BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18345_g2_i1 len=1208 path=[2783:0-108 2892:109-145 2928:146-1207]

Length=1208
                                                                      Score     E

emb|CDP10830.1|  unnamed protein product                                251   3e-76   
ref|XP_011091745.1|  PREDICTED: polygalacturonase-1 non-catalytic...    243   8e-73   
ref|XP_011091740.1|  PREDICTED: polygalacturonase-1 non-catalytic...    233   1e-69   
ref|XP_011074238.1|  PREDICTED: BURP domain-containing protein 16...    226   1e-66   
gb|EYU36709.1|  hypothetical protein MIMGU_mgv1a024306mg                223   2e-66   
gb|EYU36708.1|  hypothetical protein MIMGU_mgv1a009279mg                225   4e-66   
emb|CDP10831.1|  unnamed protein product                                220   2e-65   
ref|XP_004241419.1|  PREDICTED: BURP domain-containing protein 16...    207   1e-58   
ref|XP_010046642.1|  PREDICTED: polygalacturonase non-catalytic s...    175   1e-46   
gb|KCW86730.1|  hypothetical protein EUGRSUZ_B03341                     171   2e-46   
gb|KHN27021.1|  Putative polygalacturonase non-catalytic subunit        170   3e-45   
ref|XP_010046648.1|  PREDICTED: polygalacturonase non-catalytic s...    171   3e-45   
ref|XP_003552018.1|  PREDICTED: probable polygalacturonase non-ca...    171   1e-43   
gb|KCW86729.1|  hypothetical protein EUGRSUZ_B03340                     163   2e-43   
gb|KCW86720.1|  hypothetical protein EUGRSUZ_B03328                     160   8e-43   
ref|XP_003532010.1|  PREDICTED: probable polygalacturonase non-ca...    168   1e-42   
gb|KDO38689.1|  hypothetical protein CISIN_1g045773mg                   159   2e-41   
gb|KCW86723.1|  hypothetical protein EUGRSUZ_B03334                     157   3e-41   
ref|XP_008800877.1|  PREDICTED: BURP domain-containing protein 12...    164   3e-41   
emb|CAN67205.1|  hypothetical protein VITISV_037214                     156   3e-41   Vitis vinifera
emb|CAN66340.1|  hypothetical protein VITISV_018557                     155   4e-41   Vitis vinifera
ref|XP_009794726.1|  PREDICTED: polygalacturonase-1 non-catalytic...    163   4e-41   
ref|XP_006365229.1|  PREDICTED: polygalacturonase non-catalytic s...    163   5e-41   
ref|XP_010044627.1|  PREDICTED: polygalacturonase non-catalytic s...    159   8e-41   
ref|XP_010100469.1|  hypothetical protein L484_027781                   162   9e-41   
ref|XP_004514684.1|  PREDICTED: polygalacturonase-1 non-catalytic...    162   9e-41   
ref|XP_010924225.1|  PREDICTED: BURP domain-containing protein 12...    162   1e-40   
ref|XP_010936822.1|  PREDICTED: BURP domain-containing protein 12...    162   2e-40   
ref|XP_008444317.1|  PREDICTED: probable polygalacturonase non-ca...    161   2e-40   
ref|XP_010242994.1|  PREDICTED: probable polygalacturonase non-ca...    161   2e-40   
ref|XP_004173618.1|  PREDICTED: probable polygalacturonase non-ca...    161   3e-40   
ref|XP_006365231.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    161   3e-40   
ref|XP_008776735.1|  PREDICTED: BURP domain-containing protein 12...    161   3e-40   
ref|XP_010925453.1|  PREDICTED: BURP domain-containing protein 12...    161   3e-40   
ref|XP_004142981.1|  PREDICTED: probable polygalacturonase non-ca...    160   3e-40   
ref|XP_006365230.1|  PREDICTED: polygalacturonase-1 non-catalytic...    160   4e-40   
ref|XP_010553600.1|  PREDICTED: probable polygalacturonase non-ca...    160   5e-40   
ref|XP_006365227.1|  PREDICTED: polygalacturonase-1 non-catalytic...    160   6e-40   
ref|XP_006484316.1|  PREDICTED: probable polygalacturonase non-ca...    160   6e-40   
ref|XP_010046646.1|  PREDICTED: BURP domain-containing protein 16...    159   7e-40   
ref|XP_004509821.1|  PREDICTED: probable polygalacturonase non-ca...    160   8e-40   
gb|AHC69823.1|  polygalacturonase isoenzyme 1 beta subunit              160   8e-40   
ref|XP_004298578.1|  PREDICTED: probable polygalacturonase non-ca...    160   8e-40   
ref|XP_007153633.1|  hypothetical protein PHAVU_003G052000g             159   9e-40   
ref|XP_009596009.1|  PREDICTED: polygalacturonase-1 non-catalytic...    159   1e-39   
ref|XP_011086565.1|  PREDICTED: polygalacturonase-1 non-catalytic...    159   1e-39   
ref|XP_006438393.1|  hypothetical protein CICLE_v10033917mg             159   1e-39   
ref|XP_010044636.1|  PREDICTED: polygalacturonase-1 non-catalytic...    159   2e-39   
gb|KCW86731.1|  hypothetical protein EUGRSUZ_B03343                     159   2e-39   
ref|XP_007224206.1|  hypothetical protein PRUPE_ppa017408mg             159   2e-39   
ref|XP_007141610.1|  hypothetical protein PHAVU_008G210500g             159   2e-39   
gb|KCW86722.1|  hypothetical protein EUGRSUZ_B03333                     152   2e-39   
ref|XP_003517743.1|  PREDICTED: probable polygalacturonase non-ca...    158   2e-39   
ref|NP_001234835.1|  polygalacturonase-1 non-catalytic subunit be...    158   2e-39   
gb|KDO82433.1|  hypothetical protein CISIN_1g036311mg                   158   3e-39   
emb|CBI15046.3|  unnamed protein product                                158   3e-39   
ref|XP_010044635.1|  PREDICTED: probable polygalacturonase non-ca...    154   3e-39   
ref|XP_002279813.2|  PREDICTED: probable polygalacturonase non-ca...    158   3e-39   Vitis vinifera
ref|XP_008221868.1|  PREDICTED: probable polygalacturonase non-ca...    157   4e-39   
dbj|BAK05386.1|  predicted protein                                      157   4e-39   
ref|XP_006365228.1|  PREDICTED: polygalacturonase non-catalytic s...    157   5e-39   
gb|KEH20007.1|  polygalacturonase non-catalytic protein                 157   5e-39   
ref|XP_010046641.1|  PREDICTED: polygalacturonase non-catalytic s...    154   5e-39   
ref|XP_004509826.1|  PREDICTED: probable polygalacturonase non-ca...    157   6e-39   
ref|XP_002311777.2|  hypothetical protein POPTR_0008s19430g             157   7e-39   Populus trichocarpa [western balsam poplar]
gb|KDP26581.1|  hypothetical protein JCGZ_17739                         157   7e-39   
ref|XP_003613234.1|  Polygalacturonase-1 non-catalytic subunit beta     157   8e-39   
gb|KEH20005.1|  polygalacturonase non-catalytic protein                 154   8e-39   
ref|XP_006438394.1|  hypothetical protein CICLE_v10030947mg             157   9e-39   
ref|XP_004238668.1|  PREDICTED: polygalacturonase non-catalytic s...    156   1e-38   
ref|XP_007138090.1|  hypothetical protein PHAVU_009G179500g             156   1e-38   
ref|XP_004238667.1|  PREDICTED: polygalacturonase non-catalytic s...    156   1e-38   
gb|KHG12475.1|  Polygalacturonase non-catalytic subunit protein         156   1e-38   
gb|KHG24447.1|  Polygalacturonase non-catalytic subunit protein         156   1e-38   
gb|KCW59875.1|  hypothetical protein EUGRSUZ_H02608                     156   1e-38   
ref|XP_010023570.1|  PREDICTED: probable polygalacturonase non-ca...    156   1e-38   
ref|XP_003519820.2|  PREDICTED: probable polygalacturonase non-ca...    156   2e-38   
ref|XP_009393062.1|  PREDICTED: BURP domain-containing protein 12...    156   2e-38   
ref|XP_011071083.1|  PREDICTED: polygalacturonase-1 non-catalytic...    155   2e-38   
ref|XP_010520580.1|  PREDICTED: probable polygalacturonase non-ca...    155   2e-38   
ref|XP_010551569.1|  PREDICTED: probable polygalacturonase non-ca...    155   2e-38   
ref|XP_006483847.1|  PREDICTED: probable polygalacturonase non-ca...    155   2e-38   
ref|XP_007044636.1|  Polygalacturonase 2                                155   3e-38   
ref|XP_007157462.1|  hypothetical protein PHAVU_002G071500g             155   3e-38   
ref|XP_002266815.1|  PREDICTED: probable polygalacturonase non-ca...    155   3e-38   Vitis vinifera
ref|XP_009596020.1|  PREDICTED: polygalacturonase-1 non-catalytic...    155   4e-38   
ref|XP_008221810.1|  PREDICTED: probable polygalacturonase non-ca...    155   4e-38   
ref|XP_007210277.1|  hypothetical protein PRUPE_ppa003003mg             154   4e-38   
ref|XP_002266341.1|  PREDICTED: probable polygalacturonase non-ca...    154   5e-38   Vitis vinifera
emb|CCD74525.1|  polygalacturonase 1                                    154   5e-38   
ref|XP_006438392.1|  hypothetical protein CICLE_v10030930mg             154   5e-38   
gb|EYU31262.1|  hypothetical protein MIMGU_mgv1a002697mg                154   6e-38   
ref|XP_007223063.1|  hypothetical protein PRUPE_ppa003712mg             154   7e-38   
ref|XP_007036187.1|  Polygalacturonase 2, putative                      154   7e-38   
ref|XP_009794727.1|  PREDICTED: polygalacturonase-1 non-catalytic...    154   8e-38   
gb|KHN30893.1|  Polygalacturonase-1 non-catalytic subunit beta          153   9e-38   
ref|XP_008239752.1|  PREDICTED: probable polygalacturonase non-ca...    154   9e-38   
ref|NP_176242.1|  polygalacturonase 1                                   154   9e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417970.1|  PREDICTED: probable polygalacturonase non-ca...    154   9e-38   
ref|XP_006578624.1|  PREDICTED: polygalacturonase-1 non-catalytic...    153   1e-37   
ref|XP_010682558.1|  PREDICTED: probable polygalacturonase non-ca...    153   2e-37   
ref|XP_006365226.1|  PREDICTED: polygalacturonase-1 non-catalytic...    153   2e-37   
ref|XP_010044626.1|  PREDICTED: polygalacturonase non-catalytic s...    149   2e-37   
gb|KHN00353.1|  Polygalacturonase-1 non-catalytic subunit beta          151   2e-37   
ref|XP_010510953.1|  PREDICTED: probable polygalacturonase non-ca...    152   2e-37   
ref|XP_011034135.1|  PREDICTED: probable polygalacturonase non-ca...    152   2e-37   
ref|XP_009363553.1|  PREDICTED: probable polygalacturonase non-ca...    152   3e-37   
ref|XP_006476763.1|  PREDICTED: probable polygalacturonase non-ca...    152   3e-37   
ref|XP_002886622.1|  hypothetical protein ARALYDRAFT_475291             152   3e-37   
gb|KDO82432.1|  hypothetical protein CISIN_1g044596mg                   152   3e-37   
ref|XP_010477679.1|  PREDICTED: probable polygalacturonase non-ca...    152   4e-37   
ref|XP_008389645.1|  PREDICTED: probable polygalacturonase non-ca...    152   4e-37   
ref|XP_010555103.1|  PREDICTED: probable polygalacturonase non-ca...    152   4e-37   
ref|XP_008340027.1|  PREDICTED: probable polygalacturonase non-ca...    152   4e-37   
ref|XP_010473218.1|  PREDICTED: probable polygalacturonase non-ca...    152   5e-37   
ref|XP_004238669.1|  PREDICTED: polygalacturonase-1 non-catalytic...    151   5e-37   
ref|XP_010251282.1|  PREDICTED: probable polygalacturonase non-ca...    151   6e-37   
ref|XP_002511417.1|  Polygalacturonase-1 non-catalytic subunit be...    151   7e-37   Ricinus communis
ref|XP_002525383.1|  Polygalacturonase-1 non-catalytic subunit be...    151   8e-37   Ricinus communis
gb|EYU22487.1|  hypothetical protein MIMGU_mgv1a002927mg                150   1e-36   
ref|XP_006439797.1|  hypothetical protein CICLE_v10019363mg             150   1e-36   
ref|XP_009394250.1|  PREDICTED: BURP domain-containing protein 12...    150   2e-36   
ref|XP_009415276.1|  PREDICTED: BURP domain-containing protein 12...    150   2e-36   
gb|KHG01313.1|  Polygalacturonase non-catalytic subunit protein         149   3e-36   
ref|XP_009593470.1|  PREDICTED: probable polygalacturonase non-ca...    149   3e-36   
ref|XP_009775426.1|  PREDICTED: probable polygalacturonase non-ca...    149   4e-36   
gb|KEH20006.1|  polygalacturonase non-catalytic protein                 149   5e-36   
emb|CDP00165.1|  unnamed protein product                                149   5e-36   
gb|EEC84370.1|  hypothetical protein OsI_30914                          149   5e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_011009539.1|  PREDICTED: probable polygalacturonase non-ca...    149   6e-36   
gb|EPS60630.1|  polygalacturonase-1 non-catalytic subunit beta          148   6e-36   
ref|XP_004300895.1|  PREDICTED: probable polygalacturonase non-ca...    149   6e-36   
ref|NP_001062896.2|  Os09g0329000                                       149   6e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004956601.1|  PREDICTED: BURP domain-containing protein 14...    149   7e-36   
ref|XP_002318036.2|  hypothetical protein POPTR_0012s08060g             148   8e-36   Populus trichocarpa [western balsam poplar]
ref|XP_002314620.2|  hypothetical protein POPTR_0010s05000g             148   8e-36   Populus trichocarpa [western balsam poplar]
ref|XP_010678748.1|  PREDICTED: probable polygalacturonase non-ca...    148   9e-36   
ref|XP_011044316.1|  PREDICTED: probable polygalacturonase non-ca...    148   9e-36   
ref|XP_006303930.1|  hypothetical protein CARUB_v10008588mg             148   9e-36   
ref|XP_006390895.1|  hypothetical protein EUTSA_v10018277mg             148   9e-36   
ref|XP_010028282.1|  PREDICTED: probable polygalacturonase non-ca...    148   1e-35   
ref|XP_008346742.1|  PREDICTED: probable polygalacturonase non-ca...    147   1e-35   
ref|XP_010101197.1|  hypothetical protein L484_015001                   147   1e-35   
ref|NP_001061692.1|  Os08g0380100                                       147   1e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002890594.1|  hypothetical protein ARALYDRAFT_472637             147   2e-35   
ref|NP_173788.1|  putative polygalacturonase non-catalytic subuni...    147   2e-35   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE99852.1|  putative polygalacuronase isoenzyme 1 beta subunit     147   2e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KDP26582.1|  hypothetical protein JCGZ_17740                         147   2e-35   
ref|XP_009105700.1|  PREDICTED: probable polygalacturonase non-ca...    147   2e-35   
dbj|BAJ92348.1|  predicted protein                                      147   2e-35   
ref|XP_010460151.1|  PREDICTED: probable polygalacturonase non-ca...    147   2e-35   
gb|KDP31113.1|  hypothetical protein JCGZ_11489                         147   3e-35   
ref|NP_001146063.1|  uncharacterized protein LOC100279594 precursor     147   3e-35   Zea mays [maize]
gb|ACN34141.1|  unknown                                                 147   3e-35   Zea mays [maize]
ref|XP_006300871.1|  hypothetical protein CARUB_v10019963mg             146   3e-35   
gb|AAB39538.1|  aromatic rich glycoprotein JP630                        146   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006659367.1|  PREDICTED: BURP domain-containing protein 12...    145   3e-35   
ref|XP_010498883.1|  PREDICTED: probable polygalacturonase non-ca...    146   3e-35   
ref|XP_010427809.1|  PREDICTED: probable polygalacturonase non-ca...    146   4e-35   
emb|CDP12374.1|  unnamed protein product                                146   4e-35   
emb|CDY57845.1|  BnaA07g38770D                                          146   4e-35   
dbj|BAJ97940.1|  predicted protein                                      147   4e-35   
ref|NP_001064572.1|  Os10g0409400                                       142   6e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003528153.1|  PREDICTED: polygalacturonase-1 non-catalytic...    145   7e-35   
gb|EPS67761.1|  polygalacturonase-1 non-catalytic subunit beta          145   9e-35   
ref|XP_004236111.1|  PREDICTED: probable polygalacturonase non-ca...    145   9e-35   
ref|XP_009363551.1|  PREDICTED: probable polygalacturonase non-ca...    145   1e-34   
ref|XP_011071835.1|  PREDICTED: probable polygalacturonase non-ca...    145   1e-34   
gb|ACG28762.1|  polygalacturonase-1 non-catalytic beta subunit pr...    145   1e-34   Zea mays [maize]
ref|XP_002888771.1|  hypothetical protein ARALYDRAFT_894840             144   1e-34   
emb|CDY23501.1|  BnaC06g24700D                                          144   2e-34   
ref|XP_010415713.1|  PREDICTED: probable polygalacturonase non-ca...    144   2e-34   
ref|XP_010471032.1|  PREDICTED: probable polygalacturonase non-ca...    144   2e-34   
gb|AAB39546.1|  polygalacturonase isoenzyme 1 beta subunit homolog      144   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177194.1|  polygalacturonase 2                                   144   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010471031.1|  PREDICTED: probable polygalacturonase non-ca...    144   2e-34   
gb|KFK41456.1|  hypothetical protein AALP_AA2G132700                    144   2e-34   
ref|XP_004973305.1|  PREDICTED: BURP domain-containing protein 12...    144   3e-34   
gb|EMS58973.1|  hypothetical protein TRIUR3_16136                       143   3e-34   
ref|XP_008453099.1|  PREDICTED: probable polygalacturonase non-ca...    144   3e-34   
ref|XP_006345047.1|  PREDICTED: probable polygalacturonase non-ca...    143   4e-34   
gb|KCW86724.1|  hypothetical protein EUGRSUZ_B03335                     136   6e-34   
ref|XP_008374449.1|  PREDICTED: probable polygalacturonase non-ca...    142   6e-34   
ref|XP_006300881.1|  hypothetical protein CARUB_v10019971mg             142   7e-34   
gb|AES58800.2|  dehydration-responsive protein RD22                     138   7e-34   
ref|XP_003588549.1|  BURP domain-containing protein                     138   8e-34   
ref|XP_004501939.1|  PREDICTED: probable polygalacturonase non-ca...    142   9e-34   
ref|XP_008652571.1|  PREDICTED: BURP domain-containing protein 14...    142   1e-33   
ref|XP_002460065.1|  hypothetical protein SORBIDRAFT_02g022220          142   1e-33   Sorghum bicolor [broomcorn]
gb|EEC77314.1|  hypothetical protein OsI_15976                          134   2e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_004138283.1|  PREDICTED: probable polygalacturonase non-ca...    141   2e-33   
ref|XP_006392169.1|  hypothetical protein EUTSA_v10023352mg             141   2e-33   
ref|XP_004166494.1|  PREDICTED: probable polygalacturonase non-ca...    141   3e-33   
ref|XP_003574428.1|  PREDICTED: BURP domain-containing protein 12       140   3e-33   
ref|XP_003601289.1|  Polygalacturonase-1 non-catalytic subunit beta     140   4e-33   
gb|EPS68955.1|  hypothetical protein M569_05812                         139   7e-33   
gb|ABR16440.1|  unknown                                                 140   7e-33   Picea sitchensis
ref|XP_009338714.1|  PREDICTED: dehydration-responsive protein RD...    132   1e-32   
gb|KFK44451.1|  hypothetical protein AALP_AA1G258600                    138   2e-32   
ref|XP_003576424.1|  PREDICTED: BURP domain-containing protein 14...    139   2e-32   
gb|AES58801.2|  dehydration-responsive protein RD22                     134   2e-32   
ref|XP_003588550.1|  BURP domain-containing protein                     134   3e-32   
ref|XP_003610589.1|  Polygalacturonase-1 non-catalytic subunit beta     128   3e-31   
ref|XP_009367927.1|  PREDICTED: dehydration-responsive protein RD...    132   3e-31   
gb|AES58805.2|  dehydration-responsive RD22-like protein                129   3e-31   
gb|AGE46023.1|  dehydration-responsive protein RD22-like isoform 2      130   3e-31   
ref|NP_001132751.1|  hypothetical protein precursor                     132   4e-31   Zea mays [maize]
ref|XP_008792350.1|  PREDICTED: BURP domain-containing protein 3        131   7e-31   
ref|XP_009367929.1|  PREDICTED: dehydration-responsive protein RD...    132   9e-31   
dbj|BAB60848.1|  BURP domain-containing protein                         130   1e-30   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_007012037.1|  BURP domain-containing protein, putative iso...    130   1e-30   
ref|XP_007012036.1|  BURP domain-containing protein isoform 1           130   1e-30   
ref|XP_010911557.1|  PREDICTED: BURP domain-containing protein 6-...    129   1e-30   
ref|XP_009367928.1|  PREDICTED: BURP domain-containing protein 3-...    131   2e-30   
dbj|BAB60849.1|  BURP domain-containing protein                         130   2e-30   Bruguiera gymnorhiza [Burma mangrove]
emb|CDY47228.1|  BnaC09g14770D                                          132   2e-30   
ref|XP_007137164.1|  hypothetical protein PHAVU_009G105300g             129   2e-30   
emb|CDY53059.1|  BnaA09g14240D                                          132   2e-30   
dbj|BAB60850.1|  BURP domain-containing protein                         129   3e-30   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_002444270.1|  hypothetical protein SORBIDRAFT_07g019310          132   3e-30   Sorghum bicolor [broomcorn]
gb|AFW85139.1|  hypothetical protein ZEAMMB73_186505                    125   4e-30   
gb|AFI80905.1|  dehydration-responsive protein                          125   5e-30   
gb|ACD62790.1|  BURP domain-containing protein                          128   6e-30   Phaseolus vulgaris [French bean]
ref|XP_010925837.1|  PREDICTED: BURP domain-containing protein 3-...    126   6e-30   
ref|XP_009113216.1|  PREDICTED: probable polygalacturonase non-ca...    131   7e-30   
ref|XP_003588554.1|  BURP domain-containing protein                     127   7e-30   
gb|KDO79705.1|  hypothetical protein CISIN_1g018131mg                   127   1e-29   
ref|XP_003588552.1|  BURP domain protein                                127   1e-29   
ref|XP_010046643.1|  PREDICTED: polygalacturonase-1 non-catalytic...    124   1e-29   
ref|XP_003588558.1|  BURP domain protein                                127   1e-29   
ref|XP_010925836.1|  PREDICTED: BURP domain-containing protein 6-...    126   1e-29   
ref|XP_008781671.1|  PREDICTED: BURP domain-containing protein 6-...    127   2e-29   
dbj|BAC22501.1|  resistant specific protein-3                           125   2e-29   Vigna radiata [mung bean]
ref|XP_006450616.1|  hypothetical protein CICLE_v10008742mg             126   2e-29   
ref|XP_010925834.1|  PREDICTED: BURP domain-containing protein 6-...    125   2e-29   
ref|XP_008245628.1|  PREDICTED: dehydration-responsive protein RD...    125   2e-29   
ref|XP_009338715.1|  PREDICTED: BURP domain-containing protein 3-...    127   2e-29   
ref|XP_009416720.1|  PREDICTED: BURP domain-containing protein 3-...    127   2e-29   
ref|XP_006476150.1|  PREDICTED: dehydration-responsive protein RD...    127   2e-29   
ref|XP_009338716.1|  PREDICTED: dehydration-responsive protein RD...    127   2e-29   
ref|XP_009338717.1|  PREDICTED: BURP domain-containing protein 3-...    127   3e-29   
ref|XP_006644664.1|  PREDICTED: BURP domain-containing protein 3-...    127   3e-29   
gb|ACF84595.1|  unknown                                                 123   3e-29   Zea mays [maize]
dbj|BAC22500.1|  resistant specific protein-2                           127   4e-29   Vigna radiata [mung bean]
gb|EMT30231.1|  hypothetical protein F775_20363                         127   4e-29   
ref|XP_006450615.1|  hypothetical protein CICLE_v10008742mg             126   4e-29   
gb|EEE68602.1|  hypothetical protein OsJ_27135                          129   4e-29   Oryza sativa Japonica Group [Japonica rice]
gb|ABK96092.1|  unknown                                                 122   4e-29   Populus trichocarpa [western balsam poplar]
gb|ACH97124.1|  BURP domain-containing protein                          125   5e-29   Camellia sinensis [black tea]
gb|AAT66913.1|  dehydration-induced protein RD22-like protein 2         126   5e-29   Gossypium arboreum [tree cotton]
ref|XP_003588556.1|  Dehydration-responsive protein RD22                125   6e-29   
ref|XP_002456304.1|  hypothetical protein SORBIDRAFT_03g033760          127   6e-29   Sorghum bicolor [broomcorn]
gb|KDO79703.1|  hypothetical protein CISIN_1g018131mg                   125   7e-29   
ref|XP_010943940.1|  PREDICTED: BURP domain-containing protein 6-...    125   8e-29   
ref|NP_001141101.1|  hypothetical protein precursor                     126   9e-29   Zea mays [maize]
gb|AAL67991.1|  dehydration-induced protein RD22-like protein           124   9e-29   Gossypium hirsutum [American cotton]
ref|XP_010910075.1|  PREDICTED: BURP domain-containing protein 3-...    123   1e-28   
emb|CDP00166.1|  unnamed protein product                                127   1e-28   
ref|XP_004136300.1|  PREDICTED: dehydration-responsive protein RD...    125   1e-28   
gb|KHF97444.1|  Dehydration-responsive RD22 -like protein               123   2e-28   
gb|ACV60360.1|  RD22-like protein                                       124   2e-28   Camellia sinensis [black tea]
gb|EEC83505.1|  hypothetical protein OsI_29064                          127   2e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_008219773.1|  PREDICTED: dehydration-responsive protein RD...    123   2e-28   
dbj|BAC22498.1|  resistant specific protein-1(4)                        125   2e-28   Vigna radiata [mung bean]
gb|KHG03003.1|  Dehydration-responsive RD22 -like protein               123   3e-28   
dbj|BAB60847.1|  BURP domain-containing protein                         122   3e-28   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_002324250.2|  hypothetical protein POPTR_0018s00850g             122   3e-28   Populus trichocarpa [western balsam poplar]
ref|XP_007227268.1|  hypothetical protein PRUPE_ppa017769mg             123   3e-28   
ref|XP_008226517.1|  PREDICTED: dehydration-responsive protein RD...    123   3e-28   
ref|XP_010249743.1|  PREDICTED: dehydration-responsive protein RD22     124   4e-28   
ref|XP_011019672.1|  PREDICTED: dehydration-responsive protein RD...    124   4e-28   
emb|CDM84063.1|  unnamed protein product                                124   4e-28   
gb|AGV54277.1|  BURP domain-containing protein                          123   4e-28   
ref|XP_007227242.1|  hypothetical protein PRUPE_ppa018182mg             122   4e-28   
ref|XP_008466264.1|  PREDICTED: dehydration-responsive protein RD...    123   4e-28   
dbj|BAD23622.1|  polygalacturonase isoenzyme 1 beta subunit-like        126   5e-28   Oryza sativa Japonica Group [Japonica rice]
gb|EAY75726.1|  hypothetical protein OsI_03637                          124   5e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_002516581.1|  Dehydration-responsive protein RD22 precurso...    123   6e-28   Ricinus communis
ref|XP_007221811.1|  hypothetical protein PRUPE_ppa004101mg             122   6e-28   
ref|XP_003588551.1|  BURP domain-containing protein                     123   6e-28   
ref|NP_001044161.1|  Os01g0733500                                       123   6e-28   
gb|AAQ22345.1|  BURP domain-containing protein                          122   6e-28   
ref|XP_010925835.1|  PREDICTED: BURP domain-containing protein 6-...    122   6e-28   
ref|XP_008466262.1|  PREDICTED: dehydration-responsive protein RD...    123   7e-28   
ref|XP_010925838.1|  PREDICTED: BURP domain-containing protein 6-...    122   7e-28   
ref|XP_008226516.1|  PREDICTED: dehydration-responsive protein RD...    122   8e-28   
ref|XP_002308621.2|  Dehydration-responsive protein RD22 precursor      123   8e-28   
ref|XP_006388094.1|  hypothetical protein POPTR_0343s00200g             123   8e-28   
ref|XP_010046644.1|  PREDICTED: polygalacturonase-1 non-catalytic...    120   1e-27   
ref|XP_003569738.1|  PREDICTED: BURP domain-containing protein 3-...    123   1e-27   
gb|EMS48341.1|  hypothetical protein TRIUR3_05844                       121   1e-27   
ref|XP_009400562.1|  PREDICTED: BURP domain-containing protein 3-...    122   1e-27   
ref|XP_010917767.1|  PREDICTED: BURP domain-containing protein 6-...    121   1e-27   
emb|CAN83863.1|  hypothetical protein VITISV_030281                     120   1e-27   
ref|XP_006371718.1|  hypothetical protein POPTR_0018s00850g             122   2e-27   
ref|XP_007225823.1|  hypothetical protein PRUPE_ppa011523mg             118   2e-27   
ref|XP_009400563.1|  PREDICTED: BURP domain-containing protein 3-...    121   2e-27   
ref|XP_009400564.1|  PREDICTED: BURP domain-containing protein 3-...    121   2e-27   
ref|XP_002284434.1|  PREDICTED: dehydration-responsive protein RD...    121   2e-27   
ref|XP_006833278.1|  hypothetical protein AMTR_s00109p00021460          121   2e-27   
ref|NP_001274155.1|  uncharacterized protein LOC101767742 precursor     122   2e-27   
ref|XP_007221812.1|  hypothetical protein PRUPE_ppa004101mg             121   2e-27   
emb|CDX87079.1|  BnaC09g03940D                                          121   2e-27   
gb|EAZ13440.1|  hypothetical protein OsJ_03360                          122   2e-27   
emb|CAN75710.1|  hypothetical protein VITISV_004492                     121   3e-27   
gb|KDP34221.1|  hypothetical protein JCGZ_07792                         121   3e-27   
ref|NP_001268112.1|  RD22-like protein precursor                        121   3e-27   
ref|XP_007222614.1|  hypothetical protein PRUPE_ppa008481mg             120   3e-27   
gb|AGV54733.1|  dehydration-responsive protein RD22-like protein        120   3e-27   
ref|XP_007225722.1|  hypothetical protein PRUPE_ppa006739mg             121   3e-27   
dbj|BAK06506.1|  predicted protein                                      122   3e-27   
ref|XP_008220021.1|  PREDICTED: dehydration-responsive protein RD...    120   4e-27   
ref|XP_010911738.1|  PREDICTED: BURP domain-containing protein 6-...    119   4e-27   
ref|XP_007222162.1|  hypothetical protein PRUPE_ppa005767mg             121   4e-27   
ref|XP_003522684.1|  PREDICTED: dehydration-responsive protein RD...    119   6e-27   
gb|AAL26909.1|AF319165_1  dehydration-responsive protein RD22           119   6e-27   
gb|KHN10237.1|  Dehydration-responsive protein RD22                     119   6e-27   
ref|XP_004498543.1|  PREDICTED: dehydration-responsive protein RD...    120   6e-27   
emb|CDY19799.1|  BnaA09g04520D                                          120   6e-27   
gb|KDO69699.1|  hypothetical protein CISIN_1g0378481mg                  114   7e-27   
gb|ABK95182.1|  unknown                                                 120   7e-27   
gb|KCW86721.1|  hypothetical protein EUGRSUZ_B03330                     117   7e-27   
ref|XP_002281750.2|  PREDICTED: dehydration-responsive protein RD...    118   7e-27   
ref|XP_008226515.1|  PREDICTED: dehydration-responsive protein RD...    119   7e-27   
ref|XP_009151093.1|  PREDICTED: dehydration-responsive protein RD22     120   8e-27   
ref|XP_010648550.1|  PREDICTED: dehydration-responsive protein RD...    118   8e-27   
ref|XP_009111670.1|  PREDICTED: dehydration-responsive protein RD...    120   8e-27   
emb|CDY62417.1|  BnaA06g39340D                                          119   8e-27   
gb|EEE69479.1|  hypothetical protein OsJ_28904                          123   8e-27   
gb|ABH09493.1|  RD22-like protein                                       120   9e-27   
emb|CDX80529.1|  BnaC07g29150D                                          119   1e-26   
ref|XP_010046647.1|  PREDICTED: polygalacturonase-1 non-catalytic...    114   1e-26   
ref|NP_001238316.1|  BURP domain-containing protein precursor           119   1e-26   
ref|XP_007224966.1|  hypothetical protein PRUPE_ppa020936mg             119   1e-26   
gb|ACU19496.1|  unknown                                                 119   1e-26   
emb|CAH59196.1|  BURP-domain containing protein                         119   1e-26   
gb|KDP45575.1|  hypothetical protein JCGZ_17182                         120   1e-26   
ref|XP_010648549.1|  PREDICTED: dehydration-responsive protein RD...    118   1e-26   
gb|ACN40822.1|  unknown                                                 118   1e-26   
ref|XP_007225010.1|  hypothetical protein PRUPE_ppa020264mg             117   2e-26   
ref|XP_010648548.1|  PREDICTED: dehydration-responsive protein RD...    118   2e-26   
ref|XP_007221784.1|  hypothetical protein PRUPE_ppa005699mg             119   2e-26   
gb|AAQ57584.1|  BURP domain-containing protein                          119   2e-26   
ref|XP_010648547.1|  PREDICTED: dehydration-responsive protein RD...    118   2e-26   
ref|XP_011026571.1|  PREDICTED: dehydration-responsive protein RD...    119   2e-26   
emb|CDX68345.1|  BnaA07g23850D                                          121   2e-26   
gb|ABK24138.1|  unknown                                                 118   2e-26   
ref|XP_010276358.1|  PREDICTED: dehydration-responsive protein RD...    118   2e-26   
ref|XP_010667774.1|  PREDICTED: dehydration-responsive protein RD...    118   2e-26   
gb|AAT08718.1|  polygalacturonase                                       114   2e-26   
ref|XP_008337839.1|  PREDICTED: dehydration-responsive protein RD...    117   2e-26   
ref|XP_003603599.1|  BURP domain protein                                117   2e-26   
ref|XP_010924753.1|  PREDICTED: BURP domain-containing protein 3-...    118   3e-26   
ref|XP_008219775.1|  PREDICTED: dehydration-responsive protein RD...    117   3e-26   
ref|XP_002284380.1|  PREDICTED: BURP domain-containing protein 3-...    117   3e-26   
emb|CAN63067.1|  hypothetical protein VITISV_031226                     117   3e-26   
gb|KDP45576.1|  hypothetical protein JCGZ_17183                         119   3e-26   
ref|XP_004291216.1|  PREDICTED: dehydration-responsive protein RD...    118   3e-26   
gb|ACU20207.1|  unknown                                                 117   3e-26   
gb|KHN15367.1|  Dehydration-responsive protein RD22                     117   3e-26   
emb|CDY05501.1|  BnaA02g31900D                                          118   3e-26   
ref|XP_007227727.1|  hypothetical protein PRUPE_ppa007469mg             117   3e-26   
ref|XP_009129951.1|  PREDICTED: dehydration-responsive protein RD...    118   3e-26   
ref|XP_010667747.1|  PREDICTED: dehydration-responsive protein RD...    118   4e-26   
ref|XP_009762320.1|  PREDICTED: dehydration-responsive protein RD22     118   4e-26   
ref|XP_008245114.1|  PREDICTED: BURP domain-containing protein 5-...    117   4e-26   
ref|XP_007221813.1|  hypothetical protein PRUPE_ppa004101mg             119   4e-26   
ref|XP_003588548.1|  BURP domain-containing protein                     117   4e-26   
ref|XP_010421423.1|  PREDICTED: dehydration-responsive protein RD...    117   4e-26   
ref|XP_002284368.1|  PREDICTED: dehydration-responsive protein RD22     116   5e-26   
ref|XP_010454906.1|  PREDICTED: dehydration-responsive protein RD...    117   5e-26   
gb|ACU21473.1|  unknown                                                 117   5e-26   
ref|XP_004148853.1|  PREDICTED: BURP domain-containing protein 17...    116   5e-26   
ref|NP_001235949.1|  BURP domain protein precursor                      116   6e-26   
emb|CBI20911.3|  unnamed protein product                                116   6e-26   
gb|KFK27813.1|  hypothetical protein AALP_AA8G433300                    117   7e-26   
ref|XP_010493823.1|  PREDICTED: dehydration-responsive protein RD...    117   7e-26   
ref|XP_007222322.1|  hypothetical protein PRUPE_ppa008080mg             116   8e-26   
ref|NP_001275413.1|  BURP domain-containing protein precursor           116   9e-26   
ref|XP_003588559.1|  BURP domain-containing protein                     115   9e-26   
ref|XP_007211649.1|  hypothetical protein PRUPE_ppa008874mg             115   1e-25   
emb|CDP21056.1|  unnamed protein product                                115   1e-25   
ref|XP_010493824.1|  PREDICTED: dehydration-responsive protein RD...    116   1e-25   
gb|AAT66912.1|  dehydration-induced protein RD22-like protein 1         115   1e-25   
ref|XP_010112167.1|  hypothetical protein L484_019906                   118   1e-25   
ref|XP_002522978.1|  polygalacturonase, putative                        114   1e-25   
dbj|BAH56805.1|  AT5G25610                                              115   1e-25   
ref|NP_001234521.1|  BURP domain-containing protein precursor           115   1e-25   
ref|NP_197943.1|  dehydration-responsive protein RD22                   115   2e-25   
gb|AES58809.2|  dehydration-responsive RD22-like protein                111   2e-25   
gb|AES96108.2|  BURP domain protein                                     115   2e-25   
ref|XP_002874271.1|  hypothetical protein ARALYDRAFT_489420             115   2e-25   
ref|XP_010049078.1|  PREDICTED: dehydration-responsive protein RD22     115   2e-25   
ref|NP_001267970.1|  rd22-c protein precursor                           115   2e-25   
emb|CDY54896.1|  BnaC02g48560D                                          115   2e-25   
ref|XP_003613150.1|  Polygalacturonase-1 non-catalytic subunit beta     115   2e-25   
ref|XP_009628254.1|  PREDICTED: dehydration-responsive protein RD...    115   3e-25   
ref|XP_002522981.1|  polygalacturonase, putative                        113   3e-25   
ref|XP_009628253.1|  PREDICTED: dehydration-responsive protein RD...    115   3e-25   
ref|XP_003588464.1|  Dehydration-responsive protein RD22                114   3e-25   
ref|XP_007222784.1|  hypothetical protein PRUPE_ppa006620mg             115   3e-25   
ref|XP_007223280.1|  hypothetical protein PRUPE_ppa005535mg             115   3e-25   
ref|XP_008245112.1|  PREDICTED: dehydration-responsive protein RD...    114   3e-25   
ref|XP_004500818.1|  PREDICTED: BURP domain-containing protein 17...    113   4e-25   
gb|KHN15366.1|  Dehydration-responsive protein RD22                     114   5e-25   
emb|CDP16143.1|  unnamed protein product                                113   5e-25   
ref|XP_007226272.1|  hypothetical protein PRUPE_ppa019992mg             113   5e-25   
ref|XP_007211648.1|  hypothetical protein PRUPE_ppa008862mg             113   5e-25   
ref|XP_003579027.1|  PREDICTED: BURP domain-containing protein 3-...    113   7e-25   
ref|NP_001236126.1|  BURP domain protein 2 precursor                    113   7e-25   
ref|XP_004299100.1|  PREDICTED: BURP domain-containing protein 3-...    112   7e-25   
ref|XP_008219786.1|  PREDICTED: dehydration-responsive protein RD...    114   9e-25   
ref|XP_011081829.1|  PREDICTED: dehydration-responsive protein RD22     113   9e-25   
emb|CDP16137.1|  unnamed protein product                                112   9e-25   
ref|XP_003613151.1|  Polygalacturonase-1 non-catalytic subunit beta     110   1e-24   
ref|XP_002523253.1|  Polygalacturonase non-catalytic subunit AroG...    113   1e-24   
ref|XP_007015182.1|  Polygalacturonase, putative                        112   1e-24   
gb|KDP22138.1|  hypothetical protein JCGZ_25969                         113   1e-24   
gb|KDP46064.1|  hypothetical protein JCGZ_06575                         112   1e-24   
gb|ACU24326.1|  unknown                                                 112   2e-24   
ref|XP_008219790.1|  PREDICTED: dehydration-responsive protein RD...    112   2e-24   
ref|XP_008457931.1|  PREDICTED: LOW QUALITY PROTEIN: BURP domain-...    111   2e-24   
ref|XP_008219789.1|  PREDICTED: dehydration-responsive protein RD...    112   2e-24   
gb|KDP22142.1|  hypothetical protein JCGZ_25973                         112   2e-24   
emb|CDP18476.1|  unnamed protein product                                112   2e-24   
ref|XP_010106680.1|  BURP domain-containing protein 3                   111   3e-24   
emb|CDP18474.1|  unnamed protein product                                111   3e-24   
ref|XP_008378221.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...    112   3e-24   
ref|XP_008219787.1|  PREDICTED: dehydration-responsive protein RD...    112   3e-24   
ref|XP_007041485.1|  Uncharacterized protein TCM_006381                 110   3e-24   
emb|CDP16140.1|  unnamed protein product                                110   3e-24   
ref|XP_003537889.1|  PREDICTED: BURP domain-containing protein 3-...    110   3e-24   
gb|ACU19518.1|  unknown                                                 110   4e-24   
ref|XP_003631606.1|  PREDICTED: BURP domain-containing protein 17...    110   4e-24   
ref|NP_001237833.1|  seed coat BURP domain protein 1 precursor          110   4e-24   
ref|XP_004507419.1|  PREDICTED: BURP domain-containing protein 3-...    110   4e-24   
ref|XP_010925840.1|  PREDICTED: BURP domain-containing protein 3-...    109   4e-24   
ref|XP_008348420.1|  PREDICTED: dehydration-responsive protein RD...    110   4e-24   
ref|XP_010519915.1|  PREDICTED: dehydration-responsive protein RD22     112   4e-24   
gb|KDP46071.1|  hypothetical protein JCGZ_06582                         110   5e-24   
ref|XP_011014851.1|  PREDICTED: dehydration-responsive protein RD...    108   5e-24   
ref|XP_006387123.1|  hypothetical protein POPTR_1776s00200g             111   5e-24   
gb|KCW86727.1|  hypothetical protein EUGRSUZ_B03337                     108   6e-24   
gb|KDP22140.1|  hypothetical protein JCGZ_25971                         114   6e-24   
ref|XP_010648541.1|  PREDICTED: dehydration-responsive protein RD...    108   6e-24   
ref|XP_002306019.2|  embryonic abundant family protein                  107   6e-24   
ref|XP_010028578.1|  PREDICTED: BURP domain-containing protein 17       110   6e-24   
ref|XP_002325305.1|  embryonic abundant family protein                  110   7e-24   
ref|XP_010648542.1|  PREDICTED: dehydration-responsive protein RD...    108   7e-24   
ref|XP_006384370.1|  hypothetical protein POPTR_0004s14430g             110   8e-24   
ref|XP_006384368.1|  hypothetical protein POPTR_0004s14410g             110   8e-24   
ref|XP_003613149.1|  Polygalacturonase-1 non-catalytic subunit beta     113   8e-24   
ref|XP_006388650.1|  hypothetical protein POPTR_0129s00200g             110   9e-24   
ref|XP_008380463.1|  PREDICTED: dehydration-responsive protein RD...    110   9e-24   
gb|AAP34365.1|  putative dehydration-induced protein                    106   9e-24   
ref|XP_007140998.1|  hypothetical protein PHAVU_008G158600g             110   9e-24   
ref|XP_010999677.1|  PREDICTED: dehydration-responsive protein RD...    110   1e-23   
ref|XP_007224167.1|  hypothetical protein PRUPE_ppa016850mg             108   1e-23   
sp|Q70KG5.1|RAF1A_WHEAT  RecName: Full=Protein RAFTIN 1A; Short=T...    110   1e-23   
ref|XP_011001236.1|  PREDICTED: dehydration-responsive protein RD...    110   1e-23   
emb|CAD39857.2|  OSJNBa0036B17.11                                       108   1e-23   
ref|XP_010999675.1|  PREDICTED: dehydration-responsive protein RD...    109   1e-23   
emb|CDP16139.1|  unnamed protein product                                109   1e-23   
gb|ABK26316.1|  unknown                                                 109   2e-23   
gb|EAY93151.1|  hypothetical protein OsI_14957                          108   2e-23   
gb|AFK48420.1|  unknown                                                 109   2e-23   
gb|AFM91993.1|  RD-22 like protein                                      105   2e-23   
gb|AFM91992.1|  RD-22 like protein                                      105   2e-23   
sp|Q0JEP3.2|BURP5_ORYSJ  RecName: Full=BURP domain-containing pro...    108   2e-23   
ref|XP_011016123.1|  PREDICTED: dehydration-responsive protein RD...    108   2e-23   
emb|CDP18473.1|  unnamed protein product                                106   3e-23   
gb|EYU20466.1|  hypothetical protein MIMGU_mgv1a020040mg                108   3e-23   
ref|XP_008387386.1|  PREDICTED: BURP domain-containing protein 3-...    107   3e-23   
gb|AFM91990.1|  RD-22 like protein                                      105   4e-23   
gb|AFM91994.1|  RD-22 like protein                                      105   4e-23   
ref|XP_009373565.1|  PREDICTED: dehydration-responsive protein RD...    108   4e-23   
ref|XP_010648537.1|  PREDICTED: dehydration-responsive protein RD...    105   5e-23   
ref|XP_010667737.1|  PREDICTED: dehydration-responsive protein RD...    108   5e-23   
ref|XP_006287907.1|  hypothetical protein CARUB_v10001141mg             108   5e-23   
ref|NP_001052280.1|  Os04g0225700                                       107   5e-23   
ref|XP_008367705.1|  PREDICTED: dehydration-responsive protein RD...    107   5e-23   
emb|CDP01516.1|  unnamed protein product                                107   6e-23   
ref|XP_009367978.1|  PREDICTED: dehydration-responsive protein RD...    107   6e-23   
ref|XP_009353333.1|  PREDICTED: BURP domain-containing protein 5-...    107   6e-23   
ref|XP_004230918.1|  PREDICTED: BURP domain-containing protein 5-...    108   6e-23   
ref|XP_009373564.1|  PREDICTED: dehydration-responsive protein RD...    108   7e-23   
ref|XP_008378148.1|  PREDICTED: dehydration-responsive protein RD...    107   8e-23   
ref|XP_002522979.1|  polygalacturonase, putative                        106   8e-23   
sp|Q70KG3.1|RAF1B_WHEAT  RecName: Full=Protein RAFTIN 1B; Short=T...    107   8e-23   
ref|XP_009353316.1|  PREDICTED: dehydration-responsive protein RD...    107   8e-23   
ref|XP_008361049.1|  PREDICTED: dehydration-responsive protein RD...    107   8e-23   
ref|XP_008245942.1|  PREDICTED: BURP domain-containing protein 3-...    107   9e-23   
ref|XP_002534535.1|  Dehydration-responsive protein RD22 precurso...    105   9e-23   
gb|EPS66231.1|  hypothetical protein M569_08548                         105   1e-22   
ref|XP_009376258.1|  PREDICTED: BURP domain-containing protein 3-...    107   1e-22   
ref|XP_006365521.1|  PREDICTED: BURP domain-containing protein 3-...    107   1e-22   
ref|XP_009373562.1|  PREDICTED: dehydration-responsive protein RD...    108   1e-22   
ref|XP_007015178.1|  BURP domain-containing protein, putative           108   1e-22   
gb|KDP22137.1|  hypothetical protein JCGZ_25968                         109   1e-22   
ref|XP_009373563.1|  PREDICTED: dehydration-responsive protein RD...    107   1e-22   



>emb|CDP10830.1| unnamed protein product [Coffea canephora]
Length=336

 Score =   251 bits (642),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 138/295 (47%), Positives = 190/295 (64%), Gaps = 10/295 (3%)
 Frame = +3

Query  141   NVDGNMpksilsklsplseseTEVFTPLISQKYFSSNPKFCTTANLVCS--AVVNPPPPG  314
             NV G MP ++LSKLSPL++ + E FT L+S+K    N   C+ ANL CS  + VN     
Sbjct  43    NVQGTMPGNLLSKLSPLNKEQAEHFTSLVSKKNLPFNANHCSLANLACSPKSFVNNLMHN  102

Query  315   VKIYNFG-----FTGKVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPL  479
             +  Y +G         VDPSSF R+ +LK+G  V +P  L++QLP  SFLP +IA  I +
Sbjct  103   I-FYGYGRISPSHVQHVDPSSFLRISLLKQGSMVHLPD-LENQLPQHSFLPSQIASKISI  160

Query  480   NASELQRIFPTAFSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKH  659
               ++LQ++FP +   P TK A+  ++ YCN PA+K E  SC+K+LEDM++F++   G  H
Sbjct  161   AENDLQKLFPQSLKNPQTKDAIQSTIVYCNTPALKDEIQSCVKSLEDMVEFAKTATGNNH  220

Query  660   LAALTSDYTKGMGNQVVMIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVAN  839
             L ALTS  TKG G  ++ +G +K  K  K ++CHE+F PF+TY+C+ L  T +Y VDV  
Sbjct  221   LVALTSKNTKGSGKDLI-VGQMKKLKFGKTVSCHELFLPFSTYFCHLLSKTEVYAVDVLE  279

Query  840   PKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
             PK    +N   VICHMDTS W+P HVAFK+LK SPG+ E CHWI+Q DLI+I  +
Sbjct  280   PKTKIPINTVTVICHMDTSDWSPNHVAFKVLKTSPGQSEACHWISQNDLIFISQE  334



>ref|XP_011091745.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Sesamum indicum]
Length=336

 Score =   243 bits (619),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 122/278 (44%), Positives = 170/278 (61%), Gaps = 24/278 (9%)
 Frame = +3

Query  204  TEVFTPLISQKYFSSNPKFCTTANLVCSAVVNPPPPGVKIYNFGFT-------------G  344
            +E +   IS+  F ++ KFC+ A L CSAV++     +K+    +T              
Sbjct  65   SEYYAETISKDNFEADLKFCSLAKLACSAVLD----DIKVVKQSYTTRNVYMDNKAIPLE  120

Query  345  KVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSI  524
            KVDP SFFRL +LK+G+ + + S L + LP R+FLPP+IA  I L +  + +IFP +   
Sbjct  121  KVDPFSFFRLSILKEGNTIHL-SDLKASLPYRAFLPPQIASKITLTSKGIAKIFPES---  176

Query  525  PLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQ  704
              +K A+  +L YCNA A+KGE   C K+LE+MI FS+  LG   L ALTS  T+G G +
Sbjct  177  --SKEAVGTTLSYCNAAAIKGELKVCPKSLEEMINFSKSALGKNKLLALTSKSTRGSGEE  234

Query  705  VVMIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICH  884
            +  I  +K +   KI+ACHE++ PFATY+C+ LPS+RIY VD   PK    +N  L +CH
Sbjct  235  L-KIEKIKQFDVEKIVACHEMYLPFATYFCHSLPSSRIYSVDFVEPKSGAPVNTVLAMCH  293

Query  885  MDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIG  998
            MDTS W   HVAF++LK  PG+GE CHW  ++DL WI 
Sbjct  294  MDTSPWPADHVAFQILKFGPGQGEACHWSNEIDLAWIA  331



>ref|XP_011091740.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Sesamum indicum]
Length=281

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/266 (43%), Positives = 165/266 (62%), Gaps = 11/266 (4%)
 Frame = +3

Query  213  FTPLISQKYFSSNPKFCTTANLVCSAVVNPPPPGVKIYNFGFT----GKVDPSSFFRLLV  380
            +   IS+  F+++ +FC+ A L CS   +     +    +G       KVD  SFFRL  
Sbjct  20   YAEAISENNFNADTEFCSRAKLACSIGSDAYVTALVYNKYGGAIAPLEKVDQFSFFRLST  79

Query  381  LKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPLTKAAMDKSLG  560
            LK+G+++ + S L   LP R+FLP +IA  +PL +  + +IFP +     +K     +L 
Sbjct  80   LKEGNEIHL-SSLKVSLPFRAFLPSQIASKVPLTSEGIAKIFPQS-----SKEDTATTLY  133

Query  561  YCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGNVKPYKT  740
            YCNA A+KGE   C K+LE+MI FS+  LG   L ALTS  TKG  +++  I  +K Y  
Sbjct  134  YCNAAAIKGELKVCPKSLEEMISFSKSALGKNKLLALTSKSTKGSASEL-KIKRIKQYDV  192

Query  741  NKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVA  920
             KI+ACHE++ PFATY+C+ LPS++IY VDV  P     +N  + ICHMDTS W  +HVA
Sbjct  193  EKIVACHEMYLPFATYFCHSLPSSKIYAVDVVEPSTGAPVNTVVAICHMDTSAWPEEHVA  252

Query  921  FKLLKLSPGKGEVCHWITQMDLIWIG  998
            FK++KL PG+GEVCHW++++D+ WI 
Sbjct  253  FKIVKLGPGQGEVCHWLSEIDVAWIA  278



>ref|XP_011074238.1| PREDICTED: BURP domain-containing protein 16-like [Sesamum indicum]
Length=334

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/257 (45%), Positives = 156/257 (61%), Gaps = 8/257 (3%)
 Frame = +3

Query  240  FSSNPKFCTTANLVCS-AVVNPPPPGVKIYNFGFTGKV----DPSSFFRLLVLKKGHKVT  404
            FS++  FC+ A L C+ A            N     +V    DP SFFR+  LK G+ V 
Sbjct  76   FSADSHFCSLAKLSCTFATAKYTQQNTYGINSAAVDQVKRSEDPFSFFRVSTLKTGNLVH  135

Query  405  MPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPLTKAAMDKSLGYCNAPAVK  584
            +P+ L   LP+R+FLPP+I  +IPL    +   FP  + +  TK  +  +L YCNA A++
Sbjct  136  LPN-LQETLPDRTFLPPQIVSSIPLTYEGITEAFP-EWGVGPTKETIQTTLAYCNAAAIE  193

Query  585  GERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGNVKPYKTNKIIACHE  764
            GE  SC K+LE+M+ F+  +LGG  L ALTS  ++G G +++ IG +K Y   KI+ACHE
Sbjct  194  GETKSCPKSLEEMVGFATASLGGTKLLALTSKNSRGSGAEMI-IGKMKHYGATKIVACHE  252

Query  765  IFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSP  944
             F PFA Y C+ L ST +Y V+V +PK    +N  L ICHMDTS W   HVAF++LK  P
Sbjct  253  AFLPFAAYVCHSLSSTGLYAVEVVDPKGGAAVNTLLAICHMDTSAWPKNHVAFEILKFGP  312

Query  945  GKGEVCHWITQMDLIWI  995
            G+GE CHW TQ+DL WI
Sbjct  313  GEGEACHWFTQLDLAWI  329



>gb|EYU36709.1| hypothetical protein MIMGU_mgv1a024306mg [Erythranthe guttata]
Length=267

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 148/224 (66%), Gaps = 12/224 (5%)
 Frame = +3

Query  351  DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPL  530
            DP SFFR+ VLK G+ V +P HL   LP+R+FLP ++A  IPLN + + RIFP +     
Sbjct  44   DPFSFFRMSVLKNGNLVHLP-HLQETLPDRAFLPEKMASRIPLNYTAISRIFPDSDVTGK  102

Query  531  TKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGG----KHLAALTSDYTKGMG  698
            TKA +  +LGYCNA A++GE  SC ++LE+M+ F+R  LGG    K + ALTS  T G  
Sbjct  103  TKATIQTTLGYCNAAAIRGETKSCPRSLEEMVGFARVTLGGGGDKKKVVALTSKSTVG-S  161

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGT--MN  863
            N +  IG +K Y      KI+ACHE F PFA YYC+ L STR+Y VD  + ++ G+  +N
Sbjct  162  NSIAKIGKIKEYGGGAGEKIVACHEAFLPFAAYYCHLLTSTRLYMVDFVD-RETGSKVVN  220

Query  864  KFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
              L ICHMDTS W  +HVAFK+LK  PG+GE CHW TQ+DL WI
Sbjct  221  MMLGICHMDTSHWPKEHVAFKILKFGPGEGEACHWFTQLDLAWI  264



>gb|EYU36708.1| hypothetical protein MIMGU_mgv1a009279mg [Erythranthe guttata]
Length=347

 Score =   225 bits (574),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/269 (43%), Positives = 161/269 (60%), Gaps = 19/269 (7%)
 Frame = +3

Query  243  SSNPKFCTTANLVCSAVVNPPPPGVKIYN----FG-FTGKV---------DPSSFFRLLV  380
            +++  FC  A L C++V          Y     +G F+  +         DP +F+RL  
Sbjct  79   AADANFCALAKLACTSVFQKANIVKDTYTREKTYGRFSAALHRHQDIKNEDPFAFYRLSA  138

Query  381  LKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPLTKAAMDKSLG  560
            LK+G  + +P HL   LP+R+FLP ++A  IPLN   + RIFP +     TK  +  +L 
Sbjct  139  LKEGKLIHLP-HLKESLPDRAFLPQQMASKIPLNYDAISRIFPDSDISGKTKETIQTTLA  197

Query  561  YCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGNVKPY-K  737
            YCNA A++GE  SC K+LE+M+ F++  LGGK + ALT+  T+G  N  V IG +K Y  
Sbjct  198  YCNAEAIQGETESCPKSLEEMVGFAKSTLGGKKVVALTTKNTRG-SNSAVRIGKIKEYGG  256

Query  738  TNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGT--MNKFLVICHMDTSGWTPK  911
              KI+ACHE F PFA Y+C+ L STR+Y VDV   ++ G+  +N  L ICHMDTS W   
Sbjct  257  GKKIVACHEAFLPFAAYFCHSLSSTRLYAVDVVVDRETGSNVVNTMLGICHMDTSQWPKD  316

Query  912  HVAFKLLKLSPGKGEVCHWITQMDLIWIG  998
            HVAF++LK  PG+GE CHW T++DL WI 
Sbjct  317  HVAFQILKFGPGEGEACHWFTKLDLAWIA  345



>emb|CDP10831.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 148/219 (68%), Gaps = 2/219 (1%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIP  527
             VDPSSFF + +LK+G  + + S+L++QLP  SFLP +IA    +  ++LQ++FP +   P
Sbjct  20    VDPSSFFEISLLKQGSMMHL-SNLENQLPQHSFLPSQIASKFSVVENDLQKLFPQSLKNP  78

Query  528   LTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQV  707
              TK A+  +L YCN P +K E  SC+K+LEDM++F++  +G  H+  LT+  T+G G + 
Sbjct  79    RTKDAIQSTLIYCNTPPLKEEIQSCVKSLEDMVEFAKAAIGTNHVVPLTTKNTEGSGKEF  138

Query  708   VMIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHM  887
             + +G+V+  K  KI++CHE F PFATY+C+ L  T  Y VDV  PK    +N  +VICHM
Sbjct  139   I-VGHVEKLKFKKIVSCHEFFLPFATYFCHLLSKTEAYAVDVLEPKTKLPINTVMVICHM  197

Query  888   DTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
             DTS W+P HVAFKLLK SPGK   CHW+ Q DL+++  +
Sbjct  198   DTSNWSPNHVAFKLLKSSPGKVVACHWVFQNDLLFVSAE  236



>ref|XP_004241419.1| PREDICTED: BURP domain-containing protein 16-like [Solanum lycopersicum]
Length=408

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 140/218 (64%), Gaps = 8/218 (4%)
 Frame = +3

Query  360   SFFRLLVLKKGHKVTMPSHLDSQL---PNRSFLPPEIARNIPLNASELQRIFPTAFSIPL  530
             SFFR+  LK G+ V    HLD+ +   P+RSFLP +IA  I +N++ LQ +FP  F+ P 
Sbjct  193   SFFRVSTLKPGNTV----HLDNLVNPFPHRSFLPSQIASKISINSNHLQHLFPQTFTSPY  248

Query  531   TKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVV  710
             TK     ++  CNAP +KGE  +C K+LE+MI+FS+ +L   HL +LT++  +G G Q +
Sbjct  249   TKDTTKTTILNCNAPTLKGEVKTCAKSLEEMIEFSKRSLKQNHLISLTTESIQGSG-QKL  307

Query  711   MIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMD  890
              I       + + ++CHEIF PFATY+C+ L ST IY V++ +      +NK +V+CHMD
Sbjct  308   KIEKFHKINSQRSVSCHEIFLPFATYFCHLLSSTNIYAVELVDLNTNVHVNKAMVVCHMD  367

Query  891   TSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
             TS W   H  FK L  SPG GEVCHW++Q DL+W+G D
Sbjct  368   TSSWPADHPVFKKLNFSPGNGEVCHWMSQADLVWVGDD  405



>ref|XP_010046642.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
Length=367

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/289 (36%), Positives = 152/289 (53%), Gaps = 32/289 (11%)
 Frame = +3

Query  210  VFTPLISQKYFSSNP-KFCTTANLVC--------SAVVN----------PPPPG---VKI  323
            +F  L+++   S +   FC  A L+C         A  N          PPPP    V  
Sbjct  78   IFAELVAKGAISDHLLSFCEEAQLLCFMNSSSDGVARTNAQVYSYTNCPPPPPADTIVAT  137

Query  324  YNFGFTGKVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---EL  494
             +    G V+  +FFR  +LK G+ + MP   D+ LP RSFLP  I+  +P + S   EL
Sbjct  138  DDKKVNGGVEEGAFFRESMLKSGNVMPMPDIRDN-LPRRSFLPRGISSEMPFSTSKLAEL  196

Query  495  QRIFPTAFSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALT  674
            ++IF    +  + K  M + LG C   A++ E   C+ ++EDMI  +   LG  H   + 
Sbjct  197  KQIFHATENSAMEKI-MAQILGQCEVAALQDETKRCVASIEDMIDLATSVLG--HDVMVR  253

Query  675  SDYTKGMGNQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPK  845
            S  + G   Q V+IG VK     + +K +ACH+I FP+A YYC+  P+ RIY+ D+ +PK
Sbjct  254  STESAGGSKQEVLIGVVKRIDGSEVSKPVACHQILFPYAVYYCHAFPNVRIYEADILDPK  313

Query  846  KMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
                +N  + ICHMDTS W P + AF LL   PG+ EVCHWI + ++IW
Sbjct  314  SKAKINHGVAICHMDTSAWGPTYEAFLLLGSGPGQIEVCHWIYENNMIW  362



>gb|KCW86730.1| hypothetical protein EUGRSUZ_B03341 [Eucalyptus grandis]
Length=272

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 134/239 (56%), Gaps = 10/239 (4%)
 Frame = +3

Query  294  VNPPPPGVKIYNFGFTGKVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNI  473
            ++PP   V   +    G V+   FFR  +LK G+ + MP   D+ LP RSFLP  I+  +
Sbjct  33   LSPPDTIVATDDKKVNGGVERGLFFRESMLKSGNVMPMPDMRDN-LPKRSFLPRCISSEL  91

Query  474  PLNAS---ELQRIFPTAFSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSREN  644
            P + S   EL++IF  A         M ++LG C    V+ E   C+ ++EDMI F+   
Sbjct  92   PFSTSKLAELKQIF-RAIENSAVGKIMAQTLGECEGAGVQDETKRCVASIEDMIDFATSV  150

Query  645  LGGKHLAALTSDYTKGMGNQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTR  815
            LG  H   + S  +     Q V+IG VK  + +++   +ACHEI FP+  YYC+  P+ R
Sbjct  151  LG--HDVMVRSTESARGSKQEVLIGVVKRIEGSEVSKPVACHEILFPYIVYYCHTFPNVR  208

Query  816  IYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            +Y+ D+ +PK    +N  + ICHMDTS W+P H +F+LL   PG+ EVCHWI   +LIW
Sbjct  209  VYEADILDPKSKAKINHGVAICHMDTSTWSPAHGSFQLLGSGPGQIEVCHWIYDNNLIW  267



>gb|KHN27021.1| Putative polygalacturonase non-catalytic subunit [Glycine soja]
Length=340

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/221 (40%), Positives = 131/221 (59%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK+G  + MP   D ++P RSFLP  I   +P +++   EL+R+F  + 
Sbjct  120  VEPGKFFRETMLKEGTVMPMPDIRD-KMPKRSFLPRAILTKLPFSSAKVDELKRVFKVSE  178

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + K  MD SLG C      GE   C+ ++EDMI FS   LG +++A  T++  KG  
Sbjct  179  NSSMDKMIMD-SLGECEREPSVGETKRCVGSVEDMIDFSTSVLG-RNVAVWTTENVKG-S  235

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
            N+ VM+G VK     K  K ++CH+  FP+  YYC+ +P  R+Y+ D+ +P+    +N  
Sbjct  236  NKNVMVGRVKGMNGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPESKAKINHG  295

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DT+ W+P H AF  L   PG+ EVCHWI + DL W
Sbjct  296  VAICHLDTTAWSPTHGAFLALGSGPGRIEVCHWIFENDLTW  336



>ref|XP_010046648.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
Length=383

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 136/239 (57%), Gaps = 10/239 (4%)
 Frame = +3

Query  294  VNPPPPGVKIYNFGFTGKVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNI  473
            ++PP   V   +    G V+   FFR  +LK G+ + MP   D+ LP RSFLP  I+  +
Sbjct  144  LSPPDTIVATDDKKVNGGVERGLFFRESMLKSGNVMPMPDMRDN-LPKRSFLPRCISSEL  202

Query  474  PLNAS---ELQRIFPTAFSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSREN  644
            P + S   EL++IF    +  + K  M ++LG C    V+ E   C+ ++EDMI F+   
Sbjct  203  PFSTSKLAELKQIFRAIENSAVGKI-MAQTLGECEGAGVQDETKRCVASIEDMIDFATSV  261

Query  645  LGGKHLAALTSDYTKGMGNQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTR  815
            LG  H   + S  +     Q V+IG VK  + +++   +ACHEI FP+  YYC+  P+ R
Sbjct  262  LG--HDVMVRSTESARGSKQEVLIGVVKRIEGSEVSKPVACHEILFPYIVYYCHTFPNVR  319

Query  816  IYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            +Y+ D+ +PK    +N  + ICHMDTS W+P H +F+LL   PG+ EVCHWI   +LIW
Sbjct  320  VYEADILDPKSKAKINHGVAICHMDTSTWSPAHGSFQLLGSGPGQIEVCHWIYDNNLIW  378



>ref|XP_003552018.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=622

 Score =   171 bits (432),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 135/223 (61%), Gaps = 12/223 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK+G  + MP   D ++P RSFLP  I   +P +++   EL+R+F  + 
Sbjct  402  VEPGKFFRETMLKEGTVMPMPDIRD-KMPKRSFLPRAILTKLPFSSAKVDELKRVFKVSE  460

Query  519  SIPLTKAAMDKSLGYCN-APAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGM  695
            +  + K  MD SLG C  AP+V GE   C+ ++EDMI FS   LG +++A  T++  KG 
Sbjct  461  NSSMDKMIMD-SLGECERAPSV-GETKRCVASVEDMIDFSTSVLG-RNVAVWTTENVKGS  517

Query  696  GNQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNK  866
             N+ VM+G VK     K  K ++CH+  FP+  YYC+ +P  R+Y+ D+ +P+    +N 
Sbjct  518  -NKNVMVGRVKGMNGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPESKAKINH  576

Query  867  FLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
             + ICH+DT+ W+P H AF  L   PG+ EVCHWI + DL W 
Sbjct  577  GVAICHLDTTAWSPTHGAFLALGSGPGRIEVCHWIFENDLTWT  619



>gb|KCW86729.1| hypothetical protein EUGRSUZ_B03340 [Eucalyptus grandis]
Length=256

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/223 (39%), Positives = 128/223 (57%), Gaps = 10/223 (4%)
 Frame = +3

Query  342  GKVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPT  512
            G V+   FFR  +LK G+ + MP   D+ LP RSFLP  I+  +P + S   EL++IF  
Sbjct  33   GGVEQGLFFRESMLKSGNVMPMPDMRDN-LPKRSFLPRCISSELPFSTSKLAELKQIFRA  91

Query  513  AFSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKG  692
              +  + K  M ++LG C    V+ E   C+ ++EDMI F+   LG  H   + S  +  
Sbjct  92   IENSAMGKI-MAQTLGECEGAGVQDESKRCVASIEDMIDFTTSVLG--HDVMVRSTESAR  148

Query  693  MGNQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMN  863
               Q V+IG VK  + +++   +ACH+  FP+  YYC+  P+ R+Y+ D+ +PK    +N
Sbjct  149  GSKQEVLIGVVKRIEGSEVSKPVACHQSLFPYIVYYCHTFPNVRVYEADILDPKSKAKIN  208

Query  864  KFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
              + ICHM+TS W+P H +F LL   PG+ EVCHWI +  LIW
Sbjct  209  HGVAICHMNTSTWSPTHESFLLLGSGPGQIEVCHWIYENSLIW  251



>gb|KCW86720.1| hypothetical protein EUGRSUZ_B03328 [Eucalyptus grandis]
Length=212

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 123/211 (58%), Gaps = 10/211 (5%)
 Frame = +3

Query  378  VLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAFSIPLTKAAMD  548
            +LK G+ + MP   D+ LP RSFLP  I+  +P + S   EL++IF    +  + K  M 
Sbjct  1    MLKSGNVMPMPDIRDN-LPRRSFLPRGISSEMPFSTSKLAELKQIFHATENSAMEKI-MA  58

Query  549  KSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGNVK  728
            + LG C   A++ E   C+ ++EDMI  +   LG  H   + S  + G   Q V+IG VK
Sbjct  59   QILGQCEVAALQDETKRCVASIEDMIDLATSVLG--HDVMVRSTESAGGSKQEVLIGVVK  116

Query  729  PYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSG  899
                +++   +ACH+I FP+A YYC+  P+ RIY+ D+ +PK    +N  + ICHMDTS 
Sbjct  117  RIDGSEVSKPVACHQILFPYAVYYCHAFPNVRIYEADILDPKSKAKINHGVAICHMDTSA  176

Query  900  WTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            W P + AF LL   PG+ EVCHWI + ++IW
Sbjct  177  WGPTYEAFLLLGSGPGQIEVCHWIYENNMIW  207



>ref|XP_003532010.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=627

 Score =   168 bits (425),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/222 (39%), Positives = 128/222 (58%), Gaps = 10/222 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK G  + MP   D ++P RSFLP  I   +P ++S   EL+R+F  + 
Sbjct  407  VEPGKFFRESMLKDGTLMPMPDIRD-KMPKRSFLPRSILTKLPFSSSKVHELKRLFKVSD  465

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + K  MD SLG C      GE   C+ ++EDMI FS   LG +++A  T++   G  
Sbjct  466  NSSMEKMIMD-SLGECERVPSMGETKRCVGSIEDMIDFSTSVLG-RNVAVWTTENVNGS-  522

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
            N+ VM+G VK     K+   ++CH+  FP+  YYC+ +P  R+Y  D+ +P+    +N  
Sbjct  523  NKNVMVGRVKGMNGGKVTQSVSCHQSLFPYMLYYCHSVPKVRVYQADLLDPESKAKINHG  582

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
            + ICH+DT+ W+P H AF  L   PG+ EVCHWI + DL W 
Sbjct  583  VAICHLDTTAWSPTHGAFMALGSGPGRIEVCHWIFENDLTWT  624



>gb|KDO38689.1| hypothetical protein CISIN_1g045773mg [Citrus sinensis]
Length=303

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 132/253 (52%), Gaps = 15/253 (6%)
 Frame = +3

Query  264   TTANLVCSAVVNPPPPGVKIYNFGFTGKVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRS  443
             T AN      V  P  G  +  +     V+P  FFR  +LK G  + MP   D ++P RS
Sbjct  57    TFANYTEGTPVPKPSSGSSVNRW-----VEPGKFFRESMLKNGTLMPMPDIRD-RMPRRS  110

Query  444   FLPPEIARNIPLNAS---ELQRIFPTAFSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTL  614
              LP  I  N+P  +S   +L+ IF  + +  +     D +L  C     KGE   C+ + 
Sbjct  111   LLPRSIVSNLPFTSSKLNQLKEIFHASDNSTMESIIKD-ALSDCERAPSKGETKRCVGSA  169

Query  615   EDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGNVKPY---KTNKIIACHEIFFPFAT  785
             EDMI F+   LG  ++A  T++  KG   Q +MIG VK     +  K ++CH+  +P+  
Sbjct  170   EDMIDFATSVLG-NNVALHTTENAKG-SKQDIMIGTVKGINGGEVTKSVSCHQSLYPYLL  227

Query  786   YYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCH  965
             YYC+ +P  R+Y+ D+  PK M  +N  + ICH+DTS W+  H AF  L  SPG+ EVCH
Sbjct  228   YYCHSVPEVRVYEADILEPKTMAKINHGVAICHLDTSSWSATHEAFLTLGSSPGRIEVCH  287

Query  966   WITQMDLIWIGYD  1004
             WI + DL W   D
Sbjct  288   WIFENDLTWTIAD  300



>gb|KCW86723.1| hypothetical protein EUGRSUZ_B03334 [Eucalyptus grandis]
Length=260

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/238 (37%), Positives = 132/238 (55%), Gaps = 10/238 (4%)
 Frame = +3

Query  297  NPPPPGVKIYNFGFTGKVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIP  476
            +PP   V   +    G V+   FFR  +LK G+ + MP   D+ LP RSFLP  I+  +P
Sbjct  22   SPPDTIVATDDKKVNGGVEKGLFFRESMLKSGNVMPMPDIRDN-LPKRSFLPRCISAELP  80

Query  477  LNAS---ELQRIFPTAFSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENL  647
             + S   EL++IF    +  + K  M ++LG C   A++ E   C+ ++EDMI F+   L
Sbjct  81   FSTSKLAELKQIFHAIENSAMGKI-MAQTLGECEGAALQDETKRCVASIEDMIDFATSVL  139

Query  648  GGKHLAALTSDYTKGMGNQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRI  818
            G  H   + S  +     Q V+IG VK  + +++   +ACH   FP+  YYC+  P+ R 
Sbjct  140  G--HDVMVRSTESARGSKQEVLIGVVKRIEGSEVSKPVACHRRLFPYIVYYCHSFPNVRS  197

Query  819  YDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            Y+ D+ +PK    +N  + ICHM+TS W+P H +F LL   PG+ EVCHWI + + IW
Sbjct  198  YEADILDPKSKAKINHGVAICHMNTSTWSPIHESFLLLGSGPGQIEVCHWIYENNPIW  255



>ref|XP_008800877.1| PREDICTED: BURP domain-containing protein 12-like [Phoenix dactylifera]
Length=637

 Score =   164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/218 (39%), Positives = 119/218 (55%), Gaps = 7/218 (3%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIP  527
            V+P  FFR   LKKG  + MP  +  ++P RSFLP  IA  IP +A+E+QR+F       
Sbjct  420  VEPGKFFRESELKKGTVMPMPD-ISDRMPARSFLPRSIAGRIPFSAAEVQRVFNMPADTA  478

Query  528  LTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQV  707
            L KAA D ++  C  P  +GE   C  + ED+I F+   LG   +   T +     G+  
Sbjct  479  LGKAAAD-TVAECERPPSRGETKRCATSAEDVIDFAVSVLGNNVVVRSTENTNGSKGS--  535

Query  708  VMIGNVKPYK---TNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVI  878
            ++IG VK        K ++CH+  FP+  YYC+ +P  R+Y  ++   K    +N  + I
Sbjct  536  ILIGEVKGVNGGSVTKSVSCHQSLFPYLVYYCHSVPKVRVYQAEILAVKTKEKINHGVAI  595

Query  879  CHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            CH+DTS W+P H AF  L   PGK EVCHWI Q D+ W
Sbjct  596  CHVDTSDWSPAHGAFVALGPGPGKIEVCHWIFQGDMTW  633



>emb|CAN67205.1| hypothetical protein VITISV_037214 [Vitis vinifera]
Length=235

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 128/225 (57%), Gaps = 10/225 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
             V+P  FFR  +LKKG  + MP   D ++P RSFLP  I+  +P + S   E+++IF  A 
Sbjct  15    VEPGKFFRESMLKKGTVMPMPDIRD-KMPKRSFLPRTISSKLPFSTSKLEEMKKIFHAAD  73

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
             +  + +    ++L  C     KGE   C+ ++EDMI F+   LG +++   T+   +G  
Sbjct  74    NSSM-EHMFTEALDDCERAPSKGETKRCVPSIEDMIDFATTVLG-RNVVVRTTQSVEG-S  130

Query  699   NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
              Q VMIG+VK     +  K ++CH+  FP+  YYC+ +P  R+Y+ D+ +PK    +N  
Sbjct  131   KQNVMIGSVKGINGGQVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKTKANVNHG  190

Query  870   LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
             + ICH+DTS W+  H AF  L   PG+ EVCHWI + D+ W   D
Sbjct  191   VAICHLDTSDWSAGHGAFVALGSGPGRIEVCHWIFENDMTWTIAD  235



>emb|CAN66340.1| hypothetical protein VITISV_018557 [Vitis vinifera]
Length=226

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/225 (37%), Positives = 128/225 (57%), Gaps = 10/225 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
             ++P  FFR  +LKKG  + MP   D ++P RSFLP  I+  +P + S   E+++IF  A 
Sbjct  6     IEPGKFFRESMLKKGTVMPMPDIRD-KMPKRSFLPRSISSKLPFSTSKLEEMKKIFHAAB  64

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
             +  + +    ++L  C     KGE   C+ ++EDMI F+   LG +++   T+   +G  
Sbjct  65    NSSM-EHMFTEALDDCERAPSKGETKRCVPSIEDMIDFATTVLG-RNVVVRTTQSVEG-S  121

Query  699   NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
              Q VMIG+VK     +  K ++CH+  FP+  YYC+ +P  R+Y+ D+ +PK    +N  
Sbjct  122   KQNVMIGSVKGINGGQVTKSVSCHQSLFPYLLYYCHXVPKVRVYEADLLDPKTKANINHG  181

Query  870   LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
             + ICH+DTS W+  H AF  L   PG+ EVCHWI + D+ W   D
Sbjct  182   VAICHLDTSDWSAGHGAFVALGSGPGRIEVCHWIFENDMTWTIVD  226



>ref|XP_009794726.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana sylvestris]
Length=628

 Score =   163 bits (413),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 125/221 (57%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK G  + MP   D ++P RSFLP  IA  +P + S   EL++IF  A 
Sbjct  408  VEPGKFFREKMLKSGTVMPMPDIKD-KMPKRSFLPRVIAAKLPFSTSKIGELKKIFHAAD  466

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
              P+ K   D +L  C      GE   C+ + EDMI F+   LG +++   T++ TKG  
Sbjct  467  DSPVAKMIGD-ALTECERAPSAGETKRCINSAEDMIDFATSVLG-RNVVVRTTENTKGS-  523

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + +MIG+VK     K+   ++CH+  FP+  YYC+ +P  R+Y+ D+ +P     +N  
Sbjct  524  KENIMIGSVKGINGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADILDPNSKAKINHG  583

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W P H AF  L   PGK EVCHWI + D+ W
Sbjct  584  VAICHVDTSSWGPTHGAFVALGSGPGKIEVCHWIFENDMTW  624



>ref|XP_006365229.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Solanum tuberosum]
Length=611

 Score =   163 bits (412),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 90/225 (40%), Positives = 125/225 (56%), Gaps = 10/225 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
             V+P  FFR  +LK G  + MP  +  ++P RSFLP  IA  +P + S   EL++IF  A 
Sbjct  391   VEPGKFFREKMLKSGTIMPMPD-IKDKMPKRSFLPRVIAAKLPFSTSKIDELKKIFHAAN  449

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
                + K   D +L  C      GE   C K+ EDMI F+   LG +++   T++ TKG  
Sbjct  450   DSQVAKIIGD-ALSECERAPSAGETKRCAKSAEDMIDFATSVLG-RNVVVRTTENTKGS-  506

Query  699   NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             N  +MIG VK     K  K ++CH+  FP+  YYC+ +P  R+Y+ D+ +P     +N  
Sbjct  507   NGNIMIGAVKGINGGKVTKSVSCHQTLFPYLLYYCHSVPKVRVYEADILDPNSKANINHG  566

Query  870   LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
             + ICH+DTS W PKH AF  L   PGK EVCHWI + D+ W   D
Sbjct  567   VAICHVDTSLWGPKHGAFIALGSGPGKIEVCHWIFENDMTWATAD  611



>ref|XP_010044627.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
isoform X1 [Eucalyptus grandis]
 ref|XP_010044628.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
isoform X2 [Eucalyptus grandis]
Length=372

 Score =   159 bits (402),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 148/290 (51%), Gaps = 35/290 (12%)
 Frame = +3

Query  210  VFTPLISQKYFSSNP-KFCTTANLVCSAVVNPPPPGV---------KIYNFG--------  335
            +F  L+++   S +   FC  A L+C   +N    GV         K+Y  G        
Sbjct  85   IFAELVAKGAISDHLLSFCEEAQLLC--FMNSSSYGVAKTIDAQLYKVYPRGPPPDTIVA  142

Query  336  -----FTGKVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---E  491
                   G ++   FFR  +LK G+ + MP  L    P  SFLP  I+  +P + S   E
Sbjct  143  TDDKKVNGGMEQGLFFRESMLKSGNVMPMPD-LRDNFPKTSFLPRRISSKLPFSTSKLAE  201

Query  492  LQRIFPTAFSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAAL  671
            L++IF    +  + K  M ++LG C   A++ E   C+ ++EDMI F+   LG  H   +
Sbjct  202  LKQIFHAIENSTMEKI-MAQTLGLCEGAALQDETKRCVASIEDMIDFATSVLG--HDVMV  258

Query  672  TSDYTKGMGNQVVMIGNVKPYKTN---KIIACHEIFFPFATYYCYKLPSTRIYDVDVANP  842
             S  +     Q V+IG V+  + +   K +ACH+  FP+  YYC+  P+ R+Y+ D+ +P
Sbjct  259  RSTESARGSKQEVLIGVVRRIEGSEGSKPVACHQSLFPYIVYYCHAFPNVRVYEADILDP  318

Query  843  KKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            K    +N  + ICHMDTS W+P H +F LL   PG+ EVCHWI + +++W
Sbjct  319  KSKAKINHGVAICHMDTSTWSPAHGSFLLLGSGPGQIEVCHWINENNMMW  368



>ref|XP_010100469.1| hypothetical protein L484_027781 [Morus notabilis]
 gb|EXB82603.1| hypothetical protein L484_027781 [Morus notabilis]
Length=608

 Score =   162 bits (411),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 127/221 (57%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLN---ASELQRIFPTAF  518
            V+P  FFR   LKKG  + MP   D ++P RSFLP  I   +P +   AS+L++IF  A 
Sbjct  388  VEPGKFFRESKLKKGVVMPMPDIKD-KMPERSFLPRVITSKLPFSTSKASDLKKIFHAAD  446

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + K  +D +L  C     +GE   C+ ++EDMI F+   LG +++ A T++   G  
Sbjct  447  NSTMEKIIVD-TLAECERAPSRGETKRCVSSVEDMIDFATSVLG-RNVVARTTESVSGS-  503

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + +MIG+VK     K+   ++CH+  FP+  YYC+ +P  R+Y  D+ +P     +N  
Sbjct  504  KKNIMIGSVKGINGGKVTQSVSCHQSLFPYLVYYCHSVPKVRVYTADILDPNSKAKINHG  563

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L   PG+ EVCHWI + DL W
Sbjct  564  VAICHLDTSAWSPTHGAFLALGSKPGRIEVCHWIFENDLTW  604



>ref|XP_004514684.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
isoform X1 [Cicer arietinum]
 ref|XP_004514685.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
isoform X2 [Cicer arietinum]
Length=630

 Score =   162 bits (411),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 85/225 (38%), Positives = 125/225 (56%), Gaps = 10/225 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
             V+P  FFR  +LK+G  + MP   D ++P RSFLP  I   +P + S   E++R+F  + 
Sbjct  410   VEPGKFFREKMLKEGTVMPMPDIRD-KMPERSFLPRSILAKLPFSTSKIYEMKRLFKASD  468

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
             +  + K   D SLG C     +GE   C+ ++EDMI F+   LG   +   T +     G
Sbjct  469   NGSMEKMMRD-SLGECERVPSRGETKRCVGSIEDMIDFATSVLGRNVVVRTTKNLNGSKG  527

Query  699   NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             N  VM+G V      KI   ++CH+  FP+  YYC+ +P  R+Y VD+ +PK    +N+ 
Sbjct  528   N--VMVGRVNGINGGKITRSVSCHQSLFPYLLYYCHSVPMVRVYQVDLLDPKTKSKINQG  585

Query  870   LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
             + +CH+DTS W+P H AF  L   PG+ EVCHWI + D+ W   D
Sbjct  586   VAVCHLDTSDWSPSHGAFLSLGSGPGRIEVCHWIFENDMSWTVAD  630



>ref|XP_010924225.1| PREDICTED: BURP domain-containing protein 12-like [Elaeis guineensis]
Length=636

 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/218 (38%), Positives = 119/218 (55%), Gaps = 7/218 (3%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIP  527
            V+P  FFR   L+KG  + MP  +  ++P RSFLP  IA  IP +A+E+QR+F       
Sbjct  419  VEPGKFFRESELQKGTVMPMPD-IGDRMPARSFLPRSIAGRIPFSATEVQRVFNIPADTA  477

Query  528  LTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQV  707
            L KA  D ++  C  P  +GE   C  + ED+I F+   LG   +   T +     GN  
Sbjct  478  LGKAVAD-TVAECERPPSRGETKRCATSAEDVIDFAVSVLGSNVVVRSTENTGGSKGN--  534

Query  708  VMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVI  878
            ++IG V+      I   ++CH+  FP+  YYC+ +P  R+++ D+   K    +N  + I
Sbjct  535  ILIGKVEGVNGGNITKSVSCHQSLFPYLVYYCHSVPKVRVHEADILAVKTKEKINHGVAI  594

Query  879  CHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            CH+DTS W+P H AF  L   PG+ EVCHWI Q D+ W
Sbjct  595  CHLDTSDWSPAHGAFVALGSGPGQIEVCHWIFQGDMTW  632



>ref|XP_010936822.1| PREDICTED: BURP domain-containing protein 12-like [Elaeis guineensis]
Length=615

 Score =   162 bits (409),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 123/219 (56%), Gaps = 6/219 (3%)
 Frame = +3

Query  345  KVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSI  524
            +++P  FFR   LK G  + MP   D ++P RSFLP  IA  +P +A+ L  +F  +   
Sbjct  396  RIEPGKFFRESSLKNGTAMPMPDIRD-KMPKRSFLPRSIAEKLPFSATALAPLFGVSMDS  454

Query  525  PLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQ  704
             + +A M +++  C     +GE   C+ ++EDM+ F+   LG  ++   +++  +G G  
Sbjct  455  AMGRA-MAETVAECERAPSRGETKRCVASMEDMVDFAASMLGDDNVVVRSTENVRGSGGN  513

Query  705  VVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLV  875
            + ++GNV      K+   ++CH+  FP+  YYC+ +P  R Y+ D+ + +    +N  + 
Sbjct  514  I-LVGNVTGINGGKVTRSVSCHQSLFPYLVYYCHSVPKVRAYEADILDVETGERINHGVA  572

Query  876  ICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            ICH+DTS W+P H AF  L   PGK EVCHWI + D+ W
Sbjct  573  ICHLDTSDWSPGHGAFVALGSGPGKIEVCHWIFEGDMTW  611



>ref|XP_008444317.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Cucumis melo]
Length=623

 Score =   161 bits (408),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 131/222 (59%), Gaps = 12/222 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASEL---QRIFPTAF  518
            V+P  FFR  +L+KG  + MP   D ++P RSFLP  I   +P ++S+L   ++IF    
Sbjct  403  VEPGKFFRESMLRKGSVMAMPDIRD-KMPKRSFLPRSILSKLPFSSSKLGVMKQIFHAGD  461

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGM-  695
            +  + +  M +++  C      GE   C+ ++EDMI F+   LG +++   T++ TKG  
Sbjct  462  NSSM-ETMMTETVRECERVPSAGETKRCVGSVEDMIDFATSVLG-RNVVVRTTENTKGSK  519

Query  696  GNQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNK  866
            GN  +MIG VK     K+   ++CH+  FP+  YYC+ +P  R+Y+VD+ +P    T+N 
Sbjct  520  GN--IMIGKVKGMNGGKVTESVSCHQSLFPYLLYYCHSVPKVRVYEVDLLDPASKATINH  577

Query  867  FLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             + ICH+DTS W+P H AF  L  +PG+ EVCHWI + D+ W
Sbjct  578  GVAICHLDTSAWSPAHGAFIALGSAPGRVEVCHWIFENDMTW  619



>ref|XP_010242994.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nelumbo nucifera]
Length=641

 Score =   161 bits (408),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 126/221 (57%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK+G  + MP   D ++P RSFLP  I   +P ++S   EL++IF    
Sbjct  418  VEPGKFFREAMLKEGTVMPMPDIRD-KMPPRSFLPRSITSKLPFSSSRISELKQIFHATE  476

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + +  +  +L  C     +GE   C+ ++EDMI F+   LG  ++   T++  +G  
Sbjct  477  NSTM-EXILRNTLEECERAPSRGETKKCVGSIEDMIDFAVSVLG-HNVVVRTTESVEG-S  533

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q VMIG VK     KI   ++CH+  FPF  YYC+ +P  R+Y+ D+  PK    +N  
Sbjct  534  KQNVMIGAVKGINGGKITKSVSCHQSLFPFLVYYCHAVPKVRVYEADILEPKSKAKINHG  593

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L  SPGK EVCHWI + D+ W
Sbjct  594  VAICHVDTSAWSPGHGAFVALGSSPGKIEVCHWIFENDMTW  634



>ref|XP_004173618.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like, 
partial [Cucumis sativus]
Length=612

 Score =   161 bits (407),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 131/222 (59%), Gaps = 12/222 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASEL---QRIFPTAF  518
            V+P  FFR  +L+KG  + MP   D ++P RSFLP  I   +P ++S+L   ++IF    
Sbjct  392  VEPGKFFRESMLRKGSVMAMPDIRD-KMPKRSFLPRSILSKLPFSSSKLGVMKQIFHAGD  450

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGM-  695
            +  + +  M +++  C      GE   C+ ++EDMI F+   LG +++   T++ TKG  
Sbjct  451  NSSM-ETMMTETVRECERLPSAGETKRCVGSVEDMIDFATSVLG-RNVVVQTTENTKGSK  508

Query  696  GNQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNK  866
            GN  +MIG VK     K+   ++CH+  FP+  YYC+ +P  R+Y+VD+ +P    T+N 
Sbjct  509  GN--IMIGKVKGMNGGKVTESVSCHQSLFPYLLYYCHSVPKVRVYEVDLLDPATKATVNH  566

Query  867  FLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             + ICH+DTS W+P H AF  L  +PG+ EVCHWI + D+ W
Sbjct  567  GVAICHLDTSAWSPAHGAFIALGSAPGRVEVCHWIFENDMTW  608



>ref|XP_006365231.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase non-catalytic 
subunit AroGP3-like [Solanum tuberosum]
Length=628

 Score =   161 bits (407),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 125/226 (55%), Gaps = 12/226 (5%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
             V+P  FFR  +LK G  + MP  +  ++P RSFLP  IA  +P + S   EL++IF  A 
Sbjct  408   VEPGKFFREKMLKSGTIMPMPD-IKDKMPKRSFLPRVIASKLPFSTSKIDELKKIFHAAN  466

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKG-M  695
                + K   D +L  C      GE   C  + EDMI F+   LGG ++   T++ TKG  
Sbjct  467   DSQVAKMIGD-ALSECERAPSAGETKRCANSAEDMIDFATSVLGG-NVVVRTTENTKGSK  524

Query  696   GNQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNK  866
             GN  +MIG VK     K+   ++CH+  FP+  YYC+ +P  R+Y+ D+ +P     +N 
Sbjct  525   GN--IMIGAVKGINGGKVTKSVSCHQTLFPYLLYYCHSVPKVRVYEADILDPNSKAKINH  582

Query  867   FLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
              + ICH+DTS W PKH AF  L   PGK EVCHWI + D+ W   D
Sbjct  583   GVAICHVDTSLWGPKHGAFIALGSGPGKIEVCHWIFENDMTWATAD  628



>ref|XP_008776735.1| PREDICTED: BURP domain-containing protein 12-like [Phoenix dactylifera]
Length=641

 Score =   161 bits (407),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/218 (38%), Positives = 119/218 (55%), Gaps = 7/218 (3%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIP  527
            V+P  FFR   LKKG  + MP   D ++P RSFLP  IA  IP +A+E+Q++F       
Sbjct  424  VEPGKFFRESELKKGTVMPMPDIRD-KMPARSFLPRSIAGRIPFSAAEVQQVFNIPADTA  482

Query  528  LTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQV  707
            L KA  D ++  C  P  +GE   C  + ED+I F+   LG   +   T       GN  
Sbjct  483  LGKAVED-TVAECERPPSRGETKRCATSAEDVIDFAVSVLGNNVVVRSTESTDGSKGN--  539

Query  708  VMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVI  878
            +++G+ +     KI   ++CH+  FP+  YYC+ +P  R+YD ++ + +    +N  + I
Sbjct  540  ILVGDTRGVNGGKITKSVSCHQSLFPYLVYYCHSVPKVRVYDAEILSVQTKKKINHGVAI  599

Query  879  CHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            CH+DTS W+  H AF  L   PGK EVCHWI Q D+ W
Sbjct  600  CHLDTSDWSAGHGAFVALGSGPGKIEVCHWIFQGDMTW  637



>ref|XP_010925453.1| PREDICTED: BURP domain-containing protein 12-like [Elaeis guineensis]
Length=636

 Score =   161 bits (407),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 119/219 (54%), Gaps = 7/219 (3%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIP  527
            V+P  FFR   LKKG  + MP   D ++P RSFLP  I+  IP +A+E+QR+F       
Sbjct  419  VEPGKFFRESQLKKGTVMPMPDIRD-KMPARSFLPRSISGRIPFSAAEVQRVFNIPADTA  477

Query  528  LTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQV  707
            L KA  D ++  C  P  +GE   C  + ED+I F+   LG   +   T   +   GN  
Sbjct  478  LGKAVAD-TVAECERPPSRGETKRCATSAEDVIDFAVSVLGNNVIVRSTESTSGSKGN--  534

Query  708  VMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVI  878
            +++G+V      KI   ++CH+  FP+  YYC+ +P  R+Y  ++ + +    +N  + I
Sbjct  535  ILLGDVTGVNGGKITKSVSCHQSLFPYLVYYCHSVPKVRVYQAEILSVQTKKKINHGVAI  594

Query  879  CHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
            CH+DTS W+  H AF  L   PGK EVCHWI Q D+ W 
Sbjct  595  CHLDTSDWSAGHGAFVALGYGPGKIEVCHWIFQGDMTWT  633



>ref|XP_004142981.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cucumis sativus]
 gb|KGN62285.1| hypothetical protein Csa_2G348230 [Cucumis sativus]
Length=623

 Score =   160 bits (406),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 131/222 (59%), Gaps = 12/222 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASEL---QRIFPTAF  518
            V+P  FFR  +L+KG  + MP   D ++P RSFLP  I   +P ++S+L   ++IF    
Sbjct  403  VEPGKFFRESMLRKGSVMAMPDIRD-KMPKRSFLPRSILSKLPFSSSKLGVMKQIFHAGD  461

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGM-  695
            +  + +  M +++  C      GE   C+ ++EDMI F+   LG +++   T++ TKG  
Sbjct  462  NSSM-ETMMTETVRECERLPSAGETKRCVGSVEDMIDFATSVLG-RNVVVQTTENTKGSK  519

Query  696  GNQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNK  866
            GN  +MIG VK     K+   ++CH+  FP+  YYC+ +P  R+Y+VD+ +P    T+N 
Sbjct  520  GN--IMIGKVKGMNGGKVTESVSCHQSLFPYLLYYCHSVPKVRVYEVDLLDPATKATVNH  577

Query  867  FLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             + ICH+DTS W+P H AF  L  +PG+ EVCHWI + D+ W
Sbjct  578  GVAICHLDTSAWSPAHGAFIALGSAPGRVEVCHWIFENDMTW  619



>ref|XP_006365230.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum tuberosum]
Length=627

 Score =   160 bits (406),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/221 (40%), Positives = 124/221 (56%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK G  + MP  +  ++P RSFLP  IA  +P + S   EL++IF  A 
Sbjct  407  VEPGKFFREKMLKSGTIMPMPD-IKDKMPKRSFLPRVIAAKLPFSTSKIGELKKIFHAAN  465

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
               + K   D +L  C      GE   C  + EDMI F+   LG +++   T++ TKG  
Sbjct  466  DFQVAKMIGD-ALSECERAPSAGETKRCANSAEDMIDFAISVLG-QNVVVRTTENTKGS-  522

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
            N  +MIG+VK     K  K ++CH+  +P   YYC+ +P  R+Y+VD+ +P     +N  
Sbjct  523  NGNIMIGSVKGINGGKVTKSVSCHQTLYPSLLYYCHSVPKVRVYEVDILDPNSKAKINHG  582

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W PKH AF  L   PGK EVCHWI + D+ W
Sbjct  583  IAICHVDTSLWGPKHGAFNALGSGPGKIEVCHWIFENDMTW  623



>ref|XP_010553600.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Tarenaya hassleriana]
Length=626

 Score =   160 bits (405),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 87/261 (33%), Positives = 140/261 (54%), Gaps = 14/261 (5%)
 Frame = +3

Query  234  KYFSSNPKF--CTTANLVCSAVVNPPPPGVKIYNFGFTGKVDPSSFFRLLVLKKGHKVTM  407
            K +  NP F   T  ++V S   N      K  N      V+P  FFR  +L++G  + M
Sbjct  369  KSYGPNPNFKEYTKNDVVFSRYTNSTSASGKTVN----KWVEPGKFFREAMLREGTLMQM  424

Query  408  PSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAFSIPLTKAAMDKSLGYCNAPA  578
            P   D ++P R+FLP  I   +P ++S   E+ RIF  A +  +++  +  ++  C  P 
Sbjct  425  PDIRD-KMPRRTFLPRAITAKLPFSSSTTREILRIFSAAENSSISRI-ISYAVAECERPP  482

Query  579  VKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGN--QVVMIGNVKPYKTNKII  752
             +GE   C+ + EDMI F+   LG +H+A  T++   G     ++  +  +   K  + +
Sbjct  483  SRGEVKRCVGSAEDMIDFATSMLG-RHVAVRTTESVAGSKGTIEIGKVNGINGGKVTRSV  541

Query  753  ACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLL  932
            +CH+  +P+  YYC+ +P  R+Y+VD+ +PK    +N  + ICH+DTS W+P H AF  L
Sbjct  542  SCHQTLYPYLLYYCHSVPRVRVYEVDLLDPKSRVKINHGVAICHVDTSAWSPGHGAFLAL  601

Query  933  KLSPGKGEVCHWITQMDLIWI  995
               PG+ EVCHWI + D+ WI
Sbjct  602  GPGPGRIEVCHWIFENDMTWI  622



>ref|XP_006365227.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum tuberosum]
Length=629

 Score =   160 bits (405),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 123/221 (56%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK G  + MP  +  ++P RSFLP  IA  +P + S   EL++IF    
Sbjct  409  VEPGKFFREKMLKSGTIMPMPD-IKDKMPKRSFLPRVIAAKLPFSTSKIAELKKIFHAGD  467

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
               + K   D +L  C      GE   C+ + EDMI F+   LG +++   T++ TKG  
Sbjct  468  DSQVEKMIGD-ALSECERAPSAGETKQCVNSAEDMIDFATSVLG-RNVVVRTTENTKGS-  524

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
            N  +MIG+VK     K  K ++CH+  +P+  YYC+ +P  R+Y+ D+ +P     +N  
Sbjct  525  NGNIMIGSVKGINGGKVTKSVSCHQTLYPYLLYYCHSVPKVRVYEADILDPNSKAKINHG  584

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W P H AF  L   PGK EVCHWI + D+ W
Sbjct  585  VAICHVDTSSWGPTHGAFVALGSGPGKIEVCHWIFENDMTW  625



>ref|XP_006484316.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630-like 
[Citrus sinensis]
Length=632

 Score =   160 bits (404),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 123/221 (56%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK G  + MP   D ++P RSFLP  I  N+P   S   +L+ IF  + 
Sbjct  409  VEPGKFFRESMLKNGTLMPMPDIRD-RMPRRSFLPLSIVSNLPFTGSKLNQLKEIFHASD  467

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +     D +L  C     KGE   C+ + EDMI F+   LG  ++A  T++  KG  
Sbjct  468  NSTMESIIKD-ALSDCERAPSKGETKRCVASAEDMIDFATSVLG-NNVALHTTENAKG-S  524

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q +MIG VK     +  K ++CH+  +P+  YYC+ +P  R+Y+ D+  PK M  +N  
Sbjct  525  KQDIMIGTVKGINGGEVTKSVSCHQSLYPYLLYYCHSVPEVRVYEADILEPKTMAKINHG  584

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+  H AF  L  SPG+ EVCHWI + DL W
Sbjct  585  VAICHLDTSAWSATHGAFLTLGSSPGRIEVCHWIFENDLTW  625



>ref|XP_010046646.1| PREDICTED: BURP domain-containing protein 16-like [Eucalyptus 
grandis]
Length=538

 Score =   159 bits (403),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 97/286 (34%), Positives = 147/286 (51%), Gaps = 29/286 (10%)
 Frame = +3

Query  210  VFTPLISQKYFSSNP-KFCTTANLVC------SAVVNPPPPGVKIY------------NF  332
            +F  L+++   S +   FC  A L+C        V    P  + IY            + 
Sbjct  78   IFAELVAKGAISDHLLSFCEEAQLLCFMNSSSDGVATTKPSTIYIYGPSPPDTIVATDDK  137

Query  333  GFTGKVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRI  503
               G V+   FFR  +LK G+ + MP   D+ LP RSFLP  I+  +P + S   EL++I
Sbjct  138  KVNGGVEKGLFFRESMLKSGNVMPMPDIRDN-LPKRSFLPRCISAELPFSTSKLAELKQI  196

Query  504  FPTAFSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDY  683
            F    +  + K  M ++LG C   A++ E   C+ ++EDMI F+   LG  H   + S  
Sbjct  197  FHAIENSAMGKI-MAQTLGECEGAALQDETKRCVASIEDMIDFATSVLG--HDVMVRSTE  253

Query  684  TKGMGNQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMG  854
            +     Q V+IG VK  + +++   +ACH   FP+  YYC+  P+ R Y+ D+ +PK   
Sbjct  254  SARGSKQEVLIGVVKRIEGSEVSKPVACHRRLFPYIVYYCHSFPNVRSYEADILDPKSKA  313

Query  855  TMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             +N  + ICHM+TS W+P H +F LL   PG+ EVCHWI + + IW
Sbjct  314  KINHGVAICHMNTSTWSPIHESFLLLGSGPGQIEVCHWIYENNPIW  359



>ref|XP_004509821.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cicer arietinum]
Length=624

 Score =   160 bits (404),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 83/225 (37%), Positives = 127/225 (56%), Gaps = 10/225 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
             V P  FFR ++LK+G  + MP   D +LP RSFLP  I   +P ++S   EL+++F  + 
Sbjct  404   VQPGKFFREMMLKQGTVMPMPDIKD-KLPKRSFLPRTILTKLPFSSSKLNELKQVFKVSD  462

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
             +  + K  +D SL  C     KGE   C+ +LEDMI F+   LG +++   +++   G G
Sbjct  463   NSSMEKMIVD-SLSECERAPSKGENKRCVGSLEDMIDFATSVLG-RNVTVRSTENVNGSG  520

Query  699   NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
               + M+G V      K  K + CH+  FP+  YYC+ +P  R+Y+ D+ +P+    +N  
Sbjct  521   KNI-MVGRVNGINGGKVTKSVWCHQSLFPYLLYYCHSVPKVRVYEADLLDPESKVKVNHG  579

Query  870   LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
             + ICH+DT+ W+P H AF  L   PG+ EVCHWI + D+ W   D
Sbjct  580   VAICHLDTTTWSPSHGAFMALGFGPGRIEVCHWIFENDMTWTTAD  624



>gb|AHC69823.1| polygalacturonase isoenzyme 1 beta subunit [Nicotiana tabacum]
Length=628

 Score =   160 bits (404),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 83/221 (38%), Positives = 124/221 (56%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK G  + MP  +  ++P RSFLP  IA  +P + S   E+++IF    
Sbjct  408  VEPGKFFREKMLKSGTIMPMPD-IKDKMPKRSFLPRVIAAKLPFSTSKIGEMKKIFHAGD  466

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
              P+ K   D +L  C      GE   C+ + EDMI F+   LG +++   T++ TKG  
Sbjct  467  DSPVAKMIGD-ALTECERAPSAGETKRCINSAEDMIDFATSVLG-RNVVVRTTENTKGS-  523

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + ++IG+VK     K+   ++CH+  FP+  YYC+ +P  R+Y+ D+ +P     +N  
Sbjct  524  KENIIIGSVKGINGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADILDPNSKAKINHG  583

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W P H AF  L   PGK EVCHWI + D+ W
Sbjct  584  VAICHVDTSSWGPSHGAFVALGSGPGKIEVCHWIFENDMTW  624



>ref|XP_004298578.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Fragaria vesca subsp. vesca]
Length=624

 Score =   160 bits (404),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 122/221 (55%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNA---SELQRIFPTAF  518
            V+P  FFR  +LKKG  +  P   D ++P RSFLP  I+  +P      SEL+RIF    
Sbjct  404  VEPGKFFRESMLKKGTVMPFPDIKD-KMPERSFLPRTISSKLPFATAKLSELKRIFHAED  462

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + K   D +L  C     KGE   C+ + EDMI F+   LG +++   T+D   G  
Sbjct  463  NSTMEKIITD-ALQECERAPSKGETKRCVASAEDMIDFATSVLG-RNVVVRTTDNVSGAK  520

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
              +V +G+VK     K+   ++CH+  FP+  YYC+ +P  R+Y+ D+ +P     +N  
Sbjct  521  GDIV-VGSVKGINGGKVTQSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPTSKAKINHG  579

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H +F  L   PG+ EVCHWI Q DL W
Sbjct  580  VAICHLDTSAWSPTHGSFAALGSGPGRIEVCHWIFQNDLTW  620



>ref|XP_007153633.1| hypothetical protein PHAVU_003G052000g [Phaseolus vulgaris]
 gb|ESW25627.1| hypothetical protein PHAVU_003G052000g [Phaseolus vulgaris]
Length=624

 Score =   159 bits (403),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 86/223 (39%), Positives = 130/223 (58%), Gaps = 12/223 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK+G  + MP   D ++P RSFLP  I   +P ++S   EL+ +F  + 
Sbjct  404  VEPGKFFRESMLKEGSVMGMPDIRD-KMPQRSFLPRSILMKLPFSSSKIEELKSVFKVSD  462

Query  519  SIPLTKAAMDKSLGYCN-APAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGM  695
            +  + K   D SLG C  AP+V GE   C+ ++EDMI F+   LG  ++   T+    G 
Sbjct  463  NSSMEKMMTD-SLGECERAPSV-GEIKRCVGSVEDMIDFATSVLG-HNVGVWTTQNVNGF  519

Query  696  GNQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNK  866
             ++ VM+G VK     K  K ++CH+  FP+  YYC+ +P  R+Y+ D+ +P+    +N 
Sbjct  520  -SKNVMVGRVKGMNGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPESKAKINH  578

Query  867  FLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
             + ICH+DT+ W+P H AF  L  SPG+ EVCHWI + D+ W 
Sbjct  579  GVAICHLDTTAWSPTHGAFVALGSSPGRIEVCHWIFENDMTWT  621



>ref|XP_009596009.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana tomentosiformis]
Length=629

 Score =   159 bits (403),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 124/221 (56%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK G  + MP   D ++P RSFLP  IA  +P + S   E+++IF    
Sbjct  409  VEPGKFFREKMLKSGTIMPMPDIKD-KMPKRSFLPRVIAAKLPFSTSKIGEMKKIFHAGD  467

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
              P+ K   D +L  C      GE   C+ + EDMI F+   LG +++   T++ TKG  
Sbjct  468  DSPVAKMIGD-ALTECERAPSAGETKRCINSAEDMIDFATSVLG-RNVVVRTTENTKGS-  524

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + ++IG+VK     K+   ++CH+  FP+  YYC+ +P  R+Y+ D+ +P     +N  
Sbjct  525  KENIIIGSVKGINGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADILDPNSKAKINHG  584

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W P H AF  L   PGK EVCHWI + D+ W
Sbjct  585  VAICHVDTSSWGPSHGAFVALGSGPGKIEVCHWIFENDMTW  625



>ref|XP_011086565.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Sesamum indicum]
Length=634

 Score =   159 bits (403),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 127/221 (57%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK    + MP   D ++P RSFLP  I   +P + S   +L+++F T  
Sbjct  414  VEPGKFFRESMLKTDTIMPMPDIRD-KMPKRSFLPRVIVSKLPFSTSKLGDLKKLFHTED  472

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +T    D +LG C      GE   C+ ++EDMI F+   LG +++A  +++ TKG  
Sbjct  473  NSSMTSMITD-ALGECERVPSPGETKRCVASIEDMIDFATSVLG-RNVAVRSTETTKGS-  529

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
            N  +M+G VK     K  K ++CH+  +P+  YYC+ +P  R+Y+ D+ +PK    +N  
Sbjct  530  NGKIMLGQVKGINGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADILDPKSKAKINHG  589

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L   PGK EVCHWI + D+ W
Sbjct  590  VAICHLDTSSWSPGHGAFIALGSGPGKIEVCHWIFENDMTW  630



>ref|XP_006438393.1| hypothetical protein CICLE_v10033917mg [Citrus clementina]
 gb|ESR51633.1| hypothetical protein CICLE_v10033917mg [Citrus clementina]
Length=618

 Score =   159 bits (402),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 124/221 (56%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK G  + MP   D ++P RSFLP  I  N+P  +S   +L+ IF  + 
Sbjct  395  VEPGKFFRESMLKNGTLMPMPDIRD-RMPRRSFLPRSIVSNLPFTSSKLNQLKEIFHASD  453

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +     D +L  C     KGE   C+ + EDMI F+   LG  ++A  T++  KG  
Sbjct  454  NSTMESIIKD-ALSDCERAPSKGETKRCVGSAEDMIDFATSVLG-NNVALHTTENAKG-S  510

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q +MIG VK     +  K ++CH+  +P+  YYC+ +P  R+Y+ D+  PK M  +N  
Sbjct  511  KQDIMIGMVKGINGGEVTKSVSCHQSLYPYLLYYCHSVPEVRVYEADILEPKTMAKINHG  570

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+  H AF  L  SPG+ EVCHWI + DL W
Sbjct  571  VAICHLDTSSWSTTHGAFLTLGSSPGRIEVCHWIFENDLTW  611



>ref|XP_010044636.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Eucalyptus grandis]
Length=621

 Score =   159 bits (401),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 128/221 (58%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK G  + MP   D ++P RSFLP  IA  +P +++   EL++IF    
Sbjct  401  VEPGKFFRESMLKMGTVMPMPDIRD-KMPRRSFLPRSIASKLPFSSTKVDELKQIFHAGQ  459

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + K   D +L  C     +GE   C+ ++EDMI F+   LG +++A  +++  +G  
Sbjct  460  NSTMEKIMAD-ALAECERAPSRGESKQCVSSIEDMIDFATSILG-RNMAVRSTESIEGS-  516

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
            N+ ++IG VK     +  K ++CH+  FP+  YYC+ +P  R+Y+ D+ +PK    +N  
Sbjct  517  NRKILIGQVKGINGGEVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKLRTKINHG  576

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+  H AF  L  SPG  EVCHWI + D+ W
Sbjct  577  VAICHLDTSAWSASHGAFLTLGSSPGHIEVCHWIFENDMTW  617



>gb|KCW86731.1| hypothetical protein EUGRSUZ_B03343 [Eucalyptus grandis]
Length=610

 Score =   159 bits (401),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 128/221 (58%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK G  + MP   D ++P RSFLP  IA  +P +++   EL++IF    
Sbjct  390  VEPGKFFRESMLKMGTVMPMPDIRD-KMPRRSFLPRSIASKLPFSSTKVDELKQIFHAGQ  448

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + K   D +L  C     +GE   C+ ++EDMI F+   LG +++A  +++  +G  
Sbjct  449  NSTMEKIMAD-ALAECERAPSRGESKQCVSSIEDMIDFATSILG-RNMAVRSTESIEGS-  505

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
            N+ ++IG VK     +  K ++CH+  FP+  YYC+ +P  R+Y+ D+ +PK    +N  
Sbjct  506  NRKILIGQVKGINGGEVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKLRTKINHG  565

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+  H AF  L  SPG  EVCHWI + D+ W
Sbjct  566  VAICHLDTSAWSASHGAFLTLGSSPGHIEVCHWIFENDMTW  606



>ref|XP_007224206.1| hypothetical protein PRUPE_ppa017408mg [Prunus persica]
 gb|EMJ25405.1| hypothetical protein PRUPE_ppa017408mg [Prunus persica]
Length=620

 Score =   159 bits (401),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 125/222 (56%), Gaps = 10/222 (5%)
 Frame = +3

Query  345  KVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTA  515
            +V+P  FFR  +LKKG  + MP ++  ++P RSFLP  I+  +P   S   EL+RIF   
Sbjct  398  RVEPGKFFRESMLKKGIVMPMP-NIQDKMPKRSFLPQFISSKLPFATSKIYELKRIFQAP  456

Query  516  FSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGM  695
             +  + K  +D +L  C      GE   C+ + EDMI F+   LG  ++   T+D   G 
Sbjct  457  DNSTMEKIMLD-ALEECERAPSAGETKRCVASAEDMIDFATSVLG-TNVVVRTTDNVNGS  514

Query  696  GNQVVMIGNVKPYK---TNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNK  866
             ++V +IG+VK        K ++CH+  FP+  YYC+ +P  R+Y+ D+ +P     +N 
Sbjct  515  SHEV-LIGSVKGINGGNVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPISKAKINH  573

Query  867  FLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             + ICH+DTS W+P H AF  L   PG+ EVCHWI Q D+ W
Sbjct  574  GVAICHLDTSAWSPTHGAFVALGSGPGRIEVCHWIFQNDMTW  615



>ref|XP_007141610.1| hypothetical protein PHAVU_008G210500g [Phaseolus vulgaris]
 gb|ESW13604.1| hypothetical protein PHAVU_008G210500g [Phaseolus vulgaris]
Length=611

 Score =   159 bits (401),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/218 (36%), Positives = 117/218 (54%), Gaps = 7/218 (3%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIP  527
            V+   FFR  +LK+G  + MP   D ++P RSFLP  I   +P   S + R+F       
Sbjct  394  VEEGKFFREFMLKEGTVMAMPDIRD-KMPERSFLPRVILSKLPFTVSGVNRVFEVGAGSS  452

Query  528  LTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQV  707
            L K   D S+  C     +GE   C+ ++EDM+ F+   LG   +   T +     GN  
Sbjct  453  LDKIVKD-SVSECERVPSQGESKRCVGSMEDMVDFATGVLGSNVVVRTTENVKGSKGN--  509

Query  708  VMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVI  878
            VM+G V      ++   ++CH+  FP+  YYC+ +P  R+Y+ D+ +PK    +N+ + I
Sbjct  510  VMVGWVNGINGGRVTESVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKSKAKINRGVAI  569

Query  879  CHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            CH+DTS W+P H AF  L   PG+ EVCHWI + D+ W
Sbjct  570  CHLDTSAWSPSHGAFLALGSGPGQIEVCHWIFENDMTW  607



>gb|KCW86722.1| hypothetical protein EUGRSUZ_B03333 [Eucalyptus grandis]
Length=249

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 125/222 (56%), Gaps = 10/222 (5%)
 Frame = +3

Query  342  GKVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPT  512
            G V+   FFR  +LK G+ + MP  L   LP RSFLP  I+  +P + S   EL++IF  
Sbjct  29   GGVEQGEFFRESMLKSGNVMPMPD-LRDNLPKRSFLPRRISSELPFSTSKLAELKQIFHA  87

Query  513  AFSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKG  692
              +  + K  M ++L      A++ E   C+ ++EDMI F+   LG  H   + S  +  
Sbjct  88   IENSTMEKI-MAQTLSQWEGAALQDEIKRCVASIEDMIDFATSVLG--HDVLVRSTGSAR  144

Query  693  MGNQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMN  863
               Q V+IG VK  + +++   +ACH+  FP+  YYC+   + R+Y+ D+ +PK    +N
Sbjct  145  GSKQEVLIGVVKRIEGSEVSKPVACHQSLFPYVVYYCHTFSNVRVYEADILDPKSKAKIN  204

Query  864  KFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLI  989
              + ICHMDTS W+P H +F LL   PG+ EVCHWI + +++
Sbjct  205  HGVAICHMDTSTWSPTHESFLLLGSGPGQIEVCHWIYENEIL  246



>ref|XP_003517743.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=629

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 125/220 (57%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK+G  + MP   D +LP RSFLP  I   +P + S   EL+++F  + 
Sbjct  409  VEPGKFFREKMLKEGTVMPMPDIKD-KLPERSFLPRSILSKLPFSVSKIDELKQVFKASD  467

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + K   D SL  C     +GE   C+ +LEDMI F+   LG +++A  T+    G  
Sbjct  468  NGSMEKMMRD-SLAECERAPSRGETKRCVGSLEDMIDFATSVLG-RNVAVRTTQNVNGSK  525

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
              VV+  +  +   K  + ++CH+  FP+  YYC+ +P  R+Y+ D+ +PK    +N+ +
Sbjct  526  KSVVVGPVRGINGGKVTQSVSCHQSLFPYLLYYCHAVPKVRVYEADLLDPKTKVKINRGV  585

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W
Sbjct  586  AICHLDTSDWSPTHGAFISLGSGPGRIEVCHWIFENDVAW  625



>ref|NP_001234835.1| polygalacturonase-1 non-catalytic subunit beta precursor [Solanum 
lycopersicum]
 sp|Q40161.1|GP1_SOLLC RecName: Full=Polygalacturonase-1 non-catalytic subunit beta; 
AltName: Full=AroGP1; AltName: Full=Polygalacturonase converter; 
Short=PG converter; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34181.1| polygalacturonase isoenzyme 1 beta subunit [Solanum lycopersicum]
 gb|AAB39547.1| polygalacturonase isoenzyme 1 beta subunit [Solanum lycopersicum]
Length=630

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 123/221 (56%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK G  + MP  +  ++P RSFLP  IA  +P + S   EL++IF    
Sbjct  410  VEPGKFFREKMLKSGTIMPMPD-IKDKMPKRSFLPRVIASKLPFSTSKIAELKKIFHAGD  468

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
               + K   D +L  C      GE   C+ + EDMI F+   LG +++   T++ TKG  
Sbjct  469  ESQVEKMIGD-ALSECERAPSAGETKRCVNSAEDMIDFATSVLG-RNVVVRTTEDTKGS-  525

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
            N  +MIG+VK     K+   ++CH+  +P+  YYC+ +P  R+Y+ D+ +P     +N  
Sbjct  526  NGNIMIGSVKGINGGKVTKSVSCHQTLYPYLLYYCHSVPKVRVYEADILDPNSKVKINHG  585

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W P H AF  L   PGK EVCHWI + D+ W
Sbjct  586  VAICHVDTSSWGPSHGAFVALGSGPGKIEVCHWIFENDMTW  626



>gb|KDO82433.1| hypothetical protein CISIN_1g036311mg [Citrus sinensis]
Length=632

 Score =   158 bits (399),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/225 (36%), Positives = 127/225 (56%), Gaps = 10/225 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
             V+P  FFR  VLKKG  + MP  +  ++P RSFLP  I   +P ++S   +++ IF    
Sbjct  412   VEPGKFFRESVLKKGSVMAMPD-IQDKMPKRSFLPRTIVSKLPFSSSKIKDMKEIFHAVD  470

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
             +  + ++ + ++LG C      GE   C+ ++EDMI F+   LG +++   T++   G  
Sbjct  471   NSSM-ESIIKEALGDCERAPSAGETKRCVGSVEDMIDFATSILG-RNVVVRTTENVNGS-  527

Query  699   NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
              + +MIG+VK     K  K ++CH+  FP+  YYC+ +P  R+Y+ DV +      +N  
Sbjct  528   KKKIMIGSVKGINGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADVLDANTKAKINHG  587

Query  870   LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
             + ICH+DTS W+P H AF  L   PGK EVCHWI + D+ W   D
Sbjct  588   VAICHLDTSAWSPTHGAFLALGSGPGKIEVCHWIFENDMTWTTAD  632



>emb|CBI15046.3| unnamed protein product [Vitis vinifera]
Length=602

 Score =   158 bits (399),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/224 (37%), Positives = 126/224 (56%), Gaps = 8/224 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPT--AFS  521
             V+P  FFR  +LK+G+ + MP   D ++P RSFLP  IA  +P ++S LQ +     A  
Sbjct  382   VEPGKFFRESMLKEGNVMVMPDIRD-RMPERSFLPRVIASKLPFSSSRLQELKDIFHARD  440

Query  522   IPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGN  701
                 +  +  +L  C     +GE   C+ ++EDMI F+   LG   +   T++ T+G   
Sbjct  441   NSTMEHVIANALEECERAPSRGETKRCVGSVEDMIDFAVSVLG-HDVVVRTTETTRG-SK  498

Query  702   QVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             Q VM+G V+     K+   ++CH+  +P+  YYC+ +P  R+Y+VD+ + ++   MNK +
Sbjct  499   QRVMVGEVRGINGGKVTRSVSCHQSLYPYLLYYCHSVPKVRVYEVDILDVERKEKMNKGV  558

Query  873   VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
              ICH+DTS W+  H AF  L  SPG  EVCHWI + D+ W   D
Sbjct  559   AICHIDTSAWSQSHGAFVALGSSPGLIEVCHWIFENDMTWTTSD  602



>ref|XP_010044635.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Eucalyptus grandis]
Length=358

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 92/280 (33%), Positives = 139/280 (50%), Gaps = 19/280 (7%)
 Frame = +3

Query  204  TEVFTPLISQKYFSSN-PKFCTTANLVCSAVVNPPPPGVKIYNFGFT--------GKVDP  356
            T +F  L+++   S     FC  A L+C       P G  + N   T          V+P
Sbjct  81   TTLFAQLVAKGAISDRLSSFCRAAQLLCFPASPHYPVGYTVENSATTPAGGMNLNRGVEP  140

Query  357  SSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAFSIP  527
              +FR  +L+ G+ + MP  L  + P RSFLP  I+  +  + S   EL++IF       
Sbjct  141  GKYFRESMLRSGNMIRMPD-LRVKAPKRSFLPRSISSGLLFSTSKLAELKQIFHAGDDSN  199

Query  528  LTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQV  707
            + K  M ++L  C    ++GE   C+ ++E MI F+   LG  H   L S  +     + 
Sbjct  200  MEKI-MVRTLNQCEQAPIQGETKRCVSSVEGMIDFATSILG--HDIQLHSTESVEGSKRE  256

Query  708  VMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVI  878
            ++IG VK     K++  +ACHE  FP+  YYC+  P+ RIY+ D+ +P     +N  + +
Sbjct  257  ILIGRVKRLDGSKSSAPVACHETIFPYMVYYCHTFPTLRIYEADILDPVSKAKINHGIAL  316

Query  879  CHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIG  998
            CHMDTS W+P H AF  L  SPG+ E CHW+     +W G
Sbjct  317  CHMDTSIWSPNHEAFLALGSSPGRIEACHWVFGDYGVWTG  356



>ref|XP_002279813.2| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Vitis vinifera]
Length=633

 Score =   158 bits (399),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/224 (37%), Positives = 126/224 (56%), Gaps = 8/224 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPT--AFS  521
             V+P  FFR  +LK+G+ + MP   D ++P RSFLP  IA  +P ++S LQ +     A  
Sbjct  413   VEPGKFFRESMLKEGNVMVMPDIRD-RMPERSFLPRVIASKLPFSSSRLQELKDIFHARD  471

Query  522   IPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGN  701
                 +  +  +L  C     +GE   C+ ++EDMI F+   LG   +   T++ T+G   
Sbjct  472   NSTMEHVIANALEECERAPSRGETKRCVGSVEDMIDFAVSVLG-HDVVVRTTETTRG-SK  529

Query  702   QVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             Q VM+G V+     K+   ++CH+  +P+  YYC+ +P  R+Y+VD+ + ++   MNK +
Sbjct  530   QRVMVGEVRGINGGKVTRSVSCHQSLYPYLLYYCHSVPKVRVYEVDILDVERKEKMNKGV  589

Query  873   VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
              ICH+DTS W+  H AF  L  SPG  EVCHWI + D+ W   D
Sbjct  590   AICHIDTSAWSQSHGAFVALGSSPGLIEVCHWIFENDMTWTTSD  633



>ref|XP_008221868.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Prunus mume]
Length=619

 Score =   157 bits (398),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 124/222 (56%), Gaps = 10/222 (5%)
 Frame = +3

Query  345  KVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTA  515
            +V+P  FFR  +LKKG  + MP ++  ++P RSFLP  I+  +P   S   EL+RIF   
Sbjct  398  RVEPGKFFRESMLKKGIVMPMP-NIQDKMPKRSFLPRFISSKLPFATSKIYELKRIFQAP  456

Query  516  FSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGM  695
             +  + K  +D +L  C      GE   C+ + EDMI F+   LG  ++   T+D   G 
Sbjct  457  DNSTMEKIMVD-ALEECERAPSAGETKRCVASAEDMIDFATSVLG-TNVVVRTTDNVNGS  514

Query  696  GNQVVMIGNVKPYK---TNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNK  866
             + V +IG+VK        K ++CH+  FP+  YYC+ +P  R+Y+ D+ +P     +N 
Sbjct  515  SDDV-LIGSVKGINGGNVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADLLDPISKAKINH  573

Query  867  FLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             + ICH+DTS W+P H AF  L   PG+ EVCHWI Q D+ W
Sbjct  574  GVAICHLDTSAWSPTHGAFVALGSGPGRIEVCHWIFQNDMTW  615



>dbj|BAK05386.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=625

 Score =   157 bits (398),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/220 (36%), Positives = 119/220 (54%), Gaps = 6/220 (3%)
 Frame = +3

Query  351   DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPL  530
             +P  FFR   L  G+++ MP   D ++P R+FLP +IAR IP  AS +   F       +
Sbjct  410   EPGKFFRERELVTGNRMPMPDIRD-KMPPRAFLPRDIARKIPFEASAVSEAFGAPPDTAM  468

Query  531   TKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVV  710
              KA +  ++  C     +GE   C  + ED++ F+ E LG   +   ++  T G G   V
Sbjct  469   GKAVV-STVAECERAPSRGETKRCATSAEDVVDFAVEMLG-DDIVVRSTASTAGSG-AGV  525

Query  711   MIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMG--TMNKFLVICH  884
              +G+V   K  + ++CH+  FP+  YYC+ +P  R+Y+ D+      G   +N+ + ICH
Sbjct  526   RLGDVTGGKAARAVSCHQSLFPYLVYYCHSVPKARVYEADIMAADAGGGRKINRGVAICH  585

Query  885   MDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
             +DTS W+P H AF LL   PGK EVCHWI + D+ W   D
Sbjct  586   LDTSDWSPSHGAFVLLGGEPGKTEVCHWIFEGDMTWTAAD  625



>ref|XP_006365228.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Solanum tuberosum]
Length=632

 Score =   157 bits (398),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/225 (38%), Positives = 122/225 (54%), Gaps = 10/225 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
             V+P  FFR  +LK G  + MP  +  ++P RSFLP  IA  +P + S   EL +IF  A 
Sbjct  412   VEPGKFFREKMLKSGTIMPMPD-IKDKMPKRSFLPRTIAAKLPFSYSKIDELNKIFHAAN  470

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
                + K  +  +L  C      GE   C+ + EDMI F+   LG +++   T++ TKG  
Sbjct  471   DSQVAKM-IGNALSECERAPSAGEMKQCVNSAEDMIDFTTSVLG-RNVVVRTTENTKGS-  527

Query  699   NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             N  +MIG+VK     K  K ++CH+  +P   YYC+ +P  R+Y  D+ +P     +N  
Sbjct  528   NGNIMIGSVKGINGGKVTKSVSCHQTLYPSLLYYCHSVPKVRVYQADILDPNSKAKINHG  587

Query  870   LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
             + ICH+DTS W P H AF  L   PGK EVCHWI + D+ W   D
Sbjct  588   VAICHVDTSSWGPSHGAFIALGSGPGKIEVCHWIFENDMTWTTAD  632



>gb|KEH20007.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=627

 Score =   157 bits (398),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 124/225 (55%), Gaps = 10/225 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
             V P  FFR  +LK+G  + MP  +  +LP RSFLP  I   +P  +S   EL+++F  + 
Sbjct  407   VQPGKFFREKMLKQGVVMPMPD-IKDKLPPRSFLPRTILTKLPFASSKLNELKQVFKVSE  465

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
             +  + K  +D SLG C      GE   C+ +LEDMI F+   LG  H   + S  +    
Sbjct  466   NSSMDKMIVD-SLGECERAPSMGETKRCVGSLEDMIDFATSVLG--HDVTVRSTESVNGS  522

Query  699   NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
              + VM+G VK     K+   ++CH+  FP+  YYC+ +P  R+Y+ D+ +P+    +N  
Sbjct  523   GKNVMVGRVKGINGGKVTESVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPESKVKINHG  582

Query  870   LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
             + ICH+DT+ W+P H AF  L   PGK EVCHWI + D+ W   D
Sbjct  583   VAICHLDTTAWSPTHGAFMALGSGPGKIEVCHWIFENDMTWTTTD  627



>ref|XP_010046641.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
Length=364

 Score =   154 bits (389),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 90/284 (32%), Positives = 141/284 (50%), Gaps = 25/284 (9%)
 Frame = +3

Query  204  TEVFTPLISQKYFSSNP-KFCTTANLVCSAVVNPPPPGVK---IYNF-----------GF  338
            T +F  L+++   S +P  FC  A L+C   ++    G      Y+F             
Sbjct  81   TALFAQLVAKDALSDHPLSFCKAAQLLCFPDLSSHQVGKDGRVFYDFINGATTLVGGMNV  140

Query  339  TGKVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFP  509
               V+P  +F+   L+ G+ + MP  L S+ P RSFLP  I+  +P + S   EL++IF 
Sbjct  141  NKGVEPGKYFQESTLRSGNVIHMPD-LRSKTPERSFLPRSISSGLPFSTSKLAELKQIFH  199

Query  510  TAFSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTK  689
                  + K  M ++L  C    ++GE   C+ ++EDMI F+   LG  H   L S  + 
Sbjct  200  AGDDSTMEKI-MVRTLSLCEKAPIRGETKRCVSSVEDMIDFATSILG--HDIKLHSPKSD  256

Query  690  GMGNQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTM  860
                + ++IG VK    +K+   +ACH+  FP+  Y C+ +P+  +Y+VD+ +P     +
Sbjct  257  EGSKRDILIGRVKRIGGSKLSAPVACHDSLFPYMVYNCHAVPTLHVYEVDILDPVSKAKI  316

Query  861  NKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            N  + +CHMDTS W P H AF  L   PG+ E CHWI     +W
Sbjct  317  NNGVAVCHMDTSAWNPNHEAFLALGSGPGRIEACHWIYGDYAVW  360



>ref|XP_004509826.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cicer arietinum]
Length=636

 Score =   157 bits (397),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 125/225 (56%), Gaps = 10/225 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
             V P +FFR  +LK+G  + MP  +D +LP RSFLP  I   +P  +S   E++ +F  A 
Sbjct  416   VQPGNFFREGMLKEGTVMPMPDIVD-KLPKRSFLPRSILTKLPFASSKLNEMKHVFRVAE  474

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
                + K  +D +L  C     +GE   C+ ++EDMI F+   LG ++L   + +   G G
Sbjct  475   KSSIEKMIVD-ALSECERSPSQGETKRCVGSIEDMIDFATFVLG-RNLTVRSIENVNGSG  532

Query  699   NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
               V M+G VK     K+   ++CH+  FP+  YYC+ +P  R+Y+ D+  PK    +N  
Sbjct  533   KNV-MVGRVKGINGGKVTQSVSCHQSLFPYLLYYCHSVPDVRVYEADLLEPKSKVKINHG  591

Query  870   LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
             +VICH+DTS W+  H AF  L   PG+ EVCHWI + D+ W   D
Sbjct  592   VVICHLDTSAWSSTHDAFVALGFGPGQIEVCHWIFENDMTWTTVD  636



>ref|XP_002311777.2| hypothetical protein POPTR_0008s19430g [Populus trichocarpa]
 gb|EEE89144.2| hypothetical protein POPTR_0008s19430g [Populus trichocarpa]
Length=633

 Score =   157 bits (397),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 125/221 (57%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            ++P  FFR  +LKKG  + MP   D ++P RSFLP  I   +P + S   +L+ IF  + 
Sbjct  412  IEPGKFFRESMLKKGSVMPMPDIRD-KMPKRSFLPRSIISKLPFSTSKIDQLKEIFHASD  470

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + +  +D +L  C      GE   C  + EDMI F+   LG +++A  T+D   G  
Sbjct  471  NSSMERIILD-ALEECERSPSPGETKRCAGSAEDMIDFATSVLG-RNVAVRTTDNVNGS-  527

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + +MIG++K     ++   ++CH+  +P+  YYC+ +P  R+Y+ D+ +P    T+N  
Sbjct  528  KKNIMIGSIKGINGGRVTRSVSCHQTLYPYLLYYCHSVPKVRVYEADLLDPNSKATINHG  587

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W
Sbjct  588  VAICHLDTSSWSPTHGAFLALGSGPGRIEVCHWIFENDMTW  628



>gb|KDP26581.1| hypothetical protein JCGZ_17739 [Jatropha curcas]
Length=629

 Score =   157 bits (397),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 81/220 (37%), Positives = 126/220 (57%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIP  527
            V+P  FFR   LKKG+ + MP   D ++P RSFLP  I   +P + S++ ++  T  +I 
Sbjct  409  VEPGKFFRESELKKGNVMPMPDIRD-KMPKRSFLPRSIISKLPFSTSKISQLKETFHAID  467

Query  528  LT--KAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGN  701
             +  ++ +  +L  C      GE   C+ + EDMI F+   LG +++AA T++   G   
Sbjct  468  NSTMESIILDALSECERAPSPGETKRCVGSAEDMIDFATSVLG-RNVAARTTENVNGS-K  525

Query  702  QVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
            Q +MIG++K     K  K ++CH+  +P+  YYC+ +P  R+Y+ D+ +P     +N  +
Sbjct  526  QKIMIGSIKGINGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADLLDPNSKAKINHGV  585

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICH+DTS W+P H AF  L   PG+ EVCHWI + DL W
Sbjct  586  AICHLDTSSWSPTHGAFLALGSGPGRIEVCHWIFENDLTW  625



>ref|XP_003613234.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES96192.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=630

 Score =   157 bits (396),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/225 (37%), Positives = 126/225 (56%), Gaps = 10/225 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
             V+P  FFR  +LK+G  + MP   D +LP RSFLP  I   +P + S   E++ +F  + 
Sbjct  410   VEPGKFFREKMLKEGTVMPMPDIRD-KLPKRSFLPRSILAKLPFSTSKIDEMKGLFKASD  468

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
             +  + K   D SLG C     KGE   C+ ++EDMI F+   LG +++   T++   G  
Sbjct  469   NGSMEKMMRD-SLGDCERVPAKGETKRCVGSIEDMIDFATSVLG-RNVVVRTTENVNG-S  525

Query  699   NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
              + VM+G V      K+   ++CH+  FP+  YYC+ +P  R+Y  ++ +PK    +N+ 
Sbjct  526   KKDVMVGRVNGINGGKVTRSVSCHQSLFPYLLYYCHSVPKVRVYQAELLDPKSKDKINQG  585

Query  870   LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
             + +CH+DTS W+P H AF  L   PG+ EVCHWI + DL W   D
Sbjct  586   VAVCHLDTSDWSPTHGAFMSLGSGPGRIEVCHWIFENDLSWTVAD  630



>gb|KEH20005.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=374

 Score =   154 bits (388),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 126/221 (57%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASEL---QRIFPTAF  518
            V+P  FFR  +LK+G  + MP   D +LP RSFLP  I   +P  +S+L   +++F  + 
Sbjct  154  VEPGKFFRERMLKEGTVMPMPDTRD-KLPPRSFLPRSILIKLPFASSKLNNMKQVFKVSE  212

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + K  +D SL  C     KGE   C+ +LEDMI F+   LG  ++   +++   G  
Sbjct  213  NSFMEKMIVD-SLSECERAPSKGEIKRCVGSLEDMIDFATSILGS-NVTVRSTENVNGSN  270

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
            N V M+G VK      +   ++CH+  FP+  YYC+ +P+ RIY+ ++ +PK    +N  
Sbjct  271  NNV-MVGQVKEINGGNVMESVSCHQSLFPYLLYYCHSVPNIRIYEANLLDPKSKVKINHG  329

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DT+ W+P H AF  L   PG+ EVCHWI + D+ W
Sbjct  330  VAICHLDTTAWSPTHGAFMTLGFGPGQIEVCHWIFENDMTW  370



>ref|XP_006438394.1| hypothetical protein CICLE_v10030947mg [Citrus clementina]
 ref|XP_006483846.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Citrus sinensis]
 gb|ESR51634.1| hypothetical protein CICLE_v10030947mg [Citrus clementina]
Length=632

 Score =   157 bits (396),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 127/225 (56%), Gaps = 10/225 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
             V+P  FFR  VLKKG  + MP  +  ++P RSFLP  I   +P ++S   +++ IF    
Sbjct  412   VEPGKFFRESVLKKGSVMAMPD-IQDKMPKRSFLPRTIVSKLPFSSSKIKDMKEIFHAVD  470

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
             +  + ++ + ++LG C      GE   C+ ++EDMI F+   LG +++   T++   G  
Sbjct  471   NSSM-ESIIKEALGDCERAPSAGETKRCVGSVEDMIDFATSILG-RNVVVRTTENVNGSK  528

Query  699   NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
              ++V IG+VK     K  K ++CH+  FP+  YYC+ +P  R+Y+ D+ +      +N  
Sbjct  529   KKIV-IGSVKGINGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADILDANTKAKINHG  587

Query  870   LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
             + ICH+DTS W+P H AF  L   PGK EVCHWI + D+ W   D
Sbjct  588   VAICHLDTSAWSPTHGAFLALGSGPGKIEVCHWIFENDMTWTTAD  632



>ref|XP_004238668.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2 [Solanum 
lycopersicum]
 sp|P93217.1|GP2_SOLLC RecName: Full=Polygalacturonase non-catalytic subunit AroGP2; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAB39556.1| AROGP2 [Solanum lycopersicum]
Length=629

 Score =   156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/226 (38%), Positives = 125/226 (55%), Gaps = 12/226 (5%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
             ++P  FFR  +LK G  + MP  +  ++P RSFLP  IA  +P + S   EL++IF  A 
Sbjct  409   IEPGKFFREKMLKSGTIMPMPD-IKDKMPKRSFLPRAIAAKLPFSTSKIDELKKIFHAAN  467

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKG-M  695
                + K   D +L  C      GE   C+ + EDMI F+   LG +++   T++ T G  
Sbjct  468   DSQVAKMIGD-ALSECERAPSPGETKQCVNSAEDMIDFATSVLG-RNVVVRTTENTNGSK  525

Query  696   GNQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNK  866
             GN  +MIG++K     K  K ++CH+  +P   YYC+ +P  R+Y+ D+ +P     +N 
Sbjct  526   GN--IMIGSIKGINGGKVTKSVSCHQTLYPSLLYYCHSVPKVRVYEADILDPNSKAKINH  583

Query  867   FLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
              + ICH+DTS W P+H AF  L   PGK EVCHWI + D+ W   D
Sbjct  584   GVAICHVDTSSWGPRHGAFIALGSGPGKIEVCHWIFENDMTWATAD  629



>ref|XP_007138090.1| hypothetical protein PHAVU_009G179500g [Phaseolus vulgaris]
 gb|ESW10084.1| hypothetical protein PHAVU_009G179500g [Phaseolus vulgaris]
Length=627

 Score =   156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 126/222 (57%), Gaps = 10/222 (5%)
 Frame = +3

Query  345  KVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTA  515
            +V+P  FFR  ++K+G+ + MP   D ++P RSFLP  IA  +P ++S   E++ +F  A
Sbjct  408  RVEPGKFFRESIMKEGNVIVMPDIRD-KMPARSFLPLAIASKLPFSSSRIDEMRELFE-A  465

Query  516  FSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGM  695
                 T+  +  +L  C     +GE   C+ + E+MI+F+   LG   +   +++   G 
Sbjct  466  REGSGTERVIVNALRECERAPSRGETKRCVASAEEMIEFAASVLG-PSVVVRSTENVNGS  524

Query  696  GNQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNK  866
            G+ V MIG V P    K  K ++CH+  +P+  YYC+ +P  R+Y+ D+ N +    MN 
Sbjct  525  GSSV-MIGKVYPVDGGKVTKSVSCHQSLYPYLLYYCHSVPQVRVYEADILNVETKENMNH  583

Query  867  FLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             + ICH+DTS W P+H AF  L   PGK EVCHWI + D+ W
Sbjct  584  GVAICHLDTSSWGPEHGAFLALGSGPGKIEVCHWIFENDMTW  625



>ref|XP_004238667.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP3 [Solanum 
lycopersicum]
 sp|P93218.1|GP3_SOLLC RecName: Full=Polygalacturonase non-catalytic subunit AroGP3; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAB39557.1| AROGP3 [Solanum lycopersicum]
Length=632

 Score =   156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 125/226 (55%), Gaps = 12/226 (5%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
             ++P  FFR  +LK G  + MP  +  ++P RSFLP  IA  +P + S   EL++IF  A 
Sbjct  412   IEPGKFFREKMLKSGTIMPMPD-IKDKMPKRSFLPRAIAAKLPFSTSKIDELKKIFHAAN  470

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKG-M  695
                + K   D +L  C      GE   C+ + EDMI F+   LG +++   T++ T G  
Sbjct  471   DSQVAKMIGD-ALSECERAPSPGETKQCVNSAEDMIDFATSVLG-RNVVVRTTENTNGSK  528

Query  696   GNQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNK  866
             GN  +MIG++K     K+   ++CH+  +P   YYC+ +P  R+Y+ D+ +P     +N 
Sbjct  529   GN--IMIGSIKGINGGKVTKSVSCHQTLYPSLLYYCHSVPKVRVYEADILDPNSKAKINH  586

Query  867   FLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
              + ICH+DTS W P+H AF  L   PGK EVCHWI + D+ W   D
Sbjct  587   GVAICHVDTSSWGPRHGAFVALGSGPGKIEVCHWIFENDMTWATAD  632



>gb|KHG12475.1| Polygalacturonase non-catalytic subunit protein [Gossypium arboreum]
Length=649

 Score =   156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 124/221 (56%), Gaps = 14/221 (6%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  VLK+G+ + MP   D ++P RSFLP  I   +P + S   EL+ IF  + 
Sbjct  433  VEPGKFFRESVLKQGNVMVMPDIRD-KMPRRSFLPRGILSKLPFSTSHLSELRNIFGASM  491

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
                 +  ++ +L  C  PA +GE   C+ ++EDMI F+   LG   +   T++  KG  
Sbjct  492  -----EGMLENALTECERPASRGETKRCVGSVEDMIDFATSVLG-LSVTVRTTENVKG-S  544

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q +MIG VK     +  K ++CH+  +P+  YYC+ +P  R Y+ ++ +      +N  
Sbjct  545  KQEIMIGEVKGINGGEVTKSVSCHQSLYPYLLYYCHSVPKVRGYEAEILDVTSKSKINHG  604

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L  SPG+ EVCHWI + D+ W
Sbjct  605  VAICHLDTSAWSPTHGAFLALGSSPGQVEVCHWIFENDMTW  645



>gb|KHG24447.1| Polygalacturonase non-catalytic subunit protein [Gossypium arboreum]
Length=628

 Score =   156 bits (394),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/221 (38%), Positives = 125/221 (57%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK+G  + MP   D ++P RSFLP  I   +P ++S   EL+RIF    
Sbjct  407  VEPGKFFREKLLKQGTVMPMPDIKD-KMPVRSFLPRTIVSKLPFSSSKFGELKRIFHAGD  465

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  L    +D +L  C      GE   C+ + EDMI F+   LG +++   T++  KG  
Sbjct  466  NSTLETVMLD-ALKECERAPSPGETKRCVGSAEDMIDFATSVLG-RNVEVRTTENVKGS-  522

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q + IG+VK     K  K ++CH+  +P+  YYC+ +P  R+Y+ D+ +PK +  +N  
Sbjct  523  KQNIKIGSVKGINGGKVTKSVSCHQSLYPYLLYYCHSVPEVRVYEADILDPKSLEKINHG  582

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+  H AF  L   PG+ EVCHWI + D+ W
Sbjct  583  VAICHLDTSSWSSNHGAFLALGSGPGRIEVCHWIFENDMTW  623



>gb|KCW59875.1| hypothetical protein EUGRSUZ_H02608 [Eucalyptus grandis]
Length=623

 Score =   156 bits (394),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 124/221 (56%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LKKG  + MP  +  ++P RSFLP  I   +P + S   EL+RIF    
Sbjct  403  VEPGKFFRESMLKKGTVMPMPD-IGDKMPKRSFLPRTILSKLPFSTSKLPELKRIFHAGD  461

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + ++ M  +L  C      GE   C+ ++EDMI F+   LG + + A +++ T G  
Sbjct  462  NSSM-ESMMANALAECERAPSAGETKRCVGSMEDMIDFATSILG-RDVEARSTESTAGS-  518

Query  699  NQVVMIGNVKPYK---TNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q VM+G VK        K ++CH+  FP+  YYC+ +P  R+Y+ D+ +PK    +N  
Sbjct  519  KQEVMVGTVKGINGGMVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKTKVKINHG  578

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + +CH+DTS W+  H AF  L   PG+ EVCHWI + D+ W
Sbjct  579  VAVCHIDTSAWSATHGAFLALGSRPGQIEVCHWIFESDMTW  619



>ref|XP_010023570.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Eucalyptus grandis]
Length=624

 Score =   156 bits (394),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 124/221 (56%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LKKG  + MP  +  ++P RSFLP  I   +P + S   EL+RIF    
Sbjct  404  VEPGKFFRESMLKKGTVMPMPD-IGDKMPKRSFLPRTILSKLPFSTSKLPELKRIFHAGD  462

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + ++ M  +L  C      GE   C+ ++EDMI F+   LG + + A +++ T G  
Sbjct  463  NSSM-ESMMANALAECERAPSAGETKRCVGSMEDMIDFATSILG-RDVEARSTESTAGS-  519

Query  699  NQVVMIGNVKPYK---TNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q VM+G VK        K ++CH+  FP+  YYC+ +P  R+Y+ D+ +PK    +N  
Sbjct  520  KQEVMVGTVKGINGGMVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKTKVKINHG  579

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + +CH+DTS W+  H AF  L   PG+ EVCHWI + D+ W
Sbjct  580  VAVCHIDTSAWSATHGAFLALGSRPGQIEVCHWIFESDMTW  620



>ref|XP_003519820.2| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=628

 Score =   156 bits (394),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 124/220 (56%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  ++K+G  + MP   D ++P RSFLP  I   +P + S   EL+++F  + 
Sbjct  408  VEPGKFFREKMMKEGTVMPMPDIKD-KMPERSFLPRSILSKLPFSVSKIDELKQVFKASD  466

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + K  M  SL  C      GE   C+ +LEDMI F+   LG +++A  T+    G  
Sbjct  467  NGSMEKM-MKDSLEECERAPSSGETKRCVGSLEDMIDFATSVLG-RNVAVRTTQNVNGSK  524

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
              VV+  +  +   K  + ++CH+  FP+  YYC+ +P  R+Y+ D+ +PK    +N+ +
Sbjct  525  KSVVVGPVRGINGGKVTQSVSCHQSLFPYLLYYCHAVPKVRVYEADLLDPKTKAKINRGV  584

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W
Sbjct  585  AICHLDTSDWSPTHGAFLSLGSVPGRIEVCHWIFENDMAW  624



>ref|XP_009393062.1| PREDICTED: BURP domain-containing protein 12-like [Musa acuminata 
subsp. malaccensis]
Length=651

 Score =   156 bits (394),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 117/218 (54%), Gaps = 7/218 (3%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIP  527
            V+P  FFR   L++G  + MP   D ++P RSFLP  IA  IP + +E++RIF       
Sbjct  434  VEPGKFFREHDLRRGSVMPMPDIRD-KMPPRSFLPRSIAGRIPFSPAEVRRIFGIPADTA  492

Query  528  LTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQV  707
            L KA  D ++  C     +GE   C  + ED+I F+   LG   +   T+  T    N  
Sbjct  493  LGKAVGD-TVAECERAPSRGETKRCATSAEDVIDFAVSVLGSDVVVRSTA--TTAGSNAD  549

Query  708  VMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVI  878
            V+IG V      K+   ++CH+  FP+  YYC+ +P  R+Y+ D+        +N  + I
Sbjct  550  VLIGRVSGANGGKVTRSVSCHQSLFPYLVYYCHSVPKVRVYEADILAVHSKQKINHGVAI  609

Query  879  CHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            CH+DTS W+P H AF  L  +PGK EVCHWI + D+ W
Sbjct  610  CHLDTSAWSPTHGAFVALGSAPGKIEVCHWIFEGDMTW  647



>ref|XP_011071083.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Sesamum indicum]
Length=628

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/221 (38%), Positives = 122/221 (55%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK G  + MP   D ++P RSFLP  I   +P + S   EL+ IF    
Sbjct  408  VEPGKFFREEMLKSGSVMPMPDIRD-KMPKRSFLPRAIVTKLPFSTSKIDELKNIFHAEN  466

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
               +T   ++ SL  C      GE   C+ ++EDMI F+   LG +++A  T++ T+G  
Sbjct  467  DSSMTSMLVN-SLNECERAPSPGETKRCVASIEDMIDFATSVLG-RNVAVRTTENTQG-S  523

Query  699  NQVVMIGNVKPYK---TNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
            N  + IG VK        K ++CH+  FP+  YYC+ +P  R+Y+ D+ + +    +N  
Sbjct  524  NGNITIGQVKGINGGNVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADILDAESKARINHG  583

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L   PGK EVCHWI + D+ W
Sbjct  584  VAICHLDTSSWSPGHGAFIALGSGPGKIEVCHWIFENDMTW  624



>ref|XP_010520580.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Tarenaya hassleriana]
Length=614

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 124/221 (56%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            ++P  FFR  +LK+G+ + MP   D ++P RSFLP  I   +P + S   +++R F    
Sbjct  394  IEPGKFFREAMLKEGNMIPMPDIRD-KMPKRSFLPRNILLKLPFSTSKIADIKRNFRAND  452

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + K   D +L  C  P   GE   C+ + EDMI F+   LG +++    ++ T G  
Sbjct  453  NSTMEKIISD-ALSECERPPSAGETKRCVGSAEDMIDFATSVLG-RNIILRNTESTAG-S  509

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q VMIG VK     +  K ++CH+  +P+  YYC+ +P  R+Y+ D+ +PK    +N  
Sbjct  510  KQEVMIGKVKGINGGEVTKSVSCHQSLYPYLLYYCHSVPKVRVYESDLLDPKTKSKINHG  569

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W P+H AF  L   PG+ EVCHWI + DL W
Sbjct  570  VAICHIDTSAWGPRHGAFMALGSRPGEIEVCHWIFENDLTW  610



>ref|XP_010551569.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Tarenaya hassleriana]
Length=625

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 122/221 (55%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            ++P  FFR  +LK+G+ + MP   D ++P RSFLP  I   +P +AS   +++RIF    
Sbjct  405  IEPGKFFREAMLKEGNTIPMPDIRD-KMPKRSFLPRNIISKLPFSASKIADIKRIFGAGD  463

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + +   D +L  C      GE   C+ + EDMI F+   LG + L   T++   G  
Sbjct  464  NSTMERIISD-ALSECERSPSAGETKRCVGSAEDMIDFATSVLG-RSLELRTTENIAGS-  520

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q VMIG V+     K  K ++CH+  +P+  YYC+ +P  R+Y+ D+ +PK    +N  
Sbjct  521  KQKVMIGKVRGINGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYESDLLDPKTKSKINHG  580

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W   H AF  L   PG+ EVCHWI + D+ W
Sbjct  581  VAICHIDTSAWGASHGAFAALGSRPGQIEVCHWIFENDMTW  621



>ref|XP_006483847.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Citrus sinensis]
Length=644

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/221 (38%), Positives = 121/221 (55%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASE---LQRIFPTAF  518
            V+P  FFR  +LK G  + MP   D ++P RSFLP  I   +P ++S    L+ IF  + 
Sbjct  421  VEPGKFFRESMLKTGTVMPMPDIRD-KMPQRSFLPRAIVSKLPFSSSNVNVLKEIFHASE  479

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +     D +L  C  P  KGE   C+ + EDMI F+   LG   +   T+   +G  
Sbjct  480  NSSMESIIKD-ALSECERPPSKGETKRCIDSAEDMIDFATSVLGNS-VTLRTTQNVQG-S  536

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q +MIG+VK     K+   ++CH+  FP+  YYC+ +P  R+Y+ D+ +PK    +N  
Sbjct  537  KQNIMIGSVKGINGGKVTQSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKTKAKINHG  596

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+  H AF  L   PG+ EVCHWI + DL W
Sbjct  597  VAICHIDTSAWSQTHGAFLALGSGPGRIEVCHWIFENDLTW  637



>ref|XP_007044636.1| Polygalacturonase 2 [Theobroma cacao]
 gb|EOY00468.1| Polygalacturonase 2 [Theobroma cacao]
Length=682

 Score =   155 bits (393),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 123/221 (56%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK+G  + MP   D ++P RSFLP  I   +P ++S   EL+RIF    
Sbjct  461  VEPGKFFREKMLKRGTVLPMPDIRD-KMPERSFLPRTIVSKLPFSSSKIGELKRIFHAGD  519

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  L    +D +L  C      GE   C+ + EDMI F+   LG +++   T++  KG  
Sbjct  520  NSTLETVMLD-ALKECERAPSAGETKRCVGSAEDMIDFATSVLG-RNVEVRTTENVKG-S  576

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q + IG V+   + K+   ++CH+  +P+  YYC+ +P  R+Y+ D+ +P     +N  
Sbjct  577  KQNIKIGTVRGINSGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADILDPNSREKINHG  636

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+  H AF  L   PG+ EVCHWI + D+ W
Sbjct  637  VAICHLDTSAWSSGHGAFLALGSGPGRIEVCHWIFENDMTW  677



>ref|XP_007157462.1| hypothetical protein PHAVU_002G071500g [Phaseolus vulgaris]
 gb|ESW29456.1| hypothetical protein PHAVU_002G071500g [Phaseolus vulgaris]
Length=626

 Score =   155 bits (392),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 127/221 (57%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+   FFR  ++K+G  + MP   D ++P RSFLP  I   +P + S   +L+R+F  + 
Sbjct  406  VEAGKFFREKMMKEGTVMPMPDIRD-KMPQRSFLPRSILSKLPFSVSKMDDLKRVFRASD  464

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + +  M +SL  C     +GE   C+ +LEDMI F+   LG +++A  +++   G  
Sbjct  465  NGSMERM-MRESLEECERAPSRGETKRCVGSLEDMIDFATSVLG-RNVAVRSTESVNG-S  521

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + VM+G V      K+   ++CH+  FP+  YYC+ +P  R+Y  D+ +PK    +N+ 
Sbjct  522  KKSVMVGPVTGINGGKVTQSVSCHQSLFPYLLYYCHAVPKVRLYQADLLDPKSKTKINRG  581

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L  +PG+ EVCHWI Q D+ W
Sbjct  582  IAICHLDTSDWSPTHGAFLSLGSAPGRIEVCHWIFQNDMAW  622



>ref|XP_002266815.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Vitis vinifera]
Length=624

 Score =   155 bits (391),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 127/221 (57%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            ++P  FFR  +LKKG  + MP   D ++P RSFLP  I+  +P + S   E+++IF  A 
Sbjct  404  IEPGKFFRESMLKKGTVMPMPDIRD-KMPKRSFLPRSISSKLPFSTSKLEEMKKIFHAAD  462

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + +    ++L  C     KGE   C+ ++EDMI F+   LG +++   T+   +G  
Sbjct  463  NSSM-EHMFTEALDDCERAPSKGETRRCVPSIEDMIDFATTVLG-RNVVVRTTQSVEGS-  519

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q VMIG+VK     +  K ++CH+  FP+  YYC+ +P  R+Y+ D+ +PK    +N  
Sbjct  520  KQNVMIGSVKGINGGQVTKSVSCHQSLFPYLLYYCHFVPKVRVYEADLLDPKTKANINHG  579

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+  H AF  L   PG+ EVCHWI + D+ W
Sbjct  580  VAICHLDTSDWSAGHGAFVALGSGPGRIEVCHWIFENDMTW  620



>ref|XP_009596020.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana tomentosiformis]
Length=628

 Score =   155 bits (391),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/222 (39%), Positives = 122/222 (55%), Gaps = 12/222 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            ++P  FFR  +LK G  + MP   D ++P RSFLP  IA  +P + S   +L+ IF    
Sbjct  408  IEPGKFFREKMLKTGTIMPMPDIRD-KMPKRSFLPRVIASKLPFSTSKISDLKTIFHARD  466

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKG-M  695
               + K  M  +L  C      GE   C+ ++EDMI FS   LG + +   T++ TKG  
Sbjct  467  DSQMGKM-MSDALTECERSPSAGETKRCVNSVEDMIDFSTSVLG-RDVVVRTTENTKGSK  524

Query  696  GNQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNK  866
            GN  +MIG+VK     K  K ++CH+  FP+  YYC+ +P  R+Y+ D+ +P     +N 
Sbjct  525  GN--IMIGSVKGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADILDPNSKAKINH  582

Query  867  FLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             + ICH+DTS W   H AF  L   PGK EVCHWI + D+ W
Sbjct  583  GIAICHVDTSSWGANHGAFIALGSGPGKIEVCHWIFENDMTW  624



>ref|XP_008221810.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Prunus mume]
Length=632

 Score =   155 bits (391),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 124/221 (56%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LKKG  + MP   D ++P RSFLP  I+  +P   S   EL++IF    
Sbjct  412  VEPGKFFRESMLKKGVVMPMPDIQD-KMPKRSFLPRAISSKLPFATSKIAELKQIFHADD  470

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + K  +D +L  C      GE   C+ + EDMI F+   LG +++   +++   G  
Sbjct  471  NSTMEKIILD-ALQECERAPSAGETKRCVGSAEDMIDFATTVLG-RNVVVRSTENVNGAK  528

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
            + V MIG+VK     K+   ++CH+  FP+  YYC+ +P  R+Y+ D+ +P     +N  
Sbjct  529  HNV-MIGSVKGINGGKVTQSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPLSKAKINHG  587

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H +F  L   PG+ EVCHWI Q D+ W
Sbjct  588  VAICHLDTSAWSPTHGSFMALGSGPGRIEVCHWIFQNDMTW  628



>ref|XP_007210277.1| hypothetical protein PRUPE_ppa003003mg [Prunus persica]
 gb|EMJ11476.1| hypothetical protein PRUPE_ppa003003mg [Prunus persica]
Length=613

 Score =   154 bits (390),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 123/220 (56%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNA---SELQRIFPTAF  518
            V+P  FFR  +LK+G+ V MP   D ++P RSFLP  I   +P +    SEL+ IF  A 
Sbjct  393  VEPGKFFRESMLKQGNVVVMPDIRD-KMPERSFLPRGILSKLPFSTPGMSELREIFH-AR  450

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
                 +  +  +LG C      GE   C+ ++EDMI F+   LG  ++   T++   G  
Sbjct  451  DNSAMEHVLTNALGECERAPSPGETKRCVGSIEDMIDFATSVLG-HNVVVRTTENVWGSK  509

Query  699  NQVV--MIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             +V+  MI  +      K ++CH+  +P+  YYC+ +P  R+Y+ D+ + +    +N  +
Sbjct  510  QKVMIGMISGINGGNVTKSVSCHQTLYPYLLYYCHSVPKVRVYEADIVDVESKSKINHGV  569

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICH+DTS W+P+H AF +L  SPGK EVCHWI + D+ W
Sbjct  570  AICHIDTSSWSPEHGAFVVLGSSPGKIEVCHWIFENDMAW  609



>ref|XP_002266341.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Vitis vinifera]
Length=633

 Score =   154 bits (390),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 126/221 (57%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LKKG  + MP   D ++P RSFLP  I+   P + S   E+++IF  A 
Sbjct  413  VEPGKFFRESMLKKGTVMPMPDIRD-KMPKRSFLPRTISSKFPFSTSKLEEMKKIFHAAD  471

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + +    ++L  C     KGE   C+ ++EDMI F+   LG +++   T+   +G  
Sbjct  472  NSSM-EHMFTEALDDCERAPSKGETKRCVPSIEDMIDFATTVLG-RNVVVRTTQSVEGS-  528

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q +MIG+VK     +  K ++CH+  FP+  YYC+ +P  R+Y+ D+ +PK    +N  
Sbjct  529  KQNLMIGSVKGINGGQVTKSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKTKANVNHG  588

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+  H AF  L   PG+ EVCHWI + D+ W
Sbjct  589  VAICHLDTSDWSAGHGAFVALGSGPGRIEVCHWIFENDMTW  629



>emb|CCD74525.1| polygalacturonase 1 [Arabidopsis halleri subsp. halleri]
Length=626

 Score =   154 bits (390),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 123/220 (56%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQ---RIFPTAF  518
            V+   FFR  +LK+G  + MP  +  ++P R+FLP  I  N+P ++SE+    R+F    
Sbjct  406  VEEGKFFRESMLKEGTLMQMPD-IKDKMPKRTFLPRSIVSNLPFSSSEIGEIWRVFGAGE  464

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +    +  ++  C  PA KGE   C+ + EDMI F+   LG + +   T++   G  
Sbjct  465  NSSMA-GIISSAVSECERPASKGETKRCVGSAEDMIDFATSVLG-RGVVVRTTENVVGSK  522

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             ++V+  +  +      + ++CH+  +P+  YYC+ +P  R+Y+ D+ +PK +  +N  +
Sbjct  523  KKIVIGKVNGINGGNVTRAVSCHQSLYPYLLYYCHSVPRVRVYEADLLDPKSLEKINHGV  582

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W
Sbjct  583  AICHIDTSAWSPSHGAFLALGSGPGRIEVCHWIFENDMTW  622



>ref|XP_006438392.1| hypothetical protein CICLE_v10030930mg [Citrus clementina]
 gb|ESR51632.1| hypothetical protein CICLE_v10030930mg [Citrus clementina]
Length=644

 Score =   154 bits (390),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 83/221 (38%), Positives = 120/221 (54%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASE---LQRIFPTAF  518
            V+P  FFR  +LK G  + MP   D ++P RSFLP  I    P ++S    L+ IF  + 
Sbjct  421  VEPGKFFRESMLKTGTVMPMPDIRD-KMPQRSFLPRAIVSKFPFSSSNVNVLKEIFHASE  479

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +     D +L  C  P  KGE   C+ + EDMI F+   LG   +   T+   +G  
Sbjct  480  NSSMESIIKD-ALSECERPPSKGETKRCIGSAEDMIDFATSVLGNS-VTLRTTQNVQG-S  536

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q +MIG+VK     K+   ++CH+  FP+  YYC+ +P  R+Y+ D+ +PK    +N  
Sbjct  537  KQNIMIGSVKGINGGKVTQSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKTKAKINHG  596

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+  H AF  L   PG+ EVCHWI + DL W
Sbjct  597  VAICHIDTSAWSQTHGAFLALGSGPGRIEVCHWIFENDLTW  637



>gb|EYU31262.1| hypothetical protein MIMGU_mgv1a002697mg [Erythranthe guttata]
Length=646

 Score =   154 bits (390),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 122/222 (55%), Gaps = 10/222 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK G  + MP   D ++P RSFLP  I   +P + S   E+++IF    
Sbjct  424  VEPGKFFREAMLKTGTVMPMPDIRD-KMPKRSFLPRTIVSKLPFSTSKLAEMKKIFHAGD  482

Query  519  SIPLTKAAM-DKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGM  695
                T A M   +L  C      GE   C+ ++EDMI F+   LG +++   T+  T G 
Sbjct  483  DADSTMAKMLTDALHECERAPSPGETKRCVASIEDMIDFATTVLG-RNVVVRTTANTAGH  541

Query  696  GNQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNK  866
            G  + ++G VK     K+   ++CH+  +P+  YYC+ +P  R+Y+ D+ +P     +N 
Sbjct  542  GGDI-LLGEVKGVNGGKVTRSVSCHQSLYPYLLYYCHSVPKVRVYEADILDPNTKTKINH  600

Query  867  FLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             + ICH+DTS W+P H +F LL   PGK EVCHWI + D+ W
Sbjct  601  GVAICHLDTSSWSPGHGSFVLLGSGPGKIEVCHWIFENDMTW  642



>ref|XP_007223063.1| hypothetical protein PRUPE_ppa003712mg [Prunus persica]
 gb|EMJ24262.1| hypothetical protein PRUPE_ppa003712mg [Prunus persica]
Length=554

 Score =   154 bits (388),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 124/221 (56%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LKKG  + MP   D ++P RSFLP  I+  +P   S   EL++IF    
Sbjct  334  VEPGKFFRESMLKKGVVMPMPDIQD-KMPKRSFLPRTISSKLPFATSKMAELKQIFHADD  392

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + K  +D +L  C      GE   C+ + EDMI F+   LG +++   +++   G  
Sbjct  393  NSTMEKIILD-ALQECERAPSAGETKRCVGSAEDMIDFATTVLG-RNVVVRSTENVNGAK  450

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
            + V MIG+VK     K+   ++CH+  FP+  YYC+ +P  R+Y+ D+ +P     +N  
Sbjct  451  HNV-MIGSVKGINGGKVTQSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPLSKAKINHG  509

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H +F  L   PG+ EVCHWI Q D+ W
Sbjct  510  VAICHLDTSAWSPTHGSFMALGSGPGQIEVCHWIFQNDMTW  550



>ref|XP_007036187.1| Polygalacturonase 2, putative [Theobroma cacao]
 gb|EOY20688.1| Polygalacturonase 2, putative [Theobroma cacao]
Length=628

 Score =   154 bits (389),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 82/223 (37%), Positives = 127/223 (57%), Gaps = 14/223 (6%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASEL---QRIF--PT  512
            V+P  FFR  +LK+G+ + MP   D ++P RSFLP  +   +P + SEL   + IF  P 
Sbjct  408  VEPGKFFRESMLKQGNVMVMPDIRD-KMPKRSFLPRGVLSKLPFSTSELPSLREIFGAPD  466

Query  513  AFSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKG  692
              ++ L    +  +L  C  P  +GE   C+ ++EDMI F+   LG  ++A  T+   +G
Sbjct  467  NSTMELV---LINALAECERPPSQGETKRCVGSVEDMIDFATLVLG-HNVAVRTTKNVEG  522

Query  693  MGNQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMN  863
               Q +M+G +K     K  K ++CH+  +P+  YYC+ +P  R+Y+ ++ + K    +N
Sbjct  523  -SKQEIMLGKIKGINGGKVTKSVSCHQSLYPYLLYYCHSVPEVRVYEAEILDVKSKDKIN  581

Query  864  KFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
              + ICH+DTS W+P H AF  L  SPG+ EVCHWI Q D+ W
Sbjct  582  HGVAICHLDTSTWSPSHGAFVALGSSPGRIEVCHWIFQNDMTW  624



>ref|XP_009794727.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana sylvestris]
Length=625

 Score =   154 bits (388),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 123/222 (55%), Gaps = 12/222 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            ++P  FFR  +LK    + MP   D ++P RSFLP  IA  +P + S   +L+ IF    
Sbjct  405  IEPGKFFREKMLKTETIMPMPDIQD-KMPKRSFLPRVIASKLPFSTSKIRDLKTIFHAGD  463

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKG-M  695
               + K  +D +L  C      GE   C+ ++EDMI FS   LG +++   T++ TKG  
Sbjct  464  DTQMGKMMLD-ALTECERSPSAGETKRCVASVEDMIDFSTSVLG-RNVVVRTTENTKGSK  521

Query  696  GNQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNK  866
            GN  +MIG+VK     K  K ++CH+  FP+  YYC+ +P  R+Y+ D+ +P     +N 
Sbjct  522  GN--IMIGSVKGINGGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADILDPNSKAKINH  579

Query  867  FLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             + ICH+DTS W   H AF  L   PGK EVCHWI + D+ W
Sbjct  580  GVAICHVDTSSWGASHGAFIALGSGPGKIEVCHWIFENDMTW  621



>gb|KHN30893.1| Polygalacturonase-1 non-catalytic subunit beta [Glycine soja]
Length=541

 Score =   153 bits (387),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 126/221 (57%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  ++K+G+ + MP  +  ++P RSFLP  IA  +P ++S   E++ +F T  
Sbjct  321  VEPGKFFRESMVKEGNVIPMPD-IKDKMPARSFLPLAIASKLPFSSSRINEMREVFHTR-  378

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
                T+  M K+L  C     KGE   C+ + E+MI F+   LG  ++A  +++   G G
Sbjct  379  EGSSTERVMVKALKECERAPSKGETKRCVSSAEEMIGFAVSVLG-PNVAVRSTENLNGSG  437

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
            + V MIG V      K  K ++CH+  +P+  YYC+ +P  R+Y+ ++ +   +  +N  
Sbjct  438  SSV-MIGKVHSIDGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEAEILDVDTLEKINHG  496

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W P+H AF  L   PGK EVCHWI + DL W
Sbjct  497  VAICHLDTSAWGPQHGAFLALGFGPGKIEVCHWIFENDLTW  537



>ref|XP_008239752.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Prunus mume]
Length=627

 Score =   154 bits (388),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/220 (36%), Positives = 122/220 (55%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNA---SELQRIFPTAF  518
            V+P  FFR  +LK+G+ V MP   D ++P RSFLP  I   +P +    SEL+ IF  A 
Sbjct  407  VEPGKFFRESMLKQGNVVVMPDIRD-KMPERSFLPRGILSKLPFSTPGLSELREIFH-AR  464

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
                 +  +  +LG C      GE   C+ ++EDMI F+   LG  ++   T++   G  
Sbjct  465  DNSAMEHVLTNALGECERAPSPGETKLCVGSIEDMIDFATSVLG-HNVVVRTTENVSGSK  523

Query  699  NQVV--MIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             +V+  M+  +      K ++CH+  +P+  YYC+ +P  R+Y+ D+ + +    +N+ +
Sbjct  524  QKVMIGMVSGINGGNVTKSVSCHQTLYPYLLYYCHSVPKVRVYEADIVDVESKSKINQGV  583

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICH+DTS W+P H AF  L  SPGK EVCHWI + D+ W
Sbjct  584  AICHIDTSSWSPGHGAFMALGSSPGKIEVCHWIFENDMTW  623



>ref|NP_176242.1| polygalacturonase 1 [Arabidopsis thaliana]
 sp|O80760.1|Y639_ARATH RecName: Full=Probable polygalacturonase non-catalytic subunit 
At1g60390; AltName: Full=Aromatic-rich glycoprotein At1g60390; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24065.1| Strong similarity to AR0GP2 gene gb|1762634 from Lycopersicon 
esculentum [Arabidopsis thaliana]
 dbj|BAE99558.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33681.1| polygalacturonase 1 [Arabidopsis thaliana]
Length=624

 Score =   154 bits (388),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 123/220 (56%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+   FFR  +LK+G  + MP  +  ++P R+FLP  I +N+P ++S   E+ R+F    
Sbjct  404  VEEGKFFREAMLKEGTLMQMPD-IKDKMPKRTFLPRNIVKNLPFSSSTIGEIWRVFGAGE  462

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +    +  ++  C  PA  GE   C+ + EDMI F+   LG + +   T++   G  
Sbjct  463  NSSMA-GIISSAVSECERPASHGETKRCVGSAEDMIDFATSVLG-RGVVVRTTENVVGSK  520

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             +VV+  +  +      + ++CH+  +P+  YYC+ +P  R+Y+ D+ +PK +  +N  +
Sbjct  521  KKVVIGKVNGINGGDVTRAVSCHQSLYPYLLYYCHSVPRVRVYETDLLDPKSLEKINHGV  580

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W
Sbjct  581  AICHIDTSAWSPSHGAFLALGSGPGQIEVCHWIFENDMTW  620



>ref|XP_010417970.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Camelina sativa]
Length=628

 Score =   154 bits (388),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 124/220 (56%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASEL---QRIFPTAF  518
            V+   FFR  +LK+G  + MP  +  ++P R+FLP  I  +IP ++SE+   +R+F    
Sbjct  408  VEEGKFFRESMLKEGTLMQMPD-IKDKMPERTFLPRSIVSSIPFSSSEIGEIRRVFGAGE  466

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  ++   +  ++  C  PA  GE   C+ + EDMI F+   LG + +   T++   G  
Sbjct  467  NSSMS-GIISSAVSECERPASHGETKRCVGSAEDMIDFATSVLG-RGIVVRTTESVVGSK  524

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             ++V+  +  +      + ++CH+  +P+  YYC+ +P  R+Y+ D+  P+ +  +N  +
Sbjct  525  KKIVIGKVNGINGGDVTRAVSCHQSLYPYLLYYCHSVPRVRVYEADILEPESLEKINHGV  584

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICH+DTS W+P H AF  L  SPG+ EVCHWI + D+ W
Sbjct  585  AICHVDTSAWSPSHGAFLALGSSPGRIEVCHWIFENDMTW  624



>ref|XP_006578624.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Glycine max]
Length=631

 Score =   153 bits (387),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 126/221 (57%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  ++K+G+ + MP  +  ++P RSFLP  IA  +P ++S   E++ +F T  
Sbjct  411  VEPGKFFRESMVKEGNVIPMPD-IKDKMPARSFLPLAIASKLPFSSSRINEMREVFHTR-  468

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
                T+  M K+L  C     KGE   C+ + E+MI F+   LG  ++A  +++   G G
Sbjct  469  EGSSTERVMVKALKECERAPSKGETKRCVSSAEEMIGFAVSVLG-PNVAVRSTENLNGSG  527

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
            + V MIG V      K  K ++CH+  +P+  YYC+ +P  R+Y+ ++ +   +  +N  
Sbjct  528  SSV-MIGKVHSIDGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEAEILDVDTLEKINHG  586

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W P+H AF  L   PGK EVCHWI + DL W
Sbjct  587  VAICHLDTSAWGPQHGAFLALGFGPGKIEVCHWIFENDLTW  627



>ref|XP_010682558.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Beta vulgaris subsp. vulgaris]
Length=651

 Score =   153 bits (386),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/221 (38%), Positives = 121/221 (55%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK+G  + MP   D ++P RSFLP  I   IP  +S   +L+ IF  AF
Sbjct  430  VEPGKFFRERMLKEGTIMPMPDVKD-KMPPRSFLPRSILSKIPFESSKITQLREIF-HAF  487

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
                 +  ++ +L  C      GE   C+ ++EDMI F+   LG + + A T D   G  
Sbjct  488  DNSTMEGMLNAALRECERAPSMGETKKCVGSVEDMIDFAVSVLG-RSVEARTIDNVNGSK  546

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
              + +IG V+     KI   ++CH+  +P+  YYC+ +P  R+Y+ D+ +P     +N  
Sbjct  547  TDI-LIGKVRGINGGKITKSVSCHQSLYPYLLYYCHSVPKVRVYEADILDPSTKAKINHG  605

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L   PGK EVCHWI + DL W
Sbjct  606  VAICHIDTSAWSPTHGAFIALGPGPGKIEVCHWIFENDLTW  646



>ref|XP_006365226.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum tuberosum]
Length=625

 Score =   153 bits (386),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 122/221 (55%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASE---LQRIFPTAF  518
            V+P  FFR  +LK G  + MP   D ++P RSFLP  IA  +P + S+   L++IF    
Sbjct  405  VEPGKFFREKMLKIGTIMPMPDIQD-KMPKRSFLPRVIASKLPFSTSKIGNLKKIFHAGN  463

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
               + K  +D +L  C      GE   C+ ++EDMI FS   LG +++   T++  KG  
Sbjct  464  DSQMGKM-IDDALVECERSPSAGETKRCVSSIEDMIDFSTSVLG-QNIIVRTTENIKGSK  521

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
              + +IG+VK     K  K I+CH+  FP+  YYC+ +P  R+Y+ D+ +P     +N  
Sbjct  522  GDI-LIGSVKGINGGKVTKSISCHQSLFPYLVYYCHSVPKVRVYEADILDPNSKAKINHG  580

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W   H AF  L   PGK EVCHWI + D+ W
Sbjct  581  VAICHVDTSTWGANHGAFMALGSGPGKIEVCHWIFENDMTW  621



>ref|XP_010044626.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
 gb|KCW86719.1| hypothetical protein EUGRSUZ_B03326 [Eucalyptus grandis]
Length=364

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/284 (31%), Positives = 139/284 (49%), Gaps = 25/284 (9%)
 Frame = +3

Query  204  TEVFTPLISQKYFSSNP-KFCTTANLVCSAVVNPPPPGVK---IYNF-----------GF  338
            T +F   +++   S +   FC  A L+C   ++    G      Y+F             
Sbjct  81   TALFAQFVAKDALSDHLLSFCKAAQLLCFPDLSSHQVGKDGRVFYDFINGATTLAGGMNV  140

Query  339  TGKVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFP  509
               V+P  +F+  +L+ G+ + MP  L S+ P RSFLP  I+  +P + S   EL++IF 
Sbjct  141  NKGVEPGKYFQESMLRSGNVIRMPD-LRSKTPERSFLPRSISSGLPFSTSKLAELKQIFH  199

Query  510  TAFSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTK  689
                  + K  M ++L  C    ++GE   C+ ++EDMI F+   LG  H   L S  + 
Sbjct  200  AGDDSTMEKI-MVRTLSLCEKAPIRGETKRCVSSVEDMIDFATSILG--HDIKLHSTKSD  256

Query  690  GMGNQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTM  860
                  ++IG VK    +K+   +ACH+  FP+  Y C+ +P+  +Y+VD+ +P     +
Sbjct  257  EGSKHDILIGRVKRIGGSKLSVPVACHDSLFPYMVYNCHAVPTLHVYEVDILDPVSKAKI  316

Query  861  NKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            N  + +CHMDTS W P H AF  L   PG+ E CHWI     +W
Sbjct  317  NNGVAVCHMDTSAWNPNHEAFIALGSGPGRIEACHWIYGEYAVW  360



>gb|KHN00353.1| Polygalacturonase-1 non-catalytic subunit beta [Glycine soja]
Length=437

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 118/217 (54%), Gaps = 14/217 (6%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIP  527
            V+P  FFR  ++K+G  + MP   D ++P RSFLP  I   +P +AS+   +        
Sbjct  229  VEPGKFFREKMMKEGTVMPMPDIKD-KMPERSFLPRSILSKLPFSASDNGSM--------  279

Query  528  LTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQV  707
              +  M  SL  C      GE   C+ +LEDMI F+   LG +++A  T+    G    V
Sbjct  280  --EKMMKDSLEECERAPSSGETKRCVGSLEDMIDFATSVLG-RNVAVRTTQNVNGSKKSV  336

Query  708  VM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVIC  881
            V+  +  +   K  + ++CH+  FP+  YYC+ +P  R+Y+ D+ +PK    +N+ + IC
Sbjct  337  VVGPVRGINGGKVTQSVSCHQSLFPYLLYYCHAVPKVRVYEADLLDPKTKAKINRGVAIC  396

Query  882  HMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            H+DTS W+P H AF  L   PG+ EVCHWI + D+ W
Sbjct  397  HLDTSDWSPTHGAFLSLGSVPGRIEVCHWIFENDMAW  433



>ref|XP_010510953.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Camelina sativa]
Length=626

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/220 (32%), Positives = 124/220 (56%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASEL---QRIFPTAF  518
            ++   FFR  +LK+G  + MP  +  ++P R+FLP  I  +IP ++SE+   +R+F    
Sbjct  406  IEEGKFFRESMLKEGTLMQMPD-IKDKMPKRTFLPRSIVSSIPFSSSEIGEIRRVFGAGV  464

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + +  +  ++  C  PA  GE   C+ + EDMI F+   LG + +   T++   G  
Sbjct  465  NSSMERI-ISSAVSECERPASHGETKRCVGSAEDMIDFATSVLG-RGVVVRTTESVIGSK  522

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             ++V+  +  +      + ++CH+  +P+  YYC+ +P  R+Y+ D+  P+ +  +N  +
Sbjct  523  QKIVIGKVNGINGGDVTRAVSCHQSLYPYLLYYCHSVPRVRVYEADLLEPESLEKINHGV  582

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICH+DTS W+P H AF  L  SPG+ EVCHWI + D+ W
Sbjct  583  AICHIDTSAWSPSHGAFLALGSSPGRIEVCHWIFENDMTW  622



>ref|XP_011034135.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Populus euphratica]
Length=636

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/224 (36%), Positives = 126/224 (56%), Gaps = 13/224 (6%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            ++P  FFR  +LKKG  + MP   D ++P RSFLP  I   +P + S   +L+ IF  + 
Sbjct  412  IEPGKFFRESMLKKGSVMPMPDIRD-KMPKRSFLPRSIISKLPFSTSKIYQLKEIFHASD  470

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + +  +D +L  C      GE   C+ + EDMI F+   LG +++A  T+D   G  
Sbjct  471  NSSMERIILD-ALEECERSPSPGETKRCVGSAEDMIDFATSVLG-RNVAVRTTDNVNGS-  527

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVAN---PKKMGTM  860
             + +MIG++K     ++   ++CH+  +P+  YYC+ +P  R+Y+ D A+   P    T+
Sbjct  528  KKNIMIGSIKGINGGRVTRSVSCHQSLYPYLLYYCHSVPKVRVYEADEADLLDPNSKATI  587

Query  861  NKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            N  + ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W
Sbjct  588  NHGVAICHLDTSSWSPTHGAFLALGPGPGRIEVCHWIFENDMTW  631



>ref|XP_009363553.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009363554.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X3 [Pyrus x bretschneideri]
Length=632

 Score =   152 bits (385),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 124/221 (56%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASE---LQRIFPTAF  518
            V+P  FFR  +LKKG  + MP   D ++P RSFLP  I   +P   S+   L++IF  A 
Sbjct  412  VEPGKFFRESMLKKGVVMPMPDIQD-KMPKRSFLPRTILSKLPFATSKIAALKQIFHAAD  470

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + K  +D +L  C      GE   C+ + EDMI F+   LG +++   +++   G  
Sbjct  471  NSTMEKIIVD-ALQECERAPSAGETKRCVGSAEDMIDFATTILG-RNIVVRSTENVNGAK  528

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
            + V MIG+VK     K+   ++CH+  FP+  YYC+ +P  R+Y+ D+ +P     +N  
Sbjct  529  HDV-MIGSVKGINGGKVTQSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPVSKAKVNHG  587

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H +F  L   PG+ EVCHWI Q D+ W
Sbjct  588  VAICHLDTSAWSPTHGSFLALGSGPGRIEVCHWIFQNDMTW  628



>ref|XP_006476763.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390-like 
[Citrus sinensis]
Length=624

 Score =   152 bits (384),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 124/224 (55%), Gaps = 8/224 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASEL---QRIFPTAF  518
             V+P  FFR  +LK+G+ + MP   D ++P RSFLP  I+  +P   S+L   + IF    
Sbjct  404   VEPGKFFRESMLKQGNVMVMPDIRD-KMPRRSFLPRPISSKLPFATSQLTQLKEIFRVRD  462

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
             +  + +  ++ +L  C  P   GE   C+ ++EDMI F+   LG +++ A T+    G  
Sbjct  463   NSSMERVIVN-ALAECERPPSPGEAKRCVGSVEDMIDFATSVLG-RNVVARTTQNVNGSK  520

Query  699   NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
              +V +  +  +   K  K ++CH+  +P+  YYC+ +P  R+Y+ D+ + +    +N  +
Sbjct  521   QRVTISSVSGINGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADILDVESNAKINHGV  580

Query  873   VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
              ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W   D
Sbjct  581   AICHIDTSSWSPGHGAFVALGSGPGQIEVCHWIFENDMTWTSAD  624



>ref|XP_002886622.1| hypothetical protein ARALYDRAFT_475291 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62881.1| hypothetical protein ARALYDRAFT_475291 [Arabidopsis lyrata subsp. 
lyrata]
Length=625

 Score =   152 bits (384),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 122/219 (56%), Gaps = 6/219 (3%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIP  527
            V+   FFR  +LK+G  + +P  +  ++P R+FLP  I  N+P ++SE+  I+    +  
Sbjct  405  VEEGKFFRESMLKEGTLMQLPD-IKDKMPKRTFLPRNIVSNLPFSSSEIGEIWGVFGAGE  463

Query  528  LTKAA--MDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGN  701
             +  A  +  ++  C  PA KGE   C+ + EDMI F+   LG   +   T++   G   
Sbjct  464  NSSMAGIISSAVSECERPASKGETKRCVGSAEDMIDFATSVLG-SGVVVRTTENVVGSKK  522

Query  702  QVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLV  875
            +VV+  +  +      + ++CH+  +P+  YYC+ +P  R+Y+ D+ +PK +  +N  + 
Sbjct  523  KVVIGKVNRINGGDETRAVSCHQSLYPYLLYYCHSVPRVRVYETDLLDPKSLEKINHGVA  582

Query  876  ICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W
Sbjct  583  ICHIDTSAWSPSHGAFLALGSGPGRIEVCHWIFENDMTW  621



>gb|KDO82432.1| hypothetical protein CISIN_1g044596mg [Citrus sinensis]
Length=644

 Score =   152 bits (384),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 120/221 (54%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASE---LQRIFPTAF  518
            V+P  FFR  +LK G  + MP   D ++P RSFLP  I   +P ++S    L+ IF  + 
Sbjct  421  VEPGKFFRESMLKTGTVMPMPDIRD-KMPQRSFLPRAIVSKLPFSSSNVNVLKEIFHASE  479

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +     D +L  C     KGE   C+ + EDMI F+   LG   +   T+   +G  
Sbjct  480  NSSMESIIKD-ALSECERQPSKGETKRCIGSAEDMIDFATSVLG-NSVTLRTTQNVQG-S  536

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q +MIG+VK     K+   ++CH+  FP+  YYC+ +P  R+Y+ D+ +PK    +N  
Sbjct  537  KQNIMIGSVKGINGGKVTQSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPKTKAKINHG  596

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+  H AF  L   PG+ EVCHWI + DL W
Sbjct  597  VAICHIDTSAWSQTHGAFLALGSGPGRIEVCHWIFENDLTW  637



>ref|XP_010477679.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Camelina sativa]
Length=623

 Score =   152 bits (383),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 120/221 (54%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK+G  + MP   D ++P RSFLP  I   +P + S   E++R+F  A 
Sbjct  403  VEPGKFFRESMLKEGTLIWMPDIKD-KMPKRSFLPRSIVSKLPFSTSKITEIKRVFH-AR  460

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
                 +  +  ++  C      GE   C+ + EDMI F+   LG + +   T++   G  
Sbjct  461  DNSTMEGIIANAVTECERSPTVGETKRCVGSAEDMIDFATSVLG-RSVVVRTTESVAGS-  518

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q VMIGNVK     K  K ++CH+  +P+  YYC+ +P  R+Y+ D+ +PK    +N  
Sbjct  519  KQKVMIGNVKGINGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADLLDPKSKAKINHG  578

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICHMDTS W   H AF  L   PG+ EVCHWI + D+ W
Sbjct  579  IAICHMDTSAWGASHGAFVSLGSKPGQIEVCHWIFENDMNW  619



>ref|XP_008389645.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=632

 Score =   152 bits (383),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 124/221 (56%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASE---LQRIFPTAF  518
            V+P  FFR  +LKKG  + MP  +  ++P RSFLP  I   +P   S+   L++IF  A 
Sbjct  412  VEPGKFFRESMLKKGVVMPMPD-IQDKMPKRSFLPRTILSKLPFATSKIATLKQIFHAAD  470

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + K  +D +L  C      GE   C+ + EDMI F+   LG +++   +++   G  
Sbjct  471  NSSMEKIIVD-ALQECERAPSAGETKRCVGSAEDMIDFATTILG-RNVVVRSTENVNGAK  528

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
            + V M+G+VK     K+   ++CH+  FP+  YYC+ +P  R+Y+ D+ +P     +N  
Sbjct  529  HDV-MVGSVKGINGGKVTQSVSCHQSLFPYLLYYCHSVPKVRVYEADLLDPVSKAKINHG  587

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H +F  L   PG+ EVCHWI Q D+ W
Sbjct  588  VAICHLDTSAWSPTHGSFLALGSGPGRIEVCHWIFQNDMTW  628



>ref|XP_010555103.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Tarenaya hassleriana]
Length=602

 Score =   152 bits (383),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 123/221 (56%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIP---LNASELQRIFPTAF  518
            V+   FFR   LK+G  +TMP   D ++P RSFLP  I   +P   L  ++++RIF  + 
Sbjct  382  VEAGKFFREAKLKEGTVITMPDIRD-KMPKRSFLPRSIISKLPFSILKIADIKRIFRVSD  440

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + +  +  +L  C  P   GE   C+ + EDMI F+   LG +++   T++   G  
Sbjct  441  NSTM-EGIISDALSDCERPPTAGETKRCVGSAEDMIDFATSVLG-RNIVLRTTENVAGS-  497

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q +MIG V+     +  K ++CH+  +P+  YYC+ +P  R+Y+ D+ +P+    +N  
Sbjct  498  KQKMMIGKVRAINGGEVTKSVSCHQSLYPYLLYYCHSVPKVRVYESDLLDPESKAKINHG  557

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W P H AF  L   PG+ EVCHWI + D+ W
Sbjct  558  VAICHIDTSAWGPSHGAFVALGSRPGQIEVCHWIFENDMTW  598



>ref|XP_008340027.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=636

 Score =   152 bits (383),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 123/221 (56%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASE---LQRIFPTAF  518
            V+P  FFR  +LKKG  + MP   D + P RSFLP  I   +P   S+   L++IF  A 
Sbjct  416  VEPGKFFRESMLKKGVVMPMPDIQD-KTPKRSFLPRTILSKLPFATSKIAALKQIFHAAD  474

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + K  +D +L  C      GE   C+ + EDMI F+   LG +++   +++   G  
Sbjct  475  NSTMEKIIVD-ALQECERAPSAGETKRCVGSAEDMIDFATTVLG-RNVVVRSTENVNGAK  532

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
            + V MIG+VK     K+   ++CH+  FP+  YYC+ +P  R+Y+ D+ +P     +N  
Sbjct  533  HDV-MIGSVKGINGGKVTQSVSCHQSMFPYLLYYCHSVPKVRVYEADLLDPVSKAKINHG  591

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H +F  L   PG+ EVCHWI Q D+ W
Sbjct  592  VAICHLDTSAWSPTHGSFMALGSGPGRIEVCHWIFQNDMTW  632



>ref|XP_010473218.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Camelina sativa]
Length=629

 Score =   152 bits (383),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 123/220 (56%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASEL---QRIFPTAF  518
            V+   FFR  +LK+G  + MP   D ++P R+FLP  I  +IP ++SE+   +R+F    
Sbjct  409  VEEGKFFRESMLKEGTLMQMPDIKD-KMPERTFLPRSIVSSIPFSSSEIGEIRRVFGAGE  467

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +    +  ++  C  PA  GE   C+ + EDMI F+   LG + +   T++   G  
Sbjct  468  NSSMA-GIISSAVSECERPASHGETKRCVGSAEDMIDFATSVLG-RGVVVRTTESVVGSK  525

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             ++++  +  +      + ++CH+  +P+  YYC+ +P  R+Y+ D+  P+ +  +N  +
Sbjct  526  KKILIGKVNGINGGDVTRAVSCHQSLYPYLLYYCHSVPRVRVYEADILEPESLEKINHGV  585

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICH+DTS W+P H AF  L  SPG+ EVCHWI + D+ W
Sbjct  586  AICHVDTSAWSPSHGAFLALGSSPGRIEVCHWIFENDMTW  625



>ref|XP_004238669.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum lycopersicum]
Length=622

 Score =   151 bits (382),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 122/221 (55%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK G  + MP   D ++P RSFLP  I+  +P + S   +L++IF    
Sbjct  402  VEPGKFFREKMLKIGTIMPMPDIQD-KMPKRSFLPRVISSKLPFSTSKIGDLKKIFHAGN  460

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
               + K  +D +L  C      GE   C+ ++EDMI FS   LG +++   T++  KG  
Sbjct  461  DSQMEKM-IDDALLECERSPSTGETKKCVSSIEDMIDFSTSVLG-QNVVLRTTENIKGSK  518

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
              + +IG+VK     K+   ++CH+  FP+  YYC+ +P  R+Y+ D+ +P     +N  
Sbjct  519  GDI-LIGSVKRTNDGKVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADILDPNSKAKINHG  577

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W   H AF  L   PGK EVCHWI + D+ W
Sbjct  578  VAICHVDTSAWGANHGAFTALGSGPGKIEVCHWIFENDMNW  618



>ref|XP_010251282.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nelumbo nucifera]
Length=639

 Score =   151 bits (382),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 120/221 (54%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
             +P  FFR  +LK+G  + MP   D ++P RSFLP  I   +P ++S   EL++IF  A 
Sbjct  419  AEPGKFFRESMLKEGIVMPMPDIRD-KMPPRSFLPRSITSKLPFSSSRISELKQIFHAAE  477

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + +  +  +L  C     +GE   C+ +LE MI F+   LG  H   + S       
Sbjct  478  NSTMERV-LQNTLEECERAPSRGETKKCVGSLEGMIDFAVSVLG--HNVVVRSTENVNGS  534

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + VMIG VK     +  K ++CH+  FP+  YYC+ +P  R+Y+ D+ +      +N  
Sbjct  535  TKNVMIGAVKGINGGRVTKSVSCHQSLFPYLVYYCHSVPKVRVYEADILDANSKAKINNG  594

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L  SPGK EVCHWI + D+ W
Sbjct  595  VAICHIDTSAWSPGHGAFISLGSSPGKIEVCHWIFENDMTW  635



>ref|XP_002511417.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
 gb|EEF52019.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
Length=637

 Score =   151 bits (382),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 127/221 (57%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNA---SELQRIFPTAF  518
            V+P  FFR  +LK+G+ V MP   D ++P RSFLP  I   +P ++   SEL+ +F  A 
Sbjct  417  VEPGKFFRESMLKQGNVVVMPDITD-KMPKRSFLPRSIVSKLPFSSPRLSELKEVFH-AL  474

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
                 +  +  +L  C     +GE   C+ ++EDMI+F+   LG  ++   T++   G  
Sbjct  475  ENSTMECVLVNALAECEREPSQGETKRCVGSVEDMIEFAVSVLG-HNVVVRTTENVHGS-  532

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
            ++ VMIG VK     +  K ++CH+  +P+  YYC+ +P  R+Y+ ++ + +    +N  
Sbjct  533  SKNVMIGRVKGINGGEVTKSVSCHQSLYPYLLYYCHSVPRVRVYEAEILDVESKERINLG  592

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L+ SPG+ EVCHWI + D+ W
Sbjct  593  VAICHIDTSAWSPNHGAFVALESSPGQIEVCHWIFENDMSW  633



>ref|XP_002525383.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
 gb|EEF37021.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
Length=631

 Score =   151 bits (381),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 117/224 (52%), Gaps = 8/224 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPT--AFS  521
             V+P  FFR   LKKG  + MP   D ++P RSFLP  I   +P + S   ++  T  AF 
Sbjct  411   VEPGKFFRESKLKKGTVMPMPDIRD-KMPKRSFLPRSITSKLPFSTSNFAQLKQTFHAFD  469

Query  522   IPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGN  701
                 +  M  +L  C      GE   C+ + ED+I F+   LG   +A  T++      N
Sbjct  470   NSTMETLMLDALTECERAPSPGETKRCIGSAEDLIDFATSVLGRNVVARTTANVNGSKKN  529

Query  702   QVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
               + IG++K     K+   ++CH+  +P+  YYC+ +P  R+Y+ D+ +P     +N  +
Sbjct  530   --IKIGSIKGINGGKVTESVSCHQSLYPYLLYYCHSVPKVRVYEADILDPNSNSKINHGV  587

Query  873   VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
              ICH+DTS W+P H AF  L   PG+ EVCHWI + DL W   D
Sbjct  588   AICHLDTSSWSPTHGAFVALGSGPGRIEVCHWIFENDLTWTTAD  631



>gb|EYU22487.1| hypothetical protein MIMGU_mgv1a002927mg [Erythranthe guttata]
Length=624

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 120/221 (54%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK G  + MP   D +LP RSFLP  I   +P + S   E+++IF    
Sbjct  404  VEPGKFFRESMLKSGIVMPMPDIRD-KLPKRSFLPRAIISKLPFSTSKIREMEKIFHAGQ  462

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
               +    +  +L  C       E   C+ ++EDMI FS   LG +++   T++ T+G  
Sbjct  463  DSSMANI-LTNTLNECERKPSPHETKRCVASIEDMIDFSTSVLG-RNVVVHTTENTRGS-  519

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
            N  + IG VK     K  K ++CH+  FP+  YYC+ +P  R+Y+  + +PK    +N  
Sbjct  520  NGNITIGKVKGVNGGKVTKSVSCHQSLFPYMLYYCHSVPKVRVYEAVILDPKSRAKINNG  579

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L   PGK EVCHWI + D+ W
Sbjct  580  VAICHLDTSSWSPGHGAFIALGSGPGKIEVCHWIFENDMTW  620



>ref|XP_006439797.1| hypothetical protein CICLE_v10019363mg [Citrus clementina]
 gb|ESR53037.1| hypothetical protein CICLE_v10019363mg [Citrus clementina]
Length=608

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 122/224 (54%), Gaps = 8/224 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASEL---QRIFPTAF  518
             V+P  FFR  +LK+G+ + MP   D ++P RSFLP  I+  +P   S+L   + IF    
Sbjct  388   VEPGKFFRESMLKQGNVMVMPDIRD-KMPRRSFLPRSISSKLPFATSQLTQLKEIFRVRD  446

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
             +  + +  ++ +L  C      GE   C+ ++EDMI F+   LG +++ A T+    G  
Sbjct  447   NSSMERVILN-ALAECERAPSPGETKRCVGSVEDMIDFATSVLG-RNVVARTTQNANGSK  504

Query  699   NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
              +V +  +  +   K  K ++CH+  +P+  YYC+ +P  R+Y+ DV +      +N  +
Sbjct  505   RRVTISSVSGINGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADVLDVVSNAKINHGV  564

Query  873   VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
              ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W   D
Sbjct  565   AICHIDTSSWSPGHGAFVALGSGPGQIEVCHWIFENDMTWTSAD  608



>ref|XP_009394250.1| PREDICTED: BURP domain-containing protein 12-like [Musa acuminata 
subsp. malaccensis]
Length=646

 Score =   150 bits (378),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 118/218 (54%), Gaps = 7/218 (3%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIP  527
            V+P  FFR   L+ G+ + MP   D ++P RSFLP  IA  I  +A+E+QR F       
Sbjct  429  VEPGKFFREHELRSGNLMPMPDIRD-KMPARSFLPRSIAGRIAFSAAEVQRFFGIPADTA  487

Query  528  LTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQV  707
            L KA  D ++  C     +GE   C  + ED+I F+   LG  ++   +++ T G     
Sbjct  488  LGKAVAD-TVAECERAPSRGETKRCTTSAEDVIDFAVAMLG-SNVVGRSTESTAGS-KGT  544

Query  708  VMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVI  878
            V+IG V+      +   ++CH+  FP+  YYC+ +P  R+Y  D+   +    +N+ + I
Sbjct  545  VLIGKVRGVNGGGVTRSVSCHQSLFPYLVYYCHSVPRVRVYVADILAVQTKERINRGVAI  604

Query  879  CHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            CH+DTS W+  H AF  L  +PG+ EVCHWI + D+ W
Sbjct  605  CHLDTSDWSASHGAFLSLGSAPGRIEVCHWIFERDMTW  642



>ref|XP_009415276.1| PREDICTED: BURP domain-containing protein 12-like [Musa acuminata 
subsp. malaccensis]
Length=647

 Score =   150 bits (378),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 116/216 (54%), Gaps = 3/216 (1%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIP  527
            V+P  FFR   L++G  + MP   D ++P RSFLP  IA  IPL+A+E++RIF       
Sbjct  430  VEPGKFFRERDLRRGSVMPMPDIRD-KMPPRSFLPRSIAGRIPLSATEVRRIFGIPADTA  488

Query  528  LTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQV  707
            L +A  D ++  C     + E   C  + ED+I F+   LG   +   T++ T   GN +
Sbjct  489  LGRAVAD-TVAECERAPNRDETKRCATSAEDVIDFAVSVLGSDVVVRSTANTTGSKGNIL  547

Query  708  VMIGNVKPYKT-NKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICH  884
            +            K ++CH+  FP+  YYC+ +P  R+Y+ ++   +    +N  + ICH
Sbjct  548  IGKVGGVNGGKITKSVSCHQSLFPYLVYYCHSVPKVRVYEAEILAVESKEKINHGIAICH  607

Query  885  MDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            +DTS W+  H AF  L  +PGK EVCHWI + D+ W
Sbjct  608  LDTSDWSASHGAFVALGSAPGKIEVCHWIFEGDMTW  643



>gb|KHG01313.1| Polygalacturonase non-catalytic subunit protein [Gossypium arboreum]
Length=616

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 120/220 (55%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASE---LQRIFPTAF  518
            V+P  FFR  +LK+G  + MP   D ++P RSFLP  I   IP ++SE   L+RIF    
Sbjct  395  VEPGKFFREKMLKRGMVIPMPDIKD-KMPARSFLPRTILSKIPFSSSEIDQLKRIFHAGD  453

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  L    +D +L  C      GE   C+ + EDM+ F+   LG +++   T+    G  
Sbjct  454  NSTLGTIMLD-ALKECERLPSPGETKRCVGSAEDMVDFATSVLG-RNVEVRTTQNVNGSK  511

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
              +++  +G +   K  K ++CH+  +P+  YYC+ +P  R+Y+  + +P  M  +N  +
Sbjct  512  KNIMIGSVGKIDGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEAGILDPDSMEKINHGV  571

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICH+DTS W+  H AF  L   PG+ EVCHWI + D+ W
Sbjct  572  AICHLDTSSWSSGHGAFLALGSGPGRIEVCHWIFENDMTW  611



>ref|XP_009593470.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nicotiana tomentosiformis]
Length=636

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 123/221 (56%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASEL---QRIFPTAF  518
            V+   FFR  +LK+G  + MP   D ++P RSFLP  I+  +P +  EL   + IF    
Sbjct  416  VEEGKFFREAILKEGTVMKMPDIRD-KMPRRSFLPRTISSKLPFSTQELSNMKTIFHAQE  474

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + +  ++ +L  C   + +GE   C+ ++EDMI F+   LG  ++   T+D   G  
Sbjct  475  NSTMERVIIN-ALAECERASSQGETKRCVGSVEDMIDFAISVLG-HNVVVRTADNVVGS-  531

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + VMIG V+     ++   ++CH+  +P+  YYC+ +P  R+Y+ D+ N +    +N  
Sbjct  532  KEKVMIGKVEGINGGRVTQSVSCHQSLYPYLLYYCHSVPKVRVYEADILNVETKAKINHG  591

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W
Sbjct  592  VAICHIDTSAWSPGHGAFVALGSGPGRIEVCHWIFENDMTW  632



>ref|XP_009775426.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nicotiana sylvestris]
Length=638

 Score =   149 bits (376),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/225 (35%), Positives = 124/225 (55%), Gaps = 10/225 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNA---SELQRIFPTAF  518
             V+   FFR  +LK+G  + MP   D ++P RSFLP  I+  +P +    S+L+ IF    
Sbjct  418   VEEGKFFRESMLKEGTVMKMPDIRD-KMPGRSFLPRTISSKLPFSTKELSDLKTIFHAQE  476

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
             +  + +  ++ +L  C     +GE   C+ ++EDMI F+   LG  ++   T+D   G  
Sbjct  477   NSTMERVILN-ALAECERAPSQGETKRCVGSVEDMIDFAVSVLG-HNVVVRTTDNVVGS-  533

Query  699   NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
              + VMIG VK     ++   ++CH+  +P+  YYC+ +P  R+Y+ D+ N +    +N  
Sbjct  534   KEKVMIGKVKGINGGRVTQSVSCHQSLYPYLLYYCHSVPKVRVYEADILNVETKAKINHG  593

Query  870   LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
             + ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W   D
Sbjct  594   VAICHIDTSAWSPGHGAFVALGSGPGRIEVCHWIFENDMTWATAD  638



>gb|KEH20006.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=644

 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 125/226 (55%), Gaps = 12/226 (5%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
             V P  FFR  +LK+G  + MP   D +LP RSFLP  I   +P  +S   E++++F  + 
Sbjct  424   VQPGKFFREKMLKEGTVMPMPDIRD-KLPPRSFLPRSILTKLPFASSKLNEMKQVFKVSE  482

Query  519   SIPLTKAAMDKSLGYCN-APAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGM  695
             +  + K  +D +L  C  AP+V GE   C+ +LEDMI F+   LG  H   + S      
Sbjct  483   NSSMNKMMVD-ALSECERAPSV-GETKRCVGSLEDMIDFATSVLG--HSVTVRSTENVNG  538

Query  696   GNQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNK  866
               + VM+G VK     K+   ++CH+  FP+  YYC+ +P+  +Y+ D+ +P     +N 
Sbjct  539   AGKDVMVGKVKGINGGKVTESVSCHQSLFPYLLYYCHSVPNVHVYEADLLDPVSKAKINH  598

Query  867   FLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
              + ICH+DT+ W+  H AF  L  +PG+ EVCHWI + D+ W   D
Sbjct  599   GVAICHLDTTAWSSTHGAFMALGSAPGQIEVCHWIFENDMTWSSAD  644



>emb|CDP00165.1| unnamed protein product [Coffea canephora]
Length=631

 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 117/221 (53%), Gaps = 22/221 (10%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +L+ G  + MP   D ++P RSFLP  I   +P + S   EL++IF  A 
Sbjct  423  VEPGKFFREKMLRTGTVMPMPDIKD-KMPKRSFLPRVILSKLPFSTSKIGELKKIFHAAD  481

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
               +    M  SLG C      GE   C+ + EDMI F+  +             T+G G
Sbjct  482  DSKMA-GLMADSLGECERAPSPGETKRCVGSGEDMIDFATSS-------------TQGSG  527

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
              + +IG+V+     K+   ++CH+  FP+  YYC+ +P  R+Y  D+ +PK    +N  
Sbjct  528  GNI-LIGSVEGINGGKVTKSVSCHQSLFPYLLYYCHSVPKVRVYQADILDPKTKDKINHG  586

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L   PGK EVCHWI + D+ W
Sbjct  587  VAICHVDTSSWSPGHGAFIALGSGPGKIEVCHWIFENDMTW  627



>gb|EEC84370.1| hypothetical protein OsI_30914 [Oryza sativa Indica Group]
Length=658

 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 117/219 (53%), Gaps = 8/219 (4%)
 Frame = +3

Query  351  DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPL  530
            +P  FFR   L  G+++ MP   D + P R+FLP +IA  IP +A+ +  +F  A    +
Sbjct  441  EPGKFFRERDLVAGNRMPMPDIAD-RTPPRAFLPRDIAAKIPFDAAAVSALFGAAPGTAM  499

Query  531  TKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVV  710
             +  +  ++  C  P  +GE   C  + ED++ F+ E LG   +A  T     G G+  V
Sbjct  500  -RQVVSSTVAECARPPSRGETKRCATSAEDVVDFAVEMLGDNVVARATESTAGGGGD--V  556

Query  711  MIGNVK--PYKTN--KIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVI  878
             +G V   P   N  + ++CH+  FP+  YYC+ +P+ R+Y+ D+        +N  + I
Sbjct  557  RLGRVAGVPAGGNVTRSVSCHQSLFPYLVYYCHSVPTVRVYEADILAVDSNQRINHGVAI  616

Query  879  CHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
            CH+DTS W+P H AF  L   PG+ EVCHWI Q D+ W 
Sbjct  617  CHLDTSDWSPNHGAFIALGGKPGEMEVCHWIFQGDMTWT  655



>ref|XP_011009539.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Populus euphratica]
Length=633

 Score =   149 bits (375),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 77/221 (35%), Positives = 125/221 (57%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASEL---QRIFPTAF  518
            V+P  FFR  +LK+G ++ MP   D ++P RSFLP  I   IP + S++   + IF  + 
Sbjct  411  VEPGKFFRESMLKEGSEMPMPDIRD-KMPKRSFLPRSIISKIPFSTSKMGLIKEIFHASD  469

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + +  +D ++  C      GE   C+ + ED+I F    LG +++A  T+D  +G  
Sbjct  470  NSSMERIILD-AVEECERAPSPGETKRCVGSAEDLIDFVISVLG-RNVAVRTTDNVEGS-  526

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + V IG++K     +  K ++CH+  +P+  YYC+ +P  R+Y+ D+ +P     +N  
Sbjct  527  KKNVTIGSIKGINGGRVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADLLDPNSKTKINHG  586

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W
Sbjct  587  VAICHLDTSSWSPTHGAFLALGSGPGRIEVCHWIFENDMTW  627



>gb|EPS60630.1| polygalacturonase-1 non-catalytic subunit beta, partial [Genlisea 
aurea]
Length=595

 Score =   148 bits (374),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 125/236 (53%), Gaps = 13/236 (6%)
 Frame = +3

Query  303  PPPGVKIYNFGFTGKVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLN  482
            P  G K+ N      V+P  FFR  +LK G  + MP   D ++P RSFLP  IA  +P +
Sbjct  366  PSSGKKVVN----KWVEPGKFFRESMLKSGTIMPMPDIRD-KMPKRSFLPRSIASKLPFS  420

Query  483  AS---ELQRIFPTAFSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGG  653
             S   E+  IF            +  SL  C      GE   C+ ++EDMI F+   LG 
Sbjct  421  TSKIAEIAAIFRAGDGESKLSETIANSLRECERAPSPGETKRCVSSIEDMIDFATSVLG-  479

Query  654  KHLAALTSDYTKGMGNQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYD  824
            ++ AA T+  T G G ++  IG VK     +  K ++CH+  +P+  YYC+ +P  R+Y+
Sbjct  480  RNSAARTTATTAGSGGEI-KIGEVKGIAGGRVTKSVSCHQSLYPYLLYYCHSVPKVRVYE  538

Query  825  VDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             D+ +PK    +N  + ICH+DT+ W+P H AF  L   PGK EVCHWI Q D+ W
Sbjct  539  ADLLHPKTDSKINHGVAICHIDTTSWSPDHGAFIALGPGPGKIEVCHWIFQNDMTW  594



>ref|XP_004300895.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Fragaria vesca subsp. vesca]
Length=634

 Score =   149 bits (375),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 77/221 (35%), Positives = 121/221 (55%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK+G+ + MP  +  ++P RSFLP  I   +P + S   EL+ +F    
Sbjct  413  VEPGKFFRESMLKQGNVMVMPD-IKDKMPERSFLPRTILSKLPFSTSRMSELKELFHVG-  470

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
                T+  +  +L  C      GE   C+ ++EDMI FS   LG  ++   T++  +G  
Sbjct  471  DNSATERVITNTLTECERAPSPGETKYCVGSVEDMIDFSVSVLG-HNVVVRTTENVRGS-  528

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + VMIG V      ++   ++CH+  +P+  YYC+ +P  R+Y+ D+ + +    +N  
Sbjct  529  KKNVMIGKVIGINGGRVTESVSCHQSLYPYLLYYCHSVPKVRVYEADIVDVESRNKINHA  588

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L  SPG  EVCHWI + D+ W
Sbjct  589  VAICHLDTSAWSPGHGAFVALGSSPGNTEVCHWIFENDMTW  629



>ref|NP_001062896.2| Os09g0329000 [Oryza sativa Japonica Group]
 sp|Q6K2M1.2|BURPE_ORYSJ RecName: Full=BURP domain-containing protein 14; Short=OsBURP14; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAF24810.2| Os09g0329000 [Oryza sativa Japonica Group]
Length=690

 Score =   149 bits (376),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 117/219 (53%), Gaps = 8/219 (4%)
 Frame = +3

Query  351  DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPL  530
            +P  FFR   L  G+++ MP   D + P R+FLP +IA  IP +A+ +  +F  A    +
Sbjct  473  EPGKFFRERDLVAGNRMPMPDIAD-RTPPRAFLPRDIAAKIPFDAAAVSALFGAAPGTAM  531

Query  531  TKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVV  710
             +  +  ++  C  P  +GE   C  + ED++ F+ E LG   +A  T     G G+  V
Sbjct  532  -RQVVSSTVAECARPPSRGETKRCATSAEDVVDFAVEMLGDNVVARATESTAGGGGD--V  588

Query  711  MIGNVK--PYKTN--KIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVI  878
             +G V   P   N  + ++CH+  FP+  YYC+ +P+ R+Y+ D+        +N  + I
Sbjct  589  RLGRVAGVPAGGNVTRSVSCHQSLFPYLVYYCHSVPTVRVYEADILAVDSNQKINHGVAI  648

Query  879  CHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
            CH+DTS W+P H AF  L   PG+ EVCHWI Q D+ W 
Sbjct  649  CHLDTSDWSPNHGAFIALGGKPGEMEVCHWIFQGDMTWT  687



>ref|XP_004956601.1| PREDICTED: BURP domain-containing protein 14-like [Setaria italica]
Length=683

 Score =   149 bits (375),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 114/216 (53%), Gaps = 4/216 (2%)
 Frame = +3

Query  354  PSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPLT  533
            P  FFR   L  G+++ MP   D +LP+R+FLP +IA  IP     +  +F       + 
Sbjct  467  PGKFFRERDLMTGNRMPMPDIAD-KLPHRAFLPRDIAAKIPFEEGAVSALFGAPPGTAM-  524

Query  534  KAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVM  713
            +  +  ++  C     +GE   C  + EDM+ F+ E LG  ++A  +++ T G G  V +
Sbjct  525  RQVVASTVAECARAPSRGETKRCATSAEDMVDFAVEMLGSSNIAVRSTESTAGSGRDVRL  584

Query  714  --IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHM  887
              I  V      + ++CH+  FP+  YYC+ +P  R+Y+ D+ +      +N  + ICH+
Sbjct  585  GKITGVAGGGVTRSVSCHQSLFPYLVYYCHSVPRVRLYEADILDVDSNRRINHGVAICHL  644

Query  888  DTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
            DTS W+P H AF  L   PG+ EVCHWI + D+ W 
Sbjct  645  DTSDWSPNHGAFVALGGKPGEIEVCHWIFEGDMTWT  680



>ref|XP_002318036.2| hypothetical protein POPTR_0012s08060g [Populus trichocarpa]
 gb|EEE96256.2| hypothetical protein POPTR_0012s08060g [Populus trichocarpa]
Length=637

 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 77/222 (35%), Positives = 127/222 (57%), Gaps = 10/222 (5%)
 Frame = +3

Query  345  KVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNA---SELQRIFPTA  515
            +V+P  FFR  +LK G+ + MP   D ++P RSFLP  I   +P +    ++L+ +F  +
Sbjct  414  RVEPGKFFRESMLKPGNVMVMPDIRD-KMPERSFLPRSIVSKLPFSTTKMAKLKDLFHAS  472

Query  516  FSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGM  695
             +  +T+  ++ +L  C      GE   C+ ++EDMI F+   LG  ++   T++   G 
Sbjct  473  DNSTMTRVLIN-ALAECERAPSHGETKRCVGSVEDMIDFAVSVLG-HNVTVRTTENVNG-  529

Query  696  GNQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNK  866
              + VMIG+V+     +  K ++CH+  +P+  YYC+ +P  R+Y+ D+ + +    +N 
Sbjct  530  SKKRVMIGSVEGINGGQVTKSVSCHQSLYPYLLYYCHSVPRVRVYEADIVDVESKEKINV  589

Query  867  FLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             + ICH+DTS W P+H AF  L  SPGK EVCHWI + D+ W
Sbjct  590  GVAICHVDTSAWGPEHGAFVALGSSPGKIEVCHWIFENDMTW  631



>ref|XP_002314620.2| hypothetical protein POPTR_0010s05000g [Populus trichocarpa]
 gb|EEF00791.2| hypothetical protein POPTR_0010s05000g [Populus trichocarpa]
Length=633

 Score =   148 bits (373),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 122/220 (55%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASEL---QRIFPTAF  518
            V+P  FFR  +LK+G ++ MP   D ++P RSFLP  I   IP + S++   + IF  + 
Sbjct  411  VEPGKFFRESMLKEGSEMPMPDIRD-KMPKRSFLPRSIISKIPFSTSKMGLIKEIFHASD  469

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + +  +D ++  C      GE   C+ + ED+I F    LG +++A  T+D  +G  
Sbjct  470  NSSMERIILD-AVEECERAPSPGETKRCVGSAEDLIDFVISVLG-RNVAVRTTDNVEGSK  527

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
              V +  I  +   +  K ++CH+  +P+  YYC+ +P  R+Y+ D+ +P     +N  +
Sbjct  528  KNVTIGTIKGINGGRVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADLLDPNSKTKINHGV  587

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W
Sbjct  588  AICHLDTSSWSPTHGAFLALGSGPGRIEVCHWIFENDMTW  627



>ref|XP_010678748.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Beta vulgaris subsp. vulgaris]
Length=628

 Score =   148 bits (373),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 123/220 (56%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRI---FPTAF  518
            V+   FFR  +LK G  + MP +++ ++P RSFLP  ++  +P + SEL  +   F    
Sbjct  408  VEEGKFFRESMLKPGTVMKMP-NIEDKMPKRSFLPRVLSSKLPFSTSELVELRGTFKAKE  466

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  L +  ++ +LG C  P  +GE   C+ ++EDMI F+   LG  ++   T++   G G
Sbjct  467  NSTLERVIVN-ALGECERPPSQGETKKCVASVEDMIDFAISVLG-DNVVVRTTENVHGSG  524

Query  699  NQVV--MIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             QVV  ++  +   K  K ++CH+   P+  YYC+ +P  R+Y+ D+ + +    +N+ +
Sbjct  525  KQVVIGLVRGINGGKVTKSVSCHQSLLPYLLYYCHSVPKVRVYEADILDMENKSKINQGV  584

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICH+DTS W+  H AF  L   PG  EVCHWI + D+ W
Sbjct  585  AICHLDTSAWSAGHGAFLTLGSGPGLIEVCHWIFENDMTW  624



>ref|XP_011044316.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Populus euphratica]
Length=637

 Score =   148 bits (373),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 125/221 (57%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPL---NASELQRIFPTAF  518
            V+P  FFR  +LK+G+ + MP   D ++P RSFLP  I   +P    N ++L+ +F  + 
Sbjct  415  VEPGKFFRESMLKQGNVIVMPDIRD-KMPERSFLPRSIVSKLPFSTTNMAKLKDLFHASA  473

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
               +T+  ++ +L  C      GE   C+ ++EDMI F+   LG +++   T++   G  
Sbjct  474  KSTMTRVLVN-ALTECERVPSPGETKRCVGSVEDMIDFAVSVLG-RNVTVRTTENING-S  530

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + VMIG+V+     K  K ++CH+  +P+  YYC+ +P  R+Y+ D+ +      +N  
Sbjct  531  KKRVMIGSVEGINGGKVTKSVSCHQSLYPYLLYYCHSVPRVRVYEADIVDVASKEKINVG  590

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W  +H AF  L  SPGK EVCHWI + D+ W
Sbjct  591  VAICHLDTSAWGSEHGAFVALGSSPGKIEVCHWIFENDMTW  631



>ref|XP_006303930.1| hypothetical protein CARUB_v10008588mg [Capsella rubella]
 gb|EOA36828.1| hypothetical protein CARUB_v10008588mg [Capsella rubella]
Length=623

 Score =   148 bits (373),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 120/221 (54%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK+G  + MP   D ++P RSFLP  I   +P + S   E++R+F  A 
Sbjct  403  VEPGKFFRESMLKEGTLIWMPDVKD-KMPKRSFLPRSIVSKLPFSTSKIAEIKRVFH-AR  460

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
                 +  +  +L  C      GE   C+ + EDMI F+   LG + +   T++   G  
Sbjct  461  DNSTMEGIITNALTECERSPTIGETKRCVGSAEDMIDFATSVLG-RSVVVRTTESVAGS-  518

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + VMIG VK     K  K ++CH+  +P+  YYC+ +P  R+Y+ D+ + K    +N  
Sbjct  519  KEKVMIGKVKGINGGKVTKAVSCHQSLYPYLLYYCHSVPKVRVYESDILDLKSKAKINHG  578

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W   H AF  L+ SPG+ EVCHWI + D+ W
Sbjct  579  IAICHIDTSAWGANHGAFVSLRSSPGQIEVCHWIFENDMNW  619



>ref|XP_006390895.1| hypothetical protein EUTSA_v10018277mg [Eutrema salsugineum]
 gb|ESQ28181.1| hypothetical protein EUTSA_v10018277mg [Eutrema salsugineum]
Length=627

 Score =   148 bits (373),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 117/220 (53%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            ++P  FFR   LK+G  + MP   D ++P RSFLP  I   +P + S   E++RIF    
Sbjct  407  IEPGKFFRESTLKEGTVIPMPDIRD-KMPKRSFLPRSIISKLPFSTSKIGEIKRIFHAGD  465

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +     D ++  C  PA  GE   C+ + EDMI F+   LG + +   T++   G  
Sbjct  466  NSTMENIISD-AVKECERPASVGETKRCVGSAEDMIDFATSVLG-RSVVLRTTENVAGSK  523

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             +VV+  +  +   K  K ++CH+  +P+  YYC+ +P  R+Y+ D+        +N  +
Sbjct  524  QKVVIGKVNGINGGKLTKAVSCHQSLYPYLLYYCHSVPKVRVYEADLLELNSKTKINHGI  583

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICHMDTS W P H AF  L   PG+ EVCHWI + D+ W
Sbjct  584  AICHMDTSSWGPTHGAFLALGSKPGRIEVCHWIFENDMNW  623



>ref|XP_010028282.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Eucalyptus grandis]
 gb|KCW83445.1| hypothetical protein EUGRSUZ_B00367 [Eucalyptus grandis]
Length=643

 Score =   148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/221 (35%), Positives = 121/221 (55%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSI-  524
            V+P  FFR   L+ G  + MP  +D ++P RSFLP  IA  +P +   LQ +    F++ 
Sbjct  423  VEPGRFFRESELRPGTVMQMPDIVD-KMPRRSFLPRAIASKLPFSTQRLQEV-KELFAVQ  480

Query  525  --PLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
                T+  +  +L  C  P  +GE   C+ + EDM+ F+   LG + +   T++   G  
Sbjct  481  EGSATEHVILNALRECERPPSRGEMKRCVGSAEDMVDFASSILG-RSITVRTTENVNGS-  538

Query  699  NQVVMIGNVKPYKTN---KIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q V+IG+V+  K     K ++CH+  +P+  YYC+ +P  ++Y+ D+ N      +N  
Sbjct  539  KQKVVIGSVRGIKGGEPTKSVSCHQSLYPYLLYYCHAVPKVKVYEADILNFVGRSRINHG  598

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W
Sbjct  599  VAICHLDTSSWSPDHGAFVALGSRPGQIEVCHWIFENDMTW  639



>ref|XP_008346742.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=630

 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 121/221 (55%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIP---LNASELQRIFPTAF  518
            V+P  FFR  +L++G+ + MP   D ++P RSFLP  I   +P   L  SE++ IF    
Sbjct  410  VEPGKFFRESMLRQGNVMVMPDIRD-RMPERSFLPRGILSKLPFSTLRMSEIKEIFHAPE  468

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + +  +  +L  C      GE   C+ ++EDMI F+   L  +++   T+    G  
Sbjct  469  NSAMERV-LTNALAECERDPSPGETKRCVGSVEDMIDFAVSVLD-RNVVVRTTKNVSGS-  525

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q VMIG V    +  I   ++CH+  +P+  YYC+ +P  R+Y+ D+ + +    +N  
Sbjct  526  KQKVMIGAVSGINSGNITKSVSCHQSLYPYLLYYCHSVPRVRVYEADILDVESKSKINHG  585

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICHMDTS W+P H AF  L  SPGK EVCHWI + D+ W
Sbjct  586  VAICHMDTSSWSPGHGAFVALGSSPGKIEVCHWIFENDMTW  626



>ref|XP_010101197.1| hypothetical protein L484_015001 [Morus notabilis]
 gb|EXB87871.1| hypothetical protein L484_015001 [Morus notabilis]
Length=637

 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/222 (36%), Positives = 118/222 (53%), Gaps = 10/222 (5%)
 Frame = +3

Query  345  KVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNA---SELQRIFPTA  515
            +V+   FFR   LKKG+ + MP   D ++  RSFLP  +   +P +     EL+ IF   
Sbjct  415  RVEEGKFFRESALKKGNVMAMPDIRD-KMRKRSFLPRYLLTKLPFSKMRLDELKVIFHAQ  473

Query  516  FSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGM  695
                + +  +D +L  C      GE   C+ + EDMI F+   LG + +A  T++   G 
Sbjct  474  DGSAMERVIID-ALDECERAPSPGETKRCVGSAEDMIDFAISVLG-RDVAVRTTENVSGS  531

Query  696  GNQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNK  866
              +V MIG V+      +   ++CH+ FFP+  YYC+ +P  R+Y+ D+ + K    +N 
Sbjct  532  KGEV-MIGKVRGINGGNVTKSVSCHQSFFPYLLYYCHSVPKVRVYEADILDVKSKAKINH  590

Query  867  FLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             + ICH+DTS W P H AF  L   PGK EVCHWI + D+ W
Sbjct  591  GIAICHLDTSSWAPSHGAFVALGSGPGKIEVCHWIFENDMTW  632



>ref|NP_001061692.1| Os08g0380100 [Oryza sativa Japonica Group]
 sp|Q6ZA27.1|BURPC_ORYSJ RecName: Full=BURP domain-containing protein 12; Short=OsBURP12; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD05416.1| putative polygalacturonase isoenzyme 1 beta subunit homolog [Oryza 
sativa Japonica Group]
 dbj|BAF23606.1| Os08g0380100 [Oryza sativa Japonica Group]
 dbj|BAG95253.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96203.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 115/218 (53%), Gaps = 7/218 (3%)
 Frame = +3

Query  351  DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPL  530
            +P  FFR   L  G+ + MP   D ++P R+FLP +IA+ IP   + +  +F       +
Sbjct  411  EPGKFFRETELVSGNTMPMPDIKD-KMPPRAFLPRDIAKKIPFKPNAVSEVFGVPLDTAM  469

Query  531  TKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVV  710
             KA +  ++  C     +GE   C  + ED++ F+ E LG   +   ++  T G G Q+ 
Sbjct  470  GKA-VTSTVAECERAPSRGETKRCATSAEDIVDFAVEMLG-NDIVVRSTASTAGSGGQI-  526

Query  711  MIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVIC  881
             +GNV      K+   ++CH+  FP+  YYC+ +P  R+Y+ D+        +N  + IC
Sbjct  527  RLGNVTGVDGGKVTRSVSCHQSLFPYLVYYCHSVPKVRVYEADIMAADSDQKINHGVAIC  586

Query  882  HMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
            H+DTS W+P H AF  L   PG+ EVCHWI + D+ W 
Sbjct  587  HLDTSDWSPTHGAFIALGGKPGEVEVCHWIFEGDMTWT  624



>ref|XP_002890594.1| hypothetical protein ARALYDRAFT_472637 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66853.1| hypothetical protein ARALYDRAFT_472637 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   147 bits (371),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 119/221 (54%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK+   + MP   D ++P RSFLP  I   +P + S   E++R+F    
Sbjct  403  VEPGKFFRESLLKESSLIWMPDIKD-KMPKRSFLPRNIVSKLPFSTSKIAEIKRVFHAKD  461

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +     D ++  C      GE   C+ + EDMI F+   LG +++   T++   G  
Sbjct  462  NSTMAGIITD-AVTECERSPTIGETKRCVGSAEDMIDFATSVLG-RNVVLRTTESVAGS-  518

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q VMIG VK     +  K ++CH+  +P+  YYC+ +P  RIY+ D+ +PK    +N  
Sbjct  519  KQKVMIGKVKGINGGRVTKSVSCHQSLYPYLLYYCHSVPKVRIYESDLLDPKSKAKINHG  578

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICHMDTS W   H AF  L   PG+ EVCHWI + D+ W
Sbjct  579  IAICHMDTSAWGANHGAFMSLGSRPGQIEVCHWIFENDMNW  619



>ref|NP_173788.1| putative polygalacturonase non-catalytic subunit JP630 [Arabidopsis 
thaliana]
 sp|P92982.2|JP630_ARATH RecName: Full=Probable polygalacturonase non-catalytic subunit 
JP630; AltName: Full=Aromatic-rich glycoprotein JP630; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAC98031.1| Identical to gb|ATU59467 aromatic rich glycoprotein which is 
strongly similar to gb|U63373 polygalacturonase isozyme 1 from 
Arabidopsis thaliana. EST gb|AA395212 comes from this gene 
[Arabidopsis thaliana]
 gb|AEE30429.1| putative polygalacturonase non-catalytic subunit JP630 [Arabidopsis 
thaliana]
Length=622

 Score =   147 bits (371),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 119/221 (54%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK+G  + MP  +  ++P RSFLP  I   +P + S   E++R+F    
Sbjct  402  VEPGKFFRESMLKEGTLIWMPD-IKDKMPKRSFLPRSIVSKLPFSTSKIAEIKRVFHAND  460

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +     D ++  C  P    E   C+ + EDMI F+   LG + +   T++   G  
Sbjct  461  NSTMEGIITD-AVRECERPPTVSETKRCVGSAEDMIDFATSVLG-RSVVLRTTESVAGS-  517

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + VMIG V      +  K ++CH+  +P+  YYC+ +P  R+Y+ D+ +PK    +N  
Sbjct  518  KEKVMIGKVNGINGGRVTKSVSCHQSLYPYLLYYCHSVPKVRVYESDLLDPKSKAKINHG  577

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICHMDTS W   H AF LL   PG+ EVCHWI + D+ W
Sbjct  578  IAICHMDTSAWGANHGAFMLLGSRPGQIEVCHWIFENDMNW  618



>dbj|BAE99852.1| putative polygalacuronase isoenzyme 1 beta subunit [Arabidopsis 
thaliana]
Length=622

 Score =   147 bits (371),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 119/221 (54%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK+G  + MP  +  ++P RSFLP  I   +P + S   E++R+F    
Sbjct  402  VEPGKFFRESMLKEGTLIWMPD-IKDKMPKRSFLPRSIVSKLPFSTSKIAEIKRVFHAND  460

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +     D ++  C  P    E   C+ + EDMI F+   LG + +   T++   G  
Sbjct  461  NSTMEGIITD-AVRECERPPTVSETKRCVGSAEDMIDFATSVLG-RSVVLRTTESVAGS-  517

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + VMIG V      +  K ++CH+  +P+  YYC+ +P  R+Y+ D+ +PK    +N  
Sbjct  518  KEKVMIGKVNGINGGRVTKSVSCHQSLYPYLLYYCHSVPKVRVYESDLLDPKSKAKINHG  577

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICHMDTS W   H AF LL   PG+ EVCHWI + D+ W
Sbjct  578  IAICHMDTSAWGANHGAFMLLGSRPGQIEVCHWIFENDMNW  618



>gb|KDP26582.1| hypothetical protein JCGZ_17740 [Jatropha curcas]
Length=625

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 120/221 (54%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNA---SELQRIFPTAF  518
            V+P  FFR  +LKKG  + MP   D ++P R+FLP  I   +P +    S+L++IF    
Sbjct  405  VEPGKFFRESMLKKGSVMPMPDIRD-KMPKRAFLPRWIVSKLPFSTDQISQLKQIFNAGD  463

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
               +    +D ++  C      GE   C+ + ED+I F+   LG ++    T++   G  
Sbjct  464  GSSMETIILD-AIKECERAPSPGETKRCVGSAEDLIDFATSVLG-RNAVVWTTENVSGS-  520

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + VMIG VK     K  K ++CH+  +P+  YYC+ +P  R+Y+ D+ +P     +N  
Sbjct  521  KKDVMIGTVKGMNGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADILDPNSKEKINHG  580

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W
Sbjct  581  VAICHLDTSSWSPTHGAFLALGSGPGQIEVCHWIFENDMTW  621



>ref|XP_009105700.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Brassica rapa]
Length=627

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 118/221 (53%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            ++P  FFR   LK+G  + MP   D ++P RSFLP  I   +P + S   E+ +IF    
Sbjct  407  IEPGKFFREASLKEGTVIPMPDIKD-KMPKRSFLPRSIISKLPFSTSKLAEINKIFHAGE  465

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + K   D       +P+V GE   C+ + EDMI F+   LG + +   T++   G  
Sbjct  466  NSTMEKIISDAVTECERSPSV-GETKRCVGSAEDMIDFATSVLG-RSVVLRTTENVAGS-  522

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q VMIG V      K  K ++CH+  +P+  YYC+ +P  R+Y+ D+ + K    +N  
Sbjct  523  KQKVMIGKVNGINGGKVTKAVSCHQSLYPYLMYYCHSVPKVRVYEADLLDLKSKTKINHG  582

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICHMDTS W PKH AF  L   PG  EVCHWI + D+ W
Sbjct  583  IAICHMDTSSWGPKHGAFLALGSKPGLIEVCHWIFENDMNW  623



>dbj|BAJ92348.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/218 (34%), Positives = 115/218 (53%), Gaps = 7/218 (3%)
 Frame = +3

Query  351  DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPL  530
            +P  FFR   L  G+++ MP   D ++P R+FLP +IAR IP   + +  +F       +
Sbjct  408  EPGKFFRERELVAGNRMPMPDIRD-KMPPRAFLPRDIARKIPFEPNAVSEVFRVPLDTAM  466

Query  531  TKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVV  710
             KA +  ++  C     +GE   C  + ED++ F+ E LG   +   T+  T G G  + 
Sbjct  467  GKA-VASTVAECERVPSRGETKRCATSAEDIVDFAVEMLGSDIVVHSTAS-TAGSGADI-  523

Query  711  MIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVIC  881
             +GNV      K+   ++CH+  FP+  YYC+ +P  R+Y+ ++        +N  + IC
Sbjct  524  RLGNVTGVHGGKVTRPVSCHQSLFPYLVYYCHSVPKARVYEAEITAADSGQKINHGVAIC  583

Query  882  HMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
            H+DTS W+P H AF  L   PGK EVCHWI + D+ W 
Sbjct  584  HLDTSDWSPAHGAFVALGGKPGKIEVCHWIFEGDMTWT  621



>ref|XP_010460151.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Camelina sativa]
Length=623

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 119/221 (54%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK+G  + MP   D ++P RSFLP  I   +P + S   E++R+F    
Sbjct  403  VEPGKFFRESMLKEGTLIWMPDIKD-KMPKRSFLPRSIVSKLPFSTSKIAEIKRVFHARD  461

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +     D ++  C      GE   C+ + ED+I F+   LG + +   T++   G  
Sbjct  462  NSTMEGIITD-AVTECERLPTVGETKRCVGSAEDIIDFATSVLG-RSVVVRTTESVAGS-  518

Query  699  NQVVMIGNVKPYK---TNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q VMIGNVK        K ++CH+  +P+  YYC+ +P  R+Y+ D+ +PK    +N  
Sbjct  519  KQKVMIGNVKGINGGNVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADLLDPKSKAKINHG  578

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICHMDTS W   H AF  L   PG+ EVCHWI + D+ W
Sbjct  579  IGICHMDTSAWGASHGAFVSLGSRPGQIEVCHWIFENDMNW  619



>gb|KDP31113.1| hypothetical protein JCGZ_11489 [Jatropha curcas]
Length=627

 Score =   147 bits (370),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/221 (35%), Positives = 122/221 (55%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPL---NASELQRIFPTAF  518
            V+P  FFR  +LK+G+ + MP   D ++P RSFLP  I   +P    N SEL++IF    
Sbjct  407  VEPGKFFRESMLKQGNVMVMPDITD-KMPKRSFLPRSIVSKLPFSSSNLSELKQIFHAPE  465

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + +  ++ +L  C     +GE   CL ++EDM+ F+   L   ++   T++   G  
Sbjct  466  NSTMERV-INNALAECERTPSRGETKRCLGSIEDMVDFAVSVLS-HNVVVRTTENVHGS-  522

Query  699  NQVVMIGNVKPYK---TNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + V IG VK        K ++CH+  +P+  YYC+ +P  R+Y+ ++   +    +N  
Sbjct  523  KKNVTIGTVKGINGGAVTKSVSCHQSLYPYLLYYCHSVPKVRVYEAEILEVESKAKINVG  582

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L  SPG+ EVCHWI + D+ W
Sbjct  583  VAICHIDTSAWSPDHGAFVALGSSPGQIEVCHWIFENDMTW  623



>ref|NP_001146063.1| uncharacterized protein LOC100279594 precursor [Zea mays]
 gb|ACL53138.1| unknown [Zea mays]
 gb|ACN33667.1| unknown [Zea mays]
 gb|AFW62083.1| polygalacturonase-1 non-catalytic beta subunit [Zea mays]
Length=643

 Score =   147 bits (370),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/222 (34%), Positives = 116/222 (52%), Gaps = 12/222 (5%)
 Frame = +3

Query  351  DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPL  530
            +P  FFR   L  G+++ MP   D ++P R+FLP  IA  IP   + +      AF +PL
Sbjct  424  EPGKFFRERELVAGNRMPMPDIRD-KMPPRAFLPRAIAARIPFEPNAVSE----AFGLPL  478

Query  531  TKA---AMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGN  701
              A   A+  ++  C     KGE   C  + ED++ F+ E LG   +   T+    G G 
Sbjct  479  DTALGKAVASTVAECERAPSKGETKRCATSAEDVVDFAVEVLGDDIVVRSTASTAGGGGR  538

Query  702  -QVVMIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGT---MNKF  869
             Q+  +  V   +  + ++CH+  FP+  YYC+ +P  R+Y+ D+      G+   +N+ 
Sbjct  539  VQLGAVAGVDGGRVTRSVSCHQSLFPYLVYYCHSVPKVRVYEADILAADGSGSGEKINRG  598

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
            + ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W 
Sbjct  599  VAICHLDTSDWSPAHGAFVALGGKPGEVEVCHWIFEGDMTWT  640



>gb|ACN34141.1| unknown [Zea mays]
Length=643

 Score =   147 bits (370),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/222 (34%), Positives = 116/222 (52%), Gaps = 12/222 (5%)
 Frame = +3

Query  351  DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPL  530
            +P  FFR   L  G+++ MP   D ++P R+FLP  IA  IP   + +      AF +PL
Sbjct  424  EPGKFFRERELVAGNRMPMPDIRD-KMPPRAFLPRAIAARIPFEPNAVSE----AFGLPL  478

Query  531  TKA---AMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGN  701
              A   A+  ++  C     KGE   C  + ED++ F+ E LG   +   T+    G G 
Sbjct  479  DTALGKAVASTVAECERAPSKGETKRCATSAEDVVDFAVEVLGDDIVVRSTASTAGGGGR  538

Query  702  -QVVMIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGT---MNKF  869
             Q+  +  V   +  + ++CH+  FP+  YYC+ +P  R+Y+ D+      G+   +N+ 
Sbjct  539  VQLGAVAGVDGGRVTRSVSCHQSLFPYLVYYCHSVPKVRVYEADILAADGSGSGEKINRG  598

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
            + ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W 
Sbjct  599  VAICHLDTSDWSPAHGAFVALGGKPGEVEVCHWIFEGDMTWT  640



>ref|XP_006300871.1| hypothetical protein CARUB_v10019963mg [Capsella rubella]
 gb|EOA33769.1| hypothetical protein CARUB_v10019963mg [Capsella rubella]
Length=628

 Score =   146 bits (369),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/220 (31%), Positives = 122/220 (55%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASEL---QRIFPTAF  518
            V+   FFR  +LK+G  + MP  +  ++P R+FLP  I   +P ++SE+   +++F    
Sbjct  408  VEEGKFFRESMLKEGTFMQMPD-IKDKMPKRTFLPRSIVSKLPFSSSEIGEIRKVFGAGE  466

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +    +  ++  C  PA  GE   C+ + EDMI F+   LG + +   T++   G  
Sbjct  467  NSSMANIIL-SAVSECERPASHGETKRCVGSAEDMIDFATSVLG-RGVVVRTTENVVGSK  524

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             ++++  +  +      + ++CH+  +P+  YYC+ +P  R+Y+ D+ +P+ +  +N  +
Sbjct  525  KKILIGKVNGINGGNVTRAVSCHQSLYPYLLYYCHSVPRVRVYETDILDPESLEKINHGV  584

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W
Sbjct  585  AICHIDTSAWSPTHGAFLALGSGPGRIEVCHWIFENDMTW  624



>gb|AAB39538.1| aromatic rich glycoprotein JP630 [Arabidopsis thaliana]
Length=622

 Score =   146 bits (369),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 119/221 (54%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK+G  + MP  +  ++P RSFLP  I   +P + S   E++R+F    
Sbjct  402  VEPGKFFRESMLKEGTLIWMPD-IKDKMPKRSFLPCSIVSKLPFSTSKIAEIKRVFHAND  460

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +     D ++  C  P    E   C+ + EDMI F+   LG + +   T++   G  
Sbjct  461  NSTMEGIITD-AVRECERPPTVSETKRCVGSAEDMIDFATSVLG-RSVVLRTTESVAGS-  517

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + VMIG V      +  K ++CH+  +P+  YYC+ +P  R+Y+ D+ +PK    +N  
Sbjct  518  KEKVMIGKVNGINGGRVTKSVSCHQSLYPYLLYYCHSVPKVRVYESDLLDPKSKAKINHG  577

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICHMDTS W   H AF LL   PG+ EVCHWI + D+ W
Sbjct  578  IAICHMDTSAWGANHGAFMLLGSRPGQIEVCHWIFENDMNW  618



>ref|XP_006659367.1| PREDICTED: BURP domain-containing protein 12-like, partial [Oryza 
brachyantha]
Length=495

 Score =   145 bits (367),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/218 (33%), Positives = 114/218 (52%), Gaps = 7/218 (3%)
 Frame = +3

Query  351  DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPL  530
            +P  FFR   L  G+++ MP  +  ++P R+FLP +IA+ IP     +  +F       +
Sbjct  279  EPGKFFREQELVTGNRMPMPD-IKDKMPPRAFLPRDIAKKIPFKPDAVSEVFGVPLDTAM  337

Query  531  TKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVV  710
             KA    ++  C     +GE   C  + ED++ F+ E LG   +   ++  T G G ++ 
Sbjct  338  GKAVA-STVTECERAPSRGETKRCATSAEDIVDFAVEMLG-NDIVVRSTASTAGSGEEI-  394

Query  711  MIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVIC  881
             +GNV      K+   ++CH+  FP+  YYC+ +P  R+Y+ D+        +N  + IC
Sbjct  395  RLGNVTGVDGGKVTRSVSCHQSLFPYLVYYCHSVPKVRVYEADIMAADSDQQINHGVAIC  454

Query  882  HMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
            H+DTS W+P H AF  L   PG+ EVCHWI + D+ W 
Sbjct  455  HLDTSDWSPTHGAFIALGGKPGEVEVCHWIFEGDMTWT  492



>ref|XP_010498883.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Camelina sativa]
Length=633

 Score =   146 bits (369),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 118/221 (53%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR  +LK+G  + MP   D ++P RSFLP  I   +P + S   E++R+F    
Sbjct  413  VEPGKFFRESMLKEGMLIWMPDIKD-KMPKRSFLPRSIVSKLPFSTSKIAEIKRLFHARD  471

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +     D ++  C      GE   C+ + EDMI F+   LG + +   T++   G  
Sbjct  472  NSTMEGIITD-AVTECERLPTVGETKRCVGSAEDMIDFATSVLG-RSVVVRTTESVAGS-  528

Query  699  NQVVMIGNVKPYK---TNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q VMIGNVK        K ++CH+  +P+  YYC+ +P  R+Y+ D+ +PK    +N  
Sbjct  529  KQKVMIGNVKGINGGNVTKSVSCHQSLYPYLLYYCHSVPKVRVYESDLLDPKSKAKINHG  588

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICHMDTS W   H AF  L   PG  EVCHWI + D+ W
Sbjct  589  IAICHMDTSAWGASHGAFVSLGSKPGLIEVCHWIFENDMNW  629



>ref|XP_010427809.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X1 [Camelina sativa]
 ref|XP_010427810.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X2 [Camelina sativa]
Length=625

 Score =   146 bits (368),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 115/221 (52%), Gaps = 9/221 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            ++P  FFR   LK+G  + MP   D ++P RSFLP  I   +P + S   E++RIF  A 
Sbjct  404  IEPGKFFRESSLKEGTVIPMPDIKD-KMPKRSFLPRSIITKLPFSVSKLGEIKRIFHAAG  462

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
                    +  ++  C  P   GE   C+ + EDMI F+   LG + +   T++   G  
Sbjct  463  ENSTMGGLITDAVTECERPPSVGETKRCVGSAEDMIDFATSVLG-RSVVLRTTENVAGS-  520

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q V+IG VK     K  K ++CH+  +P+  YYC+ +P  R+Y+ D+        +N  
Sbjct  521  KQKVVIGKVKGINGGKVTKAVSCHQSLYPYLLYYCHSVPKVRVYEADILEIDSKKKINHG  580

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICHMDTS W   H AF  L   PG+ EVCHWI + D+ W
Sbjct  581  IAICHMDTSSWGATHGAFLALGSKPGRIEVCHWIFENDMNW  621



>emb|CDP12374.1| unnamed protein product [Coffea canephora]
Length=654

 Score =   146 bits (369),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 123/221 (56%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASEL---QRIFPTAF  518
            V+   FFR  +LK G  + MP   D ++P RSFLP  I+  +P + SEL   +RIF    
Sbjct  434  VEEGKFFREYMLKDGTIIKMPDIRD-KMPKRSFLPRLISSKLPFSTSELSAIKRIFHALD  492

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  L +  ++ +L  C   A +GE   C+ ++EDMI F+   LG +++   T++  +G  
Sbjct  493  NSTLERVIVN-ALEECERAASRGESKRCVGSVEDMIDFAVSVLG-RNVVVRTTENVRG-S  549

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             Q VMIG V+     ++   ++CH+  +P+  YYC+ +P  ++Y  D+ +      +N  
Sbjct  550  KQHVMIGKVQGVNGGRVTTSVSCHQSLYPYLLYYCHSVPKVKVYLADILDVVGKTKINHG  609

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L   PG  EVCHWI + D+ W
Sbjct  610  VAICHIDTSAWSPNHGAFVALGSGPGLIEVCHWIFENDMTW  650



>emb|CDY57845.1| BnaA07g38770D [Brassica napus]
Length=627

 Score =   146 bits (368),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 118/220 (54%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            ++P  FFR   LK+G  + MP   D ++P RSFLP  I   +P + S   E+ +IF    
Sbjct  407  IEPGKFFREASLKEGTVIPMPDIKD-KMPKRSFLPRSIISKLPFSTSKLAEINKIFHAGE  465

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + K   D       +P+V GE   C+ + EDMI F+   LG + +   T++   G  
Sbjct  466  NSTMEKIISDAVTECERSPSV-GETKRCVGSAEDMIDFATSVLG-RSVVLRTTENVAGSK  523

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             +VV+  +  +   K  K ++CH+  +P+  YYC+ +P  R+Y+ D+ + K    +N  +
Sbjct  524  QKVVIGKVNGINGGKVTKAVSCHQSLYPYLMYYCHSVPKVRVYEADLLDLKSKTKINHGI  583

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICHMDTS W PKH AF  L   PG  EVCHWI + D+ W
Sbjct  584  AICHMDTSSWGPKHGAFLALGSKPGLIEVCHWIFENDMNW  623



>dbj|BAJ97940.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=752

 Score =   147 bits (371),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 120/222 (54%), Gaps = 9/222 (4%)
 Frame = +3

Query  351   DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIF--PTAFSI  524
             +P  FFR   L  G+++ MP   D ++P R+FLP +IA  IP  A  +  +F  P   ++
Sbjct  536   EPGKFFRERDLITGNRMPMPDITD-KMPPRAFLPRDIATKIPFEAGAVSALFGAPPGNAM  594

Query  525   PLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGN-  701
                +  +  ++  C  P  +GE   C  + EDM+ F+ E LG  ++A  +++   G G  
Sbjct  595   ---RQVVASTVDECARPPSRGETKRCATSAEDMLDFAVEMLG-DNVAVRSTESAAGSGGD  650

Query  702   -QVVMIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVI  878
              +V  +  V      + ++CH+  FP+  YYC+ +PS R+Y+ ++        +N+ + I
Sbjct  651   IRVGRVAGVAGGHATRSVSCHQSMFPYLVYYCHSVPSVRVYEAEILAVDSGRRINRGVAI  710

Query  879   CHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
             CH+DTS W+P H AF  L   PG+ EVCHWI Q D++W   D
Sbjct  711   CHLDTSEWSPGHGAFAALGGKPGEMEVCHWIFQGDMVWTVAD  752



>ref|NP_001064572.1| Os10g0409400 [Oryza sativa Japonica Group]
 sp|Q7XES5.1|BURPG_ORYSJ RecName: Full=BURP domain-containing protein 16; Short=OsBURP16; 
AltName: Full=Protein WGP1; Short=OsWGP1; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAP53713.1| BURP domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26486.1| Os10g0409400 [Oryza sativa Japonica Group]
 gb|EAZ16044.1| hypothetical protein OsJ_31485 [Oryza sativa Japonica Group]
 gb|ABR23532.1| cell wall protein WGP1 [Oryza sativa Japonica Group]
 dbj|BAG99870.1| unnamed protein product [Oryza sativa Japonica Group]
Length=344

 Score =   142 bits (358),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/223 (35%), Positives = 117/223 (52%), Gaps = 7/223 (3%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRS-FLPPEIARNIPLNASELQRIFPTAFSI  524
             + P  FFR   LK+G+ V MP   +     RS FLP  IA  IP  A  ++ +F    + 
Sbjct  123   IKPGIFFREQELKEGNVVRMPDIANELTTARSSFLPRSIADRIPFKAEAVKSLFGLEPNT  182

Query  525   PLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQ  704
              L KA +D+++  C +   KGE   C+ + EDMI F+   LG   +   ++    G G +
Sbjct  183   TLAKA-VDETVAQCQSSPSKGETKRCVTSAEDMIDFAVAMLG-DDIVVRSTVLPNGPG-E  239

Query  705   VVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLV  875
              +MIG VK     KI   ++CHE  FP+  YYC+ +P  R+Y+ ++ + +    +N  + 
Sbjct  240   SIMIGKVKGINGGKITSSVSCHEYLFPYMVYYCHSVPKIRVYEAEILSVQTKEKINSGVA  299

Query  876   ICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
             ICH+DTS W   H AF  L   PG+ +VCHWI    + W+  D
Sbjct  300   ICHIDTSAWNAGHPAFVALGGKPGQNKVCHWIFNGSMTWVIAD  342



>ref|XP_003528153.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Glycine max]
Length=629

 Score =   145 bits (366),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 79/222 (36%), Positives = 123/222 (55%), Gaps = 10/222 (5%)
 Frame = +3

Query  345  KVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTA  515
            +V+P  FFR   +++G+ + MP   D ++P RSFLP  IA  +P ++S   E++ IF  A
Sbjct  408  RVEPGKFFRESTVREGNVIPMPDIKD-KMPARSFLPLAIASKLPFSSSRIDEMREIFH-A  465

Query  516  FSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGM  695
                 T+  M  +L  C     K E   C+ + E+MI F+   LG  ++A  +++   G 
Sbjct  466  REGSSTERVMVNALKECEREPSKDETKRCVSSGEEMIGFAVSVLG-PNVAVRSTENVNGS  524

Query  696  GNQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNK  866
            G+ V MIG V      K  K ++CH+  +P+  YYC+ +P  R+Y+ ++ +      +N 
Sbjct  525  GSSV-MIGKVYAIDGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEAEILDVDTKEMINH  583

Query  867  FLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             + ICH+DTS W P+H AF  L   PGK EVCHWI + D+ W
Sbjct  584  GVAICHLDTSAWGPQHGAFLALGFGPGKIEVCHWIFENDMTW  625



>gb|EPS67761.1| polygalacturonase-1 non-catalytic subunit beta, partial [Genlisea 
aurea]
Length=608

 Score =   145 bits (365),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 120/224 (54%), Gaps = 12/224 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIP  527
            V+P  FFR  +LK G  + MP   D ++P RSFLP  I   +P + S++  I    F  P
Sbjct  384  VEPGKFFRESMLKPGTIMPMPDIRD-KMPKRSFLPRLIVSKLPFSTSKISDI-KKLFRAP  441

Query  528  LT---KAAMDK----SLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYT  686
                  +A+ K    +L  C      GE   C+ ++EDMI F+   LG + +A  T+  T
Sbjct  442  DDGDDDSAISKMVSNALRECERKPSPGETKRCVASIEDMIDFATSVLG-RSVAVRTTATT  500

Query  687  KGMGNQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTM  860
             G   Q+++  I  +   K  K ++CH+  +P+  YYC+ +P  R+Y+ D+ +P     +
Sbjct  501  AGSDGQIMLGRIAGINGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADILDPNTKSKI  560

Query  861  NKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            N  + ICH+DT+ W+P H AF  L   PGK EVCHWI + D+ W
Sbjct  561  NHGVAICHLDTTSWSPDHGAFVALGPGPGKIEVCHWIFENDMNW  604



>ref|XP_004236111.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Solanum lycopersicum]
Length=636

 Score =   145 bits (366),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 115/221 (52%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNA---SELQRIFPTAF  518
            V+   FFR  +LK+G  + MP   D ++P RSFLP  I+  +P +    +ELQ IF  A 
Sbjct  416  VEEGKFFRESMLKEGTVMKMPDIRD-KMPGRSFLPRTISSKLPFSTKELNELQSIF-RAR  473

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
                 +  +  +L  C      GE   C+ ++EDMI F+   LG   +   T +    MG
Sbjct  474  ENSTMEHVIGNTLAECERAPSPGENKQCVASIEDMIDFAVSILGHNVVVRTTDNVAGSMG  533

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
               +MIG VK     +  K ++CH+  +P+  YYC+ +P  R+Y  D+ N      +N  
Sbjct  534  E--IMIGKVKGINGGRVTKSVSCHQSLYPYLLYYCHSVPKVRVYQADILNVDTKVKINHG  591

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L   PG  EVCHWI + D+ W
Sbjct  592  VAICHVDTSSWSPGHGAFVALGSGPGLIEVCHWIFENDMTW  632



>ref|XP_009363551.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X1 [Pyrus x bretschneideri]
Length=646

 Score =   145 bits (366),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/234 (35%), Positives = 122/234 (52%), Gaps = 22/234 (9%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASE---LQRIFPTAF  518
            V+P  FFR  +LKKG  + MP   D ++P RSFLP  I   +P   S+   L++IF  A 
Sbjct  412  VEPGKFFRESMLKKGVVMPMPDIQD-KMPKRSFLPRTILSKLPFATSKIAALKQIFHAAD  470

Query  519  SIPLTKAAMDK-------------SLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKH  659
            +  + K  +D                  C      GE   C+ + EDMI F+   LG ++
Sbjct  471  NSTMEKIIVDALQEXXXXXXXXXXXXXXCERAPSAGETKRCVGSAEDMIDFATTILG-RN  529

Query  660  LAALTSDYTKGMGNQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVD  830
            +   +++   G  + V MIG+VK     K+   ++CH+  FP+  YYC+ +P  R+Y+ D
Sbjct  530  IVVRSTENVNGAKHDV-MIGSVKGINGGKVTQSVSCHQSLFPYLLYYCHSVPKVRVYEAD  588

Query  831  VANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + +P     +N  + ICH+DTS W+P H +F  L   PG+ EVCHWI Q D+ W
Sbjct  589  LLDPVSKAKVNHGVAICHLDTSAWSPTHGSFLALGSGPGRIEVCHWIFQNDMTW  642



>ref|XP_011071835.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Sesamum indicum]
Length=635

 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 121/225 (54%), Gaps = 10/225 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASEL---QRIFPTAF  518
             V+   FFR  +LK+G  + MP+  D  +P RSFLP  I   +P + SEL   +R F    
Sbjct  415   VEEGKFFRESMLKEGTVMKMPNIRD-WMPKRSFLPRPITSKLPFSTSELVELKRTFHIED  473

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
             +  +    M+ +L  C      GE   C+ ++EDMI F+   LG   +   T++  KG  
Sbjct  474   NSTMEHVVMN-ALAECERAPSTGENKRCVGSVEDMIDFAVSVLG-HDVVVRTTEGVKGS-  530

Query  699   NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             +Q VMIG VK     +  K ++CH+  +P+  YYC+ +P  R+Y+ D+   +    +N  
Sbjct  531   SQDVMIGKVKGINGGRVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADILEVETKTKINHG  590

Query  870   LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
             + ICH+DTS W+P+H AF  L   PG  EVCHWI + D+ W   D
Sbjct  591   VAICHLDTSMWSPRHGAFLALGSGPGLIEVCHWIFENDMNWTTAD  635



>gb|ACG28762.1| polygalacturonase-1 non-catalytic beta subunit precursor [Zea 
mays]
Length=642

 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/220 (34%), Positives = 115/220 (52%), Gaps = 10/220 (5%)
 Frame = +3

Query  351  DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPL  530
            +P  FFR   L  G+++ MP   D ++P R+FLP  IA  IP   + +      AF +PL
Sbjct  425  EPGKFFRERELVAGNRMPMPDIRD-KMPPRAFLPRAIAARIPFEPNAVSE----AFGLPL  479

Query  531  TKA---AMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGN  701
              A   A+  ++  C     KGE   C  + ED++ F+ E LG   +   T+    G G 
Sbjct  480  DTALGKAVASTVAECERAPSKGETKRCATSAEDVVDFAVEVLGDDIVVRSTASTAGGGGR  539

Query  702  -QVVMIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGT-MNKFLV  875
             Q+  +  +   +  + ++CH+  FP+  YYC+ +P  R+Y+ D+      G  +N+ + 
Sbjct  540  VQLGAVAGMDGGRVTRSVSCHQSLFPYLVYYCHSVPKVRVYEADILAADGSGEKINRGVA  599

Query  876  ICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
            ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W 
Sbjct  600  ICHLDTSDWSPAHGAFVALGGKPGEVEVCHWIFEGDMTWT  639



>ref|XP_002888771.1| hypothetical protein ARALYDRAFT_894840 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65030.1| hypothetical protein ARALYDRAFT_894840 [Arabidopsis lyrata subsp. 
lyrata]
Length=626

 Score =   144 bits (364),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 116/220 (53%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            ++P  FFR   LK+G  + MP   D ++P RSFLP  I   +P + S   E++RIF    
Sbjct  406  IEPGKFFRESSLKEGTVIPMPDIKD-KMPKRSFLPRSIITKLPFSTSKLGEIKRIFHAGE  464

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +     D ++  C  P   GE   C+ + EDMI F+   LG + +   T++   G  
Sbjct  465  NSTMEGIITD-AVTECERPPSVGETKRCVGSAEDMIDFATSVLG-RSVVLRTTENVAGSK  522

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             +VV+  +  +   K  K ++CH+  +P+  YYC+ +P  R+Y+ D+        +N  +
Sbjct  523  QKVVIGKVNGINGGKLTKAVSCHQSLYPYLLYYCHSVPKVRVYEADLLELNSKKKINHGI  582

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICHMDTS W P H AF  L   PG+ EVCHWI + D+ W
Sbjct  583  AICHMDTSSWGPSHGAFLALGSKPGRIEVCHWIFENDMNW  622



>emb|CDY23501.1| BnaC06g24700D [Brassica napus]
Length=625

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 117/220 (53%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            ++P  FFR   LK+G  + MP   D ++P RSFLP  I   +P + S   E++ IF    
Sbjct  405  IEPGKFFRESTLKEGTVIAMPDIKD-KMPKRSFLPRSIVSKLPFSTSKLAEVKMIFHAGD  463

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + K   D ++  C  P   GE   C+ + EDMI F+   LG + +   T++   G  
Sbjct  464  NSSMEKIISD-AVTECERPPSVGETKRCVGSAEDMIDFATSVLG-RSVVLRTTENVAGSK  521

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             +VV+  +  +   K  K ++CH+  +P+  YYC+ +P  R+Y+ D+        +N  +
Sbjct  522  QKVVIGKVNGINGGKLTKAVSCHQSLYPYLLYYCHSVPKVRVYEADLLELNSKTKINHGI  581

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W
Sbjct  582  AICHIDTSSWSPGHGAFLALGSKPGRIEVCHWIFENDMNW  621



>ref|XP_010415713.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Camelina sativa]
Length=624

 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 115/220 (52%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            ++P  FFR   LK+G  + MP   D ++P RSFLP  I   +P + S   E++RIF    
Sbjct  404  IEPGKFFRESSLKEGTVIPMPDIKD-KMPKRSFLPRSIITKLPFSVSKLGEIKRIFHAGE  462

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +     D ++  C  P   GE   C+ + EDMI F+   LG + +   T+D   G  
Sbjct  463  NSTMGGLITD-AVTECERPPSVGETKRCVGSAEDMIDFATSVLG-RSVVLRTTDNVAGSK  520

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             +VV+  +  +   K  K ++CH+  +P+  YYC+ +P  R+Y+ D+        +N  +
Sbjct  521  QKVVIGKVNGINGGKVTKAVSCHQSLYPYLLYYCHSVPKVRVYEADILEIDSKKKINHGI  580

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICHMDTS W   H AF  L   PG+ EVCHWI + D+ W
Sbjct  581  AICHMDTSSWGATHGAFLALGSKPGRIEVCHWIFENDMNW  620



>ref|XP_010471032.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X2 [Camelina sativa]
Length=624

 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 115/220 (52%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            ++P  FFR   LK+G  + MP   D ++P RSFLP  I   +P + S   E++RIF    
Sbjct  404  IEPGKFFRESSLKEGTVIPMPDIKD-KMPKRSFLPRTIITKLPFSVSKLGEIKRIFHAGE  462

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +     D ++  C  P   GE   C+ + EDMI F+   LG + +   T+D   G  
Sbjct  463  NSTMGGLITD-AVTECERPPSVGETKRCVGSAEDMIDFATSVLG-RSVVLRTTDNVAGSK  520

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             +VV+  +  +   K  K ++CH+  +P+  YYC+ +P  R+Y+ D+        +N  +
Sbjct  521  QKVVIGKVNGINGGKVTKAVSCHQSLYPYLLYYCHSVPKVRVYEADILEIDSKKKINHGI  580

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICHMDTS W   H AF  L   PG+ EVCHWI + D+ W
Sbjct  581  AICHMDTSSWGATHGAFLALGSKPGRIEVCHWIFENDMNW  620



>gb|AAB39546.1| polygalacturonase isoenzyme 1 beta subunit homolog [Arabidopsis 
thaliana]
Length=626

 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 116/220 (53%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            ++P  FFR   LK+G  + MP   D ++P RSFLP  I   +P + S   E++RIF    
Sbjct  406  IEPGKFFRESSLKEGTVIPMPDIKD-KMPKRSFLPRSIITKLPFSTSKLGEIKRIFHAVE  464

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +     D ++  C  P   GE   C+ + EDMI F+   LG + +   T++   G  
Sbjct  465  NSTMGGIITD-AVTECERPPSVGETKRCVGSAEDMIDFATSVLG-RSVVLRTTENVAGSK  522

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             +VV+  +  +   K  K ++CH+  +P+  YYC+ +P  R+Y+ D+        +N  +
Sbjct  523  EKVVIGKVNGINGGKLTKAVSCHQSLYPYLLYYCHSVPKVRVYEADLLELNSKKKINHGI  582

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICHMDTS W P H AF  L   PG+ EVCHWI + D+ W
Sbjct  583  AICHMDTSSWGPSHGAFLALGSKPGRIEVCHWIFENDMNW  622



>ref|NP_177194.1| polygalacturonase 2 [Arabidopsis thaliana]
 ref|NP_001185361.1| polygalacturonase 2 [Arabidopsis thaliana]
 sp|P92990.2|JP650_ARATH RecName: Full=Probable polygalacturonase non-catalytic subunit 
JP650; AltName: Full=Aromatic-rich glycoprotein JP650; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAC18803.1| Identical to polygalacuronase isoenzyme 1 beta subunit homolog 
mRNA gb|U63373. EST gb|AA404878 comes from this gene [Arabidopsis 
thaliana]
 dbj|BAE98965.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35050.1| polygalacturonase 2 [Arabidopsis thaliana]
 gb|AEE35051.1| polygalacturonase 2 [Arabidopsis thaliana]
Length=626

 Score =   144 bits (362),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 116/220 (53%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            ++P  FFR   LK+G  + MP   D ++P RSFLP  I   +P + S   E++RIF    
Sbjct  406  IEPGKFFRESSLKEGTVIPMPDIKD-KMPKRSFLPRSIITKLPFSTSKLGEIKRIFHAVE  464

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +     D ++  C  P   GE   C+ + EDMI F+   LG + +   T++   G  
Sbjct  465  NSTMGGIITD-AVTECERPPSVGETKRCVGSAEDMIDFATSVLG-RSVVLRTTENVAGSK  522

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             +VV+  +  +   K  K ++CH+  +P+  YYC+ +P  R+Y+ D+        +N  +
Sbjct  523  EKVVIGKVNGINGGKLTKAVSCHQSLYPYLLYYCHSVPKVRVYEADLLELNSKKKINHGI  582

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICHMDTS W P H AF  L   PG+ EVCHWI + D+ W
Sbjct  583  AICHMDTSSWGPSHGAFLALGSKPGRIEVCHWIFENDMNW  622



>ref|XP_010471031.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X1 [Camelina sativa]
Length=624

 Score =   144 bits (362),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 115/220 (52%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            ++P  FFR   LK+G  + MP   D ++P RSFLP  I   +P + S   E++RIF    
Sbjct  404  IEPGKFFRESSLKEGTVIPMPDIKD-KMPKRSFLPRTIITKLPFSVSKLGEIKRIFHAGE  462

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +     D ++  C  P   GE   C+ + EDMI F+   LG + +   T+D   G  
Sbjct  463  NSTMGGLITD-AVTECERPPSVGETKRCVGSAEDMIDFATSVLG-RSVVLRTTDNVAGSK  520

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             +VV+  +  +   K  K ++CH+  +P+  YYC+ +P  R+Y+ D+        +N  +
Sbjct  521  QKVVIGKVNGINGGKVTKAVSCHQSLYPYLLYYCHSVPKVRVYEADILEIDSKKKINHGI  580

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICHMDTS W   H AF  L   PG+ EVCHWI + D+ W
Sbjct  581  AICHMDTSSWGATHGAFLALGSKPGRIEVCHWIFENDMNW  620



>gb|KFK41456.1| hypothetical protein AALP_AA2G132700 [Arabis alpina]
Length=617

 Score =   144 bits (362),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/220 (35%), Positives = 117/220 (53%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            ++P  FFR  VLK+G  + MP   D ++P RSFLP  I   +P + S   E+++IF    
Sbjct  397  IEPGKFFRESVLKEGTVIPMPDIKD-KMPKRSFLPRSIITKLPFSTSKIGEIKKIFHAGE  455

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +     +       AP+V GE   C+ + EDMI F+   LG + +   T++   G  
Sbjct  456  NSTMGNIITEAVTECERAPSV-GETKRCVGSAEDMIDFATSVLG-RTVVVRTTENVAGSK  513

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             QVV+  +  +   K  K ++CH+  +P+  YYC+ +P  ++Y+ D+        +N  +
Sbjct  514  QQVVVGKVNGINGGKVTKAVSCHQSLYPYLMYYCHSVPKVKVYEADLLELNSKKKINHGI  573

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICHMDTS W P H AF  L   PG+ EVCHWI + D+ W
Sbjct  574  AICHMDTSSWGPSHGAFLALGSKPGRIEVCHWIFENDMNW  613



>ref|XP_004973305.1| PREDICTED: BURP domain-containing protein 12-like [Setaria italica]
Length=647

 Score =   144 bits (362),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 116/221 (52%), Gaps = 9/221 (4%)
 Frame = +3

Query  351  DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPL  530
            +P  FFR   L  G+++ MP   D ++P R+FLP +IA  IP + + +  +F       +
Sbjct  427  EPGKFFRERELVAGNRMPMPDIRD-KMPPRAFLPRDIAAKIPFDPNAVSEVFGVPLDTAM  485

Query  531  TKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVV  710
             KA +  ++  C     KGE   C  + ED++ F+ E LG   +   T+  T G G  + 
Sbjct  486  GKA-VASTVAECQRAPSKGETKRCATSAEDIVDFAVEMLGNDVVVRSTAS-TAGSGGDIR  543

Query  711  M--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMG----TMNKFL  872
            +  +  V   K  + ++CH+  FP+  YYC+ +P  R+Y+ D+ +    G     +N  +
Sbjct  544  LGAVTGVDGGKVTQSVSCHQSLFPYLVYYCHSVPKVRVYEADIMSAAADGGSGEKINHGV  603

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
             ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W 
Sbjct  604  AICHLDTSDWSPTHGAFVALGGKPGEVEVCHWIFEGDMTWT  644



>gb|EMS58973.1| hypothetical protein TRIUR3_16136 [Triticum urartu]
Length=514

 Score =   143 bits (360),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/218 (34%), Positives = 112/218 (51%), Gaps = 7/218 (3%)
 Frame = +3

Query  351  DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPL  530
            +P  FFR   L  G+++ MP   D + P  S LP +IAR IP   + +  +F       +
Sbjct  298  EPGKFFRERELVAGNRMPMPDIRDKRPPGAS-LPRDIARKIPFELNAVSEVFRVPLDTAM  356

Query  531  TKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVV  710
             KA +  ++  C     +GE   C  + ED++ F+ E LG   +   T+  T G G  + 
Sbjct  357  GKA-VASTVAECERAPSQGETKRCATSAEDIVDFAVEMLGSDIVVHSTAS-TAGSGADI-  413

Query  711  MIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVIC  881
             +GNV      K+   ++CH+  FP+  YYC+ +P  R+Y+ D+        +N  + IC
Sbjct  414  RLGNVTGVHGGKVTRPVSCHQSLFPYLVYYCHSVPKARVYEADITAADSGQKINHGVAIC  473

Query  882  HMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
            H+DTS W+P H AF  L   PGK EVCHWI + D+ W 
Sbjct  474  HLDTSDWSPAHGAFIALGGKPGKIEVCHWIFEGDMTWT  511



>ref|XP_008453099.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Cucumis melo]
Length=648

 Score =   144 bits (362),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/221 (35%), Positives = 120/221 (54%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR   LK+G+ + MP   D ++P RSFLP  I  N+P ++S   E + +F  A 
Sbjct  428  VEPGKFFRESELKQGNVMVMPDIRD-KMPPRSFLPRAILVNLPFSSSRISEAKEMFH-AR  485

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
                 ++ +  +L  C     +GE   C+ + EDMI F+   LG + +   T++      
Sbjct  486  DGSTMESVITNALAECERAPSRGETKRCVGSAEDMIDFATTVLGRRVVVRTTANVNGSK-  544

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + V IG VK      +   ++CH+  +P+  YYC+ +P  RIY+ D+   +    +N+ 
Sbjct  545  -EKVEIGRVKGINGGNLTRSVSCHQSLYPYLLYYCHSVPKVRIYEADILRVETKEKINRG  603

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W P+H AF  L  SPG+ EVCHWI + D+ W
Sbjct  604  VAICHIDTSSWGPEHGAFVALGSSPGQIEVCHWIFENDMSW  644



>ref|XP_006345047.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Solanum tuberosum]
Length=642

 Score =   143 bits (361),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/221 (35%), Positives = 119/221 (54%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNA---SELQRIFPTAF  518
            V+   FFR  +LK+G  + MP   D ++P RSFLP  I+  +P +    +EL+ IF    
Sbjct  422  VEEGKFFRESMLKEGTVMKMPDIRD-KMPGRSFLPRSISSKLPFSTKELTELKSIFHAQE  480

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + +  +  +L  C      GE+  C+ ++EDMI F+   LG  ++   T+D   G  
Sbjct  481  NSTM-EHVIGNTLAECERAPSLGEKKQCVASMEDMIDFAVSILG-HNVVVRTTDNVAGSK  538

Query  699  NQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             +V MIG VK     +  K ++CH+  +P+  YYC+ +P  ++Y  D+ N      +N  
Sbjct  539  GEV-MIGKVKGINGGRVTKSVSCHQSLYPYLLYYCHSVPKVKVYQADILNVDTKAKINHG  597

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W+P H AF  L   PG  EVCHWI + D+ W
Sbjct  598  VAICHVDTSSWSPGHGAFVALGSGPGLIEVCHWIFENDMTW  638



>gb|KCW86724.1| hypothetical protein EUGRSUZ_B03335 [Eucalyptus grandis]
Length=207

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 111/218 (51%), Gaps = 24/218 (11%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIP  527
            ++P  +FR  +L+ G+ + MP  L  + P RSFLP  I+  +P + S+L           
Sbjct  7    LEPGKYFRESMLRSGNMIRMPD-LRVKAPQRSFLPRSISSGLPFSTSKL-----------  54

Query  528  LTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQV  707
                     L  C    ++GE   C+ ++E MI F+   LG  H   L S  +     + 
Sbjct  55   -------AELNQCEQAPIQGETKRCVSSVEGMIDFATSILG--HDIQLHSTESVEGSKRE  105

Query  708  VMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVI  878
            ++IG VK  + +K    +ACHE  FP+  YYC+  P+ RIY+ D+ +P     +N  + +
Sbjct  106  ILIGRVKRLEGSKSSAPVACHETIFPYMVYYCHTFPTLRIYEADILDPMSKAKINHGIAL  165

Query  879  CHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            CHMDTS W+P HVAF  L  SPG+ E CH +     +W
Sbjct  166  CHMDTSIWSPNHVAFLALGSSPGQIEACHCVFGDYGVW  203



>ref|XP_008374449.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=629

 Score =   142 bits (359),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 77/221 (35%), Positives = 120/221 (54%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIP---LNASELQRIFPTAF  518
            V+P  FFR  +L++G+ + MP   D ++P RSFLP  I   +P   L  SE++ IF    
Sbjct  409  VEPGKFFRESMLRQGNVMVMPDIRD-RMPERSFLPRGILSKLPFSTLRMSEIKEIFHAPE  467

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + +  +  +L  C      GE   C+ ++EDMI F+   L  +++   T++   G  
Sbjct  468  NSAMERV-LTNALAECERDPSPGETKRCVASVEDMIDFAVLVLD-RNVVVRTTENVSG-S  524

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + VMIG V       I   ++CH+  +P+  YYC+ +P  R+Y+ D+ + +    +N  
Sbjct  525  KRKVMIGAVSGINGGNITKSVSCHQSLYPYLLYYCHSVPRVRVYEADILDVESKSKINHG  584

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH DTS W+P H AF  L  SPGK EVCHWI + D+ W
Sbjct  585  VAICHXDTSSWSPGHGAFVALGSSPGKIEVCHWIFENDMTW  625



>ref|XP_006300881.1| hypothetical protein CARUB_v10019971mg [Capsella rubella]
 gb|EOA33779.1| hypothetical protein CARUB_v10019971mg [Capsella rubella]
Length=625

 Score =   142 bits (359),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 115/220 (52%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            ++P  FFR   LK+G  + MP   D ++P RSFLP  I   +P + S   E++RIF    
Sbjct  405  IEPGKFFREASLKEGTVIPMPDIKD-KMPKRSFLPRSIITKLPFSTSKLGEIKRIFHAGE  463

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  +     D ++  C  P   GE   C+ + EDMI F+   LG + +   T++   G  
Sbjct  464  NSTMGGIITD-AVTECERPPSVGETKRCVGSAEDMIDFATSVLG-RSVVLRTTENVAGSK  521

Query  699  NQVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             +VV+  +  +   K  K ++CH+  +P+  YYC+ +P  R+Y+ D+        +N  +
Sbjct  522  QKVVIGKVNGINGGKVTKAVSCHQSLYPYLMYYCHSVPKVRVYEADLLELDSKKKINHGI  581

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICHMDTS W   H AF  L   PG+ EVCHWI + D+ W
Sbjct  582  AICHMDTSSWGASHGAFLALGSKPGRIEVCHWIFENDMNW  621



>gb|AES58800.2| dehydration-responsive protein RD22 [Medicago truncatula]
Length=297

 Score =   138 bits (348),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 108/189 (57%), Gaps = 6/189 (3%)
 Frame = +3

Query  441  SFLPPEIARNIPLNASELQRIFPTAFSIPLTKAA---MDKSLGYCNAPAVKGERGSCLKT  611
            +FLP E+A +IP ++++++ I    FSI    A    + +++GYC  P ++GE  SC+ +
Sbjct  111  TFLPREVANSIPFSSNKVENIL-NYFSIKQGSAESENLKQAIGYCETPTIEGEEKSCVTS  169

Query  612  LEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGNVKPYKTNKIIACHEIFFPFATYY  791
            LE M+ F+   LG    A  T    +    Q ++   VK    NKI+ CH + +P+A +Y
Sbjct  170  LESMVDFTTSKLGNNVEAVSTEANKESDKQQYIIAKGVKKLSENKIVVCHLLSYPYAVFY  229

Query  792  CYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWI  971
            C+KL +T++Y + +      GT  K   ICH DTS W+PKH+AF +LK+ PG   VCH++
Sbjct  230  CHKLRATKVYYLPMEGID--GTKVKTAAICHNDTSQWSPKHLAFHVLKVQPGTVPVCHFL  287

Query  972  TQMDLIWIG  998
                +IW  
Sbjct  288  QHGHVIWFS  296



>ref|XP_003588549.1| BURP domain-containing protein [Medicago truncatula]
Length=305

 Score =   138 bits (348),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 108/187 (58%), Gaps = 6/187 (3%)
 Frame = +3

Query  441  SFLPPEIARNIPLNASELQRIFPTAFSIPLTKAA---MDKSLGYCNAPAVKGERGSCLKT  611
            +FLP E+A +IP ++++++ I    FSI    A    + +++GYC  P ++GE  SC+ +
Sbjct  119  TFLPREVANSIPFSSNKVENIL-NYFSIKQGSAESENLKQAIGYCETPTIEGEEKSCVTS  177

Query  612  LEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGNVKPYKTNKIIACHEIFFPFATYY  791
            LE M+ F+   LG    A  T    +    Q ++   VK    NKI+ CH + +P+A +Y
Sbjct  178  LESMVDFTTSKLGNNVEAVSTEANKESDKQQYIIAKGVKKLSENKIVVCHLLSYPYAVFY  237

Query  792  CYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWI  971
            C+KL +T++Y + +      GT  K   ICH DTS W+PKH+AF +LK+ PG   VCH++
Sbjct  238  CHKLRATKVYYLPMEGID--GTKVKTAAICHNDTSQWSPKHLAFHVLKVQPGTVPVCHFL  295

Query  972  TQMDLIW  992
                +IW
Sbjct  296  QHGHVIW  302



>ref|XP_004501939.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cicer arietinum]
Length=627

 Score =   142 bits (358),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 122/229 (53%), Gaps = 13/229 (6%)
 Frame = +3

Query  336  FTGK-----VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQR  500
            F+GK     V+P  FFR  +LK+G+ + MP   D ++P R FLP  I+  +P ++S L  
Sbjct  398  FSGKIVNRFVEPGKFFRESMLKEGNVMMMPDIKD-KMPARMFLPLTISSKLPFSSSRLGE  456

Query  501  IFPT--AFSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALT  674
            +     A     T+  +  +LG C       E   C+ + E MI+F+   LG  ++   T
Sbjct  457  VKEAFHAREGSATERVIINALGECERAPSMDETKRCVGSAEGMIEFAVSVLG-PNVVVRT  515

Query  675  SDYTKGMGNQVVMIGNV---KPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPK  845
            ++  KG     VMIG V      K  K ++CH+  +P+  YYC+ +P  R+Y+ D+ +  
Sbjct  516  TESVKGS-KTSVMIGKVYGIDGGKVTKSVSCHQSLYPYLLYYCHSVPKVRVYEADILDVD  574

Query  846  KMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
                +N+ + ICH+DTS W P+H AF  L   PGK EVCHWI + D+ W
Sbjct  575  TKKKINQGVAICHIDTSAWGPEHGAFSALGSGPGKIEVCHWIFENDMTW  623



>ref|XP_008652571.1| PREDICTED: BURP domain-containing protein 14-like [Zea mays]
 tpg|DAA61067.1| TPA: hypothetical protein ZEAMMB73_635092 [Zea mays]
Length=679

 Score =   142 bits (359),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/216 (32%), Positives = 115/216 (53%), Gaps = 5/216 (2%)
 Frame = +3

Query  351  DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPL  530
            +P  FFR   L  G+++ MP   D ++P R+FLP +IA  IP   + +  +F       +
Sbjct  463  EPGKFFRERDLMMGNRMPMPDIAD-KMPRRAFLPRDIATKIPFEENAVSALFGAPPGTAM  521

Query  531  TKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVV  710
             +  +  ++  C  P   GE   C  + EDM+ F+ E LG  ++A  +++ T G G  V 
Sbjct  522  -RQVVASTVAECARPPSPGETKRCTTSAEDMLDFAVEMLG-SNIAVRSTESTAGSGRDVR  579

Query  711  M--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICH  884
            +  I  +      + ++CH+  FP+  YYC+ +P  R+Y+ D+ +      +N  + ICH
Sbjct  580  LGKITGIAGGSVTRSVSCHQSLFPYLVYYCHSVPRVRLYEADILDVDSNRKINHGVAICH  639

Query  885  MDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            ++TS W+P H AF  L   PG+ EVCHWI + D+ W
Sbjct  640  LETSDWSPNHGAFVALGGKPGQIEVCHWIFEGDMAW  675



>ref|XP_002460065.1| hypothetical protein SORBIDRAFT_02g022220 [Sorghum bicolor]
 gb|EER96586.1| hypothetical protein SORBIDRAFT_02g022220 [Sorghum bicolor]
Length=691

 Score =   142 bits (359),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/216 (32%), Positives = 116/216 (54%), Gaps = 5/216 (2%)
 Frame = +3

Query  351  DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPL  530
            +P  FFR   L  G+++ MP   D ++P+R+FLP +IA  IP   + +  +F       +
Sbjct  475  EPGKFFRERDLMMGNRMPMPDIAD-KMPHRAFLPRDIAAKIPFEENAVSALFGAPPGTAM  533

Query  531  TKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVV  710
             +  +  ++  C  P   GE   C  + EDM+ F+ E LG  ++A  +++ T G G  V 
Sbjct  534  -RQVVASTVAECARPPSLGETKRCTTSAEDMLDFAVEMLG-SNIAVRSTESTAGGGGDVR  591

Query  711  M--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICH  884
            +  I  +      + ++CH+  FP+  YYC+ +P  R+Y+ D+ +      +N  + ICH
Sbjct  592  LGKITGIAGGSVTRSVSCHQSLFPYLVYYCHSVPRVRLYEADILDVDSNRKINHGVAICH  651

Query  885  MDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            ++TS W+P H AF  L   PG+ EVCHWI + D+ W
Sbjct  652  LETSDWSPSHGAFVALGGKPGQIEVCHWIFEGDMAW  687



>gb|EEC77314.1| hypothetical protein OsI_15976 [Oryza sativa Indica Group]
Length=202

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 107/203 (53%), Gaps = 6/203 (3%)
 Frame = +3

Query  405   MPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPLTKAAMDKSLGYCNAPAVK  584
             MP   +     RSFLP  IA  IP  A  ++ +F    +  L KA +D+++  C +   K
Sbjct  1     MPDITNESTTARSFLPRSIADRIPFEAEAVKPLFGLEPNTTLAKA-VDETVAQCQSSPSK  59

Query  585   GERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGNVKPYKTNKI---IA  755
             GE   C+ + EDMI F+   LG   +   ++    G G + +MIG VK   + KI   ++
Sbjct  60    GETKRCVTSAEDMIDFAVAMLG-DDIVVRSTVLPNGSG-ESIMIGKVKGINSGKITSSVS  117

Query  756   CHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLK  935
             CHE  FP+  Y C+ +P  R+Y+ ++ + +    +N  + +CH+DTS W+  H AF  L 
Sbjct  118   CHEYLFPYMVYSCHSVPKIRVYEAEILSVQTKEKINSGVAVCHIDTSAWSAGHPAFVALG  177

Query  936   LSPGKGEVCHWITQMDLIWIGYD  1004
               PG+ EVCHWI    + W+  D
Sbjct  178   GKPGQNEVCHWIYNGSMTWVIAD  200



>ref|XP_004138283.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cucumis sativus]
 gb|KGN63588.1| Polygalacturonase-1 non-catalytic subunit beta [Cucumis sativus]
Length=645

 Score =   141 bits (356),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/221 (34%), Positives = 119/221 (54%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR   LK+G+ + MP   D ++P RSFLP  I  N+P ++S   E + +F  A 
Sbjct  425  VEPGKFFRESELKQGNVMVMPDIKD-KMPPRSFLPRSILVNLPFSSSRISEAKEMFH-AR  482

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
                 ++ +  +L  C     +GE   C+ + EDMI F+   LG + +   T++      
Sbjct  483  DGSTMESVITNALAECERAPSRGETKRCVGSAEDMIDFATTVLGQRVVVRTTANVNGSK-  541

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + + IG VK      +   ++CH+  +P+  YYC+ +P  RIY+ D+   +    +N+ 
Sbjct  542  -EKIEIGRVKGINGGDLTRSVSCHQSLYPYLLYYCHSVPKVRIYEADILKMETKEKINRG  600

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W P+H AF  L   PG+ EVCHWI + D+ W
Sbjct  601  VAICHIDTSSWGPEHGAFVALGSGPGQIEVCHWIFENDMSW  641



>ref|XP_006392169.1| hypothetical protein EUTSA_v10023352mg [Eutrema salsugineum]
 gb|ESQ29455.1| hypothetical protein EUTSA_v10023352mg [Eutrema salsugineum]
Length=622

 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 121/220 (55%), Gaps = 8/220 (4%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASE---LQRIFPTAF  518
            V+   FFR  +LK+G  + MP   D ++P R+FLP  I  N+P ++ E   ++RIF    
Sbjct  402  VETGKFFRESMLKEGTSMQMPDIKD-KMPKRTFLPRAIVSNLPFSSPETGKIRRIFGAGE  460

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
            +  + +  +  ++  C      GE   C+ + EDMI F+   LG + +   T++   G  
Sbjct  461  NSSMAEI-ISSAISECERLPSHGETKRCVGSAEDMIDFATSVLG-RGVVVRTTENVVGSK  518

Query  699  NQVVMIGNVKPYKTN--KIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
             ++V+         N  + ++CH+  +P+  YYC+ +P  R+Y+ D+ +P+ +  +N  +
Sbjct  519  KKIVIGKVKGINGGNLTRAVSCHQSLYPYLLYYCHSVPRVRVYETDILDPENLEKINHGV  578

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             ICH+DTS W+P H AF  L  SPG+ EVCHWI + D+ W
Sbjct  579  AICHIDTSAWSPSHGAFLALGSSPGRIEVCHWIFENDMTW  618



>ref|XP_004166494.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cucumis sativus]
Length=688

 Score =   141 bits (356),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/221 (34%), Positives = 119/221 (54%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
            V+P  FFR   LK+G+ + MP   D ++P RSFLP  I  N+P ++S   E + +F  A 
Sbjct  468  VEPGKFFRESELKQGNVMVMPDIKD-KMPPRSFLPRSILVNLPFSSSRISEAKEMFH-AR  525

Query  519  SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
                 ++ +  +L  C     +GE   C+ + EDMI F+   LG + +   T++      
Sbjct  526  DGSTMESVITNALAECERAPSRGETKRCVGSAEDMIDFATTVLGQRVVVRTTANVNGSK-  584

Query  699  NQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + + IG VK      +   ++CH+  +P+  YYC+ +P  RIY+ D+   +    +N+ 
Sbjct  585  -EKIEIGRVKGINGGDLTRSVSCHQSLYPYLLYYCHSVPKVRIYEADILKMETKEKINRG  643

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W P+H AF  L   PG+ EVCHWI + D+ W
Sbjct  644  VAICHIDTSSWGPEHGAFVALGSGPGQIEVCHWIFENDMSW  684



>ref|XP_003574428.1| PREDICTED: BURP domain-containing protein 12 [Brachypodium distachyon]
Length=623

 Score =   140 bits (354),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/219 (32%), Positives = 115/219 (53%), Gaps = 9/219 (4%)
 Frame = +3

Query  351  DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPL  530
            +P  FFR   L  G+++ MP   D ++P R+FLP +I+R IP   + +  +F     +PL
Sbjct  407  EPGKFFREKELVAGNRMPMPDIRD-KMPPRAFLPRDISRKIPFEPNAVSEVF----GVPL  461

Query  531  TKA---AMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGN  701
              A   A+  ++  C+    +GE   C  + ED++ F+ E LG   +   T+      G+
Sbjct  462  DSAMGKAVASTVAECDRAPSQGETKRCATSAEDIVDFAVEMLGNDIVVHSTASPAGSGGD  521

Query  702  -QVVMIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVI  878
             ++  +  V   K  + ++CH+  FP+  YYC+ +P  R+Y  ++        +N  + I
Sbjct  522  IRLGSVTGVDGGKVTRSVSCHQSLFPYLVYYCHSVPKVRVYAAEIMAVDSDQKINHGVAI  581

Query  879  CHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
            CH+DTS W+P H AF  L   PG+ EVCHWI + D+ W 
Sbjct  582  CHLDTSDWSPAHGAFVALGGKPGETEVCHWIFEGDMTWT  620



>ref|XP_003601289.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES71540.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=628

 Score =   140 bits (353),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 116/221 (52%), Gaps = 10/221 (5%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSI-  524
            V+P  FFR  +LK+G+ + MP  +  ++P RSFLP  I+  +P ++S L  I   AF   
Sbjct  408  VEPGKFFRESMLKEGNVMVMPD-IGDKMPARSFLPLSISSKLPFSSSRLSEI-KEAFHAR  465

Query  525  --PLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
                T+  +  +L  C      GE   C+ + E MI FS   LG  ++   T++   G  
Sbjct  466  DGSATERVIFNALKECEREPSVGETKRCVGSAEGMIDFSVSILG-PNVVVKTTENVNGS-  523

Query  699  NQVVMIGNVKPYKTNKII---ACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKF  869
             + VMIG V      K+I   +CH   +P+  YYC+ +P  R+Y+ D+ +      +N  
Sbjct  524  KRTVMIGKVDATDGGKVIKSVSCHPSLYPYLLYYCHSVPKVRVYEADILDVDTKSKINHG  583

Query  870  LVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            + ICH+DTS W  KH AF  L   PGK EVCHWI + D+ W
Sbjct  584  VAICHIDTSSWGSKHGAFLALGSGPGKIEVCHWIFENDMTW  624



>gb|EPS68955.1| hypothetical protein M569_05812, partial [Genlisea aurea]
Length=592

 Score =   139 bits (351),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 122/238 (51%), Gaps = 11/238 (5%)
 Frame = +3

Query  303  PPPGVKIYNFGFTGKVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLN  482
            P PG           V    FFR   L++G+ + M +++   +P RSFLP  I   +P +
Sbjct  356  PTPGHNAAAAAAAAAVPEGKFFRETTLREGNTIRM-ANIRDWMPERSFLPRTITSKLPFS  414

Query  483  AS---ELQRIFPTAFSIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGG  653
                 +L+R+F    +  L    +  +L  C      GE   C+ ++EDMI F+   LG 
Sbjct  415  KGKLVQLKRLFRAKDNSTLDHI-LAAALAECGRAPSPGETKRCVASVEDMIDFAVSTLG-  472

Query  654  KHLAALTSDYTKGMGNQVVMIGNVKPY---KTNKIIACHEIFFPFATYYCYKLPSTRIYD  824
              +A  T+  T G G + V + NV+P    K+ K ++CH+  +P+  YYC+ +P  R+Y+
Sbjct  473  PSIAVRTTANTNGSG-RTVQLKNVEPIDGGKSTKSVSCHQTLYPYLLYYCHSVPDVRVYE  531

Query  825  VDV-ANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
             D+     +   +N+ + ICH+DT+ W+P H AF  L   PG  EVCHWI + D+ W 
Sbjct  532  ADIHETAGRREKINRGVAICHLDTASWSPNHGAFIALGSRPGLIEVCHWIFENDMTWT  589



>gb|ABR16440.1| unknown [Picea sitchensis]
Length=666

 Score =   140 bits (352),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 123/237 (52%), Gaps = 19/237 (8%)
 Frame = +3

Query  333  GFTGKVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPT  512
            G    V+   FFR  +L +G  + +P +L   +P RSFLP  +A  +P  +S+       
Sbjct  430  GTAAGVEAGKFFRENLLVQGSSLPLP-NLRDFMPRRSFLPRSLADKLPSFSSQSLAELVR  488

Query  513  AFSIPLT---KAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDY  683
             F IP     +  M K+L  C  PAVKGE   C+ ++E M +F+   LG K +  LT+  
Sbjct  489  MFRIPENSSMEGMMAKTLKECERPAVKGEIKKCVTSVEGMAEFAVGILG-KKVEVLTTAS  547

Query  684  TKGMGNQVVMIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDV-------  833
            T G G +V  +G V      ++   ++CH+  FP+  YYC+ +P  ++Y+  +       
Sbjct  548  TAGSGERV-QVGEVNGKDGGRVTRSVSCHQSMFPYLVYYCHSVPKVKVYEAALLRNSNSN  606

Query  834  ---ANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
                  +K+  +N  + ICH+DT+ W+  H AF  L   PG+ EVCHWI + DLIW+
Sbjct  607  PSSNQKEKIEKINDGVAICHLDTTQWSAGHAAFVALGHKPGQIEVCHWIFENDLIWV  663



>ref|XP_009338714.1| PREDICTED: dehydration-responsive protein RD22-like [Pyrus x 
bretschneideri]
Length=210

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 110/202 (54%), Gaps = 7/202 (3%)
 Frame = +3

Query  402  TMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPLTKAAMDKSLG---YCNA  572
            TM  H  +    ++F+P E A +IP ++++L  IF   FS+       D   G    C  
Sbjct  6    TMKLHFTTNSNTQTFVPRETAESIPFSSNKLPEIF-NQFSVKSGSVEADIIKGTILECEN  64

Query  573  PAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGN-VKPYKTNKI  749
            PA++GE   C  +LE MI FS   LGG ++ A++++  KG   Q   I + VK    +K 
Sbjct  65   PAIRGEEKYCATSLESMIDFSTSKLGGGNVRAISTEAGKGATLQKYTIASGVKKLAADKS  124

Query  750  IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKL  929
            + CH+  +P+A +YC+   +TR Y V +      G   K + +CH DTS W PKH+AF++
Sbjct  125  VVCHKQNYPYAVFYCHTTKTTRAYVVPLKGAD--GVNVKAVAVCHTDTSDWNPKHLAFQV  182

Query  930  LKLSPGKGEVCHWITQMDLIWI  995
            LK+ PG   VCH++    ++W+
Sbjct  183  LKVKPGTVPVCHFLPSDHVVWV  204



>gb|KFK44451.1| hypothetical protein AALP_AA1G258600 [Arabis alpina]
Length=621

 Score =   138 bits (348),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 115/219 (53%), Gaps = 6/219 (3%)
 Frame = +3

Query  348  VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPT--AFS  521
            V+P  FFR  +LK+G  V+MP   D ++P RSFLP  I   IP + S++  I     A  
Sbjct  401  VEPGKFFRESMLKEGTLVSMPDIKD-RMPKRSFLPRSIISKIPFSTSKIAEIKGVFHARD  459

Query  522  IPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGN  701
                +  +  ++  C  P+  GE   C+ + EDMI F+   LG + +   T+    G   
Sbjct  460  NSTMEGIISNAITECERPSTVGETKRCVGSAEDMIDFATSVLG-RRVVLRTTKSVAGSKK  518

Query  702  QVVMIGNVKPYKTN--KIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLV  875
            +VV+         N  K ++CH+  +P+  YYC+ +P  R+Y+ D+ +PK    +N  + 
Sbjct  519  KVVIGKVKGINGGNVTKSVSCHQSLYPYLLYYCHSVPKVRVYESDLLDPKSKVKINHGIA  578

Query  876  ICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
            ICHMDTS W   H AF  L   PG+ E+CHWI + D+ W
Sbjct  579  ICHMDTSAWGANHGAFVSLGSRPGQIEICHWIFENDMNW  617



>ref|XP_003576424.1| PREDICTED: BURP domain-containing protein 14-like [Brachypodium 
distachyon]
Length=775

 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 114/220 (52%), Gaps = 5/220 (2%)
 Frame = +3

Query  351   DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPL  530
             +P  FFR   L  G+++ MP  +  ++P R+FLP +IA  IP  A  +  +F       +
Sbjct  557   EPGKFFREWDLMTGNRMPMPD-ISDKMPPRAFLPRDIAAKIPFEAGAVSALFGAPPGTAM  615

Query  531   TKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVV  710
              +  +  ++  C     +GE   C  + ED++ F+ E LG  ++A  +++   G G  V 
Sbjct  616   -RQVVASTVAECERAPSRGETKRCATSAEDVLDFAVEMLG-DNIAVRSTESPAGGGGDVR  673

Query  711   MIGNVKPYKT--NKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICH  884
             +            + ++CH+  FP+  YYC+ +PS R+Y+ ++        +N+ + ICH
Sbjct  674   LGRVGGVAGGGVTRSVSCHQSLFPYLVYYCHSVPSVRVYEAEIMAVDSGQRINRGVAICH  733

Query  885   MDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
             +DTS W+P H AF  L   PG+ EVCHWI Q D+ W   D
Sbjct  734   LDTSDWSPDHGAFVALGGKPGEMEVCHWIFQGDMTWTVAD  773



>gb|AES58801.2| dehydration-responsive protein RD22 [Medicago truncatula]
Length=300

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 109/187 (58%), Gaps = 6/187 (3%)
 Frame = +3

Query  441  SFLPPEIARNIPLNASELQRIFPTAFSIPLTKAAMD---KSLGYCNAPAVKGERGSCLKT  611
            +FLP E+A +IP ++++++ I    FSI    A  +    ++G C  PA++GE  SC+ +
Sbjct  114  TFLPREVANSIPFSSNKVENIL-NYFSIKQGSAEYEIVKNTIGSCEMPAIEGEEKSCVTS  172

Query  612  LEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGNVKPYKTNKIIACHEIFFPFATYY  791
            LE M+ F+   LG    A  T    +    Q ++   VK    NKI+ CH + +P+  +Y
Sbjct  173  LESMVDFTTSKLGNNVEAVSTEVNKESDIQQYIIAKGVKKLGENKIVVCHPMDYPYTVFY  232

Query  792  CYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWI  971
            C+KL +T++Y + +      GT  K + ICH DTS W+PKH+AF++LK+ PG   VCH++
Sbjct  233  CHKLRATKVYYLPMEGVD--GTKVKAVAICHSDTSQWSPKHLAFQVLKIQPGTVPVCHFL  290

Query  972  TQMDLIW  992
             Q  ++W
Sbjct  291  PQGHVVW  297



>ref|XP_003588550.1| BURP domain-containing protein [Medicago truncatula]
Length=325

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 109/189 (58%), Gaps = 6/189 (3%)
 Frame = +3

Query  441  SFLPPEIARNIPLNASELQRIFPTAFSIPLTKAAMD---KSLGYCNAPAVKGERGSCLKT  611
            +FLP E+A +IP ++++++ I    FSI    A  +    ++G C  PA++GE  SC+ +
Sbjct  139  TFLPREVANSIPFSSNKVENIL-NYFSIKQGSAEYEIVKNTIGSCEMPAIEGEEKSCVTS  197

Query  612  LEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGNVKPYKTNKIIACHEIFFPFATYY  791
            LE M+ F+   LG    A  T    +    Q ++   VK    NKI+ CH + +P+  +Y
Sbjct  198  LESMVDFTTSKLGNNVEAVSTEVNKESDIQQYIIAKGVKKLGENKIVVCHPMDYPYTVFY  257

Query  792  CYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWI  971
            C+KL +T++Y + +      GT  K + ICH DTS W+PKH+AF++LK+ PG   VCH++
Sbjct  258  CHKLRATKVYYLPMEGVD--GTKVKAVAICHSDTSQWSPKHLAFQVLKIQPGTVPVCHFL  315

Query  972  TQMDLIWIG  998
             Q  ++W  
Sbjct  316  PQGHVVWFS  324



>ref|XP_003610589.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES92786.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=190

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 107/204 (52%), Gaps = 20/204 (10%)
 Frame = +3

Query  405   MPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPLTKAAMDKSLGYCNAPAVK  584
             MP   D +LP RSFLP  I   +P + S++  +                SLG C     +
Sbjct  3     MPDIRD-KLPKRSFLPQSILAKLPFSTSKIDEM-------------KGDSLGECERVPAR  48

Query  585   GERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGNVKPY----KTNKII  752
             GE   C+ ++EDMI F+   LG +++   T++   G   + +M+G+V       K  + +
Sbjct  49    GETKKCVGSIEDMIDFAASVLG-RNVVVRTTENVNG-SKKDLMVGHVSGINNGGKMTRTV  106

Query  753   ACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLL  932
             +CH+  F +  YYC+ +P  R+Y  ++ +PK    +N+ + +CH+DTS W+P H AF  L
Sbjct  107   SCHQSLFQYLLYYCHSVPKVRVYQAELLDPKIKDKINQGVAVCHLDTSDWSPTHGAFVSL  166

Query  933   KLSPGKGEVCHWITQMDLIWIGYD  1004
                PG+ EVCHWI + D+ W   D
Sbjct  167   GSGPGQIEVCHWIFENDMSWAVAD  190



>ref|XP_009367927.1| PREDICTED: dehydration-responsive protein RD22-like [Pyrus x 
bretschneideri]
Length=385

 Score =   132 bits (333),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 111/202 (55%), Gaps = 7/202 (3%)
 Frame = +3

Query  402  TMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPLTKAAMD---KSLGYCNA  572
            TM  H  +    ++F+P E A +IP ++++L  IF   FS+       D    ++  C  
Sbjct  181  TMKLHFTTNSNTQTFVPRETAESIPFSSNKLPEIF-NQFSVKSGSVEADIITGTIQECEN  239

Query  573  PAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGN-VKPYKTNKI  749
            PA++GE   C  +LE MI FS   LGG ++ A++++  KG   Q   I + VK    +K 
Sbjct  240  PAIRGEEKYCATSLESMIDFSTSKLGGGNVRAISTEAGKGATLQKYTIASGVKKLAADKS  299

Query  750  IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKL  929
            + CH+  +P+A +YC+   +TR Y V +      G   K + +CH DTS W PKH+AF++
Sbjct  300  VVCHKQNYPYAVFYCHTTKTTRAYVVPLKGAD--GVNVKAVAVCHTDTSDWNPKHLAFQV  357

Query  930  LKLSPGKGEVCHWITQMDLIWI  995
            LK+ PG   VCH++    ++W+
Sbjct  358  LKVKPGTVPVCHFLPSDHVVWV  379



>gb|AES58805.2| dehydration-responsive RD22-like protein [Medicago truncatula]
Length=224

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 112/190 (59%), Gaps = 10/190 (5%)
 Frame = +3

Query  444  FLPPEIARNIPLNASELQRIFPTAFSIPL-TKAA--MDKSLGYCNAPAVKGERGSCLKTL  614
            FLP E+A +IP ++++L+ I    FSI   +K A  + +++  C A  +KGE   C+ +L
Sbjct  37   FLPREVANSIPFSSNKLENIL-NKFSIKEGSKEAEIVKRTISECEANGIKGEEKLCVTSL  95

Query  615  EDMIQFSRENLGGKHLAALTSDYTK---GMGNQVVMIGNVKPYKTNKIIACHEIFFPFAT  785
            E M+ F+   LG  ++ A++++  K   G+   V+  G  K  + NK I CH+  +P+  
Sbjct  96   ESMVDFTISKLGN-NVEAISTEVDKNSNGLQQYVIAKGVNKLGEKNKTIVCHKENYPYTV  154

Query  786  YYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCH  965
            +YC+K  ST +Y V +      G M K +V+CH DTS W PKH+AF++LK+ PG   +CH
Sbjct  155  FYCHKTDSTEVYSVPLEGVD--GNMVKTIVVCHTDTSEWNPKHLAFQVLKVQPGTVPICH  212

Query  966  WITQMDLIWI  995
             + Q  ++W+
Sbjct  213  ILPQDHVVWV  222



>gb|AGE46023.1| dehydration-responsive protein RD22-like isoform 2 [Elaeis guineensis]
Length=294

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 119/220 (54%), Gaps = 10/220 (5%)
 Frame = +3

Query  351  DPSS--FFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSI  524
            DPS   FF    L  G K+T+  H    +   + LP + A +IP ++++L  I       
Sbjct  77   DPSVTVFFLEKDLHPGAKMTL--HFIRTVAGATLLPRQAADSIPFSSAKLPEILSRLSIT  134

Query  525  P--LTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTK-GM  695
            P  +   AM K+L  C  PA++GE   C  ++E M+ FS  +LG + + AL++   + G+
Sbjct  135  PYSMEAKAMKKTLQDCEEPAIEGETKYCATSVEAMVDFSTSSLGTRDVQALSTAVDREGI  194

Query  696  GNQVVMIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLV  875
              QV  I  V+   ++K + CH   +P+A +YC+   S   + V V    K GT  + + 
Sbjct  195  PTQVYSISKVQKQPSSKAVVCHGEKYPYAVFYCHTT-SAEAFKVSVVG--KDGTKVEGVA  251

Query  876  ICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
             CH DT+G+ P+HVAFKLL + PG   +CH++ Q D++WI
Sbjct  252  TCHTDTAGYNPEHVAFKLLHVKPGTVPICHFLPQSDIVWI  291



>ref|NP_001132751.1| hypothetical protein precursor [Zea mays]
 gb|ACF81734.1| unknown [Zea mays]
 gb|AFW85142.1| hypothetical protein ZEAMMB73_186505 [Zea mays]
Length=375

 Score =   132 bits (332),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 117/220 (53%), Gaps = 10/220 (5%)
 Frame = +3

Query  351  DPSS--FFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSI  524
            DPS   FFR   L+ G K T+    ++ +    FLP   A  IP ++ ++  I    FS+
Sbjct  156  DPSVALFFREEDLQPGKKTTV-QFANTAMAGAKFLPRSDAEAIPFSSEKVPEIL-GRFSV  213

Query  525  ---PLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHL-AALTSDYTKG  692
                +  A M ++L  C APA +GER +C  +LE M+ F+  +LG  H+ AA T    +G
Sbjct  214  DPDSVEAAEMAQTLHDCEAPAARGERKACATSLESMVDFATASLGTSHVRAASTVVGREG  273

Query  693  MGNQVVMIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
               Q   +  VK     +++ACH   + +A + C+    TR Y V +    + GT    +
Sbjct  274  SPRQEYTVTGVKRAGGGRLVACHAEPYAYAVFACHLTQQTRAYSVSMLG--RDGTAVDAV  331

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             +CH DTSGW PKHVAF++L++ PG   +CH++ Q  ++W
Sbjct  332  AVCHADTSGWNPKHVAFQVLRVKPGTVPICHFLPQDHVVW  371



>ref|XP_008792350.1| PREDICTED: BURP domain-containing protein 3 [Phoenix dactylifera]
Length=367

 Score =   131 bits (330),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 73/216 (34%), Positives = 117/216 (54%), Gaps = 11/216 (5%)
 Frame = +3

Query  363  FFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIP---LT  533
            FF    L+ G K+ +  H        +FLP + A +IP ++S+L  I    FSI    + 
Sbjct  153  FFLEKDLRPGAKMNL--HFTETTSGATFLPRQEADSIPFSSSKLPAIL-DRFSIESDSVE  209

Query  534  KAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTK-GMGNQ--  704
              AM K+L  C  PAV GE+  C  +LE M++FS  +LG   + A++++  K G   Q  
Sbjct  210  AEAMKKTLNECEQPAVGGEKKYCATSLESMVEFSTSSLGTHDVKAISTEVEKEGTPAQPY  269

Query  705  VVMIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICH  884
             +    V+     +++ACH   + +A +YC+   +TR Y V++    K GT  + + +CH
Sbjct  270  TIRASGVRRMAGTELVACHPENYAYAVFYCHATTATRAYTVEMVG--KDGTQVEAVAVCH  327

Query  885  MDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             DT  W PKH+AF++LK+ PG   VCH++ Q  ++W
Sbjct  328  TDTKAWNPKHLAFQVLKVKPGTVPVCHFLPQDHVVW  363



>ref|XP_009367929.1| PREDICTED: dehydration-responsive protein RD22-like [Pyrus x 
bretschneideri]
Length=406

 Score =   132 bits (331),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 111/202 (55%), Gaps = 7/202 (3%)
 Frame = +3

Query  402  TMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPLTKAAMD---KSLGYCNA  572
            TM  H  +    ++F+P E A +IP ++++L  IF   FS+       D    ++  C  
Sbjct  202  TMKLHFTTNSNTQTFVPRETAESIPFSSNKLPEIF-NQFSVKSGSVEADIITGTIQECEN  260

Query  573  PAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGN-VKPYKTNKI  749
            PA++GE   C  +LE MI FS   LGG ++ A++++  KG   Q   I + VK    +K 
Sbjct  261  PAIRGEEKYCATSLESMIDFSTSKLGGGNVRAISTEAGKGATLQKYTIASGVKKLAADKS  320

Query  750  IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKL  929
            + CH+  +P+A +YC+   +TR Y V +      G   K + +CH DTS W PKH++F++
Sbjct  321  VVCHKQNYPYAVFYCHATKTTRAYVVPLKGAD--GVNVKAVAVCHTDTSDWNPKHLSFQV  378

Query  930  LKLSPGKGEVCHWITQMDLIWI  995
            LK+ PG   VCH++    ++W+
Sbjct  379  LKIKPGTVPVCHFLPSDHVVWV  400



>dbj|BAB60848.1| BURP domain-containing protein [Bruguiera gymnorhiza]
Length=346

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 117/213 (55%), Gaps = 9/213 (4%)
 Frame = +3

Query  372  LLVLKKGHKVTMPSHLD-SQLPNRS-FLPPEIARNIPLNASELQRIFPTAFSI---PLTK  536
            L  L+K  K     +LD S+  N + FLP  +A +IP ++++LQ  F   FS+    +  
Sbjct  136  LFFLEKDMKPGKSMNLDFSESSNTATFLPRHVADSIPFSSNKLQDAF-REFSVKPGSMEA  194

Query  537  AAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMI  716
              M+ ++  C  P ++GE   C  +LE M+ FS   LG K + A++++  K  G Q   I
Sbjct  195  EIMENTVKECENPGIEGEEKYCATSLESMVDFSTSKLG-KDIQAISTEVEKQTGRQQYTI  253

Query  717  GNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTS  896
              VK    +K + CH+  +P+A +YC+   STR Y V +    +  T  + + ICH +TS
Sbjct  254  AGVKKTAGDKSVVCHKQNYPYAVFYCHSTQSTRAYLVQLKGADR--TRLQAVAICHTNTS  311

Query  897  GWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
             W PKH+AF++L + PG   +CH++ Q  ++W+
Sbjct  312  AWNPKHLAFQVLAVKPGTVPICHFLPQSHVVWV  344



>ref|XP_007012037.1| BURP domain-containing protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY29656.1| BURP domain-containing protein, putative isoform 2 [Theobroma 
cacao]
Length=337

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/235 (33%), Positives = 117/235 (50%), Gaps = 9/235 (4%)
 Frame = +3

Query  309  PGVKIYNFGFTGKV---DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPL  479
            PG  IYN+  T      DP+     L      + TM  H        +FLP +IA+ IP 
Sbjct  104  PGGFIYNYAATETQVHDDPNVALFFLEKDMHPRATMTLHFTENTETATFLPRQIAQKIPF  163

Query  480  NASELQRIFPTAFSIPLTKAA--MDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGG  653
            ++ +L  I       P +  A  M  ++  C  P ++GE   C  +LE MI FS   +G 
Sbjct  164  SSDKLPEILKKFSVKPGSAEAEIMKNTIKECEQPQIQGEDKYCATSLESMIDFSTSKIG-  222

Query  654  KHLAALTSDYTKGMGNQVVMIG-NVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVD  830
            K+  A++++  K    Q   I   V     +K + CH+  + +A +YC+K  +TR Y V 
Sbjct  223  KNAYAISTEVQKQTPEQKYTIAAGVHKMGGDKSVVCHKQNYAYAVFYCHKSETTRAYMVH  282

Query  831  VANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
            +      GT  K + ICH DTS W PKH+AF++LK+ PG   +CH++ Q  ++WI
Sbjct  283  LEGAD--GTKAKAVAICHTDTSAWNPKHLAFQVLKVEPGTIPICHFLPQDHIVWI  335



>ref|XP_007012036.1| BURP domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY29655.1| BURP domain-containing protein isoform 1 [Theobroma cacao]
Length=345

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/235 (33%), Positives = 117/235 (50%), Gaps = 9/235 (4%)
 Frame = +3

Query  309  PGVKIYNFGFTGKV---DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPL  479
            PG  IYN+  T      DP+     L      + TM  H        +FLP +IA+ IP 
Sbjct  112  PGGFIYNYAATETQVHDDPNVALFFLEKDMHPRATMTLHFTENTETATFLPRQIAQKIPF  171

Query  480  NASELQRIFPTAFSIPLTKAA--MDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGG  653
            ++ +L  I       P +  A  M  ++  C  P ++GE   C  +LE MI FS   +G 
Sbjct  172  SSDKLPEILKKFSVKPGSAEAEIMKNTIKECEQPQIQGEDKYCATSLESMIDFSTSKIG-  230

Query  654  KHLAALTSDYTKGMGNQVVMIG-NVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVD  830
            K+  A++++  K    Q   I   V     +K + CH+  + +A +YC+K  +TR Y V 
Sbjct  231  KNAYAISTEVQKQTPEQKYTIAAGVHKMGGDKSVVCHKQNYAYAVFYCHKSETTRAYMVH  290

Query  831  VANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
            +      GT  K + ICH DTS W PKH+AF++LK+ PG   +CH++ Q  ++WI
Sbjct  291  LEGAD--GTKAKAVAICHTDTSAWNPKHLAFQVLKVEPGTIPICHFLPQDHIVWI  343



>ref|XP_010911557.1| PREDICTED: BURP domain-containing protein 6-like [Elaeis guineensis]
Length=294

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/220 (34%), Positives = 118/220 (54%), Gaps = 10/220 (5%)
 Frame = +3

Query  351  DPSS--FFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSI  524
            DPS   FF    L  G K+T+  H    +   + LP + A +IP ++++L  I       
Sbjct  77   DPSVTVFFLEKDLHPGAKMTL--HFIRTVAGATLLPRQAADSIPFSSAKLPEILSRLSIT  134

Query  525  P--LTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTK-GM  695
            P  +   AM K+L  C  PA++GE   C  ++E M+ FS  +LG + + AL++   + G 
Sbjct  135  PYSMEAKAMKKTLQDCEEPAIEGETKYCATSVEAMVDFSTSSLGTRDVQALSTAVDREGT  194

Query  696  GNQVVMIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLV  875
              QV  I  V+   ++K + CH   +P+A +YC+   +T      V+   K GT  + + 
Sbjct  195  PTQVYSISKVQKQPSSKAVVCHGEKYPYAVFYCH---TTSAEAFKVSMVAKDGTKVEGVA  251

Query  876  ICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
             CH DT+G+ P+HVAFKLL + PG   +CH++ Q D++WI
Sbjct  252  TCHTDTAGYNPEHVAFKLLHVKPGTVPICHFLPQSDIVWI  291



>ref|XP_009367928.1| PREDICTED: BURP domain-containing protein 3-like [Pyrus x bretschneideri]
Length=406

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 110/202 (54%), Gaps = 7/202 (3%)
 Frame = +3

Query  402  TMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPLTKAAMDKSLG---YCNA  572
            TM  H  +    ++F+P EIA +IP ++++L  IF   FS+       D   G    C  
Sbjct  202  TMKLHFTTNSNTQTFVPREIAESIPFSSNKLPEIF-NQFSVKSGSVEADIIKGTILECEN  260

Query  573  PAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGN-VKPYKTNKI  749
            PA++GE   C  +LE MI FS   LGG ++ A++++  KG   Q   I +  K    +K 
Sbjct  261  PAIRGEEKYCATSLESMIDFSTSKLGGGNVRAISTEAGKGATLQKYTIASGAKKLAADKS  320

Query  750  IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKL  929
            + CH+  +P+A +YC+   +TR Y V +      G   K + +CH DTS W PKH++F++
Sbjct  321  VVCHKQNYPYAVFYCHATKTTRAYVVPLKGAD--GVNVKAVAVCHTDTSDWNPKHLSFQV  378

Query  930  LKLSPGKGEVCHWITQMDLIWI  995
            LK+ PG   VCH++    ++W+
Sbjct  379  LKVKPGTVPVCHFLPSDHVVWV  400



>dbj|BAB60849.1| BURP domain-containing protein [Bruguiera gymnorhiza]
Length=336

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 106/188 (56%), Gaps = 7/188 (4%)
 Frame = +3

Query  441  SFLPPEIARNIPLNASELQRIFPTAFSI---PLTKAAMDKSLGYCNAPAVKGERGSCLKT  611
            +FLP  +A +IP ++++LQ  F   FS+    L    M+ ++  C  P ++GE   C  +
Sbjct  151  TFLPRHVADSIPFSSNKLQDAF-REFSVKPGSLEAEIMENTVKECENPGIEGEEKYCATS  209

Query  612  LEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGNVKPYKTNKIIACHEIFFPFATYY  791
            LE M+ FS   LG K + A++++  K  G Q   I  VK    +K + CH+  +P+A +Y
Sbjct  210  LESMVDFSTSKLG-KDIQAISTEVEKQTGRQKYTIAGVKKIAGDKCVVCHKQNYPYAVFY  268

Query  792  CYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWI  971
            C+ + STR Y V +    +  T  + + ICH +TS W PKH AF++L + PG   +CH++
Sbjct  269  CHSIQSTRAYLVQLKGVDR--TRLQAVAICHTNTSAWNPKHPAFQVLAVKPGTVPICHFL  326

Query  972  TQMDLIWI  995
             Q  ++W+
Sbjct  327  PQSHVVWV  334



>emb|CDY47228.1| BnaC09g14770D [Brassica napus]
Length=623

 Score =   132 bits (333),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 117/224 (52%), Gaps = 8/224 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
              +P  FFR  +L++G  + MP   D ++P R+FLP  I   +  ++S   E+ RIF    
Sbjct  403   TEPGKFFRESMLREGTLMQMPDIKD-KMPKRTFLPRTIVSKLSFSSSKTGEVWRIFGAGE  461

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
             +  +    +  ++  C  P   GE   C+ + EDMI F+   LG   +   T++   G  
Sbjct  462   NSSMA-GIISSAISECERPPSYGETKRCVGSAEDMIDFATSVLG-HGVVVRTTENVVGSK  519

Query  699   NQVVMIGNVKPYKTN--KIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
              ++V+         +  + ++CH+  +P+  YYC+ +P  R+Y+ D+ +P+    +N  +
Sbjct  520   KKIVIGKVKGINGGDLTRAVSCHQSLYPYLLYYCHSVPKVRVYEADLLDPESSEKINHGI  579

Query  873   VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
              ICH+DTS W+  HVAF  L   PG+ EVCHWI + D+ W   D
Sbjct  580   AICHIDTSAWSASHVAFLALGSGPGRIEVCHWIFENDMTWTTVD  623



>ref|XP_007137164.1| hypothetical protein PHAVU_009G105300g [Phaseolus vulgaris]
 gb|ESW09158.1| hypothetical protein PHAVU_009G105300g [Phaseolus vulgaris]
Length=338

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 118/215 (55%), Gaps = 10/215 (5%)
 Frame = +3

Query  363  FFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSI-PLTKA  539
            FF    L  G K  + +H  +     +FLP ++A +IP ++ ++  +F T FSI P ++ 
Sbjct  128  FFLEKDLHYGTK--LDAHFTTSSNQATFLPRQVADSIPFSSDKVDDVF-TKFSIKPGSEE  184

Query  540  A--MDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVM  713
            A  ++ +L  C    +KGE   C  +LE M+ FS   LG K++  L+++  K MG Q   
Sbjct  185  AHIIENTLSECEETGIKGEEKYCATSLESMVDFSTSKLG-KNVEVLSTEVDKEMGLQKYT  243

Query  714  IG-NVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMD  890
            +   VK    +  + CH+  +P+A +YC+K  STR Y V +      G   K + +CH D
Sbjct  244  VAPGVKKISGDTAVVCHKQNYPYAVFYCHKTESTRTYSVPLVGAN--GIRVKSVAVCHTD  301

Query  891  TSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
            TS W PKH+AF++L + PG   +CH++ Q  ++W+
Sbjct  302  TSQWNPKHLAFQVLNVKPGTVPICHFLPQDHVVWV  336



>emb|CDY53059.1| BnaA09g14240D [Brassica napus]
Length=623

 Score =   132 bits (332),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 117/224 (52%), Gaps = 8/224 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
              +P  FFR  +LK+G  + MP   D ++P R+FLP  I   +  ++S   E++RIF    
Sbjct  403   TEPGKFFRESMLKEGTLMQMPDIKD-KMPKRTFLPRTIVSKLSFSSSKTGEVRRIFGAGE  461

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
             +  +    +  ++  C  P   GE   C+ + EDMI F+   LG   +   T++   G  
Sbjct  462   NSSMA-GIISSAISECERPPSYGETKRCVGSAEDMIDFATSVLG-HGVVVRTTENVVGSK  519

Query  699   NQVVMIGNVKPYKTN--KIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
              ++V+         +  + ++CH+  +P+  YYC+ +P  R+Y+ D+ +P+    +N  +
Sbjct  520   KKIVIGKVKGINGGDLTRAVSCHQSLYPYLLYYCHSVPKVRVYEADLLDPESSEKINHGI  579

Query  873   VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
              ICH+DTS W+  H AF  L   PG+ EVCHWI + D+ W   D
Sbjct  580   AICHIDTSAWSASHGAFLALGSGPGRIEVCHWIFENDMTWTTVD  623



>dbj|BAB60850.1| BURP domain-containing protein [Bruguiera gymnorhiza]
Length=307

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 105/188 (56%), Gaps = 7/188 (4%)
 Frame = +3

Query  441  SFLPPEIARNIPLNASELQRIFPTAFSI---PLTKAAMDKSLGYCNAPAVKGERGSCLKT  611
            +FLP  +A +IP ++++LQ  F   FS+    L    M+ ++  C  P ++GE   C  +
Sbjct  122  TFLPRHVADSIPFSSNKLQDAF-REFSVKPGSLEAEIMENTVKECENPGIEGEEKYCATS  180

Query  612  LEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGNVKPYKTNKIIACHEIFFPFATYY  791
            LE M+ FS   LG K + A++++  K  G Q   I  VK    +K + CH+  +P+A +Y
Sbjct  181  LESMVDFSTSKLG-KDVQAISTEVEKQTGRQKYTIAGVKKIAGDKCVVCHKQNYPYAVFY  239

Query  792  CYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWI  971
            C+ + STR Y V +    +  T  + + ICH +TS W PKH AF++L + PG    CH++
Sbjct  240  CHSIQSTRAYLVQLKGVDR--TRLQAVAICHTNTSAWNPKHPAFQVLAVKPGTVPTCHFL  297

Query  972  TQMDLIWI  995
             Q  ++W+
Sbjct  298  PQSHVVWV  305



>ref|XP_002444270.1| hypothetical protein SORBIDRAFT_07g019310 [Sorghum bicolor]
 gb|EES13765.1| hypothetical protein SORBIDRAFT_07g019310 [Sorghum bicolor]
Length=658

 Score =   132 bits (333),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 115/232 (50%), Gaps = 23/232 (10%)
 Frame = +3

Query  351  DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPL  530
            +P  FFR   L  G+++ MP   D ++P R+FLP  IA  IP +   +      AF +PL
Sbjct  430  EPGKFFREQELVSGNRMPMPDIRD-KMPPRAFLPRAIAARIPFDPQAVSE----AFGLPL  484

Query  531  TKA---AMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGN  701
              A   A+  ++  C     KGE   C  + ED++ F+ E LG   +   ++  T G G 
Sbjct  485  DTALGKAVSSTVAECLRAPSKGETKRCATSAEDVVDFAVETLG-DDIVVRSTASTAGSGG  543

Query  702  QVVM--IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPK----------  845
             V +  +  V   K  + ++CH+  FP+  YYC+ +P  R+Y+ D+              
Sbjct  544  DVRLGTVTGVDGGKVTRSVSCHQSLFPYLVYYCHSVPKVRVYEADIMAAAAAADDDGGSD  603

Query  846  --KMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
              +   +N  + ICH+DTS W+P H AF  L   PG+ EVCHWI + D+ W 
Sbjct  604  AGEKEIINHGVAICHLDTSDWSPTHGAFVALGGKPGEVEVCHWIFEGDMTWT  655



>gb|AFW85139.1| hypothetical protein ZEAMMB73_186505 [Zea mays]
 gb|AFW85140.1| hypothetical protein ZEAMMB73_186505 [Zea mays]
Length=193

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 102/187 (55%), Gaps = 7/187 (4%)
 Frame = +3

Query  444  FLPPEIARNIPLNASELQRIFPTAFSI---PLTKAAMDKSLGYCNAPAVKGERGSCLKTL  614
            FLP   A  IP ++ ++  I    FS+    +  A M ++L  C APA +GER +C  +L
Sbjct  6    FLPRSDAEAIPFSSEKVPEILGR-FSVDPDSVEAAEMAQTLHDCEAPAARGERKACATSL  64

Query  615  EDMIQFSRENLGGKHL-AALTSDYTKGMGNQVVMIGNVKPYKTNKIIACHEIFFPFATYY  791
            E M+ F+  +LG  H+ AA T    +G   Q   +  VK     +++ACH   + +A + 
Sbjct  65   ESMVDFATASLGTSHVRAASTVVGREGSPRQEYTVTGVKRAGGGRLVACHAEPYAYAVFA  124

Query  792  CYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWI  971
            C+    TR Y V +    + GT    + +CH DTSGW PKHVAF++L++ PG   +CH++
Sbjct  125  CHLTQQTRAYSVSMLG--RDGTAVDAVAVCHADTSGWNPKHVAFQVLRVKPGTVPICHFL  182

Query  972  TQMDLIW  992
             Q  ++W
Sbjct  183  PQDHVVW  189



>gb|AFI80905.1| dehydration-responsive protein [Morus alba]
Length=201

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 110/198 (56%), Gaps = 8/198 (4%)
 Frame = +3

Query  414  HLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSI-PLTKAA--MDKSLGYCNAPAVK  584
            H        +FLP ++A +IP ++++L  I  T FS+ P ++ A  + ++L  C++P+VK
Sbjct  2    HFTKSSNRATFLPRQVAASIPFSSNKLPEIL-TKFSVTPQSEEADMIKETLNECDSPSVK  60

Query  585  GERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGNV-KPYKTNKIIACH  761
            GE   C  +LE MI FS   LG K + AL+++     G Q   +  V K     K + CH
Sbjct  61   GEEKYCATSLESMIDFSTSKLG-KDVQALSTEVETETGVQTYTVTRVEKKTSGEKSVVCH  119

Query  762  EIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLS  941
            +  + +A +YC+   +T  Y V +      G   K + +CH DT+ W P+H+AF++LK+ 
Sbjct  120  KQKYAYAEFYCHATQTTETYLVSMEGAD--GVKAKAVAVCHTDTAAWNPRHLAFQVLKVK  177

Query  942  PGKGEVCHWITQMDLIWI  995
            PG   VCH++ +  ++WI
Sbjct  178  PGTVPVCHFLPEDHIVWI  195



>gb|ACD62790.1| BURP domain-containing protein [Phaseolus vulgaris]
 gb|AHA84261.1| dehydration-responsive protein RD22 [Phaseolus vulgaris]
 gb|AHA84280.1| BURP domain-containing protein [Phaseolus vulgaris]
Length=338

 Score =   128 bits (321),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 124/239 (52%), Gaps = 9/239 (4%)
 Frame = +3

Query  294  VNPPPPGVKIYNFGFTGKVDPSSFFRLLVLKKGHKVT-MPSHLDSQLPNRSFLPPEIARN  470
            V P  P   +Y    T   D +      + K  H  T + +H  +     +FLP ++A +
Sbjct  102  VGPKSPFDYVYAATATQLHDATKVALFFLEKDLHYGTKLDAHFTTSSNQATFLPRQVADS  161

Query  471  IPLNASELQRIFPTAFSI-PLTKAA--MDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRE  641
            IP ++ ++  +F T FSI P ++ A  ++ +L  C    +KGE   C  +LE M+ FS  
Sbjct  162  IPFSSDKVDDVF-TKFSIKPGSEEAHIIENTLSECEETGIKGEEKYCATSLESMVDFSTS  220

Query  642  NLGGKHLAALTSDYTKGMGNQVVMIG-NVKPYKTNKIIACHEIFFPFATYYCYKLPSTRI  818
             LG K++  L+++  K  G Q   +   VK    +  + CH+  +P+A +YC+K  STR 
Sbjct  221  KLG-KNVEVLSTEVDKETGLQKYTVAPGVKKISGDTAVVCHKQNYPYAVFYCHKTESTRT  279

Query  819  YDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
            Y V +      G   K + +CH DTS W PKH+AF++L + PG   +CH++ Q  ++W+
Sbjct  280  YSVPLVGAN--GIRVKAVAVCHTDTSQWNPKHLAFQVLNVKPGTVPICHFLPQDHVVWV  336



>ref|XP_010925837.1| PREDICTED: BURP domain-containing protein 3-like isoform X2 [Elaeis 
guineensis]
Length=254

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 116/219 (53%), Gaps = 10/219 (5%)
 Frame = +3

Query  351  DPSS--FFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSI  524
            DPS   +F    L  G ++T   H    +   + LP + A +IP ++++L  I       
Sbjct  37   DPSEAIYFLEKDLHPGARMTF--HFIRTITGATLLPRQAADSIPFSSAKLPEILSRLSIT  94

Query  525  P--LTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTK-GM  695
            P  +   AM K+L  C  PA++GE   C  ++E M+ FS  +LG + + AL++   + G 
Sbjct  95   PNSIEAEAMKKTLQECEKPAMEGETKYCATSVEAMVDFSTSSLGTRDVRALSTTVDREGT  154

Query  696  GNQVVMIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLV  875
              QV  I  V+    +K + CH   +P+A +YC+ + S   Y V +    K GT  + + 
Sbjct  155  PKQVYSISKVQKQPVSKAVVCHGEKYPYAVFYCH-MTSAEAYKVSMVG--KDGTKVEGVA  211

Query  876  ICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             CH DT+G+ P+HVAFKLL + PG   +CH++ Q D++W
Sbjct  212  TCHTDTAGYNPEHVAFKLLHVKPGTVPICHFLLQSDIVW  250



>ref|XP_009113216.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Brassica rapa]
Length=623

 Score =   131 bits (329),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 115/224 (51%), Gaps = 8/224 (4%)
 Frame = +3

Query  348   VDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAF  518
              +P  FFR  +LK+G    MP   D ++P R+FLP  I   +  ++S   E+ RIF    
Sbjct  403   TEPGKFFRESMLKEGTLTQMPDIKD-KMPKRTFLPRTIVSKLSFSSSKTGEVWRIFGAGE  461

Query  519   SIPLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMG  698
             +  +    +  ++  C  P   GE   C+ + EDMI F+   LG   +   T++   G  
Sbjct  462   NSSMA-GIISSAISECERPPSYGETKRCVGSAEDMIDFATSVLG-HGVVVRTTENVVGSK  519

Query  699   NQVVMIGNVKPYKTN--KIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
              ++V+         +  + ++CH+  +P+  YYC+ +P  R+Y+ D+ +P+    +N  +
Sbjct  520   KKIVIGKVKGINGGDLTRAVSCHQSLYPYLLYYCHSVPKVRVYEADLLDPESSEKINHGI  579

Query  873   VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
              ICH+DTS W+  H AF  L   PG+ EVCHWI + D+ W   D
Sbjct  580   AICHIDTSAWSASHGAFVALGSGPGRIEVCHWIFENDMTWTTVD  623



>ref|XP_003588554.1| BURP domain-containing protein [Medicago truncatula]
Length=327

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 112/190 (59%), Gaps = 10/190 (5%)
 Frame = +3

Query  444  FLPPEIARNIPLNASELQRIFPTAFSIPL-TKAA--MDKSLGYCNAPAVKGERGSCLKTL  614
            FLP E+A +IP ++++L+ I    FSI   +K A  + +++  C A  +KGE   C+ +L
Sbjct  140  FLPREVANSIPFSSNKLENIL-NKFSIKEGSKEAEIVKRTISECEANGIKGEEKLCVTSL  198

Query  615  EDMIQFSRENLGGKHLAALTSDYTK---GMGNQVVMIGNVKPYKTNKIIACHEIFFPFAT  785
            E M+ F+   LG  ++ A++++  K   G+   V+  G  K  + NK I CH+  +P+  
Sbjct  199  ESMVDFTISKLGN-NVEAISTEVDKNSNGLQQYVIAKGVNKLGEKNKTIVCHKENYPYTV  257

Query  786  YYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCH  965
            +YC+K  ST +Y V +      G M K +V+CH DTS W PKH+AF++LK+ PG   +CH
Sbjct  258  FYCHKTDSTEVYSVPLEGVD--GNMVKTIVVCHTDTSEWNPKHLAFQVLKVQPGTVPICH  315

Query  966  WITQMDLIWI  995
             + Q  ++W+
Sbjct  316  ILPQDHVVWV  325



>gb|KDO79705.1| hypothetical protein CISIN_1g018131mg [Citrus sinensis]
Length=323

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/221 (33%), Positives = 116/221 (52%), Gaps = 12/221 (5%)
 Frame = +3

Query  351  DPSS--FFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSI  524
            DP++  FF    L  G K+ +  H        +FL  + A++ P ++ +L  IF   FS+
Sbjct  102  DPNTALFFLEKDLHPGMKMNL--HFTQTSNGATFLSRQAAKSTPFSSDKLPEIF-NQFSV  158

Query  525  ---PLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGM  695
                +    M  ++  C  P +KGE+  C  +LE MI FS   LG K + A++++  KG 
Sbjct  159  KPGSVEAEIMQNTIKECEDPGIKGEQKYCATSLESMIDFSTSKLG-KSVQAISTEVKKGT  217

Query  696  GNQVVMIG-NVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
              Q   I   VK    +K + CH+  +P+A +YC+   +TR Y V +      GT  K  
Sbjct  218  KMQTYTIAAGVKQMAADKSVVCHKQNYPYAVFYCHATQTTRAYMVPLEGAD--GTKAKAA  275

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
             +CH DTS W PKH+AF++LK+ PG   +CH++ +  ++W+
Sbjct  276  AVCHTDTSAWNPKHLAFQVLKVKPGTVPICHFLPEDHIVWV  316



>ref|XP_003588552.1| BURP domain protein [Medicago truncatula]
 gb|AES58803.1| dehydration-responsive protein RD22 [Medicago truncatula]
Length=326

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 116/202 (57%), Gaps = 13/202 (6%)
 Frame = +3

Query  417  LDSQLPNRS---FLPPEIARNIPLNASELQRIFPTAFSIPL-TKAA--MDKSLGYCNAPA  578
            L+ Q  N S   FLP E+A +IP ++++++ I    FSI   +K A  + +++  C A  
Sbjct  127  LNLQFTNNSGAKFLPKEVANSIPFSSNKMENIL-NKFSIKEGSKEAEIVKRTISECEANG  185

Query  579  VKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTK---GMGNQVVMIGNVKPYKTNKI  749
            +KGE   C+ +LE M+ F+   LG  ++ A++++  K   G+   V+  G  K  + NK 
Sbjct  186  IKGEEKLCITSLESMVDFTISKLGN-NVEAVSTEVDKNSNGLQQYVIAKGVKKLGEKNKT  244

Query  750  IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKL  929
            I CH+  +P+A +YC+K  ST +Y V +      G M K + +CH DTS W PKH+AF +
Sbjct  245  IVCHKENYPYAVFYCHKTDSTEVYSVPLEGVD--GNMVKTIAVCHTDTSEWNPKHLAFYV  302

Query  930  LKLSPGKGEVCHWITQMDLIWI  995
            LK+ PG   +CH + Q  ++W+
Sbjct  303  LKVQPGTVPICHILPQDHVVWV  324



>ref|XP_010046643.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Eucalyptus grandis]
Length=211

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 110/204 (54%), Gaps = 10/204 (5%)
 Frame = +3

Query  378  VLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNAS---ELQRIFPTAFSIPLTKAAMD  548
            +L+ G+ + + + L  + P R FLP  I+  +P + S   EL++IF       + K  M 
Sbjct  1    MLRSGNMIRILN-LRVKAPKRLFLPRSISSGLPFSISKFAELKQIFHAGDDSNMEKI-MV  58

Query  549  KSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGNVK  728
            ++L  C    ++GE   C+ ++E MI F+   LG  H   L S  +     + ++IG VK
Sbjct  59   RTLSQCEQAPIQGETKRCVSSVEGMIDFATSILG--HDIQLHSTESVEGSKREILIGRVK  116

Query  729  PYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSG  899
              + +K    +ACHE  FP+  YYC+   + R+Y+ D+ +P     +N  + + HMDTS 
Sbjct  117  RLEGSKSSAPVACHETIFPYMVYYCHTFLTLRVYEADILDPVSKAKINHGIALYHMDTSI  176

Query  900  WTPKHVAFKLLKLSPGKGEVCHWI  971
            W+P H AF  L+ SPG+ E CHW+
Sbjct  177  WSPNHEAFLALRSSPGQIETCHWV  200



>ref|XP_003588558.1| BURP domain protein [Medicago truncatula]
Length=323

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 116/202 (57%), Gaps = 13/202 (6%)
 Frame = +3

Query  417  LDSQLPNRS---FLPPEIARNIPLNASELQRIFPTAFSIPL-TKAA--MDKSLGYCNAPA  578
            L+ Q  N S   FLP E+A +IP ++++++ I    FSI   +K A  + +++  C A  
Sbjct  124  LNLQFTNNSGAKFLPKEVANSIPFSSNKMENIL-NKFSIKEGSKEAEIVKRTISECEANG  182

Query  579  VKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTK---GMGNQVVMIGNVKPYKTNKI  749
            +KGE   C+ +LE M+ F+   LG  ++ A++++  K   G+   V+  G  K  + NK 
Sbjct  183  IKGEEKLCITSLESMVDFTISKLGN-NVEAVSTEVDKNSNGLQQYVIAKGVNKLGEKNKT  241

Query  750  IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKL  929
            I CH+  +P+A +YC+K  ST +Y V +      G M K + +CH DTS W PKH+AF +
Sbjct  242  IVCHKENYPYAVFYCHKTDSTEVYSVPLEGVD--GNMVKTIAVCHTDTSEWNPKHLAFYV  299

Query  930  LKLSPGKGEVCHWITQMDLIWI  995
            LK+ PG   +CH + Q  ++W+
Sbjct  300  LKVQPGTVPICHILPQDHVVWV  321



>ref|XP_010925836.1| PREDICTED: BURP domain-containing protein 6-like isoform X1 [Elaeis 
guineensis]
Length=290

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 116/219 (53%), Gaps = 10/219 (5%)
 Frame = +3

Query  351  DPSS--FFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSI  524
            DPS   +F    L  G ++T   H    +   + LP + A +IP ++++L  I       
Sbjct  73   DPSEAIYFLEKDLHPGARMTF--HFIRTITGATLLPRQAADSIPFSSAKLPEILSRLSIT  130

Query  525  P--LTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTK-GM  695
            P  +   AM K+L  C  PA++GE   C  ++E M+ FS  +LG + + AL++   + G 
Sbjct  131  PNSIEAEAMKKTLQECEKPAMEGETKYCATSVEAMVDFSTSSLGTRDVRALSTTVDREGT  190

Query  696  GNQVVMIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLV  875
              QV  I  V+    +K + CH   +P+A +YC+ + S   Y V +    K GT  + + 
Sbjct  191  PKQVYSISKVQKQPVSKAVVCHGEKYPYAVFYCH-MTSAEAYKVSMVG--KDGTKVEGVA  247

Query  876  ICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             CH DT+G+ P+HVAFKLL + PG   +CH++ Q D++W
Sbjct  248  TCHTDTAGYNPEHVAFKLLHVKPGTVPICHFLLQSDIVW  286



>ref|XP_008781671.1| PREDICTED: BURP domain-containing protein 6-like, partial [Phoenix 
dactylifera]
Length=333

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/240 (33%), Positives = 126/240 (53%), Gaps = 12/240 (5%)
 Frame = +3

Query  294  VNPPPPGVKIYNFGFTGKV--DPSS--FFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEI  461
            VNP   G  +YN+  T     DPS   FF    L  G K+T+  H        + LP   
Sbjct  95   VNPYYSGPFLYNYAATKSQIQDPSVTLFFLEEDLHPGAKMTL--HFIRTTTGATLLPRRA  152

Query  462  ARNIPLNASELQRIFPTAFSIP--LTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFS  635
            A +IP ++++L  I       P  +    M+K+L  C  PA+ GE   C  ++E M+ FS
Sbjct  153  ADSIPFSSAKLPAILSRLSIAPNSIEAKVMNKTLHECEEPAIDGETKYCATSVESMVDFS  212

Query  636  RENLGGKHLAALTSDYTK-GMGNQVVMIGNVKPYKTNKIIACHEIFFPFATYYCYKLPST  812
              +LG +++ AL++   + G   QV  I +V+   ++K++ CH   + +A +YC+K  S 
Sbjct  213  TSSLGTRNVRALSTAVGREGTPKQVYAISDVQELPSSKLVVCHGENYAYAVFYCHKT-SA  271

Query  813  RIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
              Y V +    K GT  + +  CH +T+G+ P+HVAFK+L + PG   VCH++ Q D++W
Sbjct  272  VAYKVSLVG--KDGTKVEAVATCHTNTTGFNPEHVAFKVLDVKPGTVPVCHFLPQNDIVW  329



>dbj|BAC22501.1| resistant specific protein-3 [Vigna radiata]
Length=275

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/230 (31%), Positives = 113/230 (49%), Gaps = 14/230 (6%)
 Frame = +3

Query  321  IYNFGFTGKVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPP----EIARNIPLNAS  488
            I N      + PS+FF    L++G K      LD     R+F  P    EIA ++P ++ 
Sbjct  51   IVNHHHHDHLKPSNFFSEERLRRGAK------LDVLFRKRNFSTPLLTREIAEHLPFSSE  104

Query  489  ELQRIFPTAFSIPLTKAA--MDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHL  662
            ++  I       P +K A  ++++L +C  PA+KGE   C  ++E M+ F    LG    
Sbjct  105  KINEILEILAVKPDSKDAKNVEETLNHCEKPALKGEEKQCATSVESMVDFVTSKLGNNAR  164

Query  663  AALTSDYTKGMGNQVVMIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANP  842
               T         + ++   VK     KIIACH + +P+  +YC+K+ ++  + + +   
Sbjct  165  VTSTELEIGSKFQKFIVKDGVKILAEEKIIACHPMSYPYVVFYCHKMANSTAHFLPLEGE  224

Query  843  KKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
               GT  K + ICH DTS W P HVAF++LK+ PG    CH+  +  L+W
Sbjct  225  D--GTRVKAVAICHKDTSQWDPHHVAFQVLKVKPGTSSACHFFPEGHLVW  272



>ref|XP_006450616.1| hypothetical protein CICLE_v10008742mg [Citrus clementina]
 gb|ESR63856.1| hypothetical protein CICLE_v10008742mg [Citrus clementina]
Length=323

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/221 (33%), Positives = 116/221 (52%), Gaps = 12/221 (5%)
 Frame = +3

Query  351  DPSS--FFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSI  524
            DP++  FF    L  G K+ +  H        +FL  + A++ P ++ +L  IF   FS+
Sbjct  102  DPNTALFFLEKDLHPGMKMNL--HFTQTSNGATFLSRQAAKSTPFSSDKLPEIF-NQFSV  158

Query  525  ---PLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGM  695
                +    M  ++  C  P +KGE+  C  +LE MI FS   LG K + A++++  KG 
Sbjct  159  KPGSVEAEIMQNTIKECEDPGIKGEQKYCATSLESMIDFSTSKLG-KSVQAISTEVKKGT  217

Query  696  GNQVVMIG-NVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFL  872
              Q   I   VK    +K + CH+  +P+A +YC+   +TR Y V +      GT  K  
Sbjct  218  KMQTYTIAAGVKQMAADKSVVCHKQNYPYAVFYCHATQTTRAYIVPLEGVD--GTKAKAA  275

Query  873  VICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
             +CH DTS W PKH+AF++LK+ PG   +CH++ +  ++W+
Sbjct  276  AVCHTDTSAWNPKHLAFQVLKVKPGTVPICHFLPEDHIVWV  316



>ref|XP_010925834.1| PREDICTED: BURP domain-containing protein 6-like [Elaeis guineensis]
Length=293

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 116/219 (53%), Gaps = 10/219 (5%)
 Frame = +3

Query  351  DPSS--FFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSI  524
            DPS   +F    L  G ++T   H    +   + LP + A +IP ++++L  I       
Sbjct  76   DPSEAVYFLEKDLHPGARMTF--HFIRTITGATLLPRQAADSIPFSSAKLPEILSRLSIT  133

Query  525  P--LTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTK-GM  695
            P  +   AM K+L  C  PA++GE   C  ++E M+ FS  +LG + + AL++   + G 
Sbjct  134  PNSIEAQAMKKTLQECEKPAMEGETKYCATSVEAMVDFSTSSLGTRDVRALSTAVDRDGT  193

Query  696  GNQVVMIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLV  875
              QV  I  V+    +K + CH   +P+A +YC+ + S   Y V +    K GT  + + 
Sbjct  194  PKQVYSISKVQKQPVSKAVVCHGEKYPYAVFYCH-MTSAEAYKVSMVG--KDGTKVEGVA  250

Query  876  ICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             CH DT+G+ P+HVAFKLL + PG   +CH++ Q D++W
Sbjct  251  TCHTDTAGYNPEHVAFKLLHVKPGTVPICHFLLQSDIVW  289



>ref|XP_008245628.1| PREDICTED: dehydration-responsive protein RD22-like [Prunus mume]
Length=276

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/246 (32%), Positives = 128/246 (52%), Gaps = 22/246 (9%)
 Frame = +3

Query  312  GVKIYNFGFTGKVDPSSFFRLLVLKKG-----HKVTMP-SHLDSQLPNRS----FLPPEI  461
            G+K YN    GK  PSS  +LL  K        K   P + +  Q P  S    FLP E 
Sbjct  29   GIKGYNQKRYGKGSPSSDNQLLHYKDFALFFFEKDMRPGATMKFQFPRNSNTATFLPRES  88

Query  462  ARNIPLNASELQRIFPTAFSIPLTKA---AMDKSLGYCNAPAVKGERGSCLKTLEDMIQF  632
            A++IP  +++L  IF   FS+  T      + +++  C AP +K E   C  +LE M+ F
Sbjct  89   AQSIPFTSNKLPEIF-NHFSVKPTSVEAKTIKQTIEECKAPGIKAEEKYCATSLESMVDF  147

Query  633  SRENLGGKHLAALTSDY-----TKGMGNQVVMIGNVKPYKTNKIIACHEIFFPFATYYCY  797
            S   LG +++ A++++      T  M N   M G +K    +K++ CH+  +P+A ++C+
Sbjct  148  STSKLGTRNVEAISTEVLERGATMSMHNYTTMPG-LKKLAGDKVVVCHKENYPYAVFFCH  206

Query  798  KLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQ  977
             +  T  Y + +      G   K + ICH+DTS W P+H++FK+L + PG   +CH+I+ 
Sbjct  207  AIKQTAAYVLSLKGDD--GEKVKAVTICHLDTSEWNPEHLSFKILNVKPGTVAICHFIST  264

Query  978  MDLIWI  995
              ++W+
Sbjct  265  DGIVWV  270



>ref|XP_009338715.1| PREDICTED: BURP domain-containing protein 3-like isoform X1 [Pyrus 
x bretschneideri]
Length=406

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 108/202 (53%), Gaps = 7/202 (3%)
 Frame = +3

Query  402  TMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPLTKAAMDKSLG---YCNA  572
            TM  H  +    ++F+P E A +IP ++++L  IF   FS+       D   G    C  
Sbjct  202  TMKLHFTTNSKTQTFVPRETAESIPFSSNKLPEIF-NQFSVKSGSVEADIIKGTILECEN  260

Query  573  PAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQ-VVMIGNVKPYKTNKI  749
            PA++GE   C  +LE MI FS   LGG ++ A++++   G   Q   ++   K    +K 
Sbjct  261  PAIRGEEKYCATSLESMIDFSTSKLGGGNVRAISTEAGIGATLQKYTIVSGAKKLAADKS  320

Query  750  IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKL  929
            + CH+  +P+A +YC+   +TR Y V +      G   K + +CH DTS W PKH++F++
Sbjct  321  VVCHKQNYPYAVFYCHATKTTRAYVVPLKGAD--GVNVKAVAVCHTDTSDWNPKHLSFQV  378

Query  930  LKLSPGKGEVCHWITQMDLIWI  995
            LK+ PG   VCH++    ++W+
Sbjct  379  LKIKPGTVPVCHFLPSDHVVWV  400



>ref|XP_009416720.1| PREDICTED: BURP domain-containing protein 3-like [Musa acuminata 
subsp. malaccensis]
Length=383

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/216 (33%), Positives = 115/216 (53%), Gaps = 11/216 (5%)
 Frame = +3

Query  363  FFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIP---LT  533
            FF    L  G K+ +  H  + +   SFL    A +IP +++ L+ I    FS+      
Sbjct  169  FFLEKDLHPGAKMKL--HFTNTISGASFLRRRAADSIPFSSTRLREILDR-FSVEPNSAE  225

Query  534  KAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTK-GMGNQ--  704
             AA+ ++L  C  PAV+GER +C  +LE M++FS  +LG   + A ++  +K G   Q  
Sbjct  226  AAAIKQTLRDCEEPAVRGERKTCATSLEAMVEFSTSSLGTSKVKAASTTVSKEGTPAQEY  285

Query  705  VVMIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICH  884
             V    V+     ++  CH   + +A +YC+   ++R Y+VD+    K GT  +   +CH
Sbjct  286  TVAASGVREMGGEELATCHAEPYAYAIFYCHATSTSRGYEVDMVG--KDGTTVEAAAVCH  343

Query  885  MDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
             DT+ W P+HVAFK+L + PG   VCH++ Q  ++W
Sbjct  344  TDTTAWNPEHVAFKVLDIKPGSAPVCHFLPQDHVVW  379



>ref|XP_006476150.1| PREDICTED: dehydration-responsive protein RD22-like [Citrus sinensis]
 gb|KDO79704.1| hypothetical protein CISIN_1g018131mg [Citrus sinensis]
Length=360

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 122/239 (51%), Gaps = 17/239 (7%)
 Frame = +3

Query  312  GVKIYNFGFTGKV-----DPSS--FFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARN  470
            GV  +N+ +         DP++  FF    L  G K+ +  H        +FL  + A++
Sbjct  121  GVSPFNYVYAANENQLHDDPNTALFFLEKDLHPGMKMNL--HFTQTSNGATFLSRQAAKS  178

Query  471  IPLNASELQRIFPTAFSI---PLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRE  641
             P ++ +L  IF   FS+    +    M  ++  C  P +KGE+  C  +LE MI FS  
Sbjct  179  TPFSSDKLPEIF-NQFSVKPGSVEAEIMQNTIKECEDPGIKGEQKYCATSLESMIDFSTS  237

Query  642  NLGGKHLAALTSDYTKGMGNQVVMIG-NVKPYKTNKIIACHEIFFPFATYYCYKLPSTRI  818
             LG K + A++++  KG   Q   I   VK    +K + CH+  +P+A +YC+   +TR 
Sbjct  238  KLG-KSVQAISTEVKKGTKMQTYTIAAGVKQMAADKSVVCHKQNYPYAVFYCHATQTTRA  296

Query  819  YDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
            Y V +      GT  K   +CH DTS W PKH+AF++LK+ PG   +CH++ +  ++W+
Sbjct  297  YMVPLEGAD--GTKAKAAAVCHTDTSAWNPKHLAFQVLKVKPGTVPICHFLPEDHIVWV  353



>ref|XP_009338716.1| PREDICTED: dehydration-responsive protein RD22-like isoform X2 
[Pyrus x bretschneideri]
Length=406

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 108/202 (53%), Gaps = 7/202 (3%)
 Frame = +3

Query  402  TMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPLTKAAMDKSLG---YCNA  572
            TM  H  +    ++F+P E A +IP ++++L  IF   FS+       D   G    C  
Sbjct  202  TMKLHFTTNSKTQTFVPRETAESIPFSSNKLPEIF-NQFSVKSGSVEADIIKGTILECEN  260

Query  573  PAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQ-VVMIGNVKPYKTNKI  749
            PA++GE   C  +LE MI FS   LGG ++ A++++   G   Q   ++   K    +K 
Sbjct  261  PAIRGEEKYCATSLESMIDFSTSKLGGGNVRAISTEAGIGATLQKYTIVSGAKKLAADKS  320

Query  750  IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKL  929
            + CH+  +P+A +YC+   +TR Y V +      G   K + +CH DTS W PKH++F++
Sbjct  321  VVCHKQNYPYAVFYCHATKTTRAYVVPLKGAD--GVNVKAVAVCHTDTSDWNPKHLSFQV  378

Query  930  LKLSPGKGEVCHWITQMDLIWI  995
            LK+ PG   VCH++    ++W+
Sbjct  379  LKIKPGTVPVCHFLPSDHVVWV  400



>ref|XP_009338717.1| PREDICTED: BURP domain-containing protein 3-like isoform X3 [Pyrus 
x bretschneideri]
Length=406

 Score =   127 bits (319),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 108/202 (53%), Gaps = 7/202 (3%)
 Frame = +3

Query  402  TMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPLTKAAMDKSLG---YCNA  572
            TM  H  +    ++F+P E A +IP ++++L  IF   FS+       D   G    C  
Sbjct  202  TMKLHFTTNSKTQTFVPRETAESIPFSSNKLPEIF-NQFSVKSGSVEADIIKGTILECEN  260

Query  573  PAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQ-VVMIGNVKPYKTNKI  749
            PA++GE   C  +LE MI FS   LGG ++ A++++   G   Q   ++   K    +K 
Sbjct  261  PAIRGEEKYCATSLESMIDFSTSKLGGGNVRAISTEAGIGATLQKYTIVSGAKKLAADKS  320

Query  750  IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKL  929
            + CH+  +P+A +YC+   +TR Y V +      G   K + +CH DTS W PKH++F++
Sbjct  321  VVCHKQNYPYAVFYCHATKTTRAYVVPLKGAD--GVNVKAVAVCHTDTSDWNPKHLSFQV  378

Query  930  LKLSPGKGEVCHWITQMDLIWI  995
            LK+ PG   VCH++    ++W+
Sbjct  379  LKIKPGTVPVCHFLPSDHVVWV  400



>ref|XP_006644664.1| PREDICTED: BURP domain-containing protein 3-like [Oryza brachyantha]
Length=428

 Score =   127 bits (320),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/239 (33%), Positives = 124/239 (52%), Gaps = 16/239 (7%)
 Frame = +3

Query  321   IYNFGFTGKV---DP--SSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNA  485
             IYN+  T      DP  + FF    L  G   TM  H         FLP   A  +P ++
Sbjct  195   IYNYAATETQPHDDPNVALFFLEKDLHPGK--TMTVHFTPTTAGAKFLPQSEADTMPFSS  252

Query  486   SELQRIFPTAFSI---PLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGK  656
              ++  I  + FS+    +  A M ++L  C APA KGE+ +C  +LE M+ F+  +LG  
Sbjct  253   EKVSEIL-SRFSVNPGSVEAAEMARTLRDCEAPAAKGEKKACATSLESMVDFATSSLGTS  311

Query  657   HLAALTSDYTK-GMGNQVVMIGNVKPYKT--NKIIACHEIFFPFATYYCYKLPSTRIYDV  827
             H+ A+++   K G   Q   +  VK      + ++ACH   + +A + C++  +TR Y V
Sbjct  312   HVRAVSTVVGKEGSPEQEYTMTAVKRAAAGGDTLVACHAEPYAYAVFACHRTQATRAYTV  371

Query  828   DVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWIGYD  1004
              +A   + GT  + + +CH DT+GW PKH+AF++LK+ PG   VCH++ Q  ++W   D
Sbjct  372   SMAG--RDGTTVETVAVCHADTAGWNPKHIAFQVLKVKPGTVPVCHFLPQDHVVWTRSD  428



>gb|ACF84595.1| unknown [Zea mays]
 gb|ACF85888.1| unknown [Zea mays]
Length=207

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 102/191 (53%), Gaps = 10/191 (5%)
 Frame = +3

Query  444  FLPPEIARNIPLNASELQRIFPTAFSIP--LTKAAMDKSLGYCNAPAVKGERGSCLKTLE  617
            FLP   A  IP ++ ++  I       P  +  A M ++L  C APA KGE+ +C  +LE
Sbjct  15   FLPRSEAEAIPFSSQKVPEILARLSVDPDSVEAAEMAQTLRDCEAPAAKGEKKACATSLE  74

Query  618  DMIQFSRENLGGKHLAALTSDYTK-GMGNQVVMIGNVKPY-----KTNKIIACHEIFFPF  779
             M+ F+  +LG +H+ A+++   K G   Q   +  V+          +++ACH   + +
Sbjct  75   SMVDFATASLGTRHVRAVSTVVAKEGSPKQEYTVTGVERAAGGTDDDGRVVACHAEPYAY  134

Query  780  ATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEV  959
            A + C+  P TR Y V +    + GT    + +CH DTSGW PKHVAF++L + PG   V
Sbjct  135  AVFACHLTPQTRAYSVSMLG--RDGTAVDAVAVCHADTSGWNPKHVAFQVLNVKPGTVPV  192

Query  960  CHWITQMDLIW  992
            CH++ Q  ++W
Sbjct  193  CHFLPQDHVVW  203



>dbj|BAC22500.1| resistant specific protein-2 [Vigna radiata]
Length=440

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 114/230 (50%), Gaps = 14/230 (6%)
 Frame = +3

Query  321  IYNFGFTGKVDPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPP----EIARNIPLNAS  488
            I N      + PSS+F    L++G K+ M  H       R F  P    EIA ++P ++ 
Sbjct  216  IANHHHHDHLKPSSYFSEEGLRRGAKLVMLFH------KRKFSTPLLTREIAEHLPFSSE  269

Query  489  ELQRIFPTAFSIPLTKAA--MDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHL  662
            ++  I       P +K A  ++K+L  C  PA+KGE   C  ++E M+ F    LG    
Sbjct  270  KINEILEILAVKPDSKNAKNVEKTLNNCEEPALKGEEKHCATSVESMVDFVTSKLGNNAR  329

Query  663  AALTSDYTKGMGNQVVMIGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANP  842
               T    +    + ++   VK     +IIACH + +P+  +YC+K+ ++  + V +   
Sbjct  330  VTSTELEIESKFQKFIVKDGVKILAEEEIIACHPMSYPYVVFYCHKMSNSTAHVVPLEGE  389

Query  843  KKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIW  992
               GT  K +VICH DTS W P HVAF++LK+ PG   VCH+     L+W
Sbjct  390  D--GTRVKAIVICHKDTSQWDPDHVAFQVLKVKPGTSPVCHFFPNGHLLW  437



>gb|EMT30231.1| hypothetical protein F775_20363 [Aegilops tauschii]
Length=444

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 100/195 (51%), Gaps = 6/195 (3%)
 Frame = +3

Query  417  LDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPLTKAAMDKSLGYCNAPAVKGERG  596
            +  ++P  + LP +IA  IP   + +  +F       + KA +  ++  C     +GE  
Sbjct  249  IGDKIPPGASLPRDIAGKIPFEPNAVSEVFRVPLDTAMGKA-VASTVAECERAPSQGETK  307

Query  597  SCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGNVKPYKTNKI---IACHEI  767
             C  + ED++ F+ E LG   +   ++  T G G  +  +GNV      K+   ++CH+ 
Sbjct  308  RCATSAEDIVDFAVEMLG-SDIVVHSTASTAGSGADI-RLGNVTGVHGGKVTRPVSCHQS  365

Query  768  FFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPG  947
             FP+  YYC+ +P  R+Y+ D+        +N  + ICH+DTS W+P H AF  L   PG
Sbjct  366  LFPYLVYYCHSVPKARVYEADITAADSGQKINHGVAICHLDTSDWSPAHGAFIALGGKPG  425

Query  948  KGEVCHWITQMDLIW  992
            K EVCHWI + D+ W
Sbjct  426  KIEVCHWIFEGDMTW  440



>ref|XP_006450615.1| hypothetical protein CICLE_v10008742mg [Citrus clementina]
 gb|ESR63855.1| hypothetical protein CICLE_v10008742mg [Citrus clementina]
Length=360

 Score =   126 bits (317),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 122/239 (51%), Gaps = 17/239 (7%)
 Frame = +3

Query  312  GVKIYNFGFTGKV-----DPSS--FFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARN  470
            GV  +N+ +         DP++  FF    L  G K+ +  H        +FL  + A++
Sbjct  121  GVSPFNYVYAANENQLHDDPNTALFFLEKDLHPGMKMNL--HFTQTSNGATFLSRQAAKS  178

Query  471  IPLNASELQRIFPTAFSI---PLTKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRE  641
             P ++ +L  IF   FS+    +    M  ++  C  P +KGE+  C  +LE MI FS  
Sbjct  179  TPFSSDKLPEIF-NQFSVKPGSVEAEIMQNTIKECEDPGIKGEQKYCATSLESMIDFSTS  237

Query  642  NLGGKHLAALTSDYTKGMGNQVVMIG-NVKPYKTNKIIACHEIFFPFATYYCYKLPSTRI  818
             LG K + A++++  KG   Q   I   VK    +K + CH+  +P+A +YC+   +TR 
Sbjct  238  KLG-KSVQAISTEVKKGTKMQTYTIAAGVKQMAADKSVVCHKQNYPYAVFYCHATQTTRA  296

Query  819  YDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
            Y V +      GT  K   +CH DTS W PKH+AF++LK+ PG   +CH++ +  ++W+
Sbjct  297  YIVPLEGVD--GTKAKAAAVCHTDTSAWNPKHLAFQVLKVKPGTVPICHFLPEDHIVWV  353



>gb|EEE68602.1| hypothetical protein OsJ_27135 [Oryza sativa Japonica Group]
Length=703

 Score =   129 bits (325),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/226 (31%), Positives = 114/226 (50%), Gaps = 12/226 (5%)
 Frame = +3

Query  351   DPSSFFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSIPL  530
             +P  FFR   L  G+ + MP   D ++P R+FLP +IA+ IP   + +  +F       +
Sbjct  387   EPGKFFRETELVSGNTMPMPDIKD-KMPPRAFLPRDIAKKIPFKPNAVSEVFGVPLDTAM  445

Query  531   TKAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVV  710
              KA +  ++  C     +GE   C  + ED++ F+ E LG   +   ++  T G G Q+ 
Sbjct  446   GKA-VTSTVAECERAPSRGETKRCATSAEDIVDFAVEMLG-NDIVVRSTASTAGSGGQI-  502

Query  711   MIGNVKPYKTNKI---IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVIC  881
              +GNV      K+   ++CH+  FP+  YYC+ +P  R+Y+ D+        +N  + IC
Sbjct  503   RLGNVTGVDGGKVTRSVSCHQSLFPYLVYYCHSVPKVRVYEADIMAADSDQKINHGVAIC  562

Query  882   HMDTSGWTPKHVAFKLLKLSPGKGEV-----CHWITQMDLIWIGYD  1004
             H+DTS W+P H AF  L   PG+ EV     C  +T +  +W   D
Sbjct  563   HLDTSDWSPTHGAFIALGGKPGEVEVTGVGSCWLLTGVGSLWSQQD  608



>gb|ABK96092.1| unknown [Populus trichocarpa]
Length=204

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 107/188 (57%), Gaps = 7/188 (4%)
 Frame = +3

Query  441  SFLPPEIARNIPLNASELQRIFPTAFSI-PLTKAA--MDKSLGYCNAPAVKGERGSCLKT  611
            +FLP ++A +IP +++ L  I+ + FS+ P +  A  M +++  C  P ++GE   C  +
Sbjct  19   TFLPRQVADSIPFSSNNLPEIY-SEFSVKPGSTEAEVMKETIKECENPGIEGEEKECATS  77

Query  612  LEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGNVKPYKTNKIIACHEIFFPFATYY  791
            LE MI FS   LG K++ A++++       +  +   VK    +K + CH+  + +A +Y
Sbjct  78   LESMIDFSTSKLG-KNVQAISTEVESTQMQKYTIKTGVKKMAGDKSVVCHKQNYAYAVFY  136

Query  792  CYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKLLKLSPGKGEVCHWI  971
            C+   +TR Y V +      GT  K + +CH DTS W PKH+AF++L + PG   VCH++
Sbjct  137  CHATQNTRAYAVPLEGAD--GTNAKAVAVCHTDTSAWNPKHLAFQVLNVKPGTVPVCHFL  194

Query  972  TQMDLIWI  995
             Q  ++W+
Sbjct  195  PQDHVVWL  202



>gb|ACH97124.1| BURP domain-containing protein [Camellia sinensis]
Length=337

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/214 (31%), Positives = 115/214 (54%), Gaps = 9/214 (4%)
 Frame = +3

Query  363  FFRLLVLKKGHKVTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSI---PLT  533
            FF    LKK  K+T+  H        +FLP ++A  IP ++ ++ +I    FS+    + 
Sbjct  128  FFLENDLKKYTKMTL--HFTKTTTPTTFLPRQVAEKIPFSSKKIPQIL-DYFSVKPNSME  184

Query  534  KAAMDKSLGYCNAPAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVM  713
               + +++  C  P +KGE   C  +LE M+ F    LG K + A++++  K    Q   
Sbjct  185  AKTIKQTIKECEEPGIKGEEKYCATSLESMVDFCSTRLG-KSIQAISTEVKKETPLQTYT  243

Query  714  IGNVKPYKTNKIIACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDT  893
            I  VK   ++  + CH+  + +  +YC+K  +T+ Y V +   +  GT  + + +CH DT
Sbjct  244  IEGVKKMASDAAVVCHKQNYAYTVFYCHKTQTTKAYSVSMV--RLDGTKAEAVAVCHTDT  301

Query  894  SGWTPKHVAFKLLKLSPGKGEVCHWITQMDLIWI  995
            SGW PKH+AF+LLK+ PG   +CH++ +  ++W+
Sbjct  302  SGWNPKHLAFQLLKVKPGTVPICHFLPEDHIVWV  335



>gb|AAT66913.1| dehydration-induced protein RD22-like protein 2 [Gossypium arboreum]
Length=376

 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 105/202 (52%), Gaps = 6/202 (3%)
 Frame = +3

Query  399  VTMPSHLDSQLPNRSFLPPEIARNIPLNASELQRIFPTAFSI---PLTKAAMDKSLGYCN  569
             TM  H        +FLP + A+ IP +++EL  IF   FS+    +    M  ++  C 
Sbjct  176  ATMSLHFTENTEKSAFLPYQTAQKIPFSSNELPEIF-NKFSVKPGSVKAEMMKNTIKECE  234

Query  570  APAVKGERGSCLKTLEDMIQFSRENLGGKHLAALTSDYTKGMGNQVVMIGNVKPYKTNKI  749
             PA++GE   C  +LE MI +S   LG    A  T    +   ++  +   V+    +K 
Sbjct  235  QPAIEGEEKYCATSLESMIDYSISKLGKVDQAVSTEVEKQTPTHKYTITAGVQKMTNDKA  294

Query  750  IACHEIFFPFATYYCYKLPSTRIYDVDVANPKKMGTMNKFLVICHMDTSGWTPKHVAFKL  929
            + CH+  + +A +YC+K  +TR Y V +      GT  K + +CH DTS W PKH+AF++
Sbjct  295  VVCHKQNYAYAVFYCHKSETTRAYMVPLEGAD--GTKAKAVAVCHTDTSAWNPKHLAFQV  352

Query  930  LKLSPGKGEVCHWITQMDLIWI  995
            LK+ PG   VCH++ +  ++W+
Sbjct  353  LKVEPGTIPVCHFLPRDHIVWV  374



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3013129232434