BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18345_g1_i1 len=966 path=[4053:0-130 2892:131-167 824:168-487
1144:488-732 1389:733-965]

Length=966
                                                                      Score     E

ref|XP_011091745.1|  PREDICTED: polygalacturonase-1 non-catalytic...  82.0    4e-15   
emb|CDP10830.1|  unnamed protein product                              72.0    4e-14   
ref|XP_011074238.1|  PREDICTED: BURP domain-containing protein 16...  65.5    4e-12   
gb|EYU36708.1|  hypothetical protein MIMGU_mgv1a009279mg              57.0    4e-10   
gb|KDP26581.1|  hypothetical protein JCGZ_17739                       53.9    1e-04   
ref|XP_011091740.1|  PREDICTED: polygalacturonase-1 non-catalytic...  52.4    2e-04   
ref|XP_004241419.1|  PREDICTED: BURP domain-containing protein 16...  51.6    5e-04   



>ref|XP_011091745.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Sesamum indicum]
Length=336

 Score = 82.0 bits (201),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 68/107 (64%), Gaps = 5/107 (5%)
 Frame = +1

Query  151  FWSQNVHNNMPQSILSKLSPLSESEAEMFTPLVSKKNFFSNPKFCTTANLVCSVAVKPLP  330
            FWS NV N MP++I  KLSPL++ E+E +   +SK NF ++ KFC+ A L CS  +  + 
Sbjct  40   FWSANVLNKMPEAISKKLSPLTKHESEYYAETISKDNFEADLKFCSLAKLACSAVLDDI-  98

Query  331  PSLIQYTHSTDKVYVP---VAVEQVHPASLFRLSVIKKKGTK*LSQL  462
              +++ +++T  VY+    + +E+V P S FRLS++K+  T  LS L
Sbjct  99   -KVVKQSYTTRNVYMDNKAIPLEKVDPFSFFRLSILKEGNTIHLSDL  144


 Score = 27.7 bits (60),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 5/36 (14%)
 Frame = +2

Query  542  LQRIFPTAFSIPMTKAAVQLSLSHCDAPRVKGALAI  649
            + +IFP +     +K AV  +LS+C+A  +KG L +
Sbjct  169  IAKIFPES-----SKEAVGTTLSYCNAAAIKGELKV  199



>emb|CDP10830.1| unnamed protein product [Coffea canephora]
Length=336

 Score = 72.0 bits (175),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 57/96 (59%), Gaps = 2/96 (2%)
 Frame = +1

Query  148  KFWSQNVHNNMPQSILSKLSPLSESEAEMFTPLVSKKNFFSNPKFCTTANLVCSVAVKPL  327
            K+WS+NV   MP ++LSKLSPL++ +AE FT LVSKKN   N   C+ ANL CS   K  
Sbjct  38   KYWSENVQGTMPGNLLSKLSPLNKEQAEHFTSLVSKKNLPFNANHCSLANLACS--PKSF  95

Query  328  PPSLIQYTHSTDKVYVPVAVEQVHPASLFRLSVIKK  435
              +L+           P  V+ V P+S  R+S++K+
Sbjct  96   VNNLMHNIFYGYGRISPSHVQHVDPSSFLRISLLKQ  131


 Score = 34.3 bits (77),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +2

Query  536  SELQRIFPTAFSIPMTKAAVQLSLSHCDAPRVKGAL  643
            ++LQ++FP +   P TK A+Q ++ +C+ P +K  +
Sbjct  163  NDLQKLFPQSLKNPQTKDAIQSTIVYCNTPALKDEI  198



>ref|XP_011074238.1| PREDICTED: BURP domain-containing protein 16-like [Sesamum indicum]
Length=334

 Score = 65.5 bits (158),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 55/100 (55%), Gaps = 12/100 (12%)
 Frame = +1

Query  148  KFWSQNVHNNMPQSILSKLSPLSESEAEMFTPLVSKKNFFS-NPKFCTTANLVCSVAVKP  324
            +FWSQNVHN MP+ IL KLSPLS ++ E ++ ++ +   FS +  FC+ A L C+ A   
Sbjct  37   RFWSQNVHNKMPEPILKKLSPLSRNDYEYYSNVLPQNGKFSADSHFCSLAKLSCTFATA-  95

Query  325  LPPSLIQYTHSTDKVYVPVAVEQV----HPASLFRLSVIK  432
                  +YT          AV+QV     P S FR+S +K
Sbjct  96   ------KYTQQNTYGINSAAVDQVKRSEDPFSFFRVSTLK  129


 Score = 33.9 bits (76),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 22/33 (67%), Gaps = 1/33 (3%)
 Frame = +3

Query  432  KKGNKVTLPTNLDRELPNRFFLPPQIAANFHLS  530
            K GN V LP NL   LP+R FLPPQI ++  L+
Sbjct  129  KTGNLVHLP-NLQETLPDRTFLPPQIVSSIPLT  160



>gb|EYU36708.1| hypothetical protein MIMGU_mgv1a009279mg [Erythranthe guttata]
Length=347

 Score = 57.0 bits (136),  Expect(3) = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 58/106 (55%), Gaps = 12/106 (11%)
 Frame = +1

Query  148  KFWSQNVHNNMPQSILSKLSPLSESEAEMFTPLVSKKNFF--SNPKFCTTANLVCSVAVK  321
            KFWS+NV N +P+ IL KLSPLS+   + ++ L+  KN    ++  FC  A L C+   +
Sbjct  38   KFWSENVENQIPKPILKKLSPLSQKNCDYYSNLLLSKNSIHAADANFCALAKLACTSVFQ  97

Query  322  PLPPSLIQYTHSTDKVYVPVA--------VEQVHPASLFRLSVIKK  435
                ++++ T++ +K Y   +        ++   P + +RLS +K+
Sbjct  98   --KANIVKDTYTREKTYGRFSAALHRHQDIKNEDPFAFYRLSALKE  141


 Score = 28.1 bits (61),  Expect(3) = 4e-10, Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 20/32 (63%), Gaps = 0/32 (0%)
 Frame = +2

Query  542  LQRIFPTAFSIPMTKAAVQLSLSHCDAPRVKG  637
            + RIFP +     TK  +Q +L++C+A  ++G
Sbjct  175  ISRIFPDSDISGKTKETIQTTLAYCNAEAIQG  206


 Score = 26.6 bits (57),  Expect(3) = 4e-10, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (68%), Gaps = 1/28 (4%)
 Frame = +3

Query  432  KKGNKVTLPTNLDRELPNRFFLPPQIAA  515
            K+G  + LP +L   LP+R FLP Q+A+
Sbjct  140  KEGKLIHLP-HLKESLPDRAFLPQQMAS  166



>gb|KDP26581.1| hypothetical protein JCGZ_17739 [Jatropha curcas]
Length=629

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 46/75 (61%), Gaps = 6/75 (8%)
 Frame = +1

Query  148  KFWSQNVHNNMPQS--ILSKLSPLSESEAEMFTPLVSKKNFFSN-PKFCTTANLVCSVAV  318
            ++W++ +HNN+PQS  IL+K SPL+  +A  F+ L  K    S  P FC++A+L C    
Sbjct  45   RYWNKEIHNNLPQSSFILAKASPLNAVDAVTFSKLAEKNALSSKLPDFCSSAHLFC---F  101

Query  319  KPLPPSLIQYTHSTD  363
              L PSL ++T  +D
Sbjct  102  PDLSPSLEKHTDDSD  116



>ref|XP_011091740.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Sesamum indicum]
Length=281

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 53/96 (55%), Gaps = 6/96 (6%)
 Frame = +1

Query  178  MPQSILSKLSPLSESEAEMFTPLVSKKNFFSNPKFCTTANLVCSVAVKPLPPSLIQYTHS  357
            MP++I +KLSPL+  ++  +   +S+ NF ++ +FC+ A L CS+       +L+     
Sbjct  1    MPEAISTKLSPLTNQDSNYYAEAISENNFNADTEFCSRAKLACSIGSDAYVTALVY----  56

Query  358  TDKVYVPVA-VEQVHPASLFRLSVIKKKGTK*LSQL  462
             +K    +A +E+V   S FRLS +K+     LS L
Sbjct  57   -NKYGGAIAPLEKVDQFSFFRLSTLKEGNEIHLSSL  91



>ref|XP_004241419.1| PREDICTED: BURP domain-containing protein 16-like [Solanum lycopersicum]
Length=408

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  148  KFWSQNVHNNMPQSILSKLSPLSESEAEMFTPLVSKKNFFSNPKFCTTANLVCS  309
            KFW +NV N MP S++SKLSP++  +++ +T LVSKK F  + + C  A++ C+
Sbjct  35   KFWKENVVNEMPPSLVSKLSPMNMIDSQYYTSLVSKKAFSFDTQSCLLADIFCT  88



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2146230378139