPGCSWIEVNK  529

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            ++H F  GD SHPQ E +   L+ +  ++KE GYVPDT+ VL ++ D++ E+ L  HSE+
Sbjct  530  QIHAFIMGDNSHPQKEEINKELNQIIWRLKEVGYVPDTNFVLQDLEDEQMEDSLLYHSEK  589

Query  12   LAIA  1
            +A+A
Sbjct  590  IAVA  593



>ref|XP_007028899.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao]
 gb|EOY09401.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao]
Length=718

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GE   + L E+EP  A +YV+LSN+++SAG WE    VR  M E  V+K+PG SWIE  +
Sbjct  402  GEFVGRRLLEIEPENAGNYVILSNLFASAGRWEDVRMVRDLMMEKAVKKDPGRSWIELDQ  461

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
             +H F A D SHP+ E +   L +LS K+KE GYVPD SCVLH+V++++KE +L GHSE+
Sbjct  462  TLHSFHASDRSHPRREEVLVKLKELSIKLKEAGYVPDLSCVLHDVDEEQKEKILLGHSEK  521

Query  12   LAIA  1
            LA+ 
Sbjct  522  LALT  525



>ref|XP_011005831.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g46460, mitochondrial [Populus euphratica]
Length=531

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = -3

Query  363  SAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGEEVH  184
            +AK++ +LEPN ++ YVLLSNIY+SAG W   + +R  MK+ G+ K+PG SW+    + H
Sbjct  350  AAKHILDLEPNCSAAYVLLSNIYASAGRWADVSRMRVKMKQGGLAKQPGSSWVVLRGKKH  409

Query  183  KFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSERLAI  4
            +F + D SHP +E +YD LD L +K+KE GYVPD    LH+V D++KE +L  HSERLAI
Sbjct  410  EFLSADRSHPLSERIYDKLDWLGKKLKEFGYVPDQKFALHDVEDEQKEEMLSFHSERLAI  469

Query  3    A  1
            A
Sbjct  470  A  470



>emb|CDY08114.1| BnaA06g16120D [Brassica napus]
Length=850

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 89/128 (70%), Gaps = 4/128 (3%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
            GEI+++ + EL+PN  + Y+ LSNIY+S G WE++ ++R+ MKE  + KE GCSWIE G+
Sbjct  662  GEIASRKILELDPNEPAAYIQLSNIYASTGKWEESAEMRKKMKERNLVKEGGCSWIEVGD  721

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDD----EKENLLCG  25
            + HKF  GD SHP T  +YD LD L  ++K  GYVPDT  VLH + ++    EKE LL  
Sbjct  722  KFHKFYVGDTSHPNTHRIYDELDRLIREIKRCGYVPDTDLVLHKLEEEDDVAEKERLLFQ  781

Query  24   HSERLAIA  1
            HSE++A+A
Sbjct  782  HSEKIAVA  789



>ref|XP_008454056.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Cucumis melo]
 ref|XP_008454057.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Cucumis melo]
 ref|XP_008454058.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Cucumis melo]
 ref|XP_008454059.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Cucumis melo]
Length=686

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = -3

Query  363  SAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGEEVH  184
            +AK+LFE+EP   + YV L+N+Y+SAG+W +  ++R  M   G+ KEPG SWIE   EVH
Sbjct  505  AAKSLFEIEPENPTTYVTLANMYASAGMWAEEANMRETMNNRGIVKEPGLSWIEIKREVH  564

Query  183  KFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSERLAI  4
             FT GD SHP+++ + ++L +LS++MKE GYVPDT+ VLH+V  ++KE  L  HSE+LA 
Sbjct  565  VFTVGDNSHPKSKEILEYLSELSKRMKEVGYVPDTNFVLHDVELEQKEENLSYHSEKLAA  624

Query  3    A  1
            A
Sbjct  625  A  625



>gb|KCW57075.1| hypothetical protein EUGRSUZ_I02728 [Eucalyptus grandis]
Length=518

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  372  GEISAKNLFELEPNVASHYVLLSNIYSSAGLWEKANDVRRNMKEMGVRKEPGCSWIEFGE  193
             E++A+ LF LEP  + +YVLLSN+Y+ AG W++ +++R  +K  G++K PG SWIE   
Sbjct  334  AEMAARELFVLEPENSGNYVLLSNMYAEAGKWKEVDNLRAALKSQGMKKSPGGSWIEVNG  393

Query  192  EVHKFTAGDGSHPQTEHLYDFLDDLSEKMKEEGYVPDTSCVLHNVNDDEKENLLCGHSER  13
            + H F  GD SHPQ + +Y  L+DL  K+K  GY+PDTS  LH+V+++EKE  L  HSE+
Sbjct  394  KAHLFLGGDTSHPQAKEIYLLLEDLPSKIKAAGYMPDTSFALHDVSEEEKEQNLTTHSEK  453

Query  12   LAIA  1
            LAIA
Sbjct  454  LAIA  457



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510693543822