BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18342_g1_i1 len=1771 path=[1749:0-499 2249:500-790 @2540@!:791-989
2739:990-1770]

Length=1771
                                                                      Score     E

ref|XP_009600330.1|  PREDICTED: aluminum-activated malate transpo...    553   0.0      
ref|XP_009778854.1|  PREDICTED: aluminum-activated malate transpo...    551   0.0      
ref|XP_004229999.1|  PREDICTED: aluminum-activated malate transpo...    545   0.0      
ref|XP_002264499.1|  PREDICTED: aluminum-activated malate transpo...    491   1e-164   Vitis vinifera
ref|XP_007210119.1|  hypothetical protein PRUPE_ppa022258mg             483   2e-161   
ref|XP_008239213.1|  PREDICTED: aluminum-activated malate transpo...    481   2e-160   
ref|XP_006491482.1|  PREDICTED: aluminum-activated malate transpo...    477   4e-159   
gb|KDO86531.1|  hypothetical protein CISIN_1g041036mg                   476   1e-158   
ref|XP_009358731.1|  PREDICTED: aluminum-activated malate transpo...    474   9e-158   
gb|EYU32272.1|  hypothetical protein MIMGU_mgv1a024574mg                470   1e-156   
ref|XP_008390303.1|  PREDICTED: aluminum-activated malate transpo...    468   6e-156   
ref|XP_010054987.1|  PREDICTED: aluminum-activated malate transpo...    467   3e-155   
ref|XP_011094087.1|  PREDICTED: aluminum-activated malate transpo...    466   3e-155   
ref|XP_009359585.1|  PREDICTED: aluminum-activated malate transpo...    466   7e-155   
ref|XP_011023141.1|  PREDICTED: aluminum-activated malate transpo...    466   9e-155   
ref|XP_008459754.1|  PREDICTED: aluminum-activated malate transpo...    463   8e-154   
ref|XP_002301422.2|  hypothetical protein POPTR_0002s17520g             461   4e-153   Populus trichocarpa [western balsam poplar]
ref|XP_008374093.1|  PREDICTED: aluminum-activated malate transpo...    461   1e-152   
ref|XP_006439261.1|  hypothetical protein CICLE_v10024452mg             460   2e-152   
ref|XP_010252735.1|  PREDICTED: aluminum-activated malate transpo...    460   2e-152   
ref|XP_004310262.1|  PREDICTED: aluminum-activated malate transpo...    459   2e-152   
ref|XP_007051494.1|  Aluminum activated malate transporter family...    459   3e-152   
gb|KGN46529.1|  hypothetical protein Csa_6G106810                       458   8e-152   
ref|XP_006396321.1|  hypothetical protein EUTSA_v10028612mg             452   1e-149   
ref|XP_010919295.1|  PREDICTED: LOW QUALITY PROTEIN: aluminum-act...    452   2e-149   
ref|XP_011022437.1|  PREDICTED: aluminum-activated malate transpo...    450   1e-148   
gb|KDP28457.1|  hypothetical protein JCGZ_14228                         449   2e-148   
ref|XP_002299439.1|  hypothetical protein POPTR_0001s11180g             449   4e-148   Populus trichocarpa [western balsam poplar]
ref|XP_010422744.1|  PREDICTED: aluminum-activated malate transpo...    446   3e-147   
ref|XP_010428025.1|  PREDICTED: aluminum-activated malate transpo...    446   4e-147   
ref|XP_002303680.2|  hypothetical protein POPTR_0003s14490g             447   4e-147   Populus trichocarpa [western balsam poplar]
ref|XP_007039437.1|  Aluminum activated malate transporter family...    446   7e-147   
ref|XP_009359572.1|  PREDICTED: aluminum-activated malate transpo...    445   9e-147   
emb|CDX91864.1|  BnaC03g31660D                                          446   1e-146   
ref|XP_002518887.1|  conserved hypothetical protein                     445   1e-146   Ricinus communis
ref|XP_004140623.1|  PREDICTED: aluminum-activated malate transpo...    444   2e-146   
ref|XP_002872918.1|  hypothetical protein ARALYDRAFT_352740             444   3e-146   
ref|XP_010456184.1|  PREDICTED: aluminum-activated malate transpo...    444   3e-146   
ref|XP_011026815.1|  PREDICTED: aluminum-activated malate transpo...    444   4e-146   
ref|XP_006290127.1|  hypothetical protein CARUB_v10003790mg             442   8e-146   
gb|EYU38875.1|  hypothetical protein MIMGU_mgv1a024507mg                441   1e-145   
ref|XP_008806969.1|  PREDICTED: aluminum-activated malate transpo...    441   2e-145   
ref|XP_004298279.1|  PREDICTED: aluminum-activated malate transpo...    441   3e-145   
ref|XP_009776252.1|  PREDICTED: aluminum-activated malate transpo...    440   4e-145   
ref|XP_009612746.1|  PREDICTED: aluminum-activated malate transpo...    436   3e-143   
ref|NP_567199.2|  aluminum activated malate transporter family pr...    436   4e-143   Arabidopsis thaliana [mouse-ear cress]
gb|KDP25238.1|  hypothetical protein JCGZ_20394                         435   1e-142   
ref|XP_010053089.1|  PREDICTED: aluminum-activated malate transpo...    433   6e-142   
ref|XP_010556613.1|  PREDICTED: aluminum-activated malate transpo...    432   9e-142   
ref|XP_007219805.1|  hypothetical protein PRUPE_ppa026486mg             432   9e-142   
gb|KCW77334.1|  hypothetical protein EUGRSUZ_D01695                     431   2e-141   
emb|CDX74373.1|  BnaA03g26740D                                          430   4e-141   
emb|CDX97239.1|  BnaA02g20300D                                          430   6e-141   
emb|CDP20970.1|  unnamed protein product                                429   3e-140   
ref|XP_004246086.1|  PREDICTED: aluminum-activated malate transpo...    427   6e-140   
gb|AAB62849.1|  A_TM018A10.3 gene product                               428   7e-140   Arabidopsis thaliana [mouse-ear cress]
emb|CDY01945.1|  BnaC02g27820D                                          425   3e-139   
emb|CDY01943.1|  BnaC02g27840D                                          423   2e-138   
ref|XP_009389304.1|  PREDICTED: aluminum-activated malate transpo...    422   8e-138   
ref|XP_010106139.1|  Aluminum-activated malate transporter 10           422   1e-137   
ref|XP_009387859.1|  PREDICTED: aluminum-activated malate transpo...    421   2e-137   
ref|XP_010694502.1|  PREDICTED: aluminum-activated malate transpo...    421   3e-137   
ref|XP_002273129.2|  PREDICTED: aluminum-activated malate transpo...    419   3e-137   Vitis vinifera
emb|CBI34564.3|  unnamed protein product                                419   4e-137   
gb|KDO76671.1|  hypothetical protein CISIN_1g011750mg                   415   3e-135   
ref|XP_009134496.1|  PREDICTED: LOW QUALITY PROTEIN: aluminum-act...    415   7e-135   
ref|XP_004308292.1|  PREDICTED: aluminum-activated malate transpo...    414   1e-134   
ref|XP_006444802.1|  hypothetical protein CICLE_v10024564mg             414   1e-134   
ref|XP_008233172.1|  PREDICTED: LOW QUALITY PROTEIN: aluminum-act...    412   2e-134   
ref|XP_010934557.1|  PREDICTED: aluminum-activated malate transpo...    412   3e-134   
ref|XP_002452765.1|  hypothetical protein SORBIDRAFT_04g032070          413   3e-134   Sorghum bicolor [broomcorn]
ref|NP_001047711.1|  Os02g0673100                                       412   5e-134   Oryza sativa Japonica Group [Japonica rice]
gb|KEH42891.1|  aluminum activated malate transporter family protein    411   1e-133   
gb|EAY87040.1|  hypothetical protein OsI_08439                          410   3e-133   Oryza sativa Indica Group [Indian rice]
ref|XP_009334385.1|  PREDICTED: aluminum-activated malate transpo...    410   4e-133   
gb|KEH42890.1|  aluminum activated malate transporter family protein    409   8e-133   
ref|XP_008810443.1|  PREDICTED: aluminum-activated malate transpo...    406   6e-132   
ref|XP_004495501.1|  PREDICTED: aluminum-activated malate transpo...    406   9e-132   
gb|ACU21022.1|  unknown                                                 406   2e-131   Glycine max [soybeans]
ref|XP_003556423.1|  PREDICTED: aluminum-activated malate transpo...    404   7e-131   
gb|KHN05000.1|  Aluminum-activated malate transporter 10                404   1e-130   
ref|XP_003570082.1|  PREDICTED: aluminum-activated malate transpo...    403   2e-130   
ref|XP_006647674.1|  PREDICTED: aluminum-activated malate transpo...    402   3e-130   
gb|KHN14754.1|  Aluminum-activated malate transporter 10                408   5e-130   
emb|CDY07155.1|  BnaCnng01700D                                          400   9e-130   
ref|XP_006344005.1|  PREDICTED: aluminum-activated malate transpo...    399   2e-129   
ref|XP_007161574.1|  hypothetical protein PHAVU_001G081000g             399   6e-129   
dbj|BAK00121.1|  predicted protein                                      398   1e-128   
ref|NP_001053586.1|  Os04g0567200                                       397   6e-128   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004953423.1|  PREDICTED: aluminum-activated malate transpo...    396   8e-128   
ref|XP_008646046.1|  PREDICTED: aluminum-activated malate transpo...    395   1e-127   
ref|XP_004495500.1|  PREDICTED: aluminum-activated malate transpo...    395   2e-127   
gb|EAY95197.1|  hypothetical protein OsI_17017                          396   2e-127   Oryza sativa Indica Group [Indian rice]
emb|CAN74601.1|  hypothetical protein VITISV_028111                     405   5e-127   Vitis vinifera
emb|CDY51721.1|  BnaA09g52080D                                          393   7e-127   
ref|XP_008663483.1|  PREDICTED: aluminum-activated malate transpo...    394   8e-127   
ref|XP_008646045.1|  PREDICTED: aluminum-activated malate transpo...    394   9e-127   
gb|EEE57558.1|  hypothetical protein OsJ_07901                          392   1e-126   Oryza sativa Japonica Group [Japonica rice]
gb|EMT25761.1|  hypothetical protein F775_14692                         392   2e-125   
ref|XP_004978184.1|  PREDICTED: aluminum-activated malate transpo...    388   3e-124   
gb|ABQ59607.1|  ALMT3                                                   381   4e-122   Aegilops tauschii
ref|XP_006854629.1|  hypothetical protein AMTR_s00030p00178130          380   8e-122   
ref|XP_002448354.1|  hypothetical protein SORBIDRAFT_06g025640          381   9e-122   Sorghum bicolor [broomcorn]
ref|XP_003580342.1|  PREDICTED: aluminum-activated malate transpo...    379   7e-121   
ref|XP_011042657.1|  PREDICTED: LOW QUALITY PROTEIN: aluminum-act...    377   2e-120   
ref|XP_008376196.1|  PREDICTED: aluminum-activated malate transpo...    377   5e-120   
ref|XP_010543061.1|  PREDICTED: aluminum-activated malate transpo...    367   2e-117   
ref|XP_009111397.1|  PREDICTED: LOW QUALITY PROTEIN: aluminum-act...    369   3e-117   
ref|XP_009415830.1|  PREDICTED: aluminum-activated malate transpo...    367   5e-117   
ref|XP_009415828.1|  PREDICTED: aluminum-activated malate transpo...    367   7e-117   
ref|XP_006857836.1|  hypothetical protein AMTR_s00069p00044130          363   6e-116   
gb|ACJ12884.1|  ALMT2                                                   357   7e-114   Hordeum vulgare subsp. vulgare [barley]
ref|XP_007027980.1|  Aluminum activated malate transporter family...    354   1e-111   
ref|XP_002320432.2|  hypothetical protein POPTR_0014s09670g             350   1e-110   Populus trichocarpa [western balsam poplar]
gb|KHG00783.1|  Aluminum-activated malate transporter 8 -like pro...    352   1e-110   
ref|XP_008241057.1|  PREDICTED: aluminum-activated malate transpo...    350   4e-110   
emb|CBI22787.3|  unnamed protein product                                348   9e-110   
ref|XP_002264700.2|  PREDICTED: aluminum-activated malate transpo...    348   4e-109   Vitis vinifera
ref|NP_001057543.1|  Os06g0331900                                       353   4e-109   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004980110.1|  PREDICTED: aluminum-activated malate transpo...    346   5e-109   
ref|XP_004964055.1|  PREDICTED: aluminum-activated malate transpo...    346   5e-109   
gb|EAZ00777.1|  hypothetical protein OsI_22802                          353   5e-109   Oryza sativa Indica Group [Indian rice]
ref|XP_010088638.1|  Aluminum-activated malate transporter 2            347   7e-109   
emb|CAN68984.1|  hypothetical protein VITISV_017207                     348   2e-108   Vitis vinifera
gb|KHG24514.1|  Aluminum-activated malate transporter 8 -like pro...    346   4e-108   
ref|XP_010107005.1|  Aluminum-activated malate transporter 8            346   4e-108   
ref|XP_010247129.1|  PREDICTED: aluminum-activated malate transpo...    346   4e-108   
ref|XP_010247137.1|  PREDICTED: aluminum-activated malate transpo...    346   4e-108   
ref|XP_007204444.1|  hypothetical protein PRUPE_ppa026645mg             345   4e-108   
ref|XP_002533902.1|  conserved hypothetical protein                     345   6e-108   Ricinus communis
ref|XP_008361572.1|  PREDICTED: aluminum-activated malate transpo...    344   7e-108   
ref|XP_009349949.1|  PREDICTED: aluminum-activated malate transpo...    344   1e-107   
ref|XP_004967034.1|  PREDICTED: aluminum-activated malate transpo...    348   3e-107   
ref|XP_003572808.1|  PREDICTED: aluminum-activated malate transpo...    343   4e-107   
ref|XP_010263008.1|  PREDICTED: aluminum-activated malate transpo...    343   5e-107   
gb|KCW49013.1|  hypothetical protein EUGRSUZ_K02622                     340   1e-106   
ref|XP_002298270.2|  hypothetical protein POPTR_0001s22490g             341   2e-106   Populus trichocarpa [western balsam poplar]
ref|XP_011042181.1|  PREDICTED: aluminum-activated malate transpo...    340   3e-106   
ref|XP_004293111.1|  PREDICTED: aluminum-activated malate transpo...    340   4e-106   
ref|XP_010039108.1|  PREDICTED: aluminum-activated malate transpo...    340   5e-106   
gb|KEH24242.1|  aluminum activated malate transporter family protein    340   5e-106   
ref|XP_002314250.2|  hypothetical protein POPTR_0009s02300g             340   1e-105   Populus trichocarpa [western balsam poplar]
gb|KDP36114.1|  hypothetical protein JCGZ_08758                         338   2e-105   
ref|XP_002309252.2|  hypothetical protein POPTR_0006s21960g             338   3e-105   Populus trichocarpa [western balsam poplar]
ref|XP_007162971.1|  hypothetical protein PHAVU_001G195700g             337   3e-105   
ref|XP_011046418.1|  PREDICTED: aluminum-activated malate transpo...    337   4e-105   
ref|XP_008360621.1|  PREDICTED: aluminum-activated malate transpo...    338   4e-105   
gb|KDO58242.1|  hypothetical protein CISIN_1g036990mg                   336   6e-105   
ref|XP_009374112.1|  PREDICTED: aluminum-activated malate transpo...    337   8e-105   
ref|XP_011021454.1|  PREDICTED: aluminum-activated malate transpo...    336   1e-104   
ref|XP_011003844.1|  PREDICTED: aluminum-activated malate transpo...    335   3e-104   
gb|KHG16053.1|  Aluminum-activated malate transporter 2                 333   5e-104   
ref|XP_006481850.1|  PREDICTED: aluminum-activated malate transpo...    334   5e-104   
ref|XP_004136712.1|  PREDICTED: aluminum-activated malate transpo...    334   6e-104   
ref|XP_002322786.2|  hypothetical protein POPTR_0016s07080g             334   8e-104   Populus trichocarpa [western balsam poplar]
gb|KDO41689.1|  hypothetical protein CISIN_1g040886mg                   333   9e-104   
ref|XP_006481848.1|  PREDICTED: aluminum-activated malate transpo...    332   2e-103   
ref|XP_006424112.1|  hypothetical protein CICLE_v10029898mg             331   2e-103   
ref|XP_002322785.1|  hypothetical protein POPTR_0016s07070g             332   3e-103   Populus trichocarpa [western balsam poplar]
ref|XP_008659565.1|  PREDICTED: aluminum-activated malate transpo...    338   3e-103   
ref|XP_006424110.1|  hypothetical protein CICLE_v10030132mg             332   4e-103   
ref|XP_009629476.1|  PREDICTED: aluminum-activated malate transpo...    332   4e-103   
ref|XP_004251395.2|  PREDICTED: aluminum-activated malate transpo...    331   5e-103   
ref|XP_002438441.1|  hypothetical protein SORBIDRAFT_10g019680          337   7e-103   Sorghum bicolor [broomcorn]
ref|XP_007015678.1|  Aluminum activated malate transporter family...    332   7e-103   
ref|XP_011042190.1|  PREDICTED: aluminum-activated malate transpo...    330   1e-102   
ref|XP_002279322.1|  PREDICTED: aluminum-activated malate transpo...    331   1e-102   Vitis vinifera
ref|XP_006339326.1|  PREDICTED: aluminum-activated malate transpo...    331   1e-102   
gb|KHN33155.1|  Aluminum-activated malate transporter 8                 330   2e-102   
ref|XP_004494917.1|  PREDICTED: aluminum-activated malate transpo...    330   2e-102   
ref|NP_001237989.1|  aluminum-activated malate transporter              330   2e-102   
ref|XP_008345100.1|  PREDICTED: aluminum-activated malate transpo...    330   2e-102   
ref|XP_004249775.1|  PREDICTED: aluminum-activated malate transpo...    330   2e-102   
ref|XP_011088959.1|  PREDICTED: aluminum-activated malate transpo...    329   4e-102   
gb|ACJ12886.1|  ALMT2                                                   326   4e-102   Hordeum vulgare [barley]
ref|XP_008462623.1|  PREDICTED: aluminum-activated malate transpo...    330   6e-102   
ref|XP_009804534.1|  PREDICTED: aluminum-activated malate transpo...    329   7e-102   
ref|XP_002314249.1|  hypothetical protein POPTR_0009s02310g             328   8e-102   Populus trichocarpa [western balsam poplar]
ref|XP_004305584.1|  PREDICTED: aluminum-activated malate transpo...    329   1e-101   
ref|XP_002298269.1|  hypothetical protein POPTR_0001s22470g             328   2e-101   Populus trichocarpa [western balsam poplar]
ref|XP_009628093.1|  PREDICTED: aluminum-activated malate transpo...    328   2e-101   
ref|XP_006648930.1|  PREDICTED: aluminum-activated malate transpo...    333   2e-101   
ref|XP_009760052.1|  PREDICTED: aluminum-activated malate transpo...    327   3e-101   
ref|XP_003553620.1|  PREDICTED: aluminum-activated malate transpo...    327   3e-101   
ref|XP_006481861.1|  PREDICTED: aluminum-activated malate transpo...    327   3e-101   
ref|XP_007015679.1|  Aluminum activated malate transporter family...    326   7e-101   
ref|XP_011042595.1|  PREDICTED: aluminum-activated malate transpo...    325   2e-100   
ref|XP_006430062.1|  hypothetical protein CICLE_v10013861mg             326   2e-100   
gb|KHN19922.1|  Aluminum-activated malate transporter 2                 325   2e-100   
ref|XP_010521628.1|  PREDICTED: aluminum-activated malate transpo...    325   2e-100   
ref|XP_011003849.1|  PREDICTED: aluminum-activated malate transpo...    324   3e-100   
ref|XP_004980109.1|  PREDICTED: aluminum-activated malate transpo...    322   8e-100   
ref|XP_004143397.1|  PREDICTED: aluminum-activated malate transpo...    324   9e-100   
ref|XP_011077806.1|  PREDICTED: aluminum-activated malate transpo...    324   9e-100   
ref|XP_006424111.1|  hypothetical protein CICLE_v10028411mg             323   9e-100   
emb|CDP21018.1|  unnamed protein product                                323   9e-100   
gb|EYU18115.1|  hypothetical protein MIMGU_mgv1a021852mg                322   2e-99    
ref|XP_006481849.1|  PREDICTED: aluminum-activated malate transpo...    321   2e-99    
ref|XP_008442919.1|  PREDICTED: aluminum-activated malate transpo...    322   3e-99    
emb|CDX95060.1|  BnaC05g06110D                                          323   3e-99    
gb|KHG22050.1|  Aluminum-activated malate transporter 2 -like pro...    321   4e-99    
ref|XP_006303723.1|  hypothetical protein CARUB_v10011859mg             323   4e-99    
ref|XP_004306386.1|  PREDICTED: aluminum-activated malate transpo...    321   5e-99    
ref|XP_009337710.1|  PREDICTED: aluminum-activated malate transpo...    322   5e-99    
emb|CDX93562.1|  BnaA06g04860D                                          322   6e-99    
gb|KFK43164.1|  hypothetical protein AALP_AA1G088100                    321   1e-98    
gb|AFK43844.1|  unknown                                                 320   1e-98    
ref|XP_003539851.1|  PREDICTED: aluminum-activated malate transpo...    320   2e-98    
ref|XP_010488872.1|  PREDICTED: aluminum-activated malate transpo...    321   2e-98    
ref|XP_006656938.1|  PREDICTED: aluminum-activated malate transpo...    323   2e-98    
ref|XP_010475643.1|  PREDICTED: aluminum-activated malate transpo...    320   3e-98    
ref|XP_009148099.1|  PREDICTED: aluminum-activated malate transpo...    320   4e-98    
gb|KDO70616.1|  hypothetical protein CISIN_1g037603mg                   319   5e-98    
ref|XP_010931063.1|  PREDICTED: aluminum-activated malate transpo...    318   6e-98    
ref|XP_010034243.1|  PREDICTED: aluminum-activated malate transpo...    318   1e-97    
ref|XP_008230202.1|  PREDICTED: aluminum-activated malate transpo...    318   1e-97    
gb|KCW50918.1|  hypothetical protein EUGRSUZ_J00567                     317   1e-97    
emb|CDX97489.1|  BnaC08g13540D                                          318   1e-97    
gb|EYU38689.1|  hypothetical protein MIMGU_mgv1a024010mg                317   2e-97    
ref|XP_006417690.1|  hypothetical protein EUTSA_v10009830mg             316   4e-97    
emb|CDY31146.1|  BnaA08g26960D                                          317   4e-97    
ref|XP_006407423.1|  hypothetical protein EUTSA_v10022400mg             317   4e-97    
ref|XP_010543839.1|  PREDICTED: aluminum-activated malate transpo...    317   4e-97    
ref|XP_007132493.1|  hypothetical protein PHAVU_011G098800g             316   5e-97    
ref|XP_007205300.1|  hypothetical protein PRUPE_ppa006760mg             313   1e-96    
ref|XP_009110894.1|  PREDICTED: aluminum-activated malate transpo...    316   1e-96    
ref|XP_002889694.1|  hypothetical protein ARALYDRAFT_334132             316   1e-96    
ref|XP_002298271.2|  hypothetical protein POPTR_0001s22510g             314   1e-96    Populus trichocarpa [western balsam poplar]
ref|XP_008799710.1|  PREDICTED: aluminum-activated malate transpo...    314   1e-96    
ref|NP_172320.1|  aluminum-activated malate transporter 2               315   2e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011003846.1|  PREDICTED: aluminum-activated malate transpo...    311   2e-96    
gb|KCW44681.1|  hypothetical protein EUGRSUZ_L01785                     312   3e-96    
ref|XP_010034240.1|  PREDICTED: aluminum-activated malate transpo...    313   3e-96    
ref|XP_010034242.1|  PREDICTED: aluminum-activated malate transpo...    312   6e-96    
ref|XP_010041054.1|  PREDICTED: aluminum-activated malate transpo...    312   6e-96    
emb|CDY08504.1|  BnaA05g27400D                                          313   7e-96    
ref|XP_007015680.1|  Aluminum activated malate transporter family...    311   2e-95    
ref|XP_008338598.1|  PREDICTED: aluminum-activated malate transpo...    311   3e-95    
gb|EEE65634.1|  hypothetical protein OsJ_21203                          316   3e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010458081.1|  PREDICTED: aluminum-activated malate transpo...    312   4e-95    
gb|EYU20649.1|  hypothetical protein MIMGU_mgv1a026850mg                309   5e-95    
emb|CDY01048.1|  BnaC05g41520D                                          311   6e-95    
ref|XP_007206655.1|  hypothetical protein PRUPE_ppa022263mg             310   6e-95    
ref|XP_008361562.1|  PREDICTED: aluminum-activated malate transpo...    310   8e-95    
ref|XP_010544467.1|  PREDICTED: aluminum-activated malate transpo...    305   1e-94    
ref|XP_008230212.1|  PREDICTED: aluminum-activated malate transpo...    310   2e-94    
ref|XP_007015684.1|  Aluminum activated malate transporter family...    308   3e-94    
ref|XP_009146692.1|  PREDICTED: aluminum-activated malate transpo...    309   3e-94    
ref|XP_006369382.1|  hypothetical protein POPTR_0001s22500g             305   9e-94    
ref|XP_006362899.1|  PREDICTED: aluminum-activated malate transpo...    307   9e-94    
gb|KEH29773.1|  aluminum activated malate transporter family protein    307   1e-93    
ref|XP_010912068.1|  PREDICTED: aluminum-activated malate transpo...    306   2e-93    
ref|XP_011094533.1|  PREDICTED: aluminum-activated malate transpo...    306   5e-93    
ref|XP_010685434.1|  PREDICTED: aluminum-activated malate transpo...    305   6e-93    
ref|XP_004168769.1|  PREDICTED: aluminum-activated malate transpo...    300   8e-93    
ref|XP_004506221.1|  PREDICTED: aluminum-activated malate transpo...    305   8e-93    
ref|XP_009415652.1|  PREDICTED: aluminum-activated malate transpo...    303   1e-92    
ref|XP_010486836.1|  PREDICTED: aluminum-activated malate transpo...    305   1e-92    
ref|XP_004975597.1|  PREDICTED: aluminum-activated malate transpo...    304   1e-92    
ref|XP_003579717.1|  PREDICTED: aluminum-activated malate transpo...    303   2e-92    
ref|XP_009371491.1|  PREDICTED: aluminum-activated malate transpo...    304   2e-92    
ref|XP_009121240.1|  PREDICTED: aluminum-activated malate transpo...    305   2e-92    
gb|ADD71138.1|  putative aluminum-activated malate transporter          303   3e-92    Medicago sativa [alfalfa]
ref|XP_004139139.1|  PREDICTED: aluminum-activated malate transpo...    302   4e-92    
ref|XP_006299615.1|  hypothetical protein CARUB_v10015793mg             303   5e-92    
ref|XP_008344380.1|  PREDICTED: aluminum-activated malate transpo...    303   5e-92    
ref|XP_010676260.1|  PREDICTED: aluminum-activated malate transpo...    304   5e-92    
gb|EYU36033.1|  hypothetical protein MIMGU_mgv1a026290mg                301   6e-92    
gb|KEH38993.1|  aluminum activated malate transporter family protein    301   9e-92    
emb|CDP06850.1|  unnamed protein product                                302   1e-91    
gb|KCW50917.1|  hypothetical protein EUGRSUZ_J00566                     300   1e-91    
ref|XP_008785891.1|  PREDICTED: aluminum-activated malate transpo...    301   1e-91    
ref|XP_008450296.1|  PREDICTED: aluminum-activated malate transpo...    301   2e-91    
ref|XP_010034239.1|  PREDICTED: aluminum-activated malate transpo...    300   2e-91    
ref|XP_007206564.1|  hypothetical protein PRUPE_ppa020038mg             301   2e-91    
ref|XP_010497969.1|  PREDICTED: aluminum-activated malate transpo...    301   3e-91    
gb|EPS69609.1|  hypothetical protein M569_05152                         299   3e-91    
gb|KHG16054.1|  Aluminum-activated malate transporter 7                 301   3e-91    
ref|XP_004251423.1|  PREDICTED: aluminum-activated malate transpo...    299   4e-91    
ref|XP_009373893.1|  PREDICTED: aluminum-activated malate transpo...    300   4e-91    
ref|XP_011090304.1|  PREDICTED: aluminum-activated malate transpo...    300   5e-91    
gb|AAF22891.1|AC006932_8  T27G7.12                                      301   6e-91    
gb|KCW50914.1|  hypothetical protein EUGRSUZ_J00562                     299   8e-91    
ref|XP_011089212.1|  PREDICTED: aluminum-activated malate transpo...    300   9e-91    
emb|CAH67598.1|  OSIGBa0092M08.10                                       299   1e-90    
ref|NP_001052768.1|  Os04g0417000                                       299   1e-90    
ref|XP_009618216.1|  PREDICTED: aluminum-activated malate transpo...    298   1e-90    
gb|KDP46600.1|  hypothetical protein JCGZ_04534                         299   1e-90    
ref|XP_010488865.1|  PREDICTED: aluminum-activated malate transpo...    301   2e-90    
ref|XP_010464902.1|  PREDICTED: aluminum-activated malate transpo...    299   2e-90    
ref|XP_009407598.1|  PREDICTED: aluminum-activated malate transpo...    298   2e-90    
ref|XP_008351124.1|  PREDICTED: aluminum-activated malate transpo...    294   3e-90    
ref|XP_010534663.1|  PREDICTED: aluminum-activated malate transpo...    298   4e-90    
ref|NP_001105992.1|  aluminum-induced transporter                       297   5e-90    
gb|KHN21190.1|  Aluminum-activated malate transporter 2                 297   9e-90    
gb|ACG38733.1|  ALMT1                                                   296   9e-90    
emb|CDY52054.1|  BnaC03g74300D                                          295   2e-89    
ref|XP_002274847.2|  PREDICTED: aluminum-activated malate transpo...    297   2e-89    
gb|ACF82892.1|  unknown                                                 295   2e-89    
ref|XP_004487722.1|  PREDICTED: aluminum-activated malate transpo...    296   2e-89    
ref|XP_002884858.1|  hypothetical protein ARALYDRAFT_317949             296   2e-89    
ref|XP_002879077.1|  hypothetical protein ARALYDRAFT_344480             296   3e-89    
ref|NP_187774.1|  Aluminum activated malate transporter family pr...    296   3e-89    
emb|CAN72306.1|  hypothetical protein VITISV_044063                     296   3e-89    
ref|XP_008450297.1|  PREDICTED: aluminum-activated malate transpo...    295   3e-89    
ref|XP_002513712.1|  conserved hypothetical protein                     292   5e-89    
gb|ABQ59606.1|  ALMT2                                                   293   1e-88    
tpg|DAA37874.1|  TPA: hypothetical protein ZEAMMB73_603670              294   1e-88    
ref|XP_006652274.1|  PREDICTED: aluminum-activated malate transpo...    293   2e-88    
ref|XP_004985923.1|  PREDICTED: aluminum-activated malate transpo...    293   3e-88    
ref|XP_006340425.1|  PREDICTED: aluminum-activated malate transpo...    291   3e-88    
ref|XP_003632294.2|  PREDICTED: aluminum-activated malate transpo...    292   3e-88    
emb|CAN81826.1|  hypothetical protein VITISV_020247                     294   3e-88    
gb|ABQ59605.1|  ALMT1                                                   292   4e-88    
gb|ACJ15441.1|  ALMT1                                                   292   4e-88    
ref|XP_009140863.1|  PREDICTED: aluminum-activated malate transpo...    294   4e-88    
ref|XP_002889693.1|  Al-activated malate transporter 1                  293   5e-88    
ref|NP_001289915.1|  aluminum-activated malate transporter 1-like       293   6e-88    
gb|ACB05980.1|  aluminum-activated malate transporter                   291   6e-88    
ref|XP_010088641.1|  Aluminum-activated malate transporter 2            292   7e-88    
ref|XP_010510791.1|  PREDICTED: aluminum-activated malate transpo...    292   8e-88    
ref|XP_002262763.1|  PREDICTED: aluminum-activated malate transpo...    293   8e-88    
gb|ABD32785.1|  Protein of unknown function UPF0005; Rho GTPase a...    291   1e-87    
ref|NP_001132468.1|  hypothetical protein                               291   1e-87    
ref|XP_004242115.1|  PREDICTED: aluminum-activated malate transpo...    291   2e-87    
emb|CDX97483.1|  BnaC08g13480D                                          291   2e-87    
ref|NP_180292.1|  aluminium activated malate transporter family p...    292   2e-87    
dbj|BAE97280.1|  putative aluminum activated malate transporter         291   3e-87    
ref|XP_003539484.1|  PREDICTED: aluminum-activated malate transpo...    290   3e-87    
ref|XP_008661453.1|  PREDICTED: hypothetical protein isoform X1         289   4e-87    
gb|ABF22743.1|  aluminum activated malate transporter                   291   4e-87    
ref|NP_172319.1|  aluminum-activated malate transporter 1               290   4e-87    
gb|ABF22745.1|  aluminum activated malate transporter                   290   5e-87    
ref|XP_002447812.1|  hypothetical protein SORBIDRAFT_06g016260          289   6e-87    
emb|CDY30563.1|  BnaA04g15700D                                          291   6e-87    
ref|XP_008356935.1|  PREDICTED: aluminum-activated malate transpo...    290   7e-87    
ref|XP_010458079.1|  PREDICTED: aluminum-activated malate transpo...    290   8e-87    
gb|ABF22746.1|  aluminum activated malate transporter                   290   9e-87    
dbj|BAE97281.1|  putative aluminum activated malate transporter         290   9e-87    
gb|AGZ03663.1|  malate transporter                                      290   1e-86    
gb|ABF22742.1|  aluminum activated malate transporter                   289   1e-86    
emb|CDX77103.1|  BnaC04g38980D                                          289   2e-86    
gb|EMT24110.1|  hypothetical protein F775_11946                         288   3e-86    
ref|XP_009110895.1|  PREDICTED: aluminum-activated malate transpo...    288   5e-86    
gb|KFK38536.1|  hypothetical protein AALP_AA3G126700                    286   7e-86    
ref|XP_006295809.1|  hypothetical protein CARUB_v10024935mg             287   8e-86    
ref|XP_008344384.1|  PREDICTED: aluminum-activated malate transpo...    286   9e-86    
gb|EMT20765.1|  hypothetical protein F775_06446                         286   1e-85    
ref|XP_010475642.1|  PREDICTED: aluminum-activated malate transpo...    287   1e-85    
gb|EPS68168.1|  hypothetical protein M569_06608                         284   1e-85    
gb|ABF22744.1|  aluminum activated malate transporter                   286   2e-85    
ref|XP_006481847.1|  PREDICTED: aluminum-activated malate transpo...    285   2e-85    
ref|XP_004139138.1|  PREDICTED: aluminum-activated malate transpo...    285   3e-85    
ref|XP_006424113.1|  hypothetical protein CICLE_v10030101mg             285   4e-85    
ref|XP_010417878.1|  PREDICTED: aluminum-activated malate transpo...    285   5e-85    
ref|XP_010651907.1|  PREDICTED: aluminum-activated malate transpo...    286   5e-85    
ref|XP_004974302.1|  PREDICTED: aluminum-activated malate transpo...    283   9e-85    
gb|KDO58243.1|  hypothetical protein CISIN_1g046681mg                   283   9e-85    
ref|XP_010473117.1|  PREDICTED: aluminum-activated malate transpo...    284   1e-84    
ref|XP_004293112.1|  PREDICTED: aluminum-activated malate transpo...    283   2e-84    
gb|EYU18118.1|  hypothetical protein MIMGU_mgv1a0184771mg               277   2e-84    
ref|XP_006306342.1|  hypothetical protein CARUB_v10012224mg             282   6e-84    
ref|XP_002527763.1|  conserved hypothetical protein                     281   9e-84    
ref|XP_010275270.1|  PREDICTED: aluminum-activated malate transpo...    282   2e-83    
ref|XP_008338596.1|  PREDICTED: aluminum-activated malate transpo...    281   2e-83    
ref|XP_010671955.1|  PREDICTED: aluminum-activated malate transpo...    280   3e-83    
gb|EMS50055.1|  Aluminum-activated malate transporter 1                 279   5e-83    
ref|XP_004293113.1|  PREDICTED: aluminum-activated malate transpo...    278   9e-83    
ref|XP_009757681.1|  PREDICTED: aluminum-activated malate transpo...    280   2e-82    
ref|XP_008450295.1|  PREDICTED: aluminum-activated malate transpo...    277   2e-82    
gb|EYU36032.1|  hypothetical protein MIMGU_mgv1a006531mg                276   3e-82    
gb|EYU28512.1|  hypothetical protein MIMGU_mgv1a025757mg                275   1e-81    
gb|AHA98247.1|  ALMT1                                                   274   5e-81    
gb|AAZ22849.1|  ALMT1                                                   274   5e-81    
ref|XP_009795593.1|  PREDICTED: aluminum-activated malate transpo...    277   1e-80    
sp|Q76LB1.1|ALMT1_WHEAT  RecName: Full=Aluminum-activated malate ...    272   2e-80    
ref|XP_004139140.1|  PREDICTED: aluminum-activated malate transpo...    272   2e-80    
gb|AHA98246.1|  ALMT1                                                   271   5e-80    
dbj|BAD10882.1|  aluminum-activated malate transporter                  271   7e-80    
ref|XP_004977693.1|  PREDICTED: aluminum-activated malate transpo...    271   7e-80    
ref|XP_004985922.1|  PREDICTED: uncharacterized protein LOC101778942    284   7e-80    
ref|XP_008230256.1|  PREDICTED: aluminum-activated malate transpo...    270   8e-80    
gb|ABY52952.1|  ALMT1-M39.1                                             270   8e-80    
ref|XP_011090483.1|  PREDICTED: aluminum-activated malate transpo...    270   9e-80    
gb|EYU36026.1|  hypothetical protein MIMGU_mgv1a006083mg                270   1e-79    
ref|XP_010088643.1|  Aluminum-activated malate transporter 2            271   1e-79    
ref|XP_009589542.1|  PREDICTED: aluminum-activated malate transpo...    272   1e-79    
gb|ABY52957.1|  ALMT1-1135.1                                            269   2e-79    
ref|XP_010088642.1|  Aluminum-activated malate transporter 2            270   3e-79    
gb|ABY52953.1|  ALMT1-M39.2                                             269   3e-79    
ref|XP_010275268.1|  PREDICTED: aluminum-activated malate transpo...    271   4e-79    
ref|XP_004306385.1|  PREDICTED: aluminum-activated malate transpo...    268   7e-79    
ref|XP_006362517.1|  PREDICTED: aluminum-activated malate transpo...    270   7e-79    
gb|ABA62397.1|  aluminum-activated malate transporter                   268   9e-79    
gb|EYU32631.1|  hypothetical protein MIMGU_mgv1a021804mg                268   9e-79    
ref|XP_006653685.1|  PREDICTED: aluminum-activated malate transpo...    266   2e-78    
ref|XP_009626193.1|  PREDICTED: aluminum-activated malate transpo...    270   3e-78    
gb|EEC67484.1|  hypothetical protein OsI_34737                          268   3e-78    
ref|NP_001065461.1|  Os10g0572100                                       268   3e-78    
ref|XP_003555194.1|  PREDICTED: aluminum-activated malate transpo...    268   3e-78    
ref|XP_006662090.1|  PREDICTED: aluminum-activated malate transpo...    268   4e-78    
gb|KHN23120.1|  Aluminum-activated malate transporter 12                268   5e-78    
ref|XP_010686141.1|  PREDICTED: aluminum-activated malate transpo...    266   7e-78    
gb|ABY52955.1|  ALMT1-M77.1                                             265   8e-78    
dbj|BAN78902.1|  aluminum-activated malate transporter 1                264   2e-77    
ref|XP_004228908.2|  PREDICTED: aluminum-activated malate transpo...    269   2e-77    
gb|ABA62398.1|  aluminum-activated malate transporter                   263   3e-77    
ref|XP_002447813.1|  hypothetical protein SORBIDRAFT_06g016270          261   7e-77    
emb|CAN82473.1|  hypothetical protein VITISV_030202                     261   1e-76    
gb|EAY94072.1|  hypothetical protein OsI_15848                          258   2e-76    
ref|XP_004244701.1|  PREDICTED: aluminum-activated malate transpo...    264   2e-76    
ref|XP_007039541.1|  Aluminum-activated malate transporter 12           263   3e-76    
emb|CDY01507.1|  BnaC07g34970D                                          263   4e-76    
ref|XP_002437417.1|  hypothetical protein SORBIDRAFT_10g026610          263   4e-76    
ref|XP_002513714.1|  conserved hypothetical protein                     260   4e-76    
ref|XP_009589543.1|  PREDICTED: aluminum-activated malate transpo...    262   9e-76    
emb|CDX90432.1|  BnaA03g43490D                                          261   1e-75    
ref|XP_004965619.1|  PREDICTED: aluminum-activated malate transpo...    261   2e-75    
gb|EYU28517.1|  hypothetical protein MIMGU_mgv1a008383mg                256   2e-75    
ref|XP_006436746.1|  hypothetical protein CICLE_v10031169mg             260   4e-75    
ref|XP_010559291.1|  PREDICTED: aluminum-activated malate transpo...    260   6e-75    
ref|XP_006850728.1|  hypothetical protein AMTR_s00025p00044700          257   6e-75    
ref|XP_008373555.1|  PREDICTED: aluminum-activated malate transpo...    259   7e-75    
ref|XP_009802600.1|  PREDICTED: aluminum-activated malate transpo...    259   1e-74    
ref|XP_009592604.1|  PREDICTED: aluminum-activated malate transpo...    259   1e-74    
ref|XP_010269981.1|  PREDICTED: aluminum-activated malate transpo...    259   1e-74    
ref|XP_010242373.1|  PREDICTED: aluminum-activated malate transpo...    255   2e-74    
gb|EMT22362.1|  hypothetical protein F775_13063                         254   3e-74    
gb|KHN17976.1|  Aluminum-activated malate transporter 2                 254   3e-74    
ref|XP_003574370.1|  PREDICTED: aluminum-activated malate transpo...    258   4e-74    
ref|XP_011084087.1|  PREDICTED: aluminum-activated malate transpo...    257   4e-74    
ref|XP_003539483.2|  PREDICTED: aluminum-activated malate transpo...    254   5e-74    
ref|XP_004154705.1|  PREDICTED: LOW QUALITY PROTEIN: aluminum-act...    254   5e-74    
gb|KEH44433.1|  aluminum activated malate transporter family protein    256   1e-73    
ref|XP_006414167.1|  hypothetical protein EUTSA_v10024816mg             256   2e-73    
gb|KCW71810.1|  hypothetical protein EUGRSUZ_E00295                     255   3e-73    
ref|XP_010685437.1|  PREDICTED: aluminum-activated malate transpo...    253   3e-73    
ref|XP_008648986.1|  PREDICTED: aluminum-activated malate transpo...    254   4e-73    
ref|XP_010055342.1|  PREDICTED: aluminum-activated malate transpo...    255   6e-73    
ref|XP_007209894.1|  hypothetical protein PRUPE_ppa004066mg             254   6e-73    
ref|XP_010104343.1|  Aluminum-activated malate transporter 12           254   6e-73    
ref|XP_007142743.1|  hypothetical protein PHAVU_007G013300g             254   7e-73    
ref|XP_008648985.1|  PREDICTED: aluminum-activated malate transpo...    254   8e-73    
gb|KHN37353.1|  Aluminum-activated malate transporter 12                253   2e-72    
ref|XP_009377066.1|  PREDICTED: aluminum-activated malate transpo...    253   2e-72    
ref|XP_009378981.1|  PREDICTED: aluminum-activated malate transpo...    253   2e-72    
gb|AAU44573.1|  hypothetical protein AT5G46600                          247   2e-72    
ref|XP_008238285.1|  PREDICTED: aluminum-activated malate transpo...    253   2e-72    
ref|XP_003535769.1|  PREDICTED: aluminum-activated malate transpo...    252   2e-72    
ref|XP_010441566.1|  PREDICTED: aluminum-activated malate transpo...    253   3e-72    
gb|ABD32783.1|  Protein of unknown function UPF0005                     250   3e-72    
gb|KFK28482.1|  hypothetical protein AALP_AA7G001700                    253   3e-72    
ref|XP_009136887.1|  PREDICTED: aluminum-activated malate transpo...    252   4e-72    
ref|XP_008341114.1|  PREDICTED: aluminum-activated malate transpo...    251   6e-72    
ref|XP_004139137.1|  PREDICTED: aluminum-activated malate transpo...    249   7e-72    
ref|XP_011078450.1|  PREDICTED: aluminum-activated malate transpo...    251   8e-72    
ref|NP_199472.1|  aluminum activated malate transporter family pr...    251   9e-72    
ref|XP_010481435.1|  PREDICTED: aluminum-activated malate transpo...    251   9e-72    
ref|XP_002870075.1|  hypothetical protein ARALYDRAFT_493074             251   1e-71    
ref|XP_004497252.1|  PREDICTED: aluminum-activated malate transpo...    251   1e-71    
ref|XP_003555195.1|  PREDICTED: aluminum-activated malate transpo...    250   2e-71    
ref|NP_193531.1|  aluminum-activated, malate transporter 12             251   2e-71    
gb|KHG19618.1|  Aluminum-activated malate transporter 12 -like pr...    250   3e-71    
ref|XP_002278594.2|  PREDICTED: aluminum-activated malate transpo...    250   3e-71    
gb|AAU44574.1|  hypothetical protein AT5G46600                          249   5e-71    
ref|XP_010434594.1|  PREDICTED: aluminum-activated malate transpo...    249   6e-71    
ref|XP_010439919.1|  PREDICTED: aluminum-activated malate transpo...    249   9e-71    
ref|XP_010449535.1|  PREDICTED: aluminum-activated malate transpo...    249   9e-71    
ref|XP_010441565.1|  PREDICTED: aluminum-activated malate transpo...    249   1e-70    
ref|XP_007150026.1|  hypothetical protein PHAVU_005G119700g             245   2e-70    
ref|XP_006283440.1|  hypothetical protein CARUB_v10004488mg             248   2e-70    
gb|KEH44440.1|  aluminum activated malate transporter                   247   3e-70    
ref|XP_006847704.1|  hypothetical protein AMTR_s00149p00069680          249   4e-70    
ref|XP_006280267.1|  hypothetical protein CARUB_v10026188mg             247   4e-70    
ref|XP_004487723.1|  PREDICTED: aluminum-activated malate transpo...    240   4e-70    
emb|CDP12994.1|  unnamed protein product                                251   4e-70    
gb|EPS66034.1|  hypothetical protein M569_08747                         240   4e-70    
gb|EYU28937.1|  hypothetical protein MIMGU_mgv1a019562mg                245   5e-70    
ref|XP_010494840.1|  PREDICTED: aluminum-activated malate transpo...    246   8e-70    
gb|EMS57711.1|  Aluminum-activated malate transporter 12                246   9e-70    
ref|XP_006605837.1|  PREDICTED: aluminum-activated malate transpo...    244   1e-69    
gb|KGN59213.1|  hypothetical protein Csa_3G782120                       237   2e-69    
gb|KFK31455.1|  hypothetical protein AALP_AA6G114000                    245   2e-69    
ref|XP_003555193.1|  PREDICTED: aluminum-activated malate transpo...    244   2e-69    
emb|CBI33905.3|  unnamed protein product                                249   3e-69    
ref|XP_010104344.1|  Aluminum-activated malate transporter 12           244   3e-69    
ref|XP_004148510.1|  PREDICTED: aluminum-activated malate transpo...    243   4e-69    
ref|NP_199473.1|  aluminum activated malate transporter family pr...    244   5e-69    
ref|XP_004171748.1|  PREDICTED: LOW QUALITY PROTEIN: aluminum-act...    243   5e-69    
ref|XP_008466647.1|  PREDICTED: aluminum-activated malate transpo...    243   6e-69    
ref|XP_002863395.1|  hypothetical protein ARALYDRAFT_494317             244   6e-69    
ref|XP_010481434.1|  PREDICTED: aluminum-activated malate transpo...    244   7e-69    
ref|XP_003535771.2|  PREDICTED: aluminum-activated malate transpo...    249   1e-68    
gb|AGI15324.1|  mQUAC1                                                  242   2e-68    
gb|AAU44576.1|  hypothetical protein AT5G46610                          242   3e-68    
ref|XP_006339734.1|  PREDICTED: aluminum-activated malate transpo...    229   3e-68    
gb|KHN37352.1|  Aluminum-activated malate transporter 12                238   7e-68    
ref|XP_004301694.1|  PREDICTED: aluminum-activated malate transpo...    241   8e-68    
ref|XP_011003845.1|  PREDICTED: aluminum-activated malate transpo...    237   1e-67    
ref|XP_006408684.1|  hypothetical protein EUTSA_v10001980mg             237   4e-67    



>ref|XP_009600330.1| PREDICTED: aluminum-activated malate transporter 10 [Nicotiana 
tomentosiformis]
Length=498

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/493 (61%), Positives = 380/493 (77%), Gaps = 22/493 (4%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLA  1590
             RVNMP G+S++LV ESR+  ++  +V GFV  I  F+DKAW L   EP+KVIH +KVGLA
Sbjct  15    RVNMPSGSSQILVPESRQTCRLLSLVMGFVSNITKFLDKAWNLAVNEPKKVIHCLKVGLA  74

Query  1589  LSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGV  1410
             LS+VSLFYY+RPLYD VGGNAMWAVMTVVVVFEYTVG+TL KCVNR + T LAGSLGIGV
Sbjct  75    LSIVSLFYYMRPLYDGVGGNAMWAVMTVVVVFEYTVGSTLYKCVNRAIGTCLAGSLGIGV  134

Query  1409  HWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYR  1230
             HWVA+QSG + +PIILQASVFLLAAAATFSRFIP+IKARFDYG  IFILTFSLVSVSGYR
Sbjct  135   HWVASQSGDRFEPIILQASVFLLAAAATFSRFIPTIKARFDYGAMIFILTFSLVSVSGYR  194

Query  1229  VDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDY  1050
             VDKL++LA +R+STIA+G +IC+FI M+LCPVWAG +LH LI+ NL+KLADSLEG  ++ 
Sbjct  195   VDKLVELAHERVSTIAIGATICLFITMILCPVWAGTELHHLISTNLQKLADSLEGYAAEK  254

Query  1049  LnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYL  870
                         ++K S K+L GY+CVLN+KA+E++MANFA WEP HG+FNFRHPWKQYL
Sbjct  255   F---RVDGSKNLDEKDSSKRLQGYRCVLNSKAAEESMANFARWEPAHGKFNFRHPWKQYL  311

Query  869   KIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmks  690
             KIGASMR+CAYCIETLHG INS+ +  + E++ KP+++ C R+ ++   VL++LS ++K+
Sbjct  312   KIGASMRSCAYCIETLHGGINSNTE--TPEFLKKPLNDVCMRLGTSSSNVLKELSSMIKT  369

Query  689   ttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTT---QVEEAQKPSSDHLKQETKS  519
              T S+  DILV +MNS+VE LQ A KTL  PS Q + T   + EEA   + + + + T  
Sbjct  370   LTNSTKLDILVDEMNSSVEGLQNALKTL--PSYQHIPTPDPKTEEAPTGTEESILKPT--  425

Query  518   ALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQ  339
             ALS         LMEI Q++T+ SLL+EIA+R EG+VKEVN+LA+ AQF+  S KK +KQ
Sbjct  426   ALS---------LMEIVQMATLTSLLIEIASRIEGIVKEVNELASQAQFKDDSSKK-SKQ  475

Query  338   SQSQHKEQNVQTH  300
             +Q++  E +   H
Sbjct  476   TQTKLNENDGNEH  488



>ref|XP_009778854.1| PREDICTED: aluminum-activated malate transporter 10 [Nicotiana 
sylvestris]
Length=498

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/495 (60%), Positives = 378/495 (76%), Gaps = 26/495 (5%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLA  1590
             RVNMP G+S++LV ESR+  ++  ++ G V  I  F DKAW L   EP+KVIH +KVGLA
Sbjct  15    RVNMPSGSSQILVPESRQTCRLLSLIMGLVSNIRKFFDKAWNLAVNEPKKVIHCLKVGLA  74

Query  1589  LSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGV  1410
             LS+VSLFYY+RPLYD VGGNAMWAVMTVVVVFEYTVG+TL KCVNR + T LAGSLGIGV
Sbjct  75    LSIVSLFYYMRPLYDGVGGNAMWAVMTVVVVFEYTVGSTLYKCVNRAIGTCLAGSLGIGV  134

Query  1409  HWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYR  1230
             HWVA+QSG + +P+ILQASVFLLAAAATFSRFIP+IKARFDYG  IFILTFSLVSVSGYR
Sbjct  135   HWVASQSGDRFEPVILQASVFLLAAAATFSRFIPTIKARFDYGAMIFILTFSLVSVSGYR  194

Query  1229  VDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDY  1050
             VDKL++LA +R+STIA+G +IC+FI M+LCPVWAG +LH LI+ NLEKLADSLEG  ++ 
Sbjct  195   VDKLVELAHERVSTIAIGATICLFITMILCPVWAGTELHHLISTNLEKLADSLEGYAAEN  254

Query  1049  LnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYL  870
                         ++K S K+L GYKCVLN+KA+E+AMANFA WEP HG+FNFRHPWKQYL
Sbjct  255   F---RVDGSKNLDEKDSSKRLQGYKCVLNSKAAEEAMANFARWEPAHGKFNFRHPWKQYL  311

Query  869   KIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmks  690
             KIGASMR+CAYCIETL+G INS+ +  + E++ KP+++ C R+ ++  KVL++LS ++K+
Sbjct  312   KIGASMRSCAYCIETLYGGINSNTE--TPEFLKKPLNDVCMRLGTSSSKVLKELSSMLKT  369

Query  689   ttksSIQDILVHDMNSAVEALQLAFKTL-----IPPSSQSLTTQVEEAQKPSSDHLKQET  525
              T S+  DILV +MNS+VE LQ A KTL     IPP       + EEA   + + + + T
Sbjct  370   MTNSTKLDILVDEMNSSVEGLQNALKTLSSYQHIPPPDP----KTEEAPNGTEESILKPT  425

Query  524   KSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMA  345
               ALS         LMEI Q++T+ SLL+EIA+R EG+VKEVN+LA+ A+FR +S KK +
Sbjct  426   --ALS---------LMEIVQMATLTSLLIEIASRIEGIVKEVNELASQAKFRDESSKK-S  473

Query  344   KQSQSQHKEQNVQTH  300
             KQ+Q++  E +   H
Sbjct  474   KQTQTKLNENDGNEH  488



>ref|XP_004229999.1| PREDICTED: aluminum-activated malate transporter 10 [Solanum 
lycopersicum]
Length=498

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/494 (61%), Positives = 375/494 (76%), Gaps = 23/494 (5%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRR-GKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGL  1593
             RVNMP+G+SR+L  ESR    ++  +V G VL I +F+DKAW L   EP+KV+H +KVGL
Sbjct  14    RVNMPNGSSRILAPESRETCSRLQSLVMGIVLNIKAFLDKAWNLAVNEPKKVVHCLKVGL  73

Query  1592  ALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIG  1413
             ALSLVS+FYY+RPLYD VGGNAMWAVMTVVVVFEYTVG+TL KCVNR + T LAGSLGIG
Sbjct  74    ALSLVSVFYYMRPLYDGVGGNAMWAVMTVVVVFEYTVGSTLYKCVNRAIGTCLAGSLGIG  133

Query  1412  VHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGY  1233
             VHWVA+Q+G K +P+ILQ SVFLLAAAATFSRFIP+IKARFDYG  IFILTFSLVSVSGY
Sbjct  134   VHWVASQAGDKFEPVILQVSVFLLAAAATFSRFIPTIKARFDYGAMIFILTFSLVSVSGY  193

Query  1232  RVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISD  1053
             RVDKL++LA +R+STIA+G SICIFI M+LCPVWAG +LH LI+NNLEKLADSL G  ++
Sbjct  194   RVDKLVELAHERVSTIAIGASICIFITMILCPVWAGTELHHLISNNLEKLADSLAGYAAE  253

Query  1052  YLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQY  873
                          ++K S KKL GYKCVLN+KA+E++MANFA WEP HG+FNFRHPWKQY
Sbjct  254   NF---SVDGSKNVHEKDSSKKLQGYKCVLNSKAAEESMANFARWEPAHGKFNFRHPWKQY  310

Query  872   LKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmk  693
             LKIGASMR+CAYCIETLHGSINS+ +  + E++ KP+++ C R+ +T  KVL+++S ++K
Sbjct  311   LKIGASMRSCAYCIETLHGSINSNTE--TPEFLKKPLNDVCMRLGTTSSKVLKEMSSMIK  368

Query  692   sttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQ---VEEAQKPSSDHLKQETK  522
             +  KS+  DILV +MNS+VE LQ A K  I PS Q + T     EEA  P+         
Sbjct  369   TMKKSTKLDILVDEMNSSVEGLQNALK--IFPSYQHIPTPDPGTEEA--PNGTEEPSLKS  424

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAK  342
             +ALS         LMEI Q++T+ SLLVEIA+R EG+V+EV +LA+ A+FR +S  K +K
Sbjct  425   TALS---------LMEIVQMATLTSLLVEIASRIEGIVEEVKELASQAEFRDESSMK-SK  474

Query  341   QSQSQHKEQNVQTH  300
             Q+Q++    +   H
Sbjct  475   QTQTKINGNDGNEH  488



>ref|XP_002264499.1| PREDICTED: aluminum-activated malate transporter 10 [Vitis vinifera]
 emb|CBI40582.3| unnamed protein product [Vitis vinifera]
Length=494

 Score =   491 bits (1264),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 273/484 (56%), Positives = 351/484 (73%), Gaps = 27/484 (6%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             +V++P G S  LV ES    +++     +V GF+L+IW F++KAW +G  EPRK++H +K
Sbjct  14    KVDIPGGKSETLVPESGFVCRIWRGLRGLVEGFLLKIWRFLEKAWGIGVDEPRKLVHCLK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VGLALS VSLFYY+RPLYD VGGNAMWAVMTVVVVFEYTVGATLSK +NRT ATFLAGSL
Sbjct  74    VGLALSAVSLFYYMRPLYDGVGGNAMWAVMTVVVVFEYTVGATLSKSINRTAATFLAGSL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
             GIG+HWVA+QSG++ +PIIL  SVF+LAA ATFSRF+PS+KARFDYG +IFILTFSLVSV
Sbjct  134   GIGIHWVASQSGERFEPIILGFSVFILAAVATFSRFVPSVKARFDYGASIFILTFSLVSV  193

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRV+KL+ LA  RLSTIA+GTS+CI I+ML CP+WAGD+LH LIT NLEKL+DSL GC
Sbjct  194   SGYRVEKLVGLAHNRLSTIAIGTSLCIIISMLFCPIWAGDELHSLITRNLEKLSDSLNGC  253

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             +++Y              +   KKL GYKCVLN+KA+ED+MANFA+WEP HG FNFRHPW
Sbjct  254   VAEYF---HQNGTVDSGGEDCSKKLRGYKCVLNSKATEDSMANFAIWEPAHGNFNFRHPW  310

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             KQYLK+GASMR CA CIE L+G +++  +V + E++ + + + C  + S    VL++L  
Sbjct  311   KQYLKLGASMRYCACCIEALNGCLDT--EVEAPEFLKEHLQDVCMILSSCSSNVLKELMI  368

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
              MK+  +SS  D  V +MNSAV+ LQ   K+L  P+  S+T        P +   K  TK
Sbjct  369   TMKTMRRSSKIDFFVGEMNSAVKDLQNGMKSL--PTMLSVT-------PPDTVKGKPGTK  419

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAK  342
             + +          LME+  L+T+ SLL+EIAAR E +V  +++LA LA+F+   D K  K
Sbjct  420   TTIPP--------LMEVLPLATLVSLLIEIAARIEAIVNNIDELACLAEFKPAKDDK-PK  470

Query  341   QSQS  330
             Q+QS
Sbjct  471   QNQS  474



>ref|XP_007210119.1| hypothetical protein PRUPE_ppa022258mg [Prunus persica]
 gb|EMJ11318.1| hypothetical protein PRUPE_ppa022258mg [Prunus persica]
Length=494

 Score =   483 bits (1242),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 266/487 (55%), Positives = 352/487 (72%), Gaps = 22/487 (5%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             R+ M DG+S  L  ++      +     ++GG VL++W F+ KAW LG  EPRKVIH +K
Sbjct  14    RITMADGSSEALAPDAGFAKIAWLALKGLIGGLVLKVWKFLKKAWDLGHNEPRKVIHCLK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG+AL++VSLFYY+RPLY+ VGGNAMWAVMTVVVVFE  VGATL K +NR   TFLAG L
Sbjct  74    VGMALTVVSLFYYMRPLYEGVGGNAMWAVMTVVVVFENNVGATLCKSINRICGTFLAGFL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              IG+HW+AN+SG++ +P I   SVFLLA+AATFSRFIPS+K RFDYG  IFILTFSLVSV
Sbjct  134   AIGIHWIANRSGEEFEPFITGISVFLLASAATFSRFIPSVKIRFDYGIMIFILTFSLVSV  193

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVDKLLD+A QR++TI +GTS+CI I M++CP+WAG++L+ LIT N++KLA SL+GC
Sbjct  194   SGYRVDKLLDMAGQRITTIIIGTSLCIIITMVICPIWAGEELYMLITRNMDKLAGSLDGC  253

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             +++Y     D     D+DK S+KK+LGYKCVL++K +E+AMANFA WEP HGRFNFRHPW
Sbjct  254   VAEYF---NDSGGFADSDKESDKKVLGYKCVLSSKGTEEAMANFARWEPAHGRFNFRHPW  310

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             KQYLKIGASMR CAYCIE L+G +NS  +  + E+  K +S    +V S    V+++L+K
Sbjct  311   KQYLKIGASMRDCAYCIEALNGCVNSENE--APEFTKKHISNIAIKVSSDSSMVIKELAK  368

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
              MK+  KSS  D LV +MN+AV  LQ   K+L    +  +   ++EA+ P +   +Q++K
Sbjct  369   TMKTMKKSSTIDFLVGEMNNAVLELQEDLKSL---PAIFIPQPLQEAECPENKSTEQDSK  425

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAK  342
              A         V LMEI  L T+ASLL+EI +R EG+V  V +LA L++F+  +D+K   
Sbjct  426   KA---------VPLMEIIPLVTLASLLIEIVSRIEGMVSAVEELAGLSEFKSVNDRK-TN  475

Query  341   QSQSQHK  321
             Q+Q+ +K
Sbjct  476   QNQTTNK  482



>ref|XP_008239213.1| PREDICTED: aluminum-activated malate transporter 10-like [Prunus 
mume]
Length=496

 Score =   481 bits (1237),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 269/499 (54%), Positives = 353/499 (71%), Gaps = 24/499 (5%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             R+ M DG+S  L  ++      +     ++GG VL++W F+ KAW LG  EPRKVIH +K
Sbjct  14    RITMADGSSEALAPDAGFAKIAWLALKGLIGGLVLKVWKFLKKAWDLGHNEPRKVIHCLK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG+AL++VS+FYY+RPLY+ VGGNAMWAVMTVVVVFE  VGATL K +NR   TFLAG L
Sbjct  74    VGMALTVVSVFYYMRPLYEGVGGNAMWAVMTVVVVFENNVGATLCKSINRICGTFLAGFL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              IG+HW+AN+SG++ +P I   SVFLLA+AATFSRFIPS+K RFDYG  IFILTFSLVSV
Sbjct  134   AIGIHWIANRSGEEFEPFITGISVFLLASAATFSRFIPSVKIRFDYGIMIFILTFSLVSV  193

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVDKLLD+A QR+STI +GTS+CI I +++CP+WAG++L+ LIT N++KLA SL+GC
Sbjct  194   SGYRVDKLLDMAGQRISTIIIGTSLCIIITVVICPIWAGEELYMLITRNMDKLAGSLDGC  253

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             +++Y     D     D+DK S+KK LGYKCVL++K +E+AMANFA WEP HGRFNFRHPW
Sbjct  254   VAEYF---NDSGGFADSDKESDKKALGYKCVLSSKGTEEAMANFARWEPAHGRFNFRHPW  310

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             KQYLKIGASMR CAYCIE L+G +NS  +  + E+  K +S    +V S    V+++L+K
Sbjct  311   KQYLKIGASMRDCAYCIEALNGCVNSENE--APEFTKKHISNTAIKVSSDSSMVIKELAK  368

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
              MK+  KSS  D LV +MN+AV  LQ   K+L    +  +   ++EA+ P +   +Q++K
Sbjct  369   TMKTMKKSSTIDFLVGEMNNAVLELQEDLKSL---PTLFIPQPLQEAECPENKSTEQDSK  425

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAK  342
              A         V LMEI  L T+ASLL+EI +R EG+V  V +LA LA+F+   D+   K
Sbjct  426   KA---------VPLMEIIPLVTLASLLIEIVSRIEGMVSAVEELAGLAEFKSVDDR---K  473

Query  341   QSQSQHKEQNVQTH**GLH  285
              +Q+Q   + V  H  GL 
Sbjct  474   TNQNQTINKVVPDHQGGLQ  492



>ref|XP_006491482.1| PREDICTED: aluminum-activated malate transporter 10-like [Citrus 
sinensis]
Length=504

 Score =   477 bits (1228),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 263/488 (54%), Positives = 346/488 (71%), Gaps = 17/488 (3%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYD-----IVGGFVLRIWSFIDKAWQLGKKEPRKVIHGV  1605
             R+N+ DG S  L  E+    + +      ++GGF+L+I  F++KAW L   EP+KVIHG+
Sbjct  12    RINVSDGVSERLEPETGAILRAWTWFKRLMLGGFILKICKFLEKAWNLAVDEPKKVIHGL  71

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVGLA+SLVSLFYY+RPLYD VGGNAMWAVMTVVVVFE +VGATL KC+NR + TFLAGS
Sbjct  72    KVGLAISLVSLFYYMRPLYDGVGGNAMWAVMTVVVVFESSVGATLGKCINRAIGTFLAGS  131

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             LG+GVHW+A  SG+ L+PI+L  S+FLLA+AATFSRF+P+IKARFDYG  IFILTFSLVS
Sbjct  132   LGVGVHWIAFHSGKNLEPIVLGISLFLLASAATFSRFMPTIKARFDYGIMIFILTFSLVS  191

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEG  1065
             VSGYRVDKLL+LAQQRLSTIA+G SICI I+ML CP+WAGD+LH LI  NLEKLA SL+ 
Sbjct  192   VSGYRVDKLLELAQQRLSTIAIGASICIIISMLFCPMWAGDELHLLICQNLEKLAHSLDE  251

Query  1064  CISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHP  885
             C+ +Y             D+A  KK+ GY+C LN+KA+E+  ANFA WEP HGRF+FRHP
Sbjct  252   CVVEYF---RHNKTSTAKDEACSKKMKGYRCALNSKATEELKANFARWEPAHGRFSFRHP  308

Query  884   WKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDls  705
             WKQYLKIGAS+R CAYCIETLHG ++S  Q  +  ++ + ++  C R+ S+   VL++L+
Sbjct  309   WKQYLKIGASIRNCAYCIETLHGCVDSETQ--APPHLKRHLNNICMRLSSSSSNVLQELA  366

Query  704   klmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQET  525
               +K+  +SS  ++ V +MN AV+ L+ A  +L  P+          +   +S +   E 
Sbjct  367   FALKTMKQSSKINLSVGEMNFAVQELKHALISL--PNHNISIKNPSPSTVEASGNCNTEP  424

Query  524   KSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMA  345
              +++           MEI  L+T+ASLL+E AA+ E +V  VN+LA LA+F+  +D K +
Sbjct  425   ITSIRASSS-----FMEILPLATLASLLIENAAKIEVIVNGVNELAVLAEFKPTTDNKKS  479

Query  344   KQSQSQHK  321
             K +QS  K
Sbjct  480   KSNQSPKK  487



>gb|KDO86531.1| hypothetical protein CISIN_1g041036mg [Citrus sinensis]
Length=504

 Score =   476 bits (1225),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 262/488 (54%), Positives = 346/488 (71%), Gaps = 17/488 (3%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYD-----IVGGFVLRIWSFIDKAWQLGKKEPRKVIHGV  1605
             R+N+ DG S  L  E+    + +      ++GGF+L+I  F++KAW L   EP+KVIHG+
Sbjct  12    RINVSDGVSERLEPETGAILRAWTWFKRLMLGGFILKICKFLEKAWNLAVDEPKKVIHGL  71

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVGLA+SLVSLFYY+RPLYD VGGNAMWAVMTVVVVFE +VGATL KC+NR + TFLAGS
Sbjct  72    KVGLAISLVSLFYYMRPLYDGVGGNAMWAVMTVVVVFESSVGATLGKCINRAIGTFLAGS  131

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             LG+GVHW+A  SG+ L+PI+L  S+FLLA+AATFSRF+P+IKARFDYG  IFILTFSLVS
Sbjct  132   LGVGVHWIAFHSGKNLEPIVLGISLFLLASAATFSRFMPTIKARFDYGIMIFILTFSLVS  191

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEG  1065
             VSGYRVD+LL+LAQQRLSTIA+G SICI I+ML CP+WAGD+LH LI  NLEKLA SL+ 
Sbjct  192   VSGYRVDRLLELAQQRLSTIAIGASICIIISMLFCPMWAGDELHLLICQNLEKLAHSLDE  251

Query  1064  CISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHP  885
             C+ +Y             D+A  KK+ GY+C LN+KA+E+  ANFA WEP HGRF+FRHP
Sbjct  252   CVVEYF---RHNKTSTAKDEACSKKMKGYRCALNSKATEELKANFARWEPAHGRFSFRHP  308

Query  884   WKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDls  705
             WKQYLKIGAS+R CAYCIETLHG ++S  Q  +  ++ + ++  C R+ S+   VL++L+
Sbjct  309   WKQYLKIGASIRNCAYCIETLHGCVDSETQ--APPHLKRHLNNICMRLSSSSSNVLQELA  366

Query  704   klmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQET  525
               +K+  +SS  ++ V +MN AV+ L+ A  +L  P+          +   +S +   E 
Sbjct  367   FALKTMKQSSKINLSVGEMNFAVQELKHALISL--PNHNISIKNPSPSTVEASGNCNTEP  424

Query  524   KSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMA  345
              +++           MEI  L+T+ASLL+E AA+ E +V  VN+LA LA+F+  +D K +
Sbjct  425   ITSIRASSS-----FMEILPLATLASLLIENAAKIEVIVNGVNELAVLAEFKPTTDNKKS  479

Query  344   KQSQSQHK  321
             K +QS  K
Sbjct  480   KSNQSPKK  487



>ref|XP_009358731.1| PREDICTED: aluminum-activated malate transporter 10-like [Pyrus 
x bretschneideri]
Length=498

 Score =   474 bits (1219),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 268/494 (54%), Positives = 351/494 (71%), Gaps = 31/494 (6%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRG-------KVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIH  1611
             R+ M DG+S  L + +  +G        +  +V GFV+++W+F+ KAW LG  +PRKVIH
Sbjct  14    RIKMADGSSEAL-APTEAQGCPGIACLALKGLVVGFVMKVWNFLKKAWDLGHSDPRKVIH  72

Query  1610  GVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLA  1431
              +KVG+AL++VSLFYY+RPLY+ VGGNAMWAVMTVVVVFE TVGATL K +NR   TFLA
Sbjct  73    CLKVGMALTVVSLFYYMRPLYEGVGGNAMWAVMTVVVVFENTVGATLCKSINRICGTFLA  132

Query  1430  GSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSL  1251
             G L IG+HW+AN+SG++ +PII   SVFLLA+AATFSRFIPS+KARFDYG  IFILTFSL
Sbjct  133   GFLAIGIHWIANRSGKEFEPIITGISVFLLASAATFSRFIPSVKARFDYGAMIFILTFSL  192

Query  1250  VSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSL  1071
             VSVSGYRVD+L D+A QR+ TI +GTS+C+ I M++CP+WAG++L+ LIT N++KLA+SL
Sbjct  193   VSVSGYRVDQLFDMASQRILTIIIGTSLCVVITMIICPIWAGEELYVLITRNMDKLANSL  252

Query  1070  EGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFR  891
             +GC++DY     D      +DK S+KKLLGYKCVL +K  E++MANFA WEP HGRFNFR
Sbjct  253   DGCVADYF---NDSGGFAGSDKESDKKLLGYKCVLGSKGIEESMANFARWEPAHGRFNFR  309

Query  890   HPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRD  711
             HPWKQYLKIGASMR CAYCIE L+G ++S  +V  +E   K +S    +V S    V+ +
Sbjct  310   HPWKQYLKIGASMRDCAYCIEALNGCVSSENKV--SELTKKHISNIAMKVSSDSSTVINE  367

Query  710   lsklmksttksSIQDILVHDMNSAVEALQLAFKTL----IPPSSQSLTTQVEEAQKPSSD  543
             L+K MK+  KS+  D+LV +MN+AV  LQ   K+L    I P  Q      E    P ++
Sbjct  368   LAKTMKTMKKSTAIDLLVGEMNNAVLDLQEDLKSLPNLFINPQPQ---LPQESDDCPENN  424

Query  542   HLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQ  363
             + K E ++          V LM+I  L T+ASLL+EI AR EG+V  V +LA LA+F+  
Sbjct  425   NTKAEAEA----------VALMDIIPLVTLASLLIEIVARIEGMVGAVQELAELAEFKAA  474

Query  362   SDKKMAKQSQSQHK  321
              D+K A Q+Q+ +K
Sbjct  475   GDRK-ANQNQTTNK  487



>gb|EYU32272.1| hypothetical protein MIMGU_mgv1a024574mg [Erythranthe guttata]
Length=482

 Score =   470 bits (1209),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 260/486 (53%), Positives = 342/486 (70%), Gaps = 30/486 (6%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLA  1590
             R+N+ DGTS+VLVSES  + +V   +  F  +I  F  KAW +G  EP+K +H VKVG+A
Sbjct  11    RINVSDGTSKVLVSESTSQSRVCRGLMRFFSKISDFFRKAWSMGVNEPKKTMHCVKVGMA  70

Query  1589  LSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGV  1410
             L+LVSLFYY+RPLY+ VGGNAMWAVMTVVVVFEYTVGATLSKCVNR + TFLAG+LG+GV
Sbjct  71    LTLVSLFYYMRPLYEGVGGNAMWAVMTVVVVFEYTVGATLSKCVNRAIGTFLAGALGVGV  130

Query  1409  HWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYR  1230
             HW+A+QSG+K +PIILQ      +AAATFSRFIPSIKARFDYG  IFILTFSLVSVSGYR
Sbjct  131   HWIASQSGEKFEPIILQ------SAAATFSRFIPSIKARFDYGAMIFILTFSLVSVSGYR  184

Query  1229  VDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDY  1050
             V+KL +LA  RLSTIA+GTSICI  +ML+ PVWAG +LH L+ NN+EKL+DSLEGC+++Y
Sbjct  185   VEKLFELAHNRLSTIAIGTSICILTSMLIYPVWAGTELHNLVKNNMEKLSDSLEGCLAEY  244

Query  1049  LnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYL  870
                         +     KK+ GYKC LN+KA+E+AMANFA WEP HG FN  HPWK+Y+
Sbjct  245   F--------KDADSGDCNKKMQGYKCALNSKATEEAMANFARWEPAHGSFNLGHPWKEYI  296

Query  869   KIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmks  690
             K+GA +R+CAYCIETL+GSI+S  +V   +++ K   + C R+ +    VL++L+  + +
Sbjct  297   KVGALIRSCAYCIETLNGSISSDTKV--PDFLKKHFRKFCIRLSANSSAVLKELATSIGT  354

Query  689   ttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALS  510
              T+SS  + LV +M S+V+ LQ           +SL+ Q  ++  P ++    E  S+  
Sbjct  355   MTRSSKVEFLVEEMRSSVQELQNVL--------ESLSKQPIQSTAPKNEGGTAEGNSS--  404

Query  509   DDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQS  330
                   +V L++I  L TV+SLL+EIAARTE +   VN LA  A+FR + D+K  K    
Sbjct  405   ----PIVVTLVQIVPLVTVSSLLMEIAARTEKIADAVNVLAEKAEFRSEKDEKPKKGQNP  460

Query  329   QHKEQN  312
             +  ++N
Sbjct  461   KAVDRN  466



>ref|XP_008390303.1| PREDICTED: aluminum-activated malate transporter 10-like [Malus 
domestica]
Length=487

 Score =   468 bits (1205),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 267/490 (54%), Positives = 348/490 (71%), Gaps = 24/490 (5%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRG-------KVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIH  1611
             R+ M DG+S  L + +  RG        +  +V G V+++  F+ KAW LG  EPRKVIH
Sbjct  4     RIKMADGSSESL-APTEARGCPGIAWLALKGLVVGLVMKVCDFLKKAWDLGHNEPRKVIH  62

Query  1610  GVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLA  1431
             GVKVG+AL+ VSLFYY+RPLY+ VGGNAMWAVMTVVVVFE TVGATLSK +NR   T LA
Sbjct  63    GVKVGMALTAVSLFYYMRPLYESVGGNAMWAVMTVVVVFENTVGATLSKSINRICGTLLA  122

Query  1430  GSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSL  1251
             G L IG+HW+A++SG+  +P I+  SVFLLA+AATFSRFIPS+KARFDYG  IFILTFSL
Sbjct  123   GFLAIGIHWIADRSGKDFEPFIIGFSVFLLASAATFSRFIPSVKARFDYGAMIFILTFSL  182

Query  1250  VSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSL  1071
             VSVSGYRVD+L DLA QR+STI +GT +CI I M++CP+WAG+ LH LIT N++KLA+SL
Sbjct  183   VSVSGYRVDELFDLATQRMSTIIIGTCLCIVITMIICPIWAGEQLHMLITGNMDKLANSL  242

Query  1070  EGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFR  891
             +GC++DY     D +    +DK S+KKLLGYKCVL +KA+E +MANFA WEP HG+FNFR
Sbjct  243   DGCVADYF---NDSEGFAGSDKESDKKLLGYKCVLGSKATEXSMANFARWEPAHGQFNFR  299

Query  890   HPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRD  711
             HPWKQYLKIGASMR CAYCIE L+G ++S  +V  +E   K +S    +V S    V+++
Sbjct  300   HPWKQYLKIGASMRNCAYCIEALNGCVSSENEV--SELTKKHISNIAIKVSSHSSMVIKE  357

Query  710   lsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQ  531
             L++ MK+T KSS  D+LV +MN+AV  LQ   K+L P    +    ++E + P ++   +
Sbjct  358   LARTMKTTKKSSAMDLLVGEMNNAVLKLQEDLKSL-PNLFINPKPLLQEPECPENNTTTK  416

Query  530   ETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKK  351
                 A +         LM+I  L T+ASLL+EI AR EG+V  V +LA LA+F+    +K
Sbjct  417   AEAEATA---------LMDIIPLVTLASLLIEIVARVEGMVSAVEELAKLAEFKAVGAEK  467

Query  350   MAKQSQSQHK  321
              A Q+Q+ +K
Sbjct  468   -ANQNQTSNK  476



>ref|XP_010054987.1| PREDICTED: aluminum-activated malate transporter 10-like [Eucalyptus 
grandis]
 gb|KCW71475.1| hypothetical protein EUGRSUZ_E00035 [Eucalyptus grandis]
Length=492

 Score =   467 bits (1202),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 277/489 (57%), Positives = 347/489 (71%), Gaps = 23/489 (5%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             R+N+P+G S+ L  E     K +     +VGG V R+  F+DKAW LG  EP+KVIHG K
Sbjct  12    RINVPNGMSKELDPECSCYCKPWLALKSLVGGLVARVLRFLDKAWALGVAEPKKVIHGFK  71

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG+ALSLVSLFYY+RPLYD  GGNAMWAVMTVVVVFEYTVGATLSK +NR   TFLAGSL
Sbjct  72    VGIALSLVSLFYYVRPLYDVFGGNAMWAVMTVVVVFEYTVGATLSKSINRGTGTFLAGSL  131

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
             GIGVHWVA+QSG+K +PIIL  SVFLLA+AATFSRFIPS+KARFDYG  IFILTFSLVSV
Sbjct  132   GIGVHWVASQSGEKFEPIILGISVFLLASAATFSRFIPSVKARFDYGAMIFILTFSLVSV  191

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVDKL+ +AQQRLSTIA+GTS+CIFI+M + P+WAGD+LHRLI  N+EKLA+SLE  
Sbjct  192   SGYRVDKLIGMAQQRLSTIAIGTSLCIFISMCISPIWAGDELHRLIHRNMEKLAESLEAS  251

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             +++Y     D      + + + KK   YKCVLN+KA+E++MANFA WEP HG FNFRHPW
Sbjct  252   VANYF---RDNQSGYPSQEDNSKKTQAYKCVLNSKATEESMANFARWEPAHGPFNFRHPW  308

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             K+YLKIGA +R CA CIETL G +NS  Q    E++   +      VCS    VLR+LSK
Sbjct  309   KEYLKIGALLRECACCIETLSGCLNSEKQ--GMEHLKGYLKHASMAVCSHSCNVLRELSK  366

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
              +K+TTKSS   + V +M  A++ LQ A K+L    +Q +  QV  +Q   ++  K  TK
Sbjct  367   SVKTTTKSSKLYLSVGEMKFALQELQNALKSL---PTQLILEQVLASQ---ANENKSTTK  420

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAK  342
                +         +ME+  L+T+ SLL EI AR E +V  V +LA LA+F+  +++K+A 
Sbjct  421   KECAPP-------VMEVIPLATLVSLLTEIVARIEEIVDGVIKLAELAEFKAFNEEKIA-  472

Query  341   QSQSQHKEQ  315
             Q+QS    Q
Sbjct  473   QNQSTSNNQ  481



>ref|XP_011094087.1| PREDICTED: aluminum-activated malate transporter 10 [Sesamum 
indicum]
Length=461

 Score =   466 bits (1198),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 263/465 (57%), Positives = 334/465 (72%), Gaps = 29/465 (6%)
 Frame = -3

Query  1688  GFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmt  1509
             GF+  IW F+ +AW +   EP K++H +KVGLALSLVSLFYY+RPLY  VGGNAMWAVMT
Sbjct  2     GFLTTIWGFLQRAWIIAVTEPNKLMHCLKVGLALSLVSLFYYMRPLYQGVGGNAMWAVMT  61

Query  1508  vvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAA  1329
             VVVV EYTVGATLSK VNR   TFLAG+L +GVHWVA QSG+KL+P+ILQASVFLLAAAA
Sbjct  62    VVVVSEYTVGATLSKSVNRATGTFLAGALAVGVHWVATQSGEKLEPVILQASVFLLAAAA  121

Query  1328  TFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAM  1149
             TFSRFIPSIKARFDYG  IFILTFSLVSVSGYRV KL  LA  RLSTIA+GTSICI I+M
Sbjct  122   TFSRFIPSIKARFDYGAMIFILTFSLVSVSGYRVQKLFKLAHDRLSTIAIGTSICILISM  181

Query  1148  LLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCV  969
             L+CPVWAG +LH LI NN+EKL+DSL+GC+++Y     D   +    +AS K L  YKC 
Sbjct  182   LVCPVWAGTELHNLIKNNMEKLSDSLDGCVAEYF--GNDVKSNNSKSEASHKILQAYKCT  239

Query  968   LNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLH-GSINSSAQV  792
             LN+KA+E+++ANFA WEP HG FNF HPWK+YLK+GAS+R+CAYCIE L+ GSI S A+V
Sbjct  240   LNSKATEESLANFARWEPAHGGFNFGHPWKEYLKVGASLRSCAYCIEALNGGSICSDAKV  299

Query  791   GSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFK  612
                +++     + C R+ ++   VL++L+  + +  KSS  D++V +M +AV+ L+ A K
Sbjct  300   --PDFLKTHFGKFCIRLSASSSAVLKELAVAISTMKKSSKIDVMVEEMRNAVQELENALK  357

Query  611   TLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHD------LVYLMEIAQLSTVA  450
             +L   S Q + +               ETK+  S +D  +      +V L EI  L TV 
Sbjct  358   SL---SRQQIAS--------------TETKTGDSVNDIGEGNASPVVVTLAEIVPLVTVT  400

Query  449   SLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHKEQ  315
             SLL+EIAARTE + + VN LA+ A+FR +S +   K+SQ+Q  +Q
Sbjct  401   SLLIEIAARTEKIAEAVNGLADKAEFRVESAEN-TKKSQTQKVKQ  444



>ref|XP_009359585.1| PREDICTED: aluminum-activated malate transporter 10-like [Pyrus 
x bretschneideri]
Length=497

 Score =   466 bits (1199),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 268/490 (55%), Positives = 347/490 (71%), Gaps = 24/490 (5%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRG-------KVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIH  1611
             R+ M DG+S  L + +  RG        +  +V G V+++  F+ KAW LG KEP KV H
Sbjct  14    RIKMADGSSESL-APTEARGCPDIAWLALKGLVVGLVMKVCDFLKKAWDLGHKEPIKVTH  72

Query  1610  GVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLA  1431
             GVKVG+AL+ VSLFYY+RPLY+ VGGNAMWAVMTVVVVFE TVGATLSK +NR   T LA
Sbjct  73    GVKVGMALTAVSLFYYMRPLYEGVGGNAMWAVMTVVVVFENTVGATLSKSINRICGTLLA  132

Query  1430  GSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSL  1251
             G L IG+HW+A++SG+  +P I+  SVFLLA+AATFSRFIPS+KARFDYG  IFILTFSL
Sbjct  133   GFLAIGIHWIADRSGKDFEPFIIAFSVFLLASAATFSRFIPSVKARFDYGAMIFILTFSL  192

Query  1250  VSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSL  1071
             VSVSGYRVD+L DLA QR+STI +GT +CI I M++CP+WAG+ LH LIT N++KLA+SL
Sbjct  193   VSVSGYRVDELFDLATQRMSTIIIGTCLCIVITMIICPIWAGEQLHTLITGNMDKLANSL  252

Query  1070  EGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFR  891
             +GC++DY     D  D   +DK S+KKLLGYKCVL +KA+E++MANFA WEP HGRFNFR
Sbjct  253   DGCVADYF---NDSGDFAGSDKESDKKLLGYKCVLGSKATEESMANFARWEPAHGRFNFR  309

Query  890   HPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRD  711
             HPWKQYLKIGASMR CAYCIE L+G ++S  +V  +E   K +S    +V S    V+++
Sbjct  310   HPWKQYLKIGASMRNCAYCIEALNGCVSSENKV--SELTKKYISNIAIKVSSHSSIVIKE  367

Query  710   lsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQ  531
             L+  MK+T KSS  D+LV +MN+AV  LQ   K+L P    +    ++E + P ++   +
Sbjct  368   LATTMKTTKKSSAIDLLVGEMNNAVLELQEDLKSL-PNLFINPKPLLQEPECPENNTTTK  426

Query  530   ETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKK  351
                 A +         LM+I  L T+ASLL+EI AR EG+V  V +LA LA+F+    +K
Sbjct  427   AEAEATA---------LMDIIPLVTLASLLIEIVARVEGMVSAVEELAKLAEFKAVGAEK  477

Query  350   MAKQSQSQHK  321
              A Q+Q+ +K
Sbjct  478   -ANQNQTSNK  486



>ref|XP_011023141.1| PREDICTED: aluminum-activated malate transporter 10-like [Populus 
euphratica]
Length=492

 Score =   466 bits (1198),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 258/487 (53%), Positives = 345/487 (71%), Gaps = 27/487 (6%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYD----IVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             R+N+ +GTS +L   S    +++     ++G F+L+IW+F++KA  +   EP+KVIH +K
Sbjct  14    RINVRNGTSEILQPGSGLVHRIWSWLKGLLGEFMLKIWNFLEKARNMAVAEPKKVIHCLK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG+ L++VSL YY+RPLY+ VGGNAMWA+MTVVVVFEYTVGATL KC+NR + TFLAGSL
Sbjct  74    VGVTLTIVSLVYYMRPLYEGVGGNAMWAIMTVVVVFEYTVGATLYKCINRAIGTFLAGSL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
             G+GVHW A+ SG KL+PIIL  SVFLLA+AATFSRFIPS+KARFDYG  IFILTFSLVSV
Sbjct  134   GVGVHWAASHSGDKLEPIILGISVFLLASAATFSRFIPSVKARFDYGVLIFILTFSLVSV  193

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVDKL+D+A QRLSTIA+G S+C+ I ML  P+WAG +LH LI  NLEKLAD+L+GC
Sbjct  194   SGYRVDKLIDVAHQRLSTIAIGASLCVLICMLFYPIWAGKELHNLIHRNLEKLADALDGC  253

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             I++Y            +   S KK+ GYKCVLN+KA+ED+MA FA WEP HGRFNFRHPW
Sbjct  254   IAEYF--------TDSSAGDSWKKIGGYKCVLNSKAAEDSMAGFARWEPAHGRFNFRHPW  305

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             KQYLK+GAS+R+CAYCIETL G +NS  ++ + E + + +S+ C  + S+   VL++L+ 
Sbjct  306   KQYLKVGASLRSCAYCIETLDGCLNS--EIKAPELLRRHLSDACITLSSSASFVLKELAA  363

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
              +++  KSS  D+ + +M  AV  L+ A K+L P    +  +   +    +    K  T+
Sbjct  364   TVETMRKSSEIDLSIEEMQFAVLKLENAMKSL-PNHLAATPSSTSDGDAKTEPIRKTATR  422

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAK  342
             S+           +MEI  L+T+ S+L E AAR + +  EVN+LA LA F+  + KK A 
Sbjct  423   SS-----------VMEILPLATLVSVLTETAARIKEIADEVNELAKLADFKPPNTKK-AS  470

Query  341   QSQSQHK  321
             QSQS ++
Sbjct  471   QSQSSNQ  477



>ref|XP_008459754.1| PREDICTED: aluminum-activated malate transporter 10 [Cucumis 
melo]
Length=498

 Score =   463 bits (1192),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 257/496 (52%), Positives = 348/496 (70%), Gaps = 24/496 (5%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRG----KVYDIV-GGFVLRIWSFIDKAWQLGKKEPRKVIHGV  1605
             RVNM DGT+ +L  ++        ++ D + GG +L+ W F++KAW +   EP+KV+HG+
Sbjct  10    RVNMGDGTTEILRPQASFMKNIMMRIKDFIWGGLLLKAWKFLEKAWGIANSEPKKVVHGL  69

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVGLAL++VS+FYY+RPLY+ VGGNAMWA+MTVVV FE TVGAT  KCVNR + T LAG 
Sbjct  70    KVGLALTIVSIFYYMRPLYEGVGGNAMWAIMTVVVTFESTVGATFYKCVNRVIGTSLAGC  129

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             LGIGVHW+A +SG K +PIIL  S+FLLA+AATFSRFIPS+K+RFDYG  IF+LTF LVS
Sbjct  130   LGIGVHWIAAESGDKFEPIILGISLFLLASAATFSRFIPSVKSRFDYGAMIFVLTFCLVS  189

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEG  1065
             +SGYRV+KLL+LA+ R+STIA+GTS+CIF++ML CP+WAG  L  L   NL+KLA SL+G
Sbjct  190   ISGYRVEKLLELARTRISTIAIGTSLCIFVSMLFCPIWAGSQLQSLTARNLDKLALSLDG  249

Query  1064  CISDYLna-dgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRH  888
             C+ +Y    D  G+   ++ K +  K+ GYKCVLN+KASE++MANFA WEP HGRF FRH
Sbjct  250   CVCEYFENDDDTGEMKNEDQKNNNSKVEGYKCVLNSKASEESMANFARWEPAHGRFGFRH  309

Query  887   PWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDl  708
             PWK+YL++G  MR  AYCIE LHG +NS  Q  ++  +   ++E C+ + S+  +VL++L
Sbjct  310   PWKKYLEVGGVMRKSAYCIEALHGCLNSEIQAPNSLKL--HLAEPCKALSSSSSQVLKEL  367

Query  707   sklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQ---SLTTQVEEAQKPSSDHL  537
             S ++K   KS+  D LV +MN AV+ LQ A K+L  PS+Q   SL+ Q +  +  + DH 
Sbjct  368   SIVIKKMKKSTKIDFLVSNMNIAVQELQNAIKSL--PSTQMEVSLSEQ-DHQEANNEDHH  424

Query  536   KQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSD  357
             K  T + +          LME+  L+T+ SLL+E  +R E VV  V  LAN+A +  + +
Sbjct  425   KATTAATIPP--------LMELLPLATLVSLLIETTSRIEHVVNAVETLANVADYDSEDE  476

Query  356   KKMAKQSQSQHKEQNV  309
             KK  K S S + + NV
Sbjct  477   KK--KPSSSDNHDHNV  490



>ref|XP_002301422.2| hypothetical protein POPTR_0002s17520g [Populus trichocarpa]
 gb|EEE80695.2| hypothetical protein POPTR_0002s17520g [Populus trichocarpa]
Length=492

 Score =   461 bits (1187),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 257/487 (53%), Positives = 345/487 (71%), Gaps = 27/487 (6%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYD----IVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             R+N+ +GTS +L  ++    +V+     ++G F+L+IW+F++KA  +   EP+KVIH +K
Sbjct  14    RINVRNGTSEILQPKTGLVHRVWSWLKGLLGEFMLKIWNFLEKARNIAVAEPKKVIHCLK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG+ L++VSLFYY+RPLY+ VGGNAMWA+MTVVVVFEYTVGATL KC+NR + TFLAGSL
Sbjct  74    VGVTLTIVSLFYYMRPLYEGVGGNAMWAIMTVVVVFEYTVGATLYKCINRAIGTFLAGSL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
             G+GVHW A+ SG KL+PIIL  SVFLLA+AATFSRFIPS+KARFDYG  IFILTFSLVSV
Sbjct  134   GVGVHWAASHSGDKLEPIILGISVFLLASAATFSRFIPSVKARFDYGVLIFILTFSLVSV  193

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVDKL+D+A+QRLSTIA+G S+C+ + ML  P+WAG +LH LI  NLEKLAD+L+GC
Sbjct  194   SGYRVDKLIDVARQRLSTIAIGASLCVLMCMLFYPIWAGKELHNLIHRNLEKLADALDGC  253

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
              ++Y            +   S KK+ GYKCVLN+KA+ED+MA FA WEP HGRFNFRHPW
Sbjct  254   TAEYF--------TDSSAGDSWKKIGGYKCVLNSKAAEDSMAGFARWEPAHGRFNFRHPW  305

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             KQYLK+GAS+R+CAYCIETL G +NS  ++ + E + + +S+ C  + S+   VL++L+ 
Sbjct  306   KQYLKVGASLRSCAYCIETLDGCLNS--EIKAPELLRRHLSDACITLSSSASFVLKELAT  363

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
              +K+  KSS  D  + +M  AV  L+ A K+L P    +  +   +    +    K  T 
Sbjct  364   TVKTMRKSSEIDFSIGEMQFAVLKLENAMKSL-PNHLVATPSSTSDGDAKAEPIRKTTTP  422

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAK  342
             S+           +M+I  L+T+ S+L E AAR + +  EVN+LA LA F+  + KK A 
Sbjct  423   SS-----------VMDILPLATLVSMLTETAARIKEIADEVNELAKLAAFKPPNTKK-AS  470

Query  341   QSQSQHK  321
             QSQS ++
Sbjct  471   QSQSSNQ  477



>ref|XP_008374093.1| PREDICTED: aluminum-activated malate transporter 10-like [Malus 
domestica]
Length=497

 Score =   461 bits (1185),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 265/501 (53%), Positives = 349/501 (70%), Gaps = 36/501 (7%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRG-------KVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIH  1611
             R+ M DG+S  L + +  RG        +  +V GFV+++W+F+ KAW LG  +PRKVIH
Sbjct  4     RIKMADGSSEAL-APTEARGCPGIACLALKGLVVGFVMKVWNFLKKAWDLGHSDPRKVIH  62

Query  1610  GVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLA  1431
              +KVG+AL++VS FYYLRPLY+ VGGNAMWAVMTVVVVFE T+GATL K +NR   TFLA
Sbjct  63    CLKVGMALTVVSXFYYLRPLYEGVGGNAMWAVMTVVVVFENTIGATLCKSINRICGTFLA  122

Query  1430  GSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSL  1251
             G L IG+HW+A +SG++ +P I   SVFLLA+AATFSRFIPS+KARFDYG  IFILTFSL
Sbjct  123   GFLAIGIHWIAXRSGKEFEPFITGISVFLLASAATFSRFIPSVKARFDYGAMIFILTFSL  182

Query  1250  VSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSL  1071
             VSVSGYRVD+L  +A QR+STI +GTS+C  I M++CP+WAG++L+ LIT N++KLA+SL
Sbjct  183   VSVSGYRVDQLFHMASQRMSTIVIGTSLCAVITMIICPIWAGEELYMLITRNMDKLANSL  242

Query  1070  EG---------CISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWE  918
             +G         C++DY     D      +DK S+KKLLGYKCVL +K +E++MANFA WE
Sbjct  243   DGTXFNPIPSXCVADYF---NDSGGFAGSDKESDKKLLGYKCVLGSKGAEESMANFARWE  299

Query  917   PGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVC  738
             P HGRFNFRHPWKQYLKIGASMR CAYCIE L+G + S  +V  +E   K +S    +V 
Sbjct  300   PAHGRFNFRHPWKQYLKIGASMRDCAYCIEALNGCVXSENKV--SELXKKHISNIAMKVS  357

Query  737   STCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQV--EE  564
             S    V+++L+K MK+  KS+  D+LV +MN+AV  LQ   K+L P    +   Q+  E 
Sbjct  358   SDSSTVIKELAKTMKTMKKSTAIDLLVGEMNNAVLELQEDLKSL-PNLFINRQPQLPQES  416

Query  563   AQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLAN  384
                P +++ K E ++          V LM+I  L T+ASLL+EI AR EG+V  V +LA 
Sbjct  417   DDCPENNNTKAEAEA----------VALMDIIPLVTLASLLIEIVARIEGMVGAVEELAE  466

Query  383   LAQFRGQSDKKMAKQSQSQHK  321
             LA+F+   D+K A Q+Q+ +K
Sbjct  467   LAEFKAAGDRK-ANQNQTTNK  486



>ref|XP_006439261.1| hypothetical protein CICLE_v10024452mg [Citrus clementina]
 gb|ESR52501.1| hypothetical protein CICLE_v10024452mg [Citrus clementina]
Length=489

 Score =   460 bits (1183),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 253/496 (51%), Positives = 354/496 (71%), Gaps = 32/496 (6%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSE----SRRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             ++ + DG+S  LV E    SR    V +++GG VL++W F++KAW LG  +PRKVIH +K
Sbjct  14    KIRVADGSSETLVPEAGLASRLWLGVKNMIGGLVLKVWRFLEKAWDLGVDDPRKVIHCLK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG+AL++VSLFYY RPLY+ VGGNAMWA+MTVVVVFE TVGAT++KC+NR   T LAG L
Sbjct  74    VGIALTVVSLFYYTRPLYEGVGGNAMWAIMTVVVVFENTVGATIAKCLNRVFGTLLAGFL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +GVHW+A+QSG+KL+P+I  AS+FLLA+AATFSRFIP++KARFDYG  IFILTFSLV+V
Sbjct  134   ALGVHWIASQSGEKLEPLIAGASLFLLASAATFSRFIPTVKARFDYGALIFILTFSLVTV  193

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVDKL ++A QR+STI +GTS+CI ++ML+ P+WAG DL+ LI  N++KLA+S++G 
Sbjct  194   SGYRVDKLFNMAHQRISTIVIGTSLCILVSMLIRPIWAGKDLYNLIIRNMDKLANSIDGS  253

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             +++Y           D +  ++K  LGYKCVLNTKA+E++MANFA WEP HGRFNFRHPW
Sbjct  254   VAEYF---NRSGGLTDCEGEAQKVFLGYKCVLNTKATEESMANFARWEPAHGRFNFRHPW  310

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             KQYLK+GA++R CAYCIE L+  INS  Q  + E+I K +   C RV S   +V+++L+K
Sbjct  311   KQYLKVGAAVRRCAYCIEALNACINSENQ--APEFIKKLLCNTCLRVSSNSSRVVKELAK  368

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
             ++K+  KSS  D+LV +MN+ V+ L+   K+L    S++ T++ +  +K SS       K
Sbjct  369   IIKTMKKSSTIDLLVEEMNAGVKELKDDLKSL--SLSEAGTSENKRTEKISS-------K  419

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQF-------RGQ  363
              A +       + LM +  + + AS  +EIA+R E +V+ V +LANLA+F       + Q
Sbjct  420   PAAA-------IPLMGMISMVSFASFQIEIASRIESIVEAVEELANLAEFEHPEKNKQNQ  472

Query  362   SDKKMAKQSQSQHKEQ  315
             ++ K+A   Q+  + +
Sbjct  473   ANIKVAANEQNDEETK  488



>ref|XP_010252735.1| PREDICTED: aluminum-activated malate transporter 10 [Nelumbo 
nucifera]
Length=501

 Score =   460 bits (1183),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 271/498 (54%), Positives = 348/498 (70%), Gaps = 28/498 (6%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRR---RGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKV  1599
             RV   DG SR L  ES     +  V  ++ G + ++  F++KAW +G  EPRKVIH +KV
Sbjct  15    RVRANDGDSRTLAPESAGPLGKAWVCVVLSGLMWKVRRFLEKAWGIGIDEPRKVIHCLKV  74

Query  1598  GLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLG  1419
             G+AL+ VSLFYY+RPLY  VGGNAMWAVMTVVV+FEYTVGATLSK  NRT ATFLAGSLG
Sbjct  75    GIALTTVSLFYYMRPLYQGVGGNAMWAVMTVVVLFEYTVGATLSKSFNRTTATFLAGSLG  134

Query  1418  IGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVS  1239
             +GV+WVA QSGQK QP+IL ASVFLLA+A TFSRFIP+IKARFDYG  IFILTFSLVSVS
Sbjct  135   VGVNWVATQSGQKFQPVILGASVFLLASATTFSRFIPTIKARFDYGALIFILTFSLVSVS  194

Query  1238  GYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCI  1059
             GYRV+KLLD+A QRLSTI +G S+C+ I+ML+CP+WAG++L  L+T N+EKLA+SL+ C+
Sbjct  195   GYRVEKLLDMANQRLSTIVIGASMCLIISMLICPIWAGEELQLLVTRNMEKLANSLDACM  254

Query  1058  SDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWK  879
             ++Y   +  G+   DNDK S K  LGY+CVLN+KA+ED++ANFA WEP HG F+FRHPWK
Sbjct  255   AEYF--NDCGNFAGDNDKDSHKVALGYRCVLNSKATEDSLANFARWEPAHGNFSFRHPWK  312

Query  878   QYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlskl  699
             QYLK+ ASMR CAYCIE L G IN+     + +YI K +S EC  + S    +LR+L+  
Sbjct  313   QYLKVTASMRNCAYCIEALSGRINAETDQQAPDYIKKHLSNECLALSSISSSILRELAIN  372

Query  698   mksttksSIQDILVHDMNSAVEALQLAFKT----LIPPSSQSLTTQVEEAQKPSSDHLKQ  531
             +KS   SS     V ++N AVE +Q A K+    LIPP        +   + P ++H   
Sbjct  373   IKSMRTSSTIHSSVEELNRAVEDIQSALKSLPNRLIPP-------HLPITKAPETEHRPS  425

Query  530   ETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKK  351
              T S          + L+E+  L+TVASLL+EIAAR + +V  V++LAN A F+  ++ +
Sbjct  426   ITSS----------IPLIEVLPLATVASLLIEIAARIQPLVNVVDKLANSAGFK-PAESE  474

Query  350   MAKQSQS-QHKEQNVQTH  300
              + QSQS +      Q H
Sbjct  475   NSNQSQSTKEPTSECQNH  492



>ref|XP_004310262.1| PREDICTED: aluminum-activated malate transporter 10-like [Fragaria 
vesca subsp. vesca]
Length=473

 Score =   459 bits (1180),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 258/493 (52%), Positives = 346/493 (70%), Gaps = 32/493 (6%)
 Frame = -3

Query  1760  MPDGTSRVLVSES----RRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGL  1593
             M DG+S  L  E+    R    V  ++ G +L++ +F +KAW LG+ EPRKVIH +KVG+
Sbjct  1     MTDGSSEALAPEAGLACRAWLAVKGLIMGLILKVCNFFEKAWNLGQNEPRKVIHCLKVGM  60

Query  1592  ALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIG  1413
             AL++VSLFYY+RPLY+ +GGNAMWAVMT+VVVFE TVGAT+ KC+NR   TF+AGSL IG
Sbjct  61    ALTVVSLFYYMRPLYEGMGGNAMWAVMTIVVVFENTVGATICKCLNRICGTFIAGSLAIG  120

Query  1412  VHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGY  1233
             +HW+ +QSG++ +P I   SVFLLA+A TFSRFIPS+K RFDYG  IFILTFSLV+VSGY
Sbjct  121   IHWIVSQSGKEFEPFINGISVFLLASAVTFSRFIPSVKKRFDYGAMIFILTFSLVTVSGY  180

Query  1232  RVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISD  1053
             RVDKLL+LA  R+ TI +GT++CI I M++CP+WAG++L+ LIT N++KLA SL+GC+ +
Sbjct  181   RVDKLLELANNRVYTIIIGTALCIMITMIICPIWAGEELYMLITRNMDKLAYSLDGCVGE  240

Query  1052  YLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQY  873
             Y     D     D+DK  +KK LGYKCVL +KA+E+AMANFA WEP HGRFNFRHPWKQY
Sbjct  241   YF---NDSGSSSDDDKECDKKFLGYKCVLTSKATEEAMANFARWEPAHGRFNFRHPWKQY  297

Query  872   LKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmk  693
             LK+GASMRACAYCI+ L G +NS  +V   E + K +S    +V S   +V+++L++ MK
Sbjct  298   LKVGASMRACAYCIDALDGCVNSENEV--PESMKKHMSNIALKVSSESSRVIKELARTMK  355

Query  692   sttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSAL  513
             + TKSS  D LV +MN+AV  LQ   K+L  P+S      ++ A  P     K++T++  
Sbjct  356   TMTKSSTVDYLVGEMNNAVLELQEDLKSL--PTSFINPQPLQGADCPE----KKKTRT--  407

Query  512   SDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQS-  336
                     V LM+I  L T+ SLL+EI  R EG+V EV +LA + +++  +D+K  KQ  
Sbjct  408   --------VALMDIMPLVTLTSLLIEITTRIEGMVNEVEELAEMGEYKSVADEKNQKQPA  459

Query  335   ------QSQHKEQ  315
                     +HKE+
Sbjct  460   VSKTNVPDEHKEE  472



>ref|XP_007051494.1| Aluminum activated malate transporter family protein, putative 
[Theobroma cacao]
 gb|EOX95651.1| Aluminum activated malate transporter family protein, putative 
[Theobroma cacao]
Length=493

 Score =   459 bits (1181),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 260/492 (53%), Positives = 339/492 (69%), Gaps = 30/492 (6%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             R N+PD TS+ L  +    GK +     ++GG V+++W F++K W LG  EPRKVIH  +
Sbjct  12    RTNVPDETSKKLEPDYGLVGKTWLRLKCVMGGLVMKVWGFLEKVWTLGVAEPRKVIHCAR  71

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VGLALS+VSLFYY+RPLYDD GGN MWAVMTVVVVFEYTVGATLSKC+NR   T LAG+L
Sbjct  72    VGLALSIVSLFYYIRPLYDDFGGNVMWAVMTVVVVFEYTVGATLSKCINRATGTILAGAL  131

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
             G+G+HWVA++SG KL+PI+L  SVF  A+AATFSRFIPS+KARFDYG  IFILTFSLVSV
Sbjct  132   GVGIHWVADRSGDKLKPIVLGVSVFFFASAATFSRFIPSVKARFDYGAMIFILTFSLVSV  191

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             S YR+ +L +LAQ RLST+A+G S+CI + ML CP+WAG +LHRLI  N+EKL DSL+GC
Sbjct  192   SAYRMVELFELAQDRLSTVAIGASLCILVTMLFCPIWAGCELHRLIHQNMEKLVDSLDGC  251

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             ++ Y    G+    +++     KK+ GYKCVLN+KA+E++M NFA WEP HGRFNF HPW
Sbjct  252   VAHYFKDSGNLTISEEDL---NKKIQGYKCVLNSKATEESMCNFARWEPTHGRFNFGHPW  308

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             KQYLKIGAS+R CAYCIETL+  + S   + +   I K +S++C +V S    VL++L+ 
Sbjct  309   KQYLKIGASLRRCAYCIETLNSCVGS--DIEAPPCIRKHLSDKCLKVSSYSTNVLKELAI  366

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKT-----LIPPSSQSLTTQVEEAQKPSSDHL  537
              +    KSS  +  V +MN  V+ L+ A K+     L PPSS       EE+ + +S  +
Sbjct  367   TIMKMKKSSKIEFRVAEMNFGVQELRDALKSLPSHLLAPPSSTG-----EESTEATSVPI  421

Query  536   KQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSD  357
             K+             L  +M++  L TV SLL EIAAR  GV   V +LA+LA+F+   D
Sbjct  422   KKADV----------LPPIMKVLPLITVVSLLEEIAARIGGVADAVEELASLAEFKPAKD  471

Query  356   KKMAKQSQSQHK  321
             +K  KQ+   +K
Sbjct  472   RK-PKQNLPTNK  482



>gb|KGN46529.1| hypothetical protein Csa_6G106810 [Cucumis sativus]
Length=496

 Score =   458 bits (1179),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 254/497 (51%), Positives = 342/497 (69%), Gaps = 28/497 (6%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYD-----IVGGFVLRIWSFIDKAWQLGKKEPRKVIHGV  1605
             RVNM DGT+ +L  E+     +       I GG +L+ W F++KAW +   EP+K +HG+
Sbjct  10    RVNMGDGTTEILRPEASFMKNIMMRIKNFIWGGLLLKAWKFLEKAWGIANSEPKKAVHGL  69

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVGLAL++VS+FYY+RPLY+ VGGNAMWA+MTVVV FE TVGAT  KCVNR + T LAG 
Sbjct  70    KVGLALTIVSIFYYMRPLYEGVGGNAMWAIMTVVVTFESTVGATFYKCVNRVIGTSLAGC  129

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             LGIGVHW+A +SG K +PIIL  S+FLLA+  TFSRFIPS+K+RFDYG  IF+LTF LVS
Sbjct  130   LGIGVHWIAAESGDKFEPIILGISLFLLASVTTFSRFIPSVKSRFDYGAMIFVLTFCLVS  189

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEG  1065
             +SGYRV+KL +LA+ R+STIA+GTS+CIF++ML CP+WAG  L  L   NL+KLA SL+G
Sbjct  190   ISGYRVEKLFELARTRISTIAIGTSLCIFVSMLFCPIWAGSQLQSLTARNLDKLAHSLDG  249

Query  1064  CISDYLna--dgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFR  891
             C+S+Y     D +   + +++K +  K+ GYKCVLN+KASE++MANFA WEP HGRF FR
Sbjct  250   CVSEYFENDDDTEEMKNNEDEKNNNSKVEGYKCVLNSKASEESMANFARWEPAHGRFGFR  309

Query  890   HPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRD  711
             HPWK+YL++G  MR  AYCIE LHG +NS  Q  ++  +   ++E C+ + S+  +VL++
Sbjct  310   HPWKKYLEVGGVMRKSAYCIEALHGCLNSEIQAPNSLKL--HLAEPCKALSSSSSEVLKE  367

Query  710   lsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQ---SLTTQVEEAQKPSSDH  540
             LS ++K   KS+  D LV +MN AV+ LQ A K+   PS+Q   SL+ Q EEA   + DH
Sbjct  368   LSIVIKKMKKSTKIDFLVSNMNVAVQELQNAIKSF--PSTQMEVSLSEQEEEAN--NEDH  423

Query  539   LKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQS  360
                 T           +  LM++  L+T+ SLL+E  +R E VV  V  LAN+A +  + 
Sbjct  424   KAATT----------TIPPLMKLLPLATLVSLLIETTSRIEHVVNAVETLANVANYDSED  473

Query  359   DKKMAKQSQSQHKEQNV  309
             +KK  K S S + + NV
Sbjct  474   EKK--KPSSSDNHDHNV  488



>ref|XP_006396321.1| hypothetical protein EUTSA_v10028612mg [Eutrema salsugineum]
 gb|ESQ37774.1| hypothetical protein EUTSA_v10028612mg [Eutrema salsugineum]
Length=489

 Score =   452 bits (1164),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 257/487 (53%), Positives = 335/487 (69%), Gaps = 21/487 (4%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVL-----RIWSFIDKAWQLGKKEPRKVIHGV  1605
             R+++ +GT+  LV  S    +++  + G V+     RI  F+ KAW++G  +P KV+H +
Sbjct  13    RISVDNGTTERLVPTSGVSKRIFVWLKGLVMKVLVERIAKFMRKAWRIGADDPAKVVHCL  72

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVGLALSLVS+FYY+RPLYD VGGNAMWA+MTVVVVFE  VGAT SKCVNR VAT LAGS
Sbjct  73    KVGLALSLVSIFYYMRPLYDGVGGNAMWAIMTVVVVFESNVGATFSKCVNRVVATILAGS  132

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             LGI VHWVA QSG K +  ++  SVFL A AAT+SRF+PS KARFDYG  IFILTFSLVS
Sbjct  133   LGIAVHWVATQSG-KAEIFVIGCSVFLFAFAATYSRFVPSFKARFDYGAMIFILTFSLVS  191

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEG  1065
             V GYRVDKL++LAQQR+STIA+GTSICI I +  CP+WAG  LHRL+  NLEKLADSL+G
Sbjct  192   VGGYRVDKLVELAQQRVSTIAIGTSICIIITVFFCPIWAGSQLHRLVQRNLEKLADSLDG  251

Query  1064  CISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHP  885
             C+++Y     D   +++ D+ S  KL G+KCVLN+K +E++MAN A WEP HG FNFRHP
Sbjct  252   CVAEYF-KKKDVSTNENEDEESNMKLQGFKCVLNSKGTEESMANLARWEPAHGSFNFRHP  310

Query  884   WKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDls  705
             WK Y+KIGA+MR CAYC+E L   IN   +  + + + +   E C ++ S   K+LR+L+
Sbjct  311   WKLYVKIGAAMRRCAYCLENLSICINYETE--APDQVKRHFGEACMKLSSASSKILRELA  368

Query  704   klmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQET  525
              +MK+T KSS  D LV DMNSAV+ LQ   KT +P           E  KP  +   +E 
Sbjct  369   DMMKNTRKSSKMDFLVFDMNSAVQELQETLKT-VPI----------ETNKPEEEVPSEEN  417

Query  524   KSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMA  345
             K   S+D    +  L E+  ++T+ SLL+E AAR +  V+ V++LANLA F   S KK  
Sbjct  418   KKGDSEDRTMPM-SLHEVLPVATLVSLLIENAARIQTTVEAVDELANLADFEQDSKKKPG  476

Query  344   KQSQSQH  324
              ++ ++ 
Sbjct  477   DKNNTKQ  483



>ref|XP_010919295.1| PREDICTED: LOW QUALITY PROTEIN: aluminum-activated malate transporter 
10-like [Elaeis guineensis]
Length=493

 Score =   452 bits (1163),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 257/490 (52%), Positives = 335/490 (68%), Gaps = 24/490 (5%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVL----RIWSFIDKAWQLGKKEPRKVIHGVK  1602
             RV +P G+S  +  ES   G+ +    G VL    +++ F   AW++G  +PRKVIHG+K
Sbjct  16    RVTVPSGSSVKMEWESSVIGRAWTWFAGAVLMVKSKVFGFGKNAWKMGVDDPRKVIHGIK  75

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG+ALSLVS+FYY RPLYD VGGNAMWAVMTV VVFEYTVG  L K  NR VAT  AG L
Sbjct  76    VGIALSLVSVFYYARPLYDGVGGNAMWAVMTVAVVFEYTVGGCLYKGFNRAVATLSAGGL  135

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +G+HW+A+++G+K++P+IL ASVFLL AAATFSRFIP++KARFDYG TIFILTFSLV+V
Sbjct  136   AMGIHWIASKTGEKVEPVILSASVFLLGAAATFSRFIPTVKARFDYGVTIFILTFSLVAV  195

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVD+LLDL QQR+STIA+G SIC+ + +L+CPVWA ++LH LIT N+EKLA+SLE C
Sbjct  196   SGYRVDELLDLLQQRVSTIAIGISICLLVCILICPVWASEELHLLITKNMEKLAESLEAC  255

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             + +Y   DG GD      + S+    GY+CVLN+KASED+ AN A WEP HGRF FRHPW
Sbjct  256   VEEYFMKDGAGDGKNSCSQKSQ----GYRCVLNSKASEDSQANLARWEPAHGRFGFRHPW  311

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
               YLK+GA+MR CAYCIE L+G INS  Q  + E   K + E C ++ S   KVL++LS 
Sbjct  312   SPYLKVGAAMRYCAYCIEALNGCINSEIQ--APESTKKHLXEVCMKLSSESSKVLKELSS  369

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
              +KS  +S   D+LV +M++AVE L  A +        S   Q+ +A    +    +E K
Sbjct  370   SIKSMKRSQSIDLLVEEMSTAVEELHNALR--------SFPNQLTQAAVQPAVEANEEKK  421

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAK  342
              ++S       + +ME+  L TVASLL+EI+AR +GV+  V  LA+LA F    ++   K
Sbjct  422   HSISVTTT---LPVMEVLPLITVASLLIEISARIDGVLDAVRNLADLAGFESVENE---K  475

Query  341   QSQSQHKEQN  312
                  H+EQ 
Sbjct  476   PPSPTHQEQE  485



>ref|XP_011022437.1| PREDICTED: aluminum-activated malate transporter 10-like [Populus 
euphratica]
Length=498

 Score =   450 bits (1158),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 252/484 (52%), Positives = 343/484 (71%), Gaps = 26/484 (5%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             R+ M DG+S+ LV E+    +++     ++ G VL++W F++KAW +G  +PRKVIH +K
Sbjct  14    RITMGDGSSKSLVPETGPISRIWMGLKGLMAGLVLKVWKFLNKAWDIGVDDPRKVIHCLK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
              G+AL++VSL Y+ RPLY+ VGGNAMWAVMTVVVVFE  VGAT+SK +NR + T LAG L
Sbjct  74    AGMALTVVSLVYFTRPLYEGVGGNAMWAVMTVVVVFENNVGATISKSLNRVIGTTLAGFL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
               GVHWVA+QSGQK +P+I+ ASVFLLA+AATFSRFIPS+KARFDYG  IFILTFSLV+V
Sbjct  134   AFGVHWVASQSGQKFEPLIIGASVFLLASAATFSRFIPSVKARFDYGALIFILTFSLVAV  193

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVDKL  LA QR+STI +GTS+CI + M +CP+WAG +LH LI  N++KLA SL+GC
Sbjct  194   SGYRVDKLFALAHQRISTIIIGTSLCILVTMFICPIWAGQELHALICRNMDKLAGSLDGC  253

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             + +Y        + KD+DK  +KKLLGYKCVLN+K  E++MANFA  EP HGRF+F+HPW
Sbjct  254   VEEYF---DHNGELKDSDKHPDKKLLGYKCVLNSKTPEESMANFARLEPAHGRFSFKHPW  310

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             +QYLKIGASMR+CAY IE L+  I+S  Q  + E+I K +S  C +V ST   V+++L+K
Sbjct  311   QQYLKIGASMRSCAYSIEALNSCIDSENQ--APEFIKKHMSNVCLKVSSTSSCVIKELAK  368

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
              +K+  KSS  D LV +M SAV+ LQ   K+L      S      E   P +   ++ T 
Sbjct  369   TIKTLKKSSSIDFLVEEMRSAVQDLQNEIKSL------SNLLSPAELLLPGNKKTEKTTS  422

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAK  342
             +          ++L+E+  +  +AS L++I++R + +VK V +LA +A+F+ + D K AK
Sbjct  423   T----------IHLLEVLPVVILASFLIDISSRIQDIVKTVEELAKVAEFKAEVDDK-AK  471

Query  341   QSQS  330
             Q+Q+
Sbjct  472   QNQA  475



>gb|KDP28457.1| hypothetical protein JCGZ_14228 [Jatropha curcas]
Length=478

 Score =   449 bits (1154),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 250/472 (53%), Positives = 328/472 (69%), Gaps = 35/472 (7%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIV-----GGFVLRIWSFIDKAWQLGKKEPRKVIHGV  1605
             R+++ DGTS  LV+ES   G V   +        +L++W F++KAW +G  +PRKVIHGV
Sbjct  12    RISVDDGTSEKLVAESD--GPVVKKIWVWLKNLIILKVWKFLEKAWMMGVADPRKVIHGV  69

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVG+AL +VSL YY+RPLY+ VGGNAMWAVMTVVVVFE T GATLSK +NRT+ATFLAGS
Sbjct  70    KVGVALCVVSLLYYMRPLYEGVGGNAMWAVMTVVVVFENTAGATLSKSINRTIATFLAGS  129

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             LG+GV+W+A+Q+G KLQP+IL  SVFL A+AATFSRFIP +KARFDYG  IFILTFSLVS
Sbjct  130   LGLGVNWIASQTGAKLQPVILGFSVFLFASAATFSRFIPIVKARFDYGAMIFILTFSLVS  189

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEG  1065
             VSGYRVD+L DLAQ R STI +GTS+CI I++L+CP+WAG +LH LI  NLEKLA SL+G
Sbjct  190   VSGYRVDELFDLAQHRFSTIVVGTSLCILISILICPIWAGGELHNLIIRNLEKLAHSLDG  249

Query  1064  CISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHP  885
              +  Y           ++D+   KK  GY+CVLN+K +ED+MANFA WEP HGRFNFRHP
Sbjct  250   SMECYF--------ASNSDEDPSKKTEGYRCVLNSKGTEDSMANFARWEPAHGRFNFRHP  301

Query  884   WKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDls  705
             WKQYL +GAS+R+CAYCIETL+G IN+  Q  + EY+ K +S+ C  + S    VL++L+
Sbjct  302   WKQYLNVGASLRSCAYCIETLNGCINTEIQ--APEYLKKHLSDPCETLSSYASTVLKELA  359

Query  704   klmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQET  525
               +K+ T SS   + + +M  A + L+ + K++  P+          A  P     +   
Sbjct  360   NTVKTMTISSKIGLSITEMQFAAQELKNSVKSI--PN--------HFAANPEGGKTEPTA  409

Query  524   KSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFR  369
             K++           +M++  L T+ SLL+EI  R E +V  VN+LA LA F+
Sbjct  410   KTSPPS--------VMDVLPLVTLVSLLLEIVTRVEDIVDAVNELARLADFK  453



>ref|XP_002299439.1| hypothetical protein POPTR_0001s11180g [Populus trichocarpa]
 gb|EEE84244.1| hypothetical protein POPTR_0001s11180g [Populus trichocarpa]
Length=498

 Score =   449 bits (1155),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 248/487 (51%), Positives = 346/487 (71%), Gaps = 34/487 (7%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             R+ + DG+S+ LV ++    +++     ++ G VL++W F+ +AW +G  +PRKVIH +K
Sbjct  14    RITLGDGSSKSLVPDAGPVSRIWIGLKGLIAGLVLKVWKFLKRAWDIGVDDPRKVIHCLK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG+AL++VSLFY++RPLY  VGGNAMWA+MTVVVVFE TVGAT+ K +NR   T LAG L
Sbjct  74    VGMALTVVSLFYFMRPLYKGVGGNAMWAIMTVVVVFENTVGATICKSLNRVFGTTLAGFL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
               GVHWVA+QSGQ+ +P+I  ASVFLLA+ ATFSRFIPS+KARFDYG  IFILTFSLV+V
Sbjct  134   AFGVHWVASQSGQEFEPLITGASVFLLASTATFSRFIPSVKARFDYGAMIFILTFSLVTV  193

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVDKL D+A QR+STI +GTS+CIF+ M +CP+WAG++LH LI+ N++KLA+SL+GC
Sbjct  194   SGYRVDKLFDMAHQRISTIIIGTSLCIFVTMFICPIWAGEELHILISRNMDKLANSLDGC  253

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             + ++        + KD+DK  +KKLLGYKCVL++KA+E++MA FA WEP HGRFNF+HPW
Sbjct  254   VDEHF---NYNGELKDSDKQPDKKLLGYKCVLSSKATEESMATFARWEPAHGRFNFKHPW  310

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             +QYLKIGASMR+CAYC+E L+  I+S  Q  ++E+  K +S  C +V S    V+++++K
Sbjct  311   QQYLKIGASMRSCAYCVEALNRCIDSENQ--ASEFTKKHLSNICLKVSSNSSSVMKEVAK  368

Query  701   lmksttksSIQDILVHDMNSAVEALQ--LAF--KTLIPPSSQSLTTQVEEAQKPSSDHLK  534
              +K+  +S   D LV +M S V+ LQ  L F  K L PP          E   P S   +
Sbjct  369   TIKTMKRSPSIDFLVEEMRSTVQDLQNELNFLPKLLSPP----------EVLHPESKETE  418

Query  533   QETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDK  354
             + T +           +L+E+  + T ASL++EI++R + +V+ V +LA LA+F+G+   
Sbjct  419   ETTSTT----------HLLEVIPVVTFASLMIEISSRIQAIVETVEELAELAEFKGEVQD  468

Query  353   KMAKQSQ  333
             K  KQ+Q
Sbjct  469   K-DKQNQ  474



>ref|XP_010422744.1| PREDICTED: aluminum-activated malate transporter 10-like [Camelina 
sativa]
Length=483

 Score =   446 bits (1147),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 256/487 (53%), Positives = 332/487 (68%), Gaps = 26/487 (5%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVL-----RIWSFIDKAWQLGKKEPRKVIHGV  1605
             R+++ +GT+  LV +S    +++  +   V+     RI +F+ KAW++G  +P KV+H +
Sbjct  12    RISVDNGTTERLVPKSVLSVRIFHWLKDLVMMVIVERIANFMRKAWRIGADDPAKVVHCL  71

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVGLALSLVS+FYY+RPLYD VGGNAMWA+MTVVVVFE  VGAT SKCVNR VAT LAGS
Sbjct  72    KVGLALSLVSIFYYMRPLYDGVGGNAMWAIMTVVVVFESNVGATFSKCVNRVVATILAGS  131

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             LGI VHWVA QSG K +  ++  SVFL A  AT+SRF+PS KARFDYG  IFILTFSLVS
Sbjct  132   LGIAVHWVATQSG-KAEVFVIGCSVFLFAFTATYSRFVPSFKARFDYGAMIFILTFSLVS  190

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEG  1065
             V GYRVDKL+D+AQQR+STIA+GTSICI I + LCP+WAG  LHRLI  N EKLADSL+ 
Sbjct  191   VGGYRVDKLVDMAQQRVSTIAIGTSICIIITVFLCPIWAGSQLHRLIERNFEKLADSLDA  250

Query  1064  CISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHP  885
             C+++Y   + +   +++ D  +  KL G+KCVLN+K +E+AMAN A WEP HG FNFRHP
Sbjct  251   CVAEYF-KETEVSTNRNEDGDTNMKLQGFKCVLNSKGAEEAMANLARWEPAHGSFNFRHP  309

Query  884   WKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDls  705
             WK Y+KIGA+MR CAYC+E L   IN   +  + + + K   E C ++ S   K+LR+L 
Sbjct  310   WKLYVKIGAAMRRCAYCLENLSICINYETE--APDQVKKHFGEACMKLSSASSKILRELM  367

Query  704   klmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQET  525
             ++MK+T KSS  D LV DMNSAV+ LQ   KT +P           E  KP     K E 
Sbjct  368   EMMKNTRKSSKMDFLVFDMNSAVQELQETLKT-VPV----------EKNKP-----KDEV  411

Query  524   KSALSDDDDHDL-VYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKM  348
              S   +++D  + + L EI  ++T+ SLL+E AAR +  V+ V++LANLA F     KK 
Sbjct  412   PSEEDNNEDRAIPMSLHEILPVATLVSLLIENAARIQTTVEAVDELANLADFEQDFKKKT  471

Query  347   AKQSQSQ  327
                +  Q
Sbjct  472   GDNNTKQ  478



>ref|XP_010428025.1| PREDICTED: aluminum-activated malate transporter 10-like [Camelina 
sativa]
Length=484

 Score =   446 bits (1147),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 257/487 (53%), Positives = 330/487 (68%), Gaps = 26/487 (5%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVL-----RIWSFIDKAWQLGKKEPRKVIHGV  1605
             R+++ DGT+  LV  S    K++  +   V+     RI +F+ KAW++G  +P KV+H +
Sbjct  12    RISVDDGTTERLVPRSGLSVKIFHWLKDLVMKVIVERIANFMRKAWRIGADDPAKVVHCL  71

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVGLALSLVS+FYY+RPLYD VGGNAMWA+MTVVVVFE  VGAT SKCVNR VAT LAGS
Sbjct  72    KVGLALSLVSIFYYMRPLYDGVGGNAMWAIMTVVVVFEANVGATFSKCVNRVVATILAGS  131

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             LGI VHWVA QSG K +  ++  SVFL A  AT+SRF+PS KARFDYG  IFILTFSLVS
Sbjct  132   LGIAVHWVATQSG-KAEVFVIGCSVFLFAFLATYSRFVPSFKARFDYGAMIFILTFSLVS  190

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEG  1065
             V GYRVDKL+D+AQQR+STIA+GTSICI I +  CP+WAG  LHRLI  N EKLADSL+ 
Sbjct  191   VGGYRVDKLVDMAQQRVSTIAIGTSICIIITVFFCPIWAGSQLHRLIERNFEKLADSLDA  250

Query  1064  CISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHP  885
             C+++Y   + +   +++ D  +  KL G+KCVLN+K +E+AMAN A WEP HG FNFRHP
Sbjct  251   CVAEYF-KESEVSTNRNKDGDTNMKLQGFKCVLNSKGTEEAMANLARWEPAHGSFNFRHP  309

Query  884   WKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDls  705
             WK Y+KIGA+MR CAYC+E L   IN   +  + + + K   E C ++ S   K+LR+L 
Sbjct  310   WKLYVKIGAAMRRCAYCLENLSICINYETE--APDQVKKHFGEACMKLSSASSKILRELM  367

Query  704   klmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQET  525
             ++MK+T KSS  D LV DMNSAV+ LQ   KT +P           E  KP     K E 
Sbjct  368   EMMKNTRKSSKMDFLVFDMNSAVQELQETLKT-VPI----------ETNKP-----KDEA  411

Query  524   KSALSDDDDHDL-VYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKM  348
              S   +++D  + + L EI  ++T+ SLL+E AAR +  V+ V++LANLA F     KK 
Sbjct  412   PSEEDNNEDRAISMSLHEILPVATLVSLLIENAARIQTTVEAVDELANLADFEQDFKKKT  471

Query  347   AKQSQSQ  327
                +  Q
Sbjct  472   GGNNTKQ  478



>ref|XP_002303680.2| hypothetical protein POPTR_0003s14490g [Populus trichocarpa]
 gb|EEE78659.2| hypothetical protein POPTR_0003s14490g [Populus trichocarpa]
Length=510

 Score =   447 bits (1149),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 254/497 (51%), Positives = 347/497 (70%), Gaps = 38/497 (8%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             R+ + DG+S+ LV E+    +++     ++ G VL++W F++KAW +G  +PRKVIH +K
Sbjct  14    RITLGDGSSKSLVPETGPISRIWMGLKGLMAGLVLKVWKFLNKAWDIGVDDPRKVIHCLK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
              G+AL++VSL Y+ RPLY+ VGGNAMWAVMTVVVVFE TVGAT+SK +NR + T LAG L
Sbjct  74    AGMALTIVSLVYFTRPLYEGVGGNAMWAVMTVVVVFENTVGATISKSLNRVIGTTLAGFL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
               GVHWVA+QSGQK +P+I+ ASVFLLA AATFSRFIPS+KARFDYG  IFILTFSLV+V
Sbjct  134   AFGVHWVASQSGQKFEPLIIGASVFLLATAATFSRFIPSVKARFDYGALIFILTFSLVAV  193

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLE--  1068
             SGYRVDKL  LA QR+STI +GT +CI + M +CP+WAG +LH LI  N++KLA SL+  
Sbjct  194   SGYRVDKLFALAHQRISTIIIGTCLCILVTMFICPIWAGQELHALICRNMDKLAGSLDVS  253

Query  1067  ----------GCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWE  918
                       GC+ +Y        + KD+DK  +KKLLGYKCVLN+K +E++MANFA  E
Sbjct  254   QKIYQIHRISGCVEEYF---DHNGELKDSDKHPDKKLLGYKCVLNSKTTEESMANFARLE  310

Query  917   PGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVC  738
             P HGRFNF+HPW+QYLKIGASMR+CAY IE L+  I+S  Q  + E+I K +S  C +V 
Sbjct  311   PAHGRFNFKHPWQQYLKIGASMRSCAYSIEALNSCIDSENQ--APEFIKKHMSNVCLKVS  368

Query  737   STCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQ  558
             S    V+++L+K +K+  KSS  D LV +M+SAV+ LQ   K+L      S      E  
Sbjct  369   SNSSCVIKELAKTIKTLKKSSSIDFLVEEMSSAVQDLQNEIKSL------SNLLSPAELL  422

Query  557   KPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLA  378
              P S   ++ T +          ++L+E+  + ++ASLL++I++R + +VK V +LAN+A
Sbjct  423   LPGSKETEKTTST----------IHLLEVLPVVSLASLLIDISSRIQDIVKTVEELANVA  472

Query  377   QFRGQSDKKMAKQSQSQ  327
             +F+ ++D K AKQ+Q+ 
Sbjct  473   EFKAEADDK-AKQNQAN  488



>ref|XP_007039437.1| Aluminum activated malate transporter family protein, putative 
[Theobroma cacao]
 gb|EOY23938.1| Aluminum activated malate transporter family protein, putative 
[Theobroma cacao]
Length=505

 Score =   446 bits (1147),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 250/496 (50%), Positives = 342/496 (69%), Gaps = 35/496 (7%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSES--RRRG--KVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             R+ + DG+S VLV E+   R+   ++  ++ G   ++W F+ +AW +G  +P+K+IH +K
Sbjct  14    RIRVADGSSEVLVQETGLARKAWLRIKGLISGLAFKVWMFLKRAWDMGVNDPKKLIHCIK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VGLAL++VSLFY++RPLYD VGGNAMWAVMTVVVVFE TVGATL KC+NR   T LAG L
Sbjct  74    VGLALAIVSLFYFMRPLYDGVGGNAMWAVMTVVVVFEQTVGATLYKCLNRVCGTCLAGFL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +G+HWVAN+SG+  +P ++ ASVFLLA+ ATFSR IPS K+ FDYG  IFILTFS V+V
Sbjct  134   AVGLHWVANRSGESFEPFVVGASVFLLASVATFSRLIPSAKSLFDYGAMIFILTFSFVAV  193

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLE--  1068
             SGYRVDKL D A QR+STI +GTS+CI + M++CP+W+G +LH LI  N++KLADSL+  
Sbjct  194   SGYRVDKLFDKAHQRISTIIIGTSLCIIVIMIVCPIWSGQELHSLIVRNMDKLADSLDEP  253

Query  1067  -------GCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGH  909
                    GC++ Y           ++++ ++KKL GYKCVL++KASE++MANFA WEP H
Sbjct  254   ILPIMVSGCVTQYF---NHRGVCTNSNEEADKKLQGYKCVLSSKASEESMANFARWEPSH  310

Query  908   GRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTC  729
             GRFNFRHPWKQYLKIGASMR+CAY IE L   INS  Q  +AE+I K +S  C +V S+ 
Sbjct  311   GRFNFRHPWKQYLKIGASMRSCAYRIEALSSCINSEKQ--AAEFIKKHLSISCLKVSSSS  368

Query  728   GKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPS  549
                +R+L++ +K+  KSS  D+LV +MN+AV+ LQ   K        SL+  +  +  P 
Sbjct  369   SSTIRELAETVKTMKKSSTIDLLVGEMNTAVQELQNDLK--------SLSYLLNPSTIPE  420

Query  548   SDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFR  369
             +  +K   ++  +       V LMEI  + T+AS+L+EIA R E +V  V +LA LA F 
Sbjct  421   NKKMKTSMEATAT-------VPLMEIIPVVTLASILIEIAVRIEALVGAVKELAKLADFA  473

Query  368   GQSDKKMAKQSQSQHK  321
                DK  +KQ++++ K
Sbjct  474   THDDK--SKQTKTKDK  487



>ref|XP_009359572.1| PREDICTED: aluminum-activated malate transporter 10-like [Pyrus 
x bretschneideri]
Length=486

 Score =   445 bits (1144),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 245/459 (53%), Positives = 331/459 (72%), Gaps = 17/459 (4%)
 Frame = -3

Query  1697  IVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWA  1518
             +V G V+++W+F+ KAW +G  EPRKVIH +KVG+AL++VSLFY +RPLY+D GGNA+WA
Sbjct  34    LVVGLVMKVWNFLKKAWDMGHNEPRKVIHCLKVGVALTVVSLFYAMRPLYEDAGGNAIWA  93

Query  1517  vmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLA  1338
             VMTVVVVFE TVGATLSK +NR   TFLAG L IG+H +A +SG+ ++  I   S+FLLA
Sbjct  94    VMTVVVVFENTVGATLSKSINRIFGTFLAGFLAIGIHCIARKSGKDVEHFITGFSIFLLA  153

Query  1337  AAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIF  1158
             +AATFSRFI S+KARFDYG  IFILTFSL+SVSGYRVD+L DLA+ R+STI +GTS+CI 
Sbjct  154   SAATFSRFIASVKARFDYGAMIFILTFSLISVSGYRVDQLFDLAKHRMSTIIIGTSLCIV  213

Query  1157  IAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGY  978
             I M++CP+WAG++L+ LIT N++ LA+SL+GC++DY     +       DK S+ KLLGY
Sbjct  214   ITMIICPIWAGEELYMLITRNMDTLANSLDGCVADYF----NNSGGFAGDKESDNKLLGY  269

Query  977   KCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSA  798
             KCVL +KA+E++MANFA+WEP HGRFNFRHPW QYLKIGA MR CAYCIE L+G ++S  
Sbjct  270   KCVLGSKATEESMANFAIWEPAHGRFNFRHPWNQYLKIGALMRDCAYCIEALNGCVSSKN  329

Query  797   QVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLA  618
             +V  +E     +S    +V S    V+++L++ MK+  KSS  D+LV +MN++V  LQ  
Sbjct  330   EV--SELTKTHISNTAIKVSSDSSMVIKELARTMKTMKKSSAIDLLVGEMNNSVLKLQED  387

Query  617   FKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLV  438
              K+L P    +    ++E + P +++  +   +A         V LM+I  L T+ SLLV
Sbjct  388   LKSL-PKLFINPQPPLQEPESPGNNNKTKAEAAA---------VALMDIIPLVTLTSLLV  437

Query  437   EIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHK  321
             EI AR EG+V  V +LA LA+F+   D+K A Q+Q+ +K
Sbjct  438   EIVARIEGMVSAVQELAKLAEFKAVGDRK-ANQNQTTNK  475



>emb|CDX91864.1| BnaC03g31660D [Brassica napus]
Length=505

 Score =   446 bits (1146),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 251/491 (51%), Positives = 333/491 (68%), Gaps = 29/491 (6%)
 Frame = -3

Query  1766  VNMPDGTSRVLVSESRRRGKVYDIVGGFVL-----RIWSFIDKAWQLGKKEPRKVIHGVK  1602
             +++ +GT+  LV +S    +++  + G V+     RI  F+ K W++G  +P KV+H +K
Sbjct  14    ISVDNGTTERLVPKSGLSERIFLWLNGLVMKVIVERIAKFMKKTWRIGADDPAKVVHCLK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VGLALSLVS+FYY+RPLYD VGGNAMWA+MTVVVVFE  VGAT SKCVNR VAT LAGSL
Sbjct  74    VGLALSLVSIFYYMRPLYDGVGGNAMWAIMTVVVVFESNVGATFSKCVNRVVATILAGSL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
             GI VHWVA QSG K +  ++  SVFL A AAT+SRF+PS KARFDYG  IFILTFSLVSV
Sbjct  134   GIFVHWVAIQSG-KAEIFVIGCSVFLFAFAATYSRFVPSFKARFDYGAIIFILTFSLVSV  192

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
              GYRVDKL+D+AQQR+STIA+GTSICI I +  CP+WAG  LHRL+  N  KLADSL+GC
Sbjct  193   GGYRVDKLVDMAQQRISTIAIGTSICIIITVFFCPIWAGSQLHRLVQRNFSKLADSLDGC  252

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             + +Y       D  ++ D+ +  KL G+KCVLN+K +E++MAN A WEP HG FNFRHPW
Sbjct  253   VEEYF---KKKDVSENEDEETNMKLQGFKCVLNSKGTEESMANLARWEPAHGSFNFRHPW  309

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             +QY+KIGA+MR CAYC+E L   +N   +V   + + K   E C ++ S   K+LR+L+ 
Sbjct  310   QQYVKIGAAMRRCAYCLENLSSCMNYETEV--PDQVKKHFGEACVKLSSASSKILRELAD  367

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
             +M +T  SS  D LV DMNSAV+ LQ   KT+       + T   E + P++   K++  
Sbjct  368   MMNNTRISSKMDFLVFDMNSAVQELQETLKTV------PVKTNKPEQEVPNN---KEDRT  418

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAK  342
              ++S         L E+  ++T+ SLL+E AAR +  V  V++LANLA F+  S KKM  
Sbjct  419   MSMS---------LHEVLPVATLVSLLIENAARIQTTVDAVDELANLADFKQDSKKKMGD  469

Query  341   QSQSQHKEQNV  309
              +  Q  +++V
Sbjct  470   NNARQPPQKSV  480



>ref|XP_002518887.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43420.1| conserved hypothetical protein [Ricinus communis]
Length=488

 Score =   445 bits (1144),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 247/479 (52%), Positives = 337/479 (70%), Gaps = 26/479 (5%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLA  1590
             R+N+ DG+S++LV E     + +  +   +L++WSF  KA  +G  +PRKV+H +KVG A
Sbjct  14    RINIADGSSKILVQEEGLVTRAWLGLKYLILKVWSFFKKARDVGVNDPRKVVHCLKVGTA  73

Query  1589  LSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGV  1410
             L++VS+FY++RPLY+ VGGNAMWA+MTVVVVFE TVGAT+ K +NR   T LAG L   V
Sbjct  74    LAVVSIFYFMRPLYEGVGGNAMWAIMTVVVVFENTVGATICKSLNRVCGTTLAGMLAFSV  133

Query  1409  HWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYR  1230
             HWVA +SG++ +P I+ ASVF+LA+AATFSRFIPS+K RFDYG  IFILTFSLV+VSGYR
Sbjct  134   HWVATKSGERFEPFIIGASVFILASAATFSRFIPSVKQRFDYGVVIFILTFSLVAVSGYR  193

Query  1229  VDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDY  1050
             VDKL  LA +RL+TI +G S+CIF++M++CP+WAG +L+ LIT N++KLA+SL+GC+ +Y
Sbjct  194   VDKLFALAHERLATIIIGISLCIFVSMIICPIWAGRELYTLITTNMDKLANSLDGCVDEY  253

Query  1049  LnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYL  870
                     +  ++DK S+KK LGYKCVL++KASE+++ANFA WEP HG F F+HPWKQY 
Sbjct  254   F-------NQNESDKTSDKKSLGYKCVLSSKASEESLANFARWEPAHGSFGFKHPWKQYP  306

Query  869   KIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmks  690
             KIGASMR CAYCIE L     S  Q  + E++ K +S  C RV S    V+R+LS+ +K+
Sbjct  307   KIGASMRNCAYCIEALTSCTGSENQ--APEFLQKQLSNVCLRVSSISSNVIRELSETVKT  364

Query  689   ttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALS  510
               +SS+ D LV DM SAVE LQ   ++L    S S    +E            +T SA +
Sbjct  365   MKRSSVIDSLVEDMGSAVEELQDTVRSL----SNSFNPPIENT----------DTNSAPT  410

Query  509   DDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQ  333
             + D    + L+++  L T ASLL+EIA R +GVVK V +LA+LA+F+   + K  K++Q
Sbjct  411   ETDMA--IPLVQVIPLVTFASLLIEIATRIKGVVKAVKELADLAEFKVDVEDK-CKENQ  466



>ref|XP_004140623.1| PREDICTED: aluminum-activated malate transporter 10-like [Cucumis 
sativus]
Length=482

 Score =   444 bits (1142),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 249/495 (50%), Positives = 334/495 (67%), Gaps = 38/495 (8%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYD-----IVGGFVLRIWSFIDKAWQLGKKEPRKVIHGV  1605
             RVNM DGT+ +L  E+     +       I GG +L+ W F++KAW +   EP+K +HG+
Sbjct  10    RVNMGDGTTEILRPEASFMKNIMMRIKNFIWGGLLLKAWKFLEKAWGIANSEPKKAVHGL  69

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVGLAL++VS+FYY+RPLY+ VGGNAMWA+MTVVV FE TVGAT  KCVNR + T LAG 
Sbjct  70    KVGLALTIVSIFYYMRPLYEGVGGNAMWAIMTVVVTFESTVGATFYKCVNRVIGTSLAGC  129

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             LGIGVHW+A +SG K +PIIL  S+FLLA+  TFSRFIPS+K+RFDYG  IF+LTF LVS
Sbjct  130   LGIGVHWIAAESGDKFEPIILGISLFLLASVTTFSRFIPSVKSRFDYGAMIFVLTFCLVS  189

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEG  1065
             +SGYRV+KL +LA+ R+STIA+GTS+CIF++ML CP+WAG  L  L   NL+KLA SL+ 
Sbjct  190   ISGYRVEKLFELARTRISTIAIGTSLCIFVSMLFCPIWAGSQLQSLTARNLDKLAHSLD-  248

Query  1064  CISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHP  885
                           + +++K +  K+ GYKCVLN+KASE++MANFA WEP HGRF FRHP
Sbjct  249   -----------EMKNNEDEKNNNSKVEGYKCVLNSKASEESMANFARWEPAHGRFGFRHP  297

Query  884   WKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDls  705
             WK+YL++G  MR  AYCIE LHG +NS  Q  ++  +   ++E C+ + S+  +VL++LS
Sbjct  298   WKKYLEVGGVMRKSAYCIEALHGCLNSEIQAPNSLKL--HLAEPCKALSSSSSEVLKELS  355

Query  704   klmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQ---SLTTQVEEAQKPSSDHLK  534
              ++K   KS+  D LV +MN AV+ LQ A K+   PS+Q   SL+ Q EEA   + DH  
Sbjct  356   IVIKKMKKSTKIDFLVSNMNVAVQELQNAIKSF--PSTQMEVSLSEQEEEAN--NEDHKA  411

Query  533   QETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDK  354
               T           +  LM++  L+T+ SLL+E  +R E VV  V  LAN+A +  + +K
Sbjct  412   ATT----------TIPPLMKLLPLATLVSLLIETTSRIEHVVNAVETLANVANYDSEDEK  461

Query  353   KMAKQSQSQHKEQNV  309
             K  K S S + + NV
Sbjct  462   K--KPSSSDNHDHNV  474



>ref|XP_002872918.1| hypothetical protein ARALYDRAFT_352740 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49177.1| hypothetical protein ARALYDRAFT_352740 [Arabidopsis lyrata subsp. 
lyrata]
Length=499

 Score =   444 bits (1142),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 255/499 (51%), Positives = 339/499 (68%), Gaps = 34/499 (7%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVL-RIWSFIDKAWQLGKKEPRKVIHGV  1605
             R+++ +GT+  LV  +    +++    D+V   ++ R+  F+ KAW++G  +P KV+H +
Sbjct  12    RISVDNGTTERLVPRAGLSKRIFLWLKDLVMKVIVERMAEFMMKAWRIGADDPAKVVHCL  71

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVGLALSLVS+FYY+RPLYD VGGNAMWA+MTVVVVFE  VGAT  KCVNR VAT LAGS
Sbjct  72    KVGLALSLVSIFYYMRPLYDGVGGNAMWAIMTVVVVFESNVGATFCKCVNRVVATILAGS  131

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             LGI VHWVA QSG K +  ++  SVFL A AAT+SRF+PS KARFDYG  IFILTFSLVS
Sbjct  132   LGIAVHWVATQSG-KAEVFVIGCSVFLFAFAATYSRFVPSFKARFDYGAMIFILTFSLVS  190

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEG  1065
             V GYRVDKL++LAQQR+STIA+GTSICI I +  CP+WAG  LHRLI  NLEKLADSL+G
Sbjct  191   VGGYRVDKLVELAQQRVSTIAIGTSICIIITVFFCPIWAGSQLHRLIERNLEKLADSLDG  250

Query  1064  CISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAM-------------ANFAV  924
             C+++Y   +    +  +++  S  KL G+KCVLN+K +E+AM             AN A 
Sbjct  251   CVAEYFKENEVSTNRNEDEDTS-MKLQGFKCVLNSKGTEEAMPLIHFAGFSLISQANLAR  309

Query  923   WEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRR  744
             WEP HG FNFRHPWK Y+KIGA+MR CAYC+E L  SI  S +  + + + K   E C +
Sbjct  310   WEPAHGSFNFRHPWKLYVKIGAAMRRCAYCLENL--SICVSYETETPDQVKKHFGEACMK  367

Query  743   VCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEE  564
             + S   K+LR+L ++MK+T KSS  D LV DMNSAV+ LQ   KT +P         +E 
Sbjct  368   LSSASSKILRELMEMMKNTRKSSKMDFLVFDMNSAVQELQETLKT-VP---------IET  417

Query  563   AQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLAN  384
              +KP  + +  E ++ + +++ + L+ L E+  ++T+ SLL+E AAR +  V+ V++LAN
Sbjct  418   KKKP--EEVPSEEENKVDNEERNTLMSLHEVLPVATLVSLLIENAARIQTAVEAVDELAN  475

Query  383   LAQFRGQSDKKMAKQSQSQ  327
             LA F   S KK    +  Q
Sbjct  476   LADFEQDSKKKTGDNNTKQ  494



>ref|XP_010456184.1| PREDICTED: aluminum-activated malate transporter 10 [Camelina 
sativa]
Length=483

 Score =   444 bits (1141),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 255/487 (52%), Positives = 331/487 (68%), Gaps = 26/487 (5%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVL-----RIWSFIDKAWQLGKKEPRKVIHGV  1605
             R+++ +GT+  LV  S    +++  +   V+     RI +F+ KAW++G  +P KV+H +
Sbjct  12    RISVHNGTTERLVPRSGLSVRIFHWLKDLVMKVIVERIANFMRKAWRIGADDPAKVVHCL  71

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVGLALSLVS+FYY+RPLYD VGGNAMWA+MTVVVVFE  VGAT SKCVNR VAT LAGS
Sbjct  72    KVGLALSLVSIFYYMRPLYDGVGGNAMWAIMTVVVVFEANVGATFSKCVNRVVATILAGS  131

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             LGI VHWVA QSG K +  ++  SVFL A  AT+SRF+PS KARFDYG  IFILTFSLVS
Sbjct  132   LGIAVHWVATQSG-KAEVFVIGCSVFLFAFTATYSRFVPSFKARFDYGAMIFILTFSLVS  190

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEG  1065
             V GYRVDKL+D+AQQR+STIA+GTSICI I +  CP+WAG  LHRLI  N EKLADSL+ 
Sbjct  191   VGGYRVDKLVDMAQQRVSTIAIGTSICIIITVFFCPIWAGSQLHRLIERNFEKLADSLDA  250

Query  1064  CISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHP  885
             C+++Y   + +   +++ D  +  KL G+KCVLN+K +E+AMAN A WEP HG FNFRHP
Sbjct  251   CVAEYF-KENEVSTNRNVDGDTNMKLQGFKCVLNSKGTEEAMANLARWEPAHGSFNFRHP  309

Query  884   WKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDls  705
             WK Y+KIGA+MR CAYC+E L   IN  ++  + + + K   E C ++ S   K+LR+L 
Sbjct  310   WKLYVKIGAAMRRCAYCLENLSICINYESE--APDQVKKHFGEACMKLSSASSKILRELR  367

Query  704   klmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQET  525
             ++MK+T KSS  D LV DMNSAV+ LQ   KT +P           E  KP     K E 
Sbjct  368   EMMKNTRKSSKMDFLVFDMNSAVQELQETLKT-VPI----------ETNKP-----KDEV  411

Query  524   KSALSDDDDHDL-VYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKM  348
              S   +++D  + + L EI  ++T+ SLL+E AAR +  V+ V++LANLA F     KK 
Sbjct  412   PSEEDNNEDKVISMSLHEILPVATLVSLLIENAARIQTTVEAVDELANLADFEQDFKKKT  471

Query  347   AKQSQSQ  327
                +  Q
Sbjct  472   GDNNTKQ  478



>ref|XP_011026815.1| PREDICTED: aluminum-activated malate transporter 10-like [Populus 
euphratica]
Length=499

 Score =   444 bits (1141),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 250/487 (51%), Positives = 345/487 (71%), Gaps = 33/487 (7%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             R+ + DG+S+ LV ++    +++     ++ G VL++W F+ +A  +G  +PRKVIH +K
Sbjct  14    RITLGDGSSKSLVPDAGPVSRIWIGLKGLIAGLVLKVWKFLKRAGDIGVDDPRKVIHCLK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG+AL++VSLFYY+RPLY  VGGNAMWA+MTVVVVFE TVGAT+ K +NR   T LAG L
Sbjct  74    VGMALTVVSLFYYMRPLYKGVGGNAMWAIMTVVVVFENTVGATICKSLNRVFGTTLAGFL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
               GVHWVA+QSGQ+ +P+I  ASVFLLA+ ATFSRFIPS+KARFDYG  IFILTFSLV+V
Sbjct  134   AFGVHWVASQSGQEFEPLITGASVFLLASTATFSRFIPSVKARFDYGAMIFILTFSLVTV  193

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVDKL D+A QR+STI +GTS+CI + M +CP+WAG +LH LI+NN++KLA+SL GC
Sbjct  194   SGYRVDKLFDMAHQRISTIIIGTSLCILVTMFICPIWAGGELHILISNNMDKLANSLVGC  253

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             + ++        + KD+DK  +KKLLGYKCVL++KA+E+++A FA WEP HGRFNF+HPW
Sbjct  254   VDEHF---NYNGELKDSDKQPDKKLLGYKCVLSSKATEESIAKFARWEPAHGRFNFKHPW  310

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             +QYLKIGASMR+CAYC+E L+  I+S  Q  + E+  K +S  C +V S    V+++++K
Sbjct  311   QQYLKIGASMRSCAYCVEALNRCIDSENQ--APEFTKKHLSNICLKVSSNSSSVIKEVAK  368

Query  701   lmksttksSIQDILVHDMNSAVEALQ--LAF--KTLIPPSSQSLTTQVEEAQKPSSDHLK  534
              +K+  +S   D LV +M SAV+ LQ  L F  K L PP          E   P S   +
Sbjct  369   TIKTMKRSPSIDSLVEEMRSAVQDLQNELNFLPKVLSPP----------EVLHPESKETE  418

Query  533   QETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDK  354
             + T S           +L+E+  + T ASL++EI++R + +V+ V +LA LA+F+G+  +
Sbjct  419   ETTSST---------THLLEVIPVVTFASLMIEISSRIQAIVETVEELAELAEFKGEVQE  469

Query  353   KMAKQSQ  333
             K AKQ+Q
Sbjct  470   K-AKQNQ  475



>ref|XP_006290127.1| hypothetical protein CARUB_v10003790mg [Capsella rubella]
 gb|EOA23025.1| hypothetical protein CARUB_v10003790mg [Capsella rubella]
Length=485

 Score =   442 bits (1138),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 252/486 (52%), Positives = 332/486 (68%), Gaps = 22/486 (5%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVL-RIWSFIDKAWQLGKKEPRKVIHGV  1605
             R+++ +GT+  LV  +    +++    D+V   ++ RI SF+ KAW++G  +P KV+H +
Sbjct  12    RISVDNGTTERLVPRAGLSERIFLWLKDLVMKVIVERITSFMRKAWRIGADDPAKVVHCL  71

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVGLALSLVS+FYY+RPLYD VGGNAMWA+MTVVVVFE TVGAT SKCVNR VAT LAGS
Sbjct  72    KVGLALSLVSIFYYMRPLYDGVGGNAMWAIMTVVVVFESTVGATFSKCVNRVVATILAGS  131

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             LGI VHWVA Q+G+  +  ++  SVF+ A  AT+SRF+PS K+RFDYG  IFILTFSLVS
Sbjct  132   LGIAVHWVATQAGEA-EVFVIGCSVFIFAFTATYSRFVPSFKSRFDYGAMIFILTFSLVS  190

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEG  1065
             V GYRVDKL+D+AQQR+STIA+GTSICI I +  CP+WAG  LHRLI  NL KLADSL+G
Sbjct  191   VGGYRVDKLVDMAQQRVSTIAIGTSICIIITVFFCPIWAGSQLHRLIERNLGKLADSLDG  250

Query  1064  CISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHP  885
             C+  Y   + +   +++ D+ +  KL G+KCVLN+K +E+AMAN A WEP HG FNFRHP
Sbjct  251   CVEQYF-KENEVSTNRNEDEDTNLKLQGFKCVLNSKGTEEAMANLARWEPAHGSFNFRHP  309

Query  884   WKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDls  705
             WK Y+KIGA+MR CAYC+E L   IN   +  + + + K   + C ++ S   K+LR+L 
Sbjct  310   WKLYVKIGAAMRRCAYCLENLSICINYETE--ATDQVKKHFGDACMKLSSASSKILRELM  367

Query  704   klmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQET  525
             +++K+T KSS  D LV DMNSAV+ LQ   KT +P           E  KP     ++E 
Sbjct  368   EMIKNTRKSSKMDFLVFDMNSAVQELQETLKT-VPI----------ETNKPEEVPSEEEN  416

Query  524   KSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMA  345
             K    ++D    + L E+  ++T+ SLL+E AAR +  V+ VN+LANLA F   S KK  
Sbjct  417   KG--ENEDKTMSMSLHEVLPVATLVSLLIENAARIQTTVEAVNELANLADFEQDSKKKTR  474

Query  344   KQSQSQ  327
                  Q
Sbjct  475   DNKTKQ  480



>gb|EYU38875.1| hypothetical protein MIMGU_mgv1a024507mg [Erythranthe guttata]
Length=451

 Score =   441 bits (1134),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 246/476 (52%), Positives = 326/476 (68%), Gaps = 54/476 (11%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLA  1590
             R+N PDGTS++L               G   +I+ F  +AW+LG  +P+K  H  KVG+A
Sbjct  16    RINFPDGTSKIL---------------GLFSKIYGFFREAWRLGMDDPKKFFHCFKVGIA  60

Query  1589  LSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGV  1410
             LSLVSLFYY+RPLY  VGGNAMWAV+TVVVVFEYTVGATL KC+N+  ATFLAG+LGIGV
Sbjct  61    LSLVSLFYYMRPLYQGVGGNAMWAVLTVVVVFEYTVGATLCKCLNKATATFLAGALGIGV  120

Query  1409  HWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYR  1230
             HW+ +  G+KLQPI LQ SVF+LAAAATF+RF+PS+KARFDYG  IFILTFSLVSVSG+R
Sbjct  121   HWIGSHFGEKLQPIFLQGSVFVLAAAATFTRFMPSVKARFDYGVLIFILTFSLVSVSGFR  180

Query  1229  VDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDY  1050
             V KL + A  RLSTIA+GTSICI  ++L CPVWAG++LH LI  N+EKLADSL+ C+++Y
Sbjct  181   VGKLFEFASHRLSTIAIGTSICILTSILFCPVWAGEELHNLIQTNMEKLADSLDECVAEY  240

Query  1049  LnadgdgdddkdndkASEKKLLGYKCVLNTKASED-------------AMANFAVWEPGH  909
                           +AS K  +GY+CVLN++A+E+             A ANFA WEP H
Sbjct  241   F-------RKDARSEASNKISVGYRCVLNSRATEESLVLFSFTNYASIAQANFARWEPAH  293

Query  908   GRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTC  729
             G FNF HPWK+Y K+GAS+R+CAY IE L+GSIN+  +  + +++ K  S+ C ++ S+ 
Sbjct  294   GGFNFGHPWKEYRKVGASLRSCAYHIEVLNGSINAGTK--APDFLKKHFSKFCMKLSSSS  351

Query  728   GKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIP-PSSQSLTTQVEEAQKP  552
               VL++L  +  + T+S+  DI+V +M SAVE LQ+  K+LI  P + S    +   +  
Sbjct  352   SAVLKELVFVTHTMTRSAKIDIIVEEMRSAVEELQIVLKSLITQPINASTNINIGNEESD  411

Query  551   SSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLAN  384
             +S+       +++S         L+EIA L T++SLL+EIAARTE + K VN+LAN
Sbjct  412   ASN-------TSMS---------LIEIAPLVTLSSLLIEIAARTEDIAKAVNELAN  451



>ref|XP_008806969.1| PREDICTED: aluminum-activated malate transporter 10-like [Phoenix 
dactylifera]
Length=491

 Score =   441 bits (1135),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 258/493 (52%), Positives = 337/493 (68%), Gaps = 22/493 (4%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVL----RIWSFIDKAWQLGKKEPRKVIHGVK  1602
             RV +P G+S  + SES    + +    G VL     ++ F    W++G  +PRKVIHG K
Sbjct  14    RVTVPSGSSVKMESESGVISRAWTWFAGAVLMAKSTVFGFGKSVWKMGVDDPRKVIHGFK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG+ALSLVS+FYY RPLYD VGGNAMWAVMTVVVVFEYTVG  L K  NR VAT  AG L
Sbjct  74    VGIALSLVSIFYYTRPLYDGVGGNAMWAVMTVVVVFEYTVGGCLYKGFNRAVATLSAGGL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +G+HW+A+++G++++P+IL ASVFLL AAATFSRFIP+IKARFDYG TIFILTFSLV+V
Sbjct  134   AVGIHWIASKTGERVEPVILSASVFLLGAAATFSRFIPTIKARFDYGITIFILTFSLVAV  193

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVD++LDLAQQRLSTIA+G  IC+ + +L+CPVWA ++LH LIT N+EKLA+SLE C
Sbjct  194   SGYRVDEVLDLAQQRLSTIAIGIFICLLVCILICPVWASEELHLLITRNMEKLAESLESC  253

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             I +Y   DGD D      + S+    GYKCVLN+KASED+ AN A WE  HGRF FRHPW
Sbjct  254   IKEYFMEDGDVDGTNSCSQKSQ----GYKCVLNSKASEDSQANLARWELAHGRFGFRHPW  309

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
              QYLK+GA+MR CAYC+E L+G INS  Q  + +   K + E C ++ S   KVL++LS 
Sbjct  310   SQYLKVGAAMRYCAYCMEALNGCINSEIQ--APKSTKKHLREVCMKLSSASSKVLKELSS  367

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
              +KS  +S   D  V +M++AVE L  A ++     +Q       EA +P+ +   +E K
Sbjct  368   SIKSMKRSQSIDFSVEEMSNAVEELHDALRSFPNQFTQ-------EADEPAVEA-TEEKK  419

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRG-QSDKKMA  345
              ++S       +  +E+  L TVASLL+EI+AR EGVV  V+ LA+LA F   + +K ++
Sbjct  420   HSISVTTT---LPAIELLPLITVASLLIEISARIEGVVDAVHTLADLAGFDSVEKEKPLS  476

Query  344   KQSQSQHKEQNVQ  306
                Q Q   + +Q
Sbjct  477   PTHQEQQDMKAIQ  489



>ref|XP_004298279.1| PREDICTED: aluminum-activated malate transporter 10-like [Fragaria 
vesca subsp. vesca]
Length=488

 Score =   441 bits (1135),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 254/495 (51%), Positives = 342/495 (69%), Gaps = 31/495 (6%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             R+ M DG+S  L  ++    + +     ++ G +L++  F   AW LG+ +PRKVIH +K
Sbjct  14    RIKMADGSSEALAQQTGLACRAWLALKGLIMGLILKVCDFFKNAWDLGQNDPRKVIHCLK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG+AL++VSLFYY+RPLY+ +GGNAMWAVMTVVVVFE TVGAT+ KC+NR   TF+AGSL
Sbjct  74    VGMALTVVSLFYYMRPLYEGMGGNAMWAVMTVVVVFENTVGATICKCLNRICGTFIAGSL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              IG+HW+ +QSG++ +P I   SVFLLA+A +FSRFIPS+K RFDYG  IFILTFSLV+V
Sbjct  134   AIGIHWIVSQSGKEFEPFINGISVFLLASAVSFSRFIPSVKKRFDYGAMIFILTFSLVTV  193

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVDKLL++A  R+ TI +GT++CI I M++CP+WAG++L+ LIT N++KLA SL+GC
Sbjct  194   SGYRVDKLLEMANNRVYTIIIGTALCIMITMIICPIWAGEELYMLITRNMDKLAYSLDGC  253

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             + +Y     D     D+DK S+KKLLGYKCVL +KA+E+AMANFA WEP HGRFNFRHPW
Sbjct  254   VGEYF---NDSGSSSDDDKESDKKLLGYKCVLTSKATEEAMANFARWEPAHGRFNFRHPW  310

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             KQYLK+GASMRACAYCI+ L G +NS  +V   E I K +S    +V S   +V++DL++
Sbjct  311   KQYLKVGASMRACAYCIDALDGCVNSENEV--PELIKKHMSSIALKVSSESSRVIKDLAR  368

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
              MK+  KSS  D LV +MN+AV  LQ   K+L  P+       ++ A  P     K+ T 
Sbjct  369   SMKTMKKSSNIDYLVGEMNNAVLELQEDLKSL--PTLFINPQPLQGADCPE----KKNTG  422

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAK  342
             +          V LM+I  L T+ASLL+EI  R EG+V  V +LA +  ++  +D+K   
Sbjct  423   A----------VALMDIMPLVTLASLLIEITTRIEGMVNAVEKLAEMGVYKSVADEKNQN  472

Query  341   QSQS------QHKEQ  315
             Q  S      +HK++
Sbjct  473   QPVSKSNVPDEHKQE  487



>ref|XP_009776252.1| PREDICTED: aluminum-activated malate transporter 10-like [Nicotiana 
sylvestris]
Length=480

 Score =   440 bits (1132),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 241/494 (49%), Positives = 342/494 (69%), Gaps = 35/494 (7%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGF----VLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             R+ M DG+S +L  ES    ++Y  +  F    +L  W F++KAW +G  EPRKVIH +K
Sbjct  14    RIRMSDGSSAILPPESSLVTRIYISIKSFFKNIILIFWRFLEKAWIIGMNEPRKVIHCIK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG+ALS+VSLFYY++PLY+ VGG AMWAV+TVVVVFEYTVGATL KC+NR   T LAG L
Sbjct  74    VGIALSVVSLFYYMKPLYEGVGGTAMWAVLTVVVVFEYTVGATLYKCLNRAAGTSLAGFL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              IG+HW+ANQSG++ +PII+ AS+F+LA+AATFSRFIP++KARFDYG  IFILTF+LVS+
Sbjct  134   AIGIHWIANQSGKRFEPIIMGASIFILASAATFSRFIPAVKARFDYGAMIFILTFTLVSI  193

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRV+ LL++A +R+STI +G S+C+  ++L+ P+WAG++LH+L+ +NLEK A+SL+ C
Sbjct  194   SGYRVENLLNMAHERVSTIIIGASLCVITSILIFPIWAGEELHKLVISNLEKQAESLDCC  253

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             +++Y         D ++   + KK+L YKCVLN+KASE+ MANFA WEP HG FNF+HPW
Sbjct  254   VTEYF-------SDSEDTTTNTKKMLAYKCVLNSKASEETMANFARWEPAHGHFNFQHPW  306

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             K YLKI A MR+CA CIE L   IN   Q  ++E + K ++  C+++ S+  ++L++L+ 
Sbjct  307   KYYLKISALMRSCACCIEALTSCINQKDQ--ASEVLRKQLNNTCQQLSSSTSEILKELAM  364

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKT----LIPPSSQSLTTQVEEAQKPSSDHLK  534
              MK+  KSS  DIL+ + NSA++ L+   K     LI P                + + K
Sbjct  365   NMKTMRKSSRIDILIQEKNSAIQELETQLKQVSGLLIVPK--------------GAKNEK  410

Query  533   QETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDK  354
              E K  ++     +++ ++EI   +T ASL++EIA R EGVV  V +L+ +A+F+ + D 
Sbjct  411   NEEKPVVTTG---NVIPMVEIIPAATFASLVIEIAMRIEGVVDAVEELSKMAKFKIE-DA  466

Query  353   KMAKQSQSQHKEQN  312
             +M KQS+   K  N
Sbjct  467   EMIKQSKPDIKIIN  480



>ref|XP_009612746.1| PREDICTED: aluminum-activated malate transporter 10-like [Nicotiana 
tomentosiformis]
Length=480

 Score =   436 bits (1120),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 237/487 (49%), Positives = 336/487 (69%), Gaps = 35/487 (7%)
 Frame = -3

Query  1766  VNMPDGTSRVLVSESRRRGKVYDIVGGF----VLRIWSFIDKAWQLGKKEPRKVIHGVKV  1599
             + M DG+  +L  ES    ++   +  F    +L    F++K+W +G  EPRKVIH +KV
Sbjct  15    IRMADGSFAILAPESSLVTRISLSIKSFFKNLMLVFCRFLEKSWNIGMNEPRKVIHCIKV  74

Query  1598  GLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLG  1419
             G+ALS+VSLFYY++PLY+ VGG AMWAV+TVVVVFEYTVGATL KC+NR   TFLAG   
Sbjct  75    GIALSVVSLFYYMKPLYEGVGGTAMWAVLTVVVVFEYTVGATLYKCLNRATGTFLAGFFA  134

Query  1418  IGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVS  1239
             IG+HW+ANQSG++ +PII+  S+F+L +AATFSRFIP++KARFDYG  IFILTF+LVS+S
Sbjct  135   IGIHWIANQSGKRFEPIIMGTSIFILGSAATFSRFIPAVKARFDYGAMIFILTFTLVSIS  194

Query  1238  GYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCI  1059
             GYRV  LL++A +R+STI +G S+C+  ++L+ P+WAG++LH+L+ +NLEK ADSLE C+
Sbjct  195   GYRVKNLLNMAHERVSTIIIGASLCVITSILIFPIWAGEELHKLVISNLEKQADSLECCV  254

Query  1058  SDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWK  879
             ++Y         D ++   + KK+L +KCVLN+KASE+ MANFA WEP HG FNF+HPWK
Sbjct  255   AEYF-------SDSEDTTTNTKKMLAFKCVLNSKASEETMANFARWEPAHGNFNFQHPWK  307

Query  878   QYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlskl  699
              YLKI ASMR+CA CIE L   IN   Q  ++E++ K ++  C++V S+  ++L++L+  
Sbjct  308   YYLKISASMRSCACCIEALTSCINQKNQ--ASEFVRKQLTNTCQQVSSSTAEILKELAIN  365

Query  698   mksttksSIQDILVHDMNSAVEALQLAFKT----LIPPSSQSLTTQVEEAQKPSSDHLKQ  531
             MK+  KSS  DILV + NS ++ L+   K     LI P                + + K 
Sbjct  366   MKTMRKSSRIDILVQEKNSTIQELETQLKQASGLLIVPK--------------GAKNEKD  411

Query  530   ETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKK  351
             E KS +      +++ ++EI   +T ASL++EIA R EGVV  V +L+ +A+F+ ++ +K
Sbjct  412   EEKSVVRTS---NVIPMVEIIPAATFASLVIEIATRIEGVVDAVEELSKMAKFKIEAAEK  468

Query  350   MAKQSQS  330
             M KQS+S
Sbjct  469   M-KQSKS  474



>ref|NP_567199.2| aluminum activated malate transporter family protein [Arabidopsis 
thaliana]
 sp|O23086.2|ALMTA_ARATH RecName: Full=Aluminum-activated malate transporter 10; Short=AtALMT10 
[Arabidopsis thaliana]
 gb|AEE81955.1| aluminum activated malate transporter family protein [Arabidopsis 
thaliana]
Length=497

 Score =   436 bits (1121),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 252/498 (51%), Positives = 333/498 (67%), Gaps = 34/498 (7%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVL-RIWSFIDKAWQLGKKEPRKVIHGV  1605
             R+++ +GT+  LV  S    +++    D+V   ++ R+  F+ KAW++G  +P KV+H +
Sbjct  12    RISVDNGTTERLVPRSGLSKRIFLWLKDLVMKVIMERVAKFMRKAWRIGADDPAKVVHCL  71

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVGLALSLVS+FYY+RPLYD VGGNAMWA+MTVVVVFE  VGAT  KCVNR VAT LAGS
Sbjct  72    KVGLALSLVSIFYYMRPLYDGVGGNAMWAIMTVVVVFESNVGATFCKCVNRVVATILAGS  131

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             LGI VHWVA QSG K +  ++  SVFL A AAT+SRF+PS KARFDYG  IFILTFSLVS
Sbjct  132   LGIAVHWVATQSG-KAEVFVIGCSVFLFAFAATYSRFVPSFKARFDYGAMIFILTFSLVS  190

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEG  1065
             V GYRVDKL++LAQQR+STIA+GTSICI I +  CP+WAG  LHRLI  NLEKLADSL+G
Sbjct  191   VGGYRVDKLVELAQQRVSTIAIGTSICIIITVFFCPIWAGSQLHRLIERNLEKLADSLDG  250

Query  1064  CISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAM------------ANFAVW  921
             C+++Y   + +   +++ D+ +  KL G+KCVLN+K +E+AM            AN A W
Sbjct  251   CVAEYF-KENEVSTNRNEDENTNMKLQGFKCVLNSKGTEEAMPLIRFSGFSFSQANLARW  309

Query  920   EPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRV  741
             EP HG FNFRHPWK Y+KIGA+MR CAYC+E L   IN   +  + + +     E C ++
Sbjct  310   EPAHGSFNFRHPWKLYVKIGAAMRRCAYCLENLSICINYETE--APDQVKNHFGEACMKL  367

Query  740   CSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEA  561
              S   K+LR+L+ +MK+T KSS  D LV DMNSAV+ LQ   K  +P           E 
Sbjct  368   SSASSKILRELADMMKNTRKSSKMDFLVFDMNSAVQELQETLKN-VPI----------ET  416

Query  560   QKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANL  381
              KP  + +  E ++ +  ++    + L E+  ++T+ SLL+E AAR +  V+ V++LANL
Sbjct  417   NKP--EEVPSEEENKVDSEERTTSMSLHEVLPVATLVSLLIENAARIQTAVEAVDELANL  474

Query  380   AQFRGQSDKKMAKQSQSQ  327
             A F   S KK    +  Q
Sbjct  475   ADFEQDSKKKTGDNNTKQ  492



>gb|KDP25238.1| hypothetical protein JCGZ_20394 [Jatropha curcas]
Length=489

 Score =   435 bits (1118),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 246/498 (49%), Positives = 343/498 (69%), Gaps = 44/498 (9%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRG-KVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGL  1593
             R+++  G+S+++V ES     + +  +   VL++  F  KA ++G  +PRKV+H +KVG+
Sbjct  14    RISLEHGSSKIMVEESSGPAVRAWLGLKCLVLKVGKFFGKAKEVGVNDPRKVVHCLKVGM  73

Query  1592  ALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIG  1413
             AL +VSLFYY+RPLY+ VGGNAMWA+MTVVVVFE TVGAT+ K +NR + T LAG L   
Sbjct  74    ALCIVSLFYYMRPLYEGVGGNAMWAIMTVVVVFENTVGATIYKSLNRVLGTSLAGMLAFS  133

Query  1412  VHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGY  1233
             VHW+A QSG+K +PII+ AS+FLLA++ATFSRFIPS+K  FDYG  IFILTF LV+VSGY
Sbjct  134   VHWLATQSGEKFEPIIVGASIFLLASSATFSRFIPSVKQWFDYGAMIFILTFCLVAVSGY  193

Query  1232  RVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISD  1053
             RVD+L ++A QRLSTI +GTS+CIF++ML+CP+WAG +L+  +T+N++KLA+SL+GC+++
Sbjct  194   RVDQLFEMAYQRLSTIIIGTSLCIFVSMLICPIWAGQELYTQLTSNMDKLANSLDGCVAE  253

Query  1052  YLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQY  873
             Y        +  DN+K S+K L GYKCVL++KASED+MANFA WEP HG F+F+HPWKQY
Sbjct  254   YF-------NSNDNNKTSDKNLFGYKCVLSSKASEDSMANFARWEPAHGLFSFKHPWKQY  306

Query  872   LKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmk  693
              KIGAS+R+ A CIE L   I+S  Q  + E+I K +   C RV S    V+++LSK +K
Sbjct  307   PKIGASLRSWACCIEALTSCIDSENQ--TPEFIKKQLDSVCLRVSSNSSNVIKELSKTIK  364

Query  692   sttksSIQDILVHDMNSAVEALQLAFKTL----IPPSSQSLTTQVEEAQKPSSDHLKQET  525
                +S   D  + +MNSAVE LQ A  +L     PP          E++KP  D +    
Sbjct  365   KMKRSPNIDFFIEEMNSAVEELQEAITSLSSLFSPP----------ESKKP--DEV----  408

Query  524   KSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFR--------  369
                  D +  D + LME+  ++T ASLL+E+A RT+ +VKEV +LA LA+F+        
Sbjct  409   -----DSEAMDTIPLMEVIPVATFASLLIEVATRTKTIVKEVEELAKLAEFKVAGEDKCK  463

Query  368   -GQSDKKMAKQSQSQHKE  318
               Q + ++  QSQ++ +E
Sbjct  464   ENQPNNRIELQSQAKDEE  481



>ref|XP_010053089.1| PREDICTED: aluminum-activated malate transporter 10-like [Eucalyptus 
grandis]
Length=498

 Score =   433 bits (1113),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 248/486 (51%), Positives = 338/486 (70%), Gaps = 24/486 (5%)
 Frame = -3

Query  1766  VNMPDGTSRVLVSESRRRGKVYD----IVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKV  1599
             + M DGTS  L        K ++    ++  FVL+IW F+ KAW LG  +PRKV+H +KV
Sbjct  15    IKMADGTSETLAPREGPVRKAWNCLVRLLSQFVLKIWRFLQKAWSLGANDPRKVVHCLKV  74

Query  1598  GLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLG  1419
             G ALS+VSLF+Y+RPLY+ VG NAMWAVMTVVVVFE+TVGAT+SK  NR   T LAG LG
Sbjct  75    GTALSVVSLFFYMRPLYESVGKNAMWAVMTVVVVFEHTVGATISKSFNRVCGTILAGFLG  134

Query  1418  IGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVS  1239
             +GV+WVA+QSG+K +P I  +S+FLLA+AATFSRFIPS+KARFDYG  IFILTFSLVSVS
Sbjct  135   LGVNWVADQSGEKFEPWIAGSSLFLLASAATFSRFIPSVKARFDYGAMIFILTFSLVSVS  194

Query  1238  GYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCI  1059
             GYRV++L  LA +RLSTI +GTS+CI ++ML+CP+WAG +LH LI  N++KL+ SLEGC+
Sbjct  195   GYRVEELFALAHERLSTIVIGTSLCIIVSMLVCPIWAGTELHNLIVRNMDKLSCSLEGCV  254

Query  1058  SDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWK  879
              +Y +   +G   +       K L GYKCVL +KA E+ MANFA WEP HG FNFRHPW+
Sbjct  255   IEYFDGSAEGGKSEPI-----KNLQGYKCVLTSKAMEETMANFARWEPAHGHFNFRHPWQ  309

Query  878   QYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlskl  699
             QYLK+GAS+R+CAYC+E L+G I S  Q  + E I   ++  C RV S    V+++L+K+
Sbjct  310   QYLKVGASLRSCAYCVEALYGCICSETQ--APESIKSHLASTCLRVSSQSSNVVKELAKV  367

Query  698   mksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKS  519
             +K+T+KSS  D +V +M+ AV+ LQ     L        T +V   +K       + + +
Sbjct  368   IKATSKSSTIDSVVGEMDDAVKDLQSCLADLPKLLLPLPTPEVSGLEK------AERSAA  421

Query  518   ALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQ  339
             +L+         L+++  L T ASLL+EIA R +GVV++V++LA+LA+F   +D++ +K 
Sbjct  422   SLATTP------LLDMVPLVTSASLLIEIAGRIKGVVEDVDELADLAEFE-PADQENSKH  474

Query  338   SQSQHK  321
             +Q  +K
Sbjct  475   NQPTNK  480



>ref|XP_010556613.1| PREDICTED: aluminum-activated malate transporter 10-like [Tarenaya 
hassleriana]
Length=478

 Score =   432 bits (1110),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 247/489 (51%), Positives = 328/489 (67%), Gaps = 30/489 (6%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSES----RRRGKVYD---IVGGFVLRIWSFIDKAWQLGKKEPRKVIH  1611
             R+N+ DGTS  L   +     RR  V+    ++  FVL   + ++KAW++G +EP KV+H
Sbjct  13    RINVEDGTSERLDPPAGSGLSRRVAVWFKCLVMNRFVLGTVASMEKAWRIGAEEPTKVVH  72

Query  1610  GVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLA  1431
              +KVGLALSLVS+FYY+RPLY+ VGGNAMWA+MTVVVVF+  +GAT SKC+NR VAT LA
Sbjct  73    CLKVGLALSLVSIFYYMRPLYEGVGGNAMWAIMTVVVVFDSNIGATFSKCINRVVATLLA  132

Query  1430  GSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSL  1251
             GSLGIGVHW+A QSG   +P+++  SVFL A+AAT+SRF+PS KARFDYG  IFILTFSL
Sbjct  133   GSLGIGVHWMAAQSGSG-EPLVIAGSVFLFASAATYSRFVPSFKARFDYGAMIFILTFSL  191

Query  1250  VSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSL  1071
             VSVSGYRVDKL+ LAQQR+STIA+GTSICI I+M  CP+WAG  LH L+  NL+KLADSL
Sbjct  192   VSVSGYRVDKLIALAQQRVSTIAIGTSICIIISMFFCPIWAGVQLHHLLQRNLDKLADSL  251

Query  1070  EGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFR  891
             +GC+++Y         ++D D    KK+ G+ CVLN+K  E++MANFA WEP HG FNFR
Sbjct  252   DGCVAEYFKEKEASTQNEDEDM--NKKIKGFMCVLNSKGPEESMANFARWEPAHGSFNFR  309

Query  890   HPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRD  711
             HPWKQYLK GASMR CAYC+E L   INS  +V   +++   + E C ++ S   K+L++
Sbjct  310   HPWKQYLKAGASMRRCAYCLENLTICINSETEV--PDHLKNHLREACLKLSSASSKILKE  367

Query  710   lsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQ  531
             L+  MKSTTKSS  D L+  M SA + LQ   +T +P   +                 K 
Sbjct  368   LANAMKSTTKSSSMDFLLFGMISAKQELQERLRT-VPERIE-----------------KH  409

Query  530   ETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKK  351
             E    +  +   +   + E+  L+T+ SLL+E   R + +V+ V +L+NLA F+  S +K
Sbjct  410   EEGEVMEKEGGENRRSMHEVLPLATLVSLLLENTDRIQEIVRAVEELSNLAGFKTGSQRK  469

Query  350   MAKQSQSQH  324
                +  + H
Sbjct  470   SDTKPNNHH  478



>ref|XP_007219805.1| hypothetical protein PRUPE_ppa026486mg [Prunus persica]
 gb|EMJ21004.1| hypothetical protein PRUPE_ppa026486mg [Prunus persica]
Length=481

 Score =   432 bits (1110),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 256/499 (51%), Positives = 327/499 (66%), Gaps = 40/499 (8%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             R+N+PDGT+ VLV ES    KV+     ++GG  L++W F+ KAW LG  EP+K IH +K
Sbjct  14    RINVPDGTTNVLVPESGIVDKVWLELNGVLGGLRLKVWRFLLKAWDLGVAEPKKAIHALK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VGLALS+VSLFYY+R LY+ VGGNAMWAVMTVVVVFE TVGATL K +NR   TFLAGSL
Sbjct  74    VGLALSIVSLFYYMRSLYESVGGNAMWAVMTVVVVFESTVGATLYKSINRPAGTFLAGSL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
             G+GVHW+A +SG+K +PII+  SVF  A+AATFSRFIPS+K+RFDYG  IFILTFSLVSV
Sbjct  134   GLGVHWIAYKSGEKFEPIIIGISVFFFASAATFSRFIPSVKSRFDYGALIFILTFSLVSV  193

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRV +L +LA  RLSTI +GTS CI I+ML  P WAGD+LHRLI  NLEKLADSL+  
Sbjct  194   SGYRVGELSELAYDRLSTIGIGTSFCILISMLFYPTWAGDELHRLIYRNLEKLADSLD--  251

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
               + +      ++    D    K++ GYKCVL++KA+ED  A  A WEP HG FNF+HPW
Sbjct  252   -ENDILLYFKDNEAVTEDNCPAKEIKGYKCVLDSKATEDNWAKLARWEPAHGSFNFKHPW  310

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             KQYLKIGASM +CAYCIE L   + S  Q      + K +S  C+        +LR+L+K
Sbjct  311   KQYLKIGASMHSCAYCIEALSSCMESETQAAGIGQLKKHLSNACKTTNKYSSGILRELAK  370

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKT----LIPPSSQSLTTQVEEAQKPSSDHLK  534
              +K+ TKSS    LV +MN+AV+ LQ + K+    LI P+ +             +D  K
Sbjct  371   TIKTMTKSSDMGSLVWEMNNAVQELQNSLKSVPIGLIAPTPE------------DTDDGK  418

Query  533   QETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDK  354
              E+           +  ++E+  ++T+ SLL+E AAR  G+V  VN+LA      GQ D 
Sbjct  419   GESF----------ITPVVEVLSVTTLVSLLIENAARINGIVDAVNELA------GQVDM  462

Query  353   KMAKQSQS-QHKEQNVQTH  300
             K A Q  S Q+K  +   H
Sbjct  463   KPAPQENSKQYKPSSDTPH  481



>gb|KCW77334.1| hypothetical protein EUGRSUZ_D01695 [Eucalyptus grandis]
Length=482

 Score =   431 bits (1109),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 248/484 (51%), Positives = 337/484 (70%), Gaps = 24/484 (5%)
 Frame = -3

Query  1760  MPDGTSRVLVSESRRRGKVYD----IVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGL  1593
             M DGTS  L        K ++    ++  FVL+IW F+ KAW LG  +PRKV+H +KVG 
Sbjct  1     MADGTSETLAPREGPVRKAWNCLVRLLSQFVLKIWRFLQKAWSLGANDPRKVVHCLKVGT  60

Query  1592  ALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIG  1413
             ALS+VSLF+Y+RPLY+ VG NAMWAVMTVVVVFE+TVGAT+SK  NR   T LAG LG+G
Sbjct  61    ALSVVSLFFYMRPLYESVGKNAMWAVMTVVVVFEHTVGATISKSFNRVCGTILAGFLGLG  120

Query  1412  VHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGY  1233
             V+WVA+QSG+K +P I  +S+FLLA+AATFSRFIPS+KARFDYG  IFILTFSLVSVSGY
Sbjct  121   VNWVADQSGEKFEPWIAGSSLFLLASAATFSRFIPSVKARFDYGAMIFILTFSLVSVSGY  180

Query  1232  RVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISD  1053
             RV++L  LA +RLSTI +GTS+CI ++ML+CP+WAG +LH LI  N++KL+ SLEGC+ +
Sbjct  181   RVEELFALAHERLSTIVIGTSLCIIVSMLVCPIWAGTELHNLIVRNMDKLSCSLEGCVIE  240

Query  1052  YLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQY  873
             Y +   +G   +       K L GYKCVL +KA E+ MANFA WEP HG FNFRHPW+QY
Sbjct  241   YFDGSAEGGKSEPI-----KNLQGYKCVLTSKAMEETMANFARWEPAHGHFNFRHPWQQY  295

Query  872   LKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmk  693
             LK+GAS+R+CAYC+E L+G I S  Q  + E I   ++  C RV S    V+++L+K++K
Sbjct  296   LKVGASLRSCAYCVEALYGCICSETQ--APESIKSHLASTCLRVSSQSSNVVKELAKVIK  353

Query  692   sttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSAL  513
             +T+KSS  D +V +M+ AV+ LQ     L        T +V   +K       + + ++L
Sbjct  354   ATSKSSTIDSVVGEMDDAVKDLQSCLADLPKLLLPLPTPEVSGLEK------AERSAASL  407

Query  512   SDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQ  333
             +         L+++  L T ASLL+EIA R +GVV++V++LA+LA+F   +D++ +K +Q
Sbjct  408   ATTP------LLDMVPLVTSASLLIEIAGRIKGVVEDVDELADLAEFE-PADQENSKHNQ  460

Query  332   SQHK  321
               +K
Sbjct  461   PTNK  464



>emb|CDX74373.1| BnaA03g26740D [Brassica napus]
Length=477

 Score =   430 bits (1106),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 245/486 (50%), Positives = 327/486 (67%), Gaps = 31/486 (6%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVL-----RIWSFIDKAWQLGKKEPRKVIHGV  1605
             R+N+ +G +  LV +S    +++  + G V+     R+  F+ K W++G  +P KV+H +
Sbjct  13    RINVDNGATERLVPKSGPSIRIFLWLKGLVMKVILERLSKFMRKTWKIGADDPAKVVHCL  72

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVGLALSLVS+FYY+RPLYD VGGNAMWA+MTVVVVFE  VGAT SKCVNR VAT LAGS
Sbjct  73    KVGLALSLVSIFYYMRPLYDGVGGNAMWAIMTVVVVFESNVGATFSKCVNRVVATILAGS  132

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             LGI VHWVANQSG K +  ++  SVFL A AAT+SRF+PS KARFDYG  IFILTFSLVS
Sbjct  133   LGIAVHWVANQSG-KAEIFVIGCSVFLFAFAATYSRFVPSFKARFDYGAMIFILTFSLVS  191

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEG  1065
             V GYRVDKL+D+AQ+R+STIA+GTSICI I +  CP+WAG  LHRL+  N  KLADSL+G
Sbjct  192   VGGYRVDKLVDMAQERVSTIAIGTSICIIITVFFCPIWAGTQLHRLVQRNFIKLADSLDG  251

Query  1064  CISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHP  885
              + +Y       D  ++ D+ +  KL G+KCVLN+K +E++MAN A WEP HG FNFRHP
Sbjct  252   RVEEYF---KKKDVSENEDEETNMKLQGFKCVLNSKGTEESMANLARWEPAHGSFNFRHP  308

Query  884   WKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDls  705
             W+QY+KIGA+MR CAYC+E L   +N   +V   + + K   + C ++ S   K+LR+L+
Sbjct  309   WQQYVKIGAAMRRCAYCLENLSICMNYETEV--PDQVKKHFGQACVKLSSASSKILRELA  366

Query  704   klmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQET  525
             +++ +T KSS  D LV DMN+AV  L+   KT +P +    T + EE             
Sbjct  367   EMINNTRKSSKMDFLVFDMNTAVHELREILKT-VPVA----TNKPEEGD-----------  410

Query  524   KSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMA  345
                 S++D    + + E+  ++T+ SLL+E AAR +  V+ V++LANLA F+  S KK  
Sbjct  411   ----SNEDRTMPMSVHEVLPVATLVSLLIENAARIQKTVEAVDELANLADFKQDSKKKTG  466

Query  344   KQSQSQ  327
                  Q
Sbjct  467   DNKAKQ  472



>emb|CDX97239.1| BnaA02g20300D [Brassica napus]
Length=484

 Score =   430 bits (1105),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 249/487 (51%), Positives = 328/487 (67%), Gaps = 26/487 (5%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVL-----RIWSFIDKAWQLGKKEPRKVIHGV  1605
             R+++ +GT+  LV       +++  + GFV+     RI   +   W++G  +P KV+H +
Sbjct  13    RISVDNGTTERLVPTYGPSKRIFLWLKGFVMKVILERIAKSMRNIWRIGADDPAKVVHCL  72

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVGLALSLVS+FYY+RPLYD VGGNAMWA+MTVVVVFE TVGAT SKCVNR VAT LAG+
Sbjct  73    KVGLALSLVSIFYYMRPLYDGVGGNAMWAIMTVVVVFESTVGATFSKCVNRVVATILAGT  132

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             LGI VHWVA +SG K +  +   SVFL A  AT+SRF+PS K+RFDYG  IFILTFSLVS
Sbjct  133   LGIAVHWVATRSG-KAEIFVTACSVFLFAFTATYSRFVPSFKSRFDYGAIIFILTFSLVS  191

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEG  1065
             V GYRVDKL D+AQQR STIA+GTSICI I + LCP+WAG  L+RL+  N  KLADSL+G
Sbjct  192   VGGYRVDKLFDMAQQRASTIAIGTSICIVITVFLCPIWAGSQLNRLVQCNFVKLADSLDG  251

Query  1064  CISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHP  885
             C+++Y     D   +++ D+ + KKL G+KCVLN+K +E+AMAN A WEP HG FNFRHP
Sbjct  252   CVAEYF-KKKDVSTNENEDEETNKKLQGFKCVLNSKGTEEAMANLARWEPAHGSFNFRHP  310

Query  884   WKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDls  705
             W+QY+KIGA+MR CAYC+E L  SI ++ +  + + +     E C  + S   K+LR+L+
Sbjct  311   WQQYVKIGAAMRRCAYCLENL--SICTNYETEAPDQVKNHFGEACMSLSSASSKILRELA  368

Query  704   klmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQET  525
              ++K+T KSS  D LV DMNSAV+ L    KT +P           E  +P  D      
Sbjct  369   DMIKNTRKSSKMDYLVFDMNSAVQELHETLKT-VPI----------ETNRPEED-----V  412

Query  524   KSALSDDDDHDL-VYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKM  348
             KS   ++ D  + + L EI  ++T+ SLL+E AAR +  V+ V++LANLA F+  S KK 
Sbjct  413   KSEKDEEGDRTMAMSLHEILPVATLVSLLIENAARIQTTVEAVDELANLADFKQDSKKKT  472

Query  347   AKQSQSQ  327
                +  Q
Sbjct  473   GGNNAKQ  479



>emb|CDP20970.1| unnamed protein product [Coffea canephora]
Length=502

 Score =   429 bits (1102),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 238/489 (49%), Positives = 333/489 (68%), Gaps = 26/489 (5%)
 Frame = -3

Query  1769  RVNMPDGTS-RVLVSESRRRG---KVYD--IVGGFVLRIWSFIDKAWQLGKKEPRKVIHG  1608
             RV+  DG+S +VL +E        +V+   +   F +R+  F+ KAW LG  +PRKV H 
Sbjct  16    RVDEKDGSSDQVLETEPGPANGFCRVFKCLVANKFSMRLLRFLKKAWHLGVDDPRKVFHC  75

Query  1607  VKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAG  1428
             +KVG+ALS+VSLFYY+RPLYD VGG AMWAVMTVVVVFE TVGAT+SK +NR + T LAG
Sbjct  76    LKVGIALSVVSLFYYMRPLYDGVGGTAMWAVMTVVVVFENTVGATISKSLNRAIGTCLAG  135

Query  1427  SLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLV  1248
              L +G+HWVA++SG KL+P+I++ S+FLLA+AATFSRF+P++K +FDYG  IFILTFSLV
Sbjct  136   LLAVGIHWVASKSGNKLEPVIVEGSLFLLASAATFSRFVPAVKKKFDYGTVIFILTFSLV  195

Query  1247  SVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLE  1068
             SVSGYRV+KL D+A+QRLSTI +GTS+CI  +ML+ P+WAG +LH LI  N+EKLA SLE
Sbjct  196   SVSGYRVEKLFDMAKQRLSTIIIGTSLCILTSMLVSPIWAGQELHCLIIKNMEKLATSLE  255

Query  1067  GCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRH  888
              C+++Y +                + L  YKCVLN+KA+E++MANFA WEP HG FNF+H
Sbjct  256   CCVAEYFDDGQKTTSAPV------QNLQAYKCVLNSKATEESMANFAAWEPAHGSFNFQH  309

Query  887   PWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDl  708
             PWKQYLKI A+MR CAYCIE L+  I++  Q  +++ + K +S+ C +V S+ G +LR+L
Sbjct  310   PWKQYLKIAAAMRDCAYCIEALNSCISNKKQ--ASKSMKKHLSDICLKVNSSSGSILREL  367

Query  707   sklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQE  528
             +  +++  K+S  DI + +MN++V+ ++   K+L       LT        P++   K  
Sbjct  368   AINLETFKKTSKMDISIEEMNNSVQEVKNYLKSL---PGLVLT--------PTTSETKSS  416

Query  527   TKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKM  348
               + +      + + L+E+  L T  SLL+EI  R E +V  V +LAN A+F+   D K 
Sbjct  417   ETAIMEPLLTTNTIPLVEVIPLVTFTSLLIEIPTRVEAIVDAVEELANKAKFKPAPDDK-  475

Query  347   AKQSQSQHK  321
              KQ++  +K
Sbjct  476   PKQNEQNNK  484



>ref|XP_004246086.1| PREDICTED: aluminum-activated malate transporter 10-like [Solanum 
lycopersicum]
Length=476

 Score =   427 bits (1098),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 232/483 (48%), Positives = 337/483 (70%), Gaps = 28/483 (6%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             R+ M DG+S  L  ES    ++Y      +   +L +  F++K+W +GK EPRKVIH +K
Sbjct  10    RIRMADGSSENLAPESSLVTRMYLSFERFLKNLILIVMRFLEKSWNIGKNEPRKVIHCLK  69

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG+AL +VSLFYY+RPLY+ VGG AMWAVMTVVVVFEYTVGATL KC+NR   TF AG L
Sbjct  70    VGIALCVVSLFYYMRPLYNGVGGTAMWAVMTVVVVFEYTVGATLYKCLNRATGTFCAGFL  129

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              IG+HW+ANQSG++ +PII+  S+F+LA+AATF+RFIP++KAR+DYG  IFILTF+LVS+
Sbjct  130   AIGIHWIANQSGKRFEPIIMGVSIFILASAATFTRFIPAVKARYDYGTMIFILTFTLVSI  189

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRV  LL++A +R+STI +G S+C+  ++L+ P+WAG++LH+L+ +NLEKLA+SL+ C
Sbjct  190   SGYRVANLLNMAHERVSTIIIGASLCVITSILIFPIWAGEELHKLVISNLEKLAESLDCC  249

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             ++++         D ++   + KK+L +KCVLN+KASE+ MANFA WEP HG FNF+HPW
Sbjct  250   VAEFF-------SDSEDTTTNTKKMLAFKCVLNSKASEETMANFARWEPAHGLFNFQHPW  302

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
              +YLKI ASMR+CA CIE L   IN   Q  ++E +   ++  C++V S+  ++L++L+ 
Sbjct  303   GKYLKISASMRSCACCIEALTSCINQKDQ--ASELLKNELTNTCQQVSSSTSEILKELAL  360

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
              MK+  KSS  DIL+ + ++A++ L+    TL+   S  L  Q      P +D  K   +
Sbjct  361   NMKTMRKSSRMDILLQEKSNAIQELE----TLMEQLSGLLFIQ------PKNDQEKPVIR  410

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAK  342
             ++       +++ L+EI   +T ASL++EIA R EGVV  V +L+ LA+F+ +    + K
Sbjct  411   TS-----STNVIPLVEIIPTATFASLVIEIATRIEGVVDGVEELSKLAKFKLEDADMIIK  465

Query  341   QSQ  333
             Q++
Sbjct  466   QNK  468



>gb|AAB62849.1| A_TM018A10.3 gene product [Arabidopsis thaliana]
 emb|CAB80900.1| AT4g00910 [Arabidopsis thaliana]
Length=507

 Score =   428 bits (1100),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 252/508 (50%), Positives = 333/508 (66%), Gaps = 44/508 (9%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVL-RIWSFIDKAWQLGKKEPRKVIHGV  1605
             R+++ +GT+  LV  S    +++    D+V   ++ R+  F+ KAW++G  +P KV+H +
Sbjct  12    RISVDNGTTERLVPRSGLSKRIFLWLKDLVMKVIMERVAKFMRKAWRIGADDPAKVVHCL  71

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVGLALSLVS+FYY+RPLYD VGGNAMWA+MTVVVVFE  VGAT  KCVNR VAT LAGS
Sbjct  72    KVGLALSLVSIFYYMRPLYDGVGGNAMWAIMTVVVVFESNVGATFCKCVNRVVATILAGS  131

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             LGI VHWVA QSG K +  ++  SVFL A AAT+SRF+PS KARFDYG  IFILTFSLVS
Sbjct  132   LGIAVHWVATQSG-KAEVFVIGCSVFLFAFAATYSRFVPSFKARFDYGAMIFILTFSLVS  190

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLE-  1068
             V GYRVDKL++LAQQR+STIA+GTSICI I +  CP+WAG  LHRLI  NLEKLADSL+ 
Sbjct  191   VGGYRVDKLVELAQQRVSTIAIGTSICIIITVFFCPIWAGSQLHRLIERNLEKLADSLDA  250

Query  1067  ---------GCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAM--------  939
                      GC+++Y   + +   +++ D+ +  KL G+KCVLN+K +E+AM        
Sbjct  251   RVLTVTKTAGCVAEYF-KENEVSTNRNEDENTNMKLQGFKCVLNSKGTEEAMPLIRFSGF  309

Query  938   ----ANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYIL  771
                 AN A WEP HG FNFRHPWK Y+KIGA+MR CAYC+E L   IN   +  + + + 
Sbjct  310   SFSQANLARWEPAHGSFNFRHPWKLYVKIGAAMRRCAYCLENLSICINYETE--APDQVK  367

Query  770   KPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSS  591
                 E C ++ S   K+LR+L+ +MK+T KSS  D LV DMNSAV+ LQ   K  +P   
Sbjct  368   NHFGEACMKLSSASSKILRELADMMKNTRKSSKMDFLVFDMNSAVQELQETLKN-VPI--  424

Query  590   QSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGV  411
                     E  KP  + +  E ++ +  ++    + L E+  ++T+ SLL+E AAR +  
Sbjct  425   --------ETNKP--EEVPSEEENKVDSEERTTSMSLHEVLPVATLVSLLIENAARIQTA  474

Query  410   VKEVNQLANLAQFRGQSDKKMAKQSQSQ  327
             V+ V++LANLA F   S KK    +  Q
Sbjct  475   VEAVDELANLADFEQDSKKKTGDNNTKQ  502



>emb|CDY01945.1| BnaC02g27820D [Brassica napus]
Length=477

 Score =   425 bits (1093),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 246/478 (51%), Positives = 324/478 (68%), Gaps = 24/478 (5%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVLR-----IWSFIDKAWQLGKKEPRKVIHGV  1605
             R+++ +GT+  LV       +++  + GFV++     I   +   W++G  +P K +H +
Sbjct  13    RISVDNGTTERLVPAYGPSKRIFLWLKGFVMKVILEQIAKSMRNIWRIGADDPAKAVHCL  72

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVGLALSLVS+FYY+RPLYD VGGNAMWA+MTVVVVFE TVGAT SKCVNR VAT LAG+
Sbjct  73    KVGLALSLVSIFYYMRPLYDGVGGNAMWAIMTVVVVFESTVGATFSKCVNRVVATILAGT  132

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             LGI VHWVA QSG K +  +   SVFL A  AT+SRF+PS K+RFDYG  IFILTFSLVS
Sbjct  133   LGIAVHWVATQSG-KAEIFVTACSVFLFAFTATYSRFVPSFKSRFDYGAMIFILTFSLVS  191

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEG  1065
             V GYRVDKL D+AQQR STIA+GTSICI I + LCP+WAG  L+RL+  N  KLADSL+G
Sbjct  192   VGGYRVDKLFDMAQQRASTIAIGTSICIVITVFLCPIWAGSQLNRLVQCNFVKLADSLDG  251

Query  1064  CISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHP  885
             C+++Y     D   +++ D+ + KKL G+KCVLN+K +E+AMAN A WEP HG FNFRHP
Sbjct  252   CVAEYF-KKKDVSTNENEDEETNKKLQGFKCVLNSKGTEEAMANLARWEPAHGSFNFRHP  310

Query  884   WKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDls  705
             W+QY+KIGA+MR CAYC+E L  SI  + +  + + +     E C  + S   K+LR+L+
Sbjct  311   WQQYVKIGAAMRRCAYCLENL--SICMNYETEAPDQVKNHFGEACMSLSSASSKILRELA  368

Query  704   klmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQET  525
              ++K+T KSS  D LV DMNSAV+ LQ   K ++P           E  +P  D   ++ 
Sbjct  369   DMIKNTRKSSKMDYLVFDMNSAVQELQETLK-IVPI----------EINRPEDDVKSEKD  417

Query  524   KSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKK  351
             K    + D    + L EI  ++T+ SLL+E AAR +  V+ V++LANLA F+  S KK
Sbjct  418   K----EGDRTMAMSLHEILPVATLVSLLIENAARIQTTVEAVDELANLADFKQDSKKK  471



>emb|CDY01943.1| BnaC02g27840D [Brassica napus]
Length=477

 Score =   423 bits (1088),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 245/478 (51%), Positives = 324/478 (68%), Gaps = 24/478 (5%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVLR-----IWSFIDKAWQLGKKEPRKVIHGV  1605
             R+++ +GT+  LV       +++  + GFV++     I   +   W++G  +P K +H +
Sbjct  13    RISVDNGTTERLVPAYGPSKRIFLWLKGFVMKVILEQIAKSMRNIWRIGADDPAKAVHCL  72

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVGLALSLVS+FYY+RPLYD VGGNAMWA+MTVVVVFE TVGAT SKCVNR VAT LAG+
Sbjct  73    KVGLALSLVSIFYYMRPLYDGVGGNAMWAIMTVVVVFESTVGATFSKCVNRVVATILAGT  132

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             LGI VHWVA +SG K +  +   SVFL A  AT+SRF+PS K+RFDYG  IFILTFSLVS
Sbjct  133   LGIAVHWVATRSG-KAEIFVTACSVFLFAFTATYSRFVPSFKSRFDYGAMIFILTFSLVS  191

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEG  1065
             V GYRVDKL D+AQQR STIA+GTSICI I + LCP+WAG  L+RL+  N  KLADSL+G
Sbjct  192   VGGYRVDKLFDMAQQRASTIAIGTSICIVITVFLCPIWAGSQLNRLVQCNFVKLADSLDG  251

Query  1064  CISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHP  885
             C+++Y     D   +++ D+ + KKL G+KCVLN+K +E+AMAN A WEP HG FNFRHP
Sbjct  252   CVAEYF-KKKDVSTNENEDEETNKKLQGFKCVLNSKGTEEAMANLARWEPAHGSFNFRHP  310

Query  884   WKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDls  705
             W+QY+KIGA+MR CAYC+E L  SI  + +  + + +     E C  + S   K+LR+L+
Sbjct  311   WQQYVKIGAAMRRCAYCLENL--SICMNYETEAPDQVKNHFGEACMSLSSASSKILRELA  368

Query  704   klmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQET  525
              ++K+T KSS  D LV DMNSAV+ LQ   K ++P           E  +P  D   ++ 
Sbjct  369   DMIKNTRKSSKMDYLVFDMNSAVQELQETLK-IVPI----------EINRPEDDVKSEKD  417

Query  524   KSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKK  351
             K    + D    + L EI  ++T+ SLL+E AAR +  V+ V++LANLA F+  S KK
Sbjct  418   K----EGDRTMAMSLHEILPVATLVSLLIENAARIQTTVEAVDELANLADFKQDSKKK  471



>ref|XP_009389304.1| PREDICTED: aluminum-activated malate transporter 10-like [Musa 
acuminata subsp. malaccensis]
Length=491

 Score =   422 bits (1085),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 244/488 (50%), Positives = 332/488 (68%), Gaps = 22/488 (5%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSES----RRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             RV++P+G++  +  ES    R R  +  +V   V ++ SF  KA ++G  +PRKVIHGVK
Sbjct  14    RVSVPEGSAAEMELESKWIHRARTWLIQLVMTVVSKVTSFGKKAGKIGADDPRKVIHGVK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG+AL+LVSLFYY RPLYD VGG A+WAVMTVVVVFE+TVG  L K +NR VAT  AG+L
Sbjct  74    VGIALTLVSLFYYTRPLYDGVGGCALWAVMTVVVVFEFTVGGCLYKGINRAVATSTAGTL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +G+HW+A++SG+K++PIIL +SVFLLA+AATFSRFIP+IKARFDYG TIFILTFSLV+V
Sbjct  134   AVGIHWIASKSGEKVEPIILSSSVFLLASAATFSRFIPNIKARFDYGITIFILTFSLVAV  193

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVD+LL LAQ R+ TIA+G +IC+ + +L+ PVWAG +LH L++ N++KLADSLEG 
Sbjct  194   SGYRVDELLRLAQVRICTIAIGIAICLVVCVLVRPVWAGQELHLLVSRNMDKLADSLEGL  253

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             + DY   D   + +    + S+    GYK VLN+KASED+ AN A WEPGHG+F F+HPW
Sbjct  254   VEDYFMKDKKVEGEVSCSQRSQ----GYKNVLNSKASEDSQANLARWEPGHGKFGFKHPW  309

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
              QYLK+GA+MR CAYC+E L+G INS  Q  + E++ + + + C R+     KVL+++S 
Sbjct  310   SQYLKVGAAMRYCAYCMEALNGCINSEIQ--APEHMKRHLRDVCMRLSLGSSKVLKEISS  367

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
              +KS  +S    +LV +MN AVE LQ+A +        SL  Q+ ++   +++    E +
Sbjct  368   SVKSMKESRSIQVLVGEMNDAVEELQVALR--------SLPKQLTQSPAAAAEAATIEKR  419

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAK  342
               +        + LME+  L T  SLL+E++ R  GVV  V  LA LA F     KK + 
Sbjct  420   HCVPATT----ISLMEVMPLFTAVSLLIEVSERVGGVVDAVGTLATLACFEPIDHKKASS  475

Query  341   QSQSQHKE  318
                 Q +E
Sbjct  476   SVVPQDEE  483



>ref|XP_010106139.1| Aluminum-activated malate transporter 10 [Morus notabilis]
 gb|EXC07933.1| Aluminum-activated malate transporter 10 [Morus notabilis]
Length=491

 Score =   422 bits (1084),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 238/440 (54%), Positives = 314/440 (71%), Gaps = 19/440 (4%)
 Frame = -3

Query  1667  SFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfey  1488
             +F+ KAW L   +PRKVIH +KVGLAL+ VSLFYY+RPLYD VGGNAMWAVMTVVVV E 
Sbjct  53    NFLKKAWDLACNDPRKVIHCLKVGLALTAVSLFYYVRPLYDGVGGNAMWAVMTVVVVCEN  112

Query  1487  tvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIP  1308
             TVGATLSK +NR   TFLAG + +GVHWVA Q+G+K +P I+  SVF+LA+AATFSRFIP
Sbjct  113   TVGATLSKSLNRICGTFLAGFIAVGVHWVAIQAGEKSEPFIMGVSVFILASAATFSRFIP  172

Query  1307  SIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWA  1128
             +IKARFDYGC IFILTFS VSVSGYR+DKL D+A+QRLST+ +GTS+CI I++++CP+WA
Sbjct  173   TIKARFDYGCMIFILTFSFVSVSGYRIDKLFDMARQRLSTVFIGTSLCIIISIIICPIWA  232

Query  1127  GDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASE  948
             G +LH LIT N++KLA+SL+GC+++Y  ++ +            K LLGYKCVLN+KA E
Sbjct  233   GQELHTLITRNMDKLANSLDGCVAEYFISNEEDSTGSQKGCG--KNLLGYKCVLNSKAPE  290

Query  947   DAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILK  768
             ++MAN A WEP HGRFNFRHPWKQYLK+G  MR CAYCIE L+G I+S  +  + E++  
Sbjct  291   ESMANIARWEPAHGRFNFRHPWKQYLKMGTEMRGCAYCIEALNGCISSENK--APEHLKT  348

Query  767   PVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFK---TLIPP  597
              VS  C  + S    V+++L+ ++K+  KSS  D L   MNS V+ L+   K   +L+ P
Sbjct  349   RVSNICLELSSNSSSVIKELASIVKTMKKSSSIDFLAEQMNSRVQGLRNELKFLPSLVTP  408

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
              +      V++++K   + +   + S            LMEI  L+T+ SLL+E AAR E
Sbjct  409   ETPKEAGNVQDSKKTKENSVGLASAS------------LMEIVPLATLTSLLIENAARIE  456

Query  416   GVVKEVNQLANLAQFRGQSD  357
             G+V  V +LA+LAQF+  +D
Sbjct  457   GIVDAVEELADLAQFKPVAD  476



>ref|XP_009387859.1| PREDICTED: aluminum-activated malate transporter 10-like [Musa 
acuminata subsp. malaccensis]
Length=494

 Score =   421 bits (1082),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 248/489 (51%), Positives = 336/489 (69%), Gaps = 22/489 (4%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSE----SRRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             RV +P+G+S  +  E    SR   ++ ++      ++ +F  K W++G   PRKVIHG K
Sbjct  16    RVTVPEGSSVKMEPEPSWISRTWNRLVELGSKLRSKVSTFGKKVWKIGADSPRKVIHGAK  75

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG AL+LVSLFYYLRPLY+  G +AMWAVMTVVVVFEYTVG  L K +NR +AT  AG L
Sbjct  76    VGAALTLVSLFYYLRPLYNGFGSSAMWAVMTVVVVFEYTVGGCLYKGINRAIATLSAGGL  135

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +G+ WVA++SG+  +P+IL ASVFLLA+AATFSRF+P++KARFDYG TIFILTFSLV+V
Sbjct  136   AVGIDWVASKSGESWEPVILSASVFLLASAATFSRFLPTVKARFDYGVTIFILTFSLVAV  195

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRV++L++LA QR++TIA+G +I + I +L+ PVW+G +LH L++ N+EKLADSLEGC
Sbjct  196   SGYRVEELINLAVQRIATIAIGIAIALSICILVYPVWSGQELHLLVSRNMEKLADSLEGC  255

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             + DY       D  + +   SE    GYKCVLN+KASED+ AN A WEP HGRF FRHPW
Sbjct  256   VEDYFMKSEITDAKESSATRSE----GYKCVLNSKASEDSQANLARWEPAHGRFGFRHPW  311

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             KQYLK+ A++R CAYC+E LHG INS A+  + E + K + + C ++ S   KVL++LS 
Sbjct  312   KQYLKVAAALRNCAYCVEALHGCINSEAK--APECMKKHLRDACMKLSSDSSKVLKELSS  369

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKP-SSDHLKQET  525
              +K   +S   D LV +M +AV  LQ AF +L  P+  + TT    A  P  S   K+ +
Sbjct  370   SIKLMKRSKSIDALVGEMKNAVHELQNAFASL--PNHLTQTT----ASSPIESTEGKKNS  423

Query  524   KSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMA  345
               +++D      V LME   L T+ASLL+EI+AR +GVV  V  LA LA+F G  ++K +
Sbjct  424   NISIADG-----VALMEAMPLMTIASLLIEISARIQGVVDAVGTLATLARFEGIRNEKSS  478

Query  344   KQSQSQHKE  318
              + Q++ +E
Sbjct  479   SKVQAEEQE  487



>ref|XP_010694502.1| PREDICTED: aluminum-activated malate transporter 10 [Beta vulgaris 
subsp. vulgaris]
Length=496

 Score =   421 bits (1082),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 231/489 (47%), Positives = 330/489 (67%), Gaps = 18/489 (4%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFV-LRIWSFIDKAWQLGKKEPRKVIHGVKVGL  1593
             ++N+ +GT++VL  E    G+V+  V   + ++ W F+   W +G  EP +  H +KVGL
Sbjct  14    KINVSNGTTKVLEPERGLAGRVWQKVQSLIIMKAWKFLMDCWNIGVAEPTRFTHCLKVGL  73

Query  1592  ALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIG  1413
             +L++VSL YY+RPLYD +G NAMWA+MTVVVV EYTVG+T+ K +NR VAT +AGSLG+G
Sbjct  74    SLTVVSLLYYMRPLYDGIGKNAMWAIMTVVVVSEYTVGSTIYKSINRAVATTIAGSLGVG  133

Query  1412  VHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGY  1233
             VHWVA+   +  QPIIL  SVF+ A+ ATF+RFIP++KARFDYG  IFILTFSLVS+SGY
Sbjct  134   VHWVASHCDRVYQPIILGVSVFIFASVATFTRFIPTVKARFDYGAMIFILTFSLVSISGY  193

Query  1232  RVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISD  1053
             RVD+L+ LAQQR+STIA+G S+CI ++ML  PVWAGD LH    +NLEKLA SLEG I++
Sbjct  194   RVDELVMLAQQRVSTIAIGISLCILVSMLFWPVWAGDKLHNQTISNLEKLAISLEGYIAE  253

Query  1052  YLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQY  873
             Y + +      ++      KKL GYKCVLN+K +E++MAN A+WEP HGRF F +PWKQY
Sbjct  254   YFSTEEAAQIPQEVL---NKKLQGYKCVLNSKTTEESMANLAIWEPAHGRFYFGYPWKQY  310

Query  872   LKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmk  693
             L IGA+ R+CAYCI+ L+  I+S  Q  + E + K ++++C R+   C +VLR+L+  +K
Sbjct  311   LNIGAATRSCAYCIDNLNSCIDSKMQ--APELLKKHINDKCTRLSFYCSEVLRELATAIK  368

Query  692   sttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSAL  513
             +  +S   D+ V  M   VE  Q A K+L       L+T  E +   + + ++   ++  
Sbjct  369   TRKRSYNIDLSVDKMIFEVEEFQNALKSLPCEFVLPLSTP-ENSIDKNGEKIENPNQAT-  426

Query  512   SDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQ  333
                       L+E+  L  +A+LL+EI AR E VV+EV++LA++A+F+ Q +KK+     
Sbjct  427   ----------LLEVLPLGMLATLLIEIVARVEEVVQEVDKLADMAEFKIQKEKKLQDIQP  476

Query  332   SQHKEQNVQ  306
             S++ +   Q
Sbjct  477   SENNQTKNQ  485



>ref|XP_002273129.2| PREDICTED: aluminum-activated malate transporter 10 [Vitis vinifera]
Length=459

 Score =   419 bits (1078),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 230/477 (48%), Positives = 313/477 (66%), Gaps = 44/477 (9%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             ++ + DG+S+ LV ES   G+ +     ++ G VL++     KAW L   +PRKVIH +K
Sbjct  18    KIRVADGSSKDLVPESGPAGRAWLGIQGLIAGLVLKVGRCFKKAWDLAVDDPRKVIHCLK  77

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG AL++VSLFYY RPLY+ +G NAMW VMT VVVFE TVGATLSK +NR   T LAGSL
Sbjct  78    VGTALTVVSLFYYTRPLYEGLGRNAMWGVMTAVVVFENTVGATLSKSLNRACGTLLAGSL  137

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +GVHW+A+QSG+KL+P +  ASVFLLA+AATFSRFIP+++ RFDYG  +FILTFSL+S+
Sbjct  138   AVGVHWIASQSGEKLEPFVNGASVFLLASAATFSRFIPTVRTRFDYGALVFILTFSLISI  197

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRV+KLL +A QRLSTIA+G  +CI I++L+CP+WAG +LH LIT N++KLA SL+GC
Sbjct  198   SGYRVEKLLKMAHQRLSTIAIGGFMCILISILVCPIWAGKELHLLITRNMDKLAYSLDGC  257

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             +++Y N  G             +K  GYKCVLN+KA+E+ MANFA WEP HG F F+HPW
Sbjct  258   VAEYFNNSGIPV----------EKSQGYKCVLNSKAAEETMANFARWEPAHGHFKFKHPW  307

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             +QYLK+GASMR CAYCIE L+G INS  QV   E I + +S  C R+ S    V+R+   
Sbjct  308   RQYLKVGASMRRCAYCIEALNGCINSENQV--PESIKQHLSGNCLRLGSVSSSVIRE---  362

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIP-PSSQSLTTQVEEAQKPSSDHLKQET  525
                                     L +  +T+   P +Q+L  +++ + +   + L    
Sbjct  363   ------------------------LAITMRTMKKSPRTQNLLKEMKNSVQELHNELGSLP  398

Query  524   KSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDK  354
                L        + L E+  ++TVASLL+E+AAR EG+V    +LA+LA+F+   ++
Sbjct  399   NLLLPPPSIEATLPLEEVIPIATVASLLIEVAARIEGIVSATEELASLAKFKPAVER  455



>emb|CBI34564.3| unnamed protein product [Vitis vinifera]
Length=455

 Score =   419 bits (1077),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 230/472 (49%), Positives = 311/472 (66%), Gaps = 44/472 (9%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             ++ + DG+S+ LV ES   G+ +     ++ G VL++     KAW L   +PRKVIH +K
Sbjct  14    KIRVADGSSKDLVPESGPAGRAWLGIQGLIAGLVLKVGRCFKKAWDLAVDDPRKVIHCLK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG AL++VSLFYY RPLY+ +G NAMW VMT VVVFE TVGATLSK +NR   T LAGSL
Sbjct  74    VGTALTVVSLFYYTRPLYEGLGRNAMWGVMTAVVVFENTVGATLSKSLNRACGTLLAGSL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +GVHW+A+QSG+KL+P +  ASVFLLA+AATFSRFIP+++ RFDYG  +FILTFSL+S+
Sbjct  134   AVGVHWIASQSGEKLEPFVNGASVFLLASAATFSRFIPTVRTRFDYGALVFILTFSLISI  193

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRV+KLL +A QRLSTIA+G  +CI I++L+CP+WAG +LH LIT N++KLA SL+GC
Sbjct  194   SGYRVEKLLKMAHQRLSTIAIGGFMCILISILVCPIWAGKELHLLITRNMDKLAYSLDGC  253

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             +++Y N  G             +K  GYKCVLN+KA+E+ MANFA WEP HG F F+HPW
Sbjct  254   VAEYFNNSGIPV----------EKSQGYKCVLNSKAAEETMANFARWEPAHGHFKFKHPW  303

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             +QYLK+GASMR CAYCIE L+G INS  QV   E I + +S  C R+ S    V+R+   
Sbjct  304   RQYLKVGASMRRCAYCIEALNGCINSENQV--PESIKQHLSGNCLRLGSVSSSVIRE---  358

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIP-PSSQSLTTQVEEAQKPSSDHLKQET  525
                                     L +  +T+   P +Q+L  +++ + +   + L    
Sbjct  359   ------------------------LAITMRTMKKSPRTQNLLKEMKNSVQELHNELGSLP  394

Query  524   KSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFR  369
                L        + L E+  ++TVASLL+E+AAR EG+V    +LA+LA+F+
Sbjct  395   NLLLPPPSIEATLPLEEVIPIATVASLLIEVAARIEGIVSATEELASLAKFK  446



>gb|KDO76671.1| hypothetical protein CISIN_1g011750mg [Citrus sinensis]
Length=478

 Score =   415 bits (1066),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 238/496 (48%), Positives = 330/496 (67%), Gaps = 70/496 (14%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSE----SRRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             ++ + DG+S  LV E    SR    V +++GG VL++W F++KAW LG  +PRKVIH +K
Sbjct  41    KIRVADGSSETLVPEAGLASRLWLGVKNMIGGLVLKVWRFLEKAWDLGVDDPRKVIHCLK  100

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG+AL++VSLFYY RPLY+ VGGNAMWA+MTVVVVFE TVGAT++KC+NR   T LAG L
Sbjct  101   VGIALTVVSLFYYTRPLYEGVGGNAMWAIMTVVVVFENTVGATIAKCLNRVFGTLLAGFL  160

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +GVHW+A+QSG+KL+P+I  AS+FLLA+AATFSRFIP+ KARFDYG  IFILTFSLV+V
Sbjct  161   ALGVHWIASQSGEKLEPLIAGASLFLLASAATFSRFIPTFKARFDYGALIFILTFSLVTV  220

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVDKL ++A QR+STI +GTS+CI ++ML+ P+WAG DL+ LI  N++KLA+S++G 
Sbjct  221   SGYRVDKLFNMAHQRISTIVIGTSLCILVSMLIRPIWAGKDLYNLIIRNMDKLANSIDG-  279

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
                                                     +ANFA WEP HGRFNFRHPW
Sbjct  280   ----------------------------------------LANFARWEPAHGRFNFRHPW  299

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             KQYLK+GA++R CAYCIE L+  INS  Q  + E+I K +   C RV S   +V+++L+K
Sbjct  300   KQYLKVGAAVRRCAYCIEALNACINSENQ--APEFIKKLLCNTCLRVSSNSSRVVKELAK  357

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
             ++K+  KSS  D+LV +MN+AV+ L+   K+L    S++ T++ +  +K SS       K
Sbjct  358   IIKTMKKSSTIDLLVEEMNAAVKELKDDLKSL--SLSEAGTSENKRTEKISS-------K  408

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQF-------RGQ  363
              A +       + LM +  + + AS  +EIA+R E +V+ V +LANLA+F       + Q
Sbjct  409   PAAA-------IPLMGMISMVSFASFQIEIASRIESIVEAVEELANLAEFEHPEKNKQNQ  461

Query  362   SDKKMAKQSQSQHKEQ  315
             ++ K+A   Q+  + +
Sbjct  462   ANIKVAANEQNDEETK  477



>ref|XP_009134496.1| PREDICTED: LOW QUALITY PROTEIN: aluminum-activated malate transporter 
10-like [Brassica rapa]
Length=506

 Score =   415 bits (1067),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 240/510 (47%), Positives = 324/510 (64%), Gaps = 52/510 (10%)
 Frame = -3

Query  1766  VNMPDGTSRVLVSESRRRGKVYDIVGGFVL-----RIWSFIDKAWQLGKKEPRKVIHGVK  1602
             +N+ +G +  LV +S    +++  + G V+     R+  F+ K W++G  +P KV+H +K
Sbjct  14    INVDNGATERLVPKSGPSIRIFLWLKGLVMKVILERLSKFMRKTWKIGADDPAKVVHCLK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VGLALSLVS+FYY+RPLYD VGGNAMWA+MTVVVVFE  VG  + K  NR VAT LAGSL
Sbjct  74    VGLALSLVSIFYYMRPLYDGVGGNAMWAIMTVVVVFESNVGINILKMCNRVVATILAGSL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
             GI VHWVANQSG K +  ++  SVFL A AAT+SRF+PS KARFDYG  IFILTFSLVSV
Sbjct  134   GIAVHWVANQSG-KAEIFVIGCSVFLFAFAATYSRFVPSFKARFDYGAMIFILTFSLVSV  192

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
              GYRVDKL+D+AQ+R+STIA+GTSICI I +  CP+WAG  LHRL+  N  KLADSL+GC
Sbjct  193   GGYRVDKLVDMAQERVSTIAIGTSICIIITVFFCPIWAGTQLHRLVQRNFVKLADSLDGC  252

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAM-------------------  939
             + +Y     D   +++ D+ +  KL G+KCVLN+K +E++M                   
Sbjct  253   VEEYF-KKKDISTNENQDEETNMKLQGFKCVLNSKGTEESMVTXKVYLHFFFFAAAYDFL  311

Query  938   ------ANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
                   AN A WEP HG FNFRHPW+QY+KIGA+MR CAYC+E L   ++   +V   + 
Sbjct  312   FIIITQANLARWEPAHGSFNFRHPWQQYVKIGAAMRRCAYCLENLSTCMSYETEV--PDK  369

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
             + +   + C ++ S   K+LR+L+ +M +T KSS  D LV DMNSAV+ LQ   KT+   
Sbjct  370   VKRHFGDACLKLSSASSKILRELADMMNNTRKSSKMDFLVFDMNSAVQELQETLKTV---  426

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
                 + T   E + P+++  +  + S            L E+  ++T+ SLL+E AAR +
Sbjct  427   ---PVKTNKPEEEVPNNNEDRTMSMS------------LHEVLPVATLVSLLIENAARIQ  471

Query  416   GVVKEVNQLANLAQFRGQSDKKMAKQSQSQ  327
               V+ V++LANLA F+  S KK       Q
Sbjct  472   NTVEAVDELANLADFKQDSKKKTGDNKAKQ  501



>ref|XP_004308292.1| PREDICTED: aluminum-activated malate transporter 10-like [Fragaria 
vesca subsp. vesca]
Length=493

 Score =   414 bits (1064),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 244/487 (50%), Positives = 325/487 (67%), Gaps = 34/487 (7%)
 Frame = -3

Query  1769  RVNMPDGTSRVL-VSESRRRGKVY----DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGV  1605
              +N+ DGT +V+ V E R   K +     +VGG +L++W F+ KAW LG  EP+K+IH +
Sbjct  14    NINVRDGTKQVVAVPELRLVDKAWLQLKSVVGGLILKVWRFLVKAWNLGVAEPKKIIHAM  73

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVGLAL++VSL YYLR +Y+ VGGNAMWAVMTVVVVFE +VGATL K +NR  AT LAGS
Sbjct  74    KVGLALTIVSLCYYLRSMYEGVGGNAMWAVMTVVVVFESSVGATLYKSINRVAATSLAGS  133

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             LG+GVHW++ +SG+K +PII+  SVF LA+AATFSRFI S+K+RFDYG  IFILTF+LVS
Sbjct  134   LGLGVHWISYKSGEKFEPIIIGISVFFLASAATFSRFISSVKSRFDYGAVIFILTFTLVS  193

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEG  1065
             VSGYRV+++ +LA QRL TI +GTS CI I++   P WAG +LHRLI  NLEKLADSL+G
Sbjct  194   VSGYRVNEISELAFQRLLTIFIGTSFCILISIFFYPTWAGAELHRLIYQNLEKLADSLDG  253

Query  1064  CISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAM---------ANFAVWEPG  912
              +  Y     D + +   D    K + GYK VL++KA+ED +         ANFA WEP 
Sbjct  254   YVIRYF----DDNGNVAEDSNHNKAIKGYKYVLDSKATEDNLVIIVASTFQANFARWEPA  309

Query  911   HGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCST  732
             HG FNF HPWKQYLKIGAS+R+ AYCIE L G ++S +Q     Y+ K VS  C+ +  +
Sbjct  310   HGGFNFYHPWKQYLKIGASLRSSAYCIEALRGCMDSESQAPGIWYLKKHVSNACKTINKS  369

Query  731   CGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKP  552
                +LR+L+  +K+ TKSS   +LV +MN+AV+ LQ++ K++  PS     T  E A + 
Sbjct  370   SSDILRELAITVKTMTKSSKMGLLVQEMNTAVQKLQISLKSI--PSCLIAPTSEETADEA  427

Query  551   SSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQF  372
                      K+ ++         L+E+  L+T  SLL+E AAR  G+V  VN+LA +   
Sbjct  428   PFR------KTCITP--------LVEVIPLTTFVSLLIENAARINGIVDAVNELAVMVDM  473

Query  371   RGQSDKK  351
             +  S KK
Sbjct  474   KHGSSKK  480



>ref|XP_006444802.1| hypothetical protein CICLE_v10024564mg [Citrus clementina]
 gb|ESR58042.1| hypothetical protein CICLE_v10024564mg [Citrus clementina]
Length=495

 Score =   414 bits (1064),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 242/488 (50%), Positives = 325/488 (67%), Gaps = 26/488 (5%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYD-----IVGGFVLRIWSFIDKAWQLGKKEPRKVIHGV  1605
             R+N+ DG S  L  E+    + +      ++GGF+L+I  F++KAW L   EP+KVIHG+
Sbjct  12    RINVSDGVSERLEPETGAILRAWTWFKRLMLGGFILKICKFLEKAWNLAVDEPKKVIHGL  71

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVGLA+SLVSLFYY+RPLYD VGGNAMWAVMTVVVVFE +VGATL KC+NR + TFLAGS
Sbjct  72    KVGLAISLVSLFYYMRPLYDGVGGNAMWAVMTVVVVFESSVGATLGKCINRAIGTFLAGS  131

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             LG+GVHW+A  SG+ L+PI+L  S+F      +FS  I SI     Y      +   LVS
Sbjct  132   LGVGVHWIAFHSGKNLEPIVLGISLFPF----SFSSNILSI-----YANNQSQIRLCLVS  182

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEG  1065
             VSGYRVD+LL+LAQQRLSTIA+G SICI I+ML CP+WAGD+LH LI  NLEKLA SL+ 
Sbjct  183   VSGYRVDRLLELAQQRLSTIAIGASICIIISMLFCPMWAGDELHLLICQNLEKLAHSLDE  242

Query  1064  CISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHP  885
             C+ +Y             D+A  KK+ GY+C LN+KA+E+  ANFA WEP HGRF+FRHP
Sbjct  243   CVVEYF---RHNKTSTAKDEACSKKMKGYRCALNSKATEELKANFARWEPAHGRFSFRHP  299

Query  884   WKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDls  705
             WKQYLKIGAS+R CAYCIETLHG ++S  Q  +  ++ + ++  C R+ S+   VL++L+
Sbjct  300   WKQYLKIGASIRNCAYCIETLHGCVDSETQ--APPHLKRHLNNICMRLSSSSSNVLQELA  357

Query  704   klmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQET  525
               +K+  +SS  ++ V +MN AV+ L+ A  +L  P+          +   +S +   E 
Sbjct  358   FALKTMKQSSKINLSVGEMNFAVQELKHALISL--PNHNISIKNPSPSTVEASGNCNTEP  415

Query  524   KSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMA  345
              +++           MEI  L+T+ASLL+E AA+ E +V  VN+LA LA+F+  +D K +
Sbjct  416   ITSIRASSS-----FMEILPLATLASLLIENAAKIEVIVNGVNELAVLAEFKPTTDNKKS  470

Query  344   KQSQSQHK  321
             K +QS  K
Sbjct  471   KSNQSPKK  478



>ref|XP_008233172.1| PREDICTED: LOW QUALITY PROTEIN: aluminum-activated malate transporter 
10 [Prunus mume]
Length=475

 Score =   412 bits (1060),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 249/495 (50%), Positives = 320/495 (65%), Gaps = 48/495 (10%)
 Frame = -3

Query  1766  VNMPDGTSRVLVSESRRRGKVY----DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKV  1599
             +N+PDGT+ VLV ES    KV+     ++GG  L++W F+ KAW LG  EP+K IH +KV
Sbjct  15    INVPDGTTNVLVPESGIVDKVWLELKGVLGGLRLKVWRFLLKAWDLGVAEPKKAIHALKV  74

Query  1598  GLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLG  1419
             GLALS+VSLFYY+R LY+  GGNAMW VMTVV VFE TVGATL K +NR   TFLAGSLG
Sbjct  75    GLALSIVSLFYYMRSLYESFGGNAMWTVMTVVEVFESTVGATLYKSINRAAGTFLAGSLG  134

Query  1418  IGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVS  1239
             +GVHW+A +SG+K +PII+  SVF  A+AATFS FIPS+K+RFDYG  IFILTFSLVSVS
Sbjct  135   LGVHWIAYKSGEKFEPIIIGISVFFFASAATFSXFIPSVKSRFDYGALIFILTFSLVSVS  194

Query  1238  GYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCI  1059
             GYRV +L +LA  RLSTI +GTS CI I+ML    WAGD+LHRLI  NLEKLADSL+G +
Sbjct  195   GYRVGELSELAYDRLSTIGIGTSFCILISMLXYHTWAGDELHRLIYRNLEKLADSLDGHV  254

Query  1058  SDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRH---  888
              +Y       ++    D    +++ GYKCVL++KA+ED  A  A WEP HG FNF+H   
Sbjct  255   LEYF----KDNEAVTEDNCPTEEIKGYKCVLDSKATEDNWAKLARWEPAHGSFNFKHQWK  310

Query  887   PWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKP-VSEECRRVCSTCGKVLRD  711
              WKQYLKIGASMR+CAYCIE L   + S  Q  +A   LK  +S  C+        +LR+
Sbjct  311   QWKQYLKIGASMRSCAYCIEALSSCMESETQTPAAIGQLKKHLSNACKTTNKYSSGILRE  370

Query  710   lsklmksttksSIQDILVHDMNSAVEALQLAFKT----LIPPSSQSLTTQVEEAQKPSSD  543
             L+K +K+ TKSS    LV +MN+AV+ LQ + K+    LI P+ +               
Sbjct  371   LAKTIKTMTKSSDMGSLVWEMNNAVQELQNSLKSVPIGLIAPTPED--------------  416

Query  542   HLKQETKSALSDDDDHD--LVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFR  369
                       +DD   +  +  ++E+  ++T+ SLL+E AAR  G+V  VN+LA      
Sbjct  417   ----------TDDGRGESFITPVVEVLPVTTLVSLLIENAARINGIVDAVNELA------  460

Query  368   GQSDKKMAKQSQSQH  324
             GQ D K A Q  S+ 
Sbjct  461   GQVDMKPAPQENSKQ  475



>ref|XP_010934557.1| PREDICTED: aluminum-activated malate transporter 10-like [Elaeis 
guineensis]
Length=478

 Score =   412 bits (1060),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 239/477 (50%), Positives = 320/477 (67%), Gaps = 44/477 (9%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGK----VYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             RV +P GTS  L  ES    +    +Y +V    L++  F+ KAW++G  +PRKV+HG+K
Sbjct  14    RVMVPCGTSLKLEMESGSIDQEGLWLYHLVLAAKLKVSGFMKKAWKIGADDPRKVVHGIK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VGLAL+LVS+FYY RPLYD VGG AMWA+MTVVVVFE+TVG +L K +NR +AT  AG+L
Sbjct  74    VGLALALVSVFYYTRPLYDGVGGTAMWAIMTVVVVFEFTVGGSLYKGLNRAIATLSAGAL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +G+HW+A++S +  + IIL ++VF L++AATFSRFIP++K +FDYG TIFILTFSLV++
Sbjct  134   AVGIHWLASKSKETAEHIILGSAVFFLSSAATFSRFIPTVKVQFDYGITIFILTFSLVAL  193

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVD+L DLA++RL+TIA+G SIC+ + +L+CPVWAG+DLH LIT N+EKLADSL  C
Sbjct  194   SGYRVDELFDLAKRRLTTIAIGVSICLLVCILICPVWAGEDLHLLITRNMEKLADSLVVC  253

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             +  YL           + +AS + L GYKCVLN+KASED++AN A WEP HGRF+FR+PW
Sbjct  254   VDKYL----KEGGIDGDKEASCQNLQGYKCVLNSKASEDSLANLARWEPAHGRFSFRYPW  309

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             +QY K+ A+MR CAYCIETL+  INS  Q  +   I K +S+ C ++   C KVL++L+ 
Sbjct  310   RQYQKVSAAMRDCAYCIETLNSCINSETQ--APHSIKKHISDVCVKLSLECSKVLKELAS  367

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
              +KS  KS+  + LV +MN+AVE L  AF++L                            
Sbjct  368   SIKSMKKSARINYLVGEMNNAVEELLDAFRSL----------------------------  399

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKK  351
                      D V L E   + TVASLL+EI+ RT+ VV  V  LA+LA F     +K
Sbjct  400   ------QQADSVPLFESLPVVTVASLLIEISVRTDRVVDAVEDLASLACFEPADSEK  450



>ref|XP_002452765.1| hypothetical protein SORBIDRAFT_04g032070 [Sorghum bicolor]
 gb|EES05741.1| hypothetical protein SORBIDRAFT_04g032070 [Sorghum bicolor]
Length=500

 Score =   413 bits (1062),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 236/458 (52%), Positives = 311/458 (68%), Gaps = 35/458 (8%)
 Frame = -3

Query  1664  FIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeyt  1485
             F  K W++   +PRK +HG+KVGLAL+LVS+FYY RPLYD VGG AMWA+MTVVVVFEYT
Sbjct  56    FARKVWRIAADDPRKAVHGLKVGLALALVSVFYYTRPLYDGVGGAAMWAIMTVVVVFEYT  115

Query  1484  vgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPS  1305
             VG ++ KC NR VAT  AG L +GVHWVA++SG+ L+P+I+  S+FLLAAAATFSRFIP+
Sbjct  116   VGGSVYKCFNRVVATASAGVLALGVHWVADRSGE-LEPVIVTGSLFLLAAAATFSRFIPT  174

Query  1304  IKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAG  1125
             +KARFDYG TIFILT+SLV+VSGYRVD+L  LAQQRLSTIA+G  +C+ ++ML+CPVW+G
Sbjct  175   VKARFDYGVTIFILTYSLVAVSGYRVDQLAALAQQRLSTIAIGIFLCLAVSMLICPVWSG  234

Query  1124  DDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASED  945
              +LH L T N++KLAD++E C+ DY       +      ++++ K  GYKCVLN+KASED
Sbjct  235   AELHLLTTRNMDKLADAVEACVEDYF---AAEEPTPAARQSTKSKSDGYKCVLNSKASED  291

Query  944   AMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKP  765
             A AN A WEP HGRF FRHP+ QY K+GA+MRACAYC+E L  S  + A+V +  ++ + 
Sbjct  292   AQANLARWEPAHGRFGFRHPYAQYAKVGAAMRACAYCVEAL--SSCARAEVQAPPHVKRL  349

Query  764   VSEECRRVCSTCGKVLRDlsklmksttksSIQ---DILVHDMNSAVEALQLAFKTLIPPS  594
             + + C RV + C +VLR+ S+ + + T SS     D  V DMN+AV+ LQ   +TL  PS
Sbjct  350   LRDVCARVGARCARVLREASRSVATMTTSSSSRTLDFAVADMNTAVQELQGDMRTL--PS  407

Query  593   SQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEG  414
             +             ++  L  ET S            LM+   + TVASLLVEI+AR EG
Sbjct  408   TVL-----------AAKLLAAETTS------------LMDTMPVFTVASLLVEISARVEG  444

Query  413   VVKEVNQLANLAQFRGQSDKKMAKQSQSQHKEQNVQTH  300
             VV  V++LA LA F+ Q D       +    E  ++ H
Sbjct  445   VVDAVDELATLASFK-QVDDDDDDDDKKGETEMTIKVH  481



>ref|NP_001047711.1| Os02g0673100 [Oryza sativa Japonica Group]
 dbj|BAD27825.1| aluminum-activated malate transporter-like [Oryza sativa Japonica 
Group]
 dbj|BAD29455.1| aluminum-activated malate transporter-like [Oryza sativa Japonica 
Group]
 dbj|BAF09625.1| Os02g0673100 [Oryza sativa Japonica Group]
 dbj|BAG98571.1| unnamed protein product [Oryza sativa Japonica Group]
Length=488

 Score =   412 bits (1059),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 238/487 (49%), Positives = 312/487 (64%), Gaps = 46/487 (9%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSES----RRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             RV +P+G+S  +  E+    R    V  ++      +  F  K W++G  +PR+ +H +K
Sbjct  17    RVTVPEGSSVTVEHEAGVAERAWAWVVRMLVAVRAAVAGFARKVWKIGADDPRRAVHSLK  76

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VGLAL+LVS+ YY RP+YD VGGNAMWAVMTVVVVFEYTVG  + K  NR VAT  AG L
Sbjct  77    VGLALTLVSIVYYTRPVYDGVGGNAMWAVMTVVVVFEYTVGGCMYKGFNRAVATASAGLL  136

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +GV+WVA++SG KL+P IL  S+FLLAAAATFSRFIP++KARFDYG TIFILTFSLV+V
Sbjct  137   ALGVNWVADKSGDKLEPFILSGSLFLLAAAATFSRFIPTVKARFDYGVTIFILTFSLVAV  196

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVD+LLDLAQQR+STI +G  IC+ + +++ PVWAG +LH L   N+EKLA ++EGC
Sbjct  197   SGYRVDQLLDLAQQRMSTIGIGIVICLAVCVVIWPVWAGQELHLLTVRNMEKLAGAVEGC  256

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             + DY              K +  K  GYKCVLN+KASED+ AN A WEP HGRF FRHP+
Sbjct  257   VEDYF-----------AAKPAAAKSEGYKCVLNSKASEDSQANLARWEPPHGRFGFRHPY  305

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
              QY K+GA+MR CAYC+E L+  +   A+V + E++ + + + C R+ S C +VLR+ S 
Sbjct  306   AQYTKVGAAMRHCAYCVEALNSCVR--AEVQAPEHVKRLLGDVCTRLASQCARVLREAST  363

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
              + + T     D  V DMN+AV  LQ   + L PP                   L  E  
Sbjct  364   SVAAMTSPKTLDFAVADMNTAVHELQGDLRAL-PPV------------------LALEPA  404

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAK  342
             + +S         LM+   L TVASLL+EI+AR EGVV  V  LA+LA F+ Q +    K
Sbjct  405   AEMS---------LMDAMPLFTVASLLIEISARIEGVVDAVETLASLASFK-QVEDDDDK  454

Query  341   QSQSQHK  321
             + Q++ K
Sbjct  455   KGQTEMK  461



>gb|KEH42891.1| aluminum activated malate transporter family protein [Medicago 
truncatula]
Length=484

 Score =   411 bits (1057),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 234/453 (52%), Positives = 310/453 (68%), Gaps = 29/453 (6%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++  F+ KAW++G  +PRK IH +KVG+AL+ VSLFYYL PLYD VG NAMWAVMTVVVV
Sbjct  42    KLCKFMKKAWEIGVNDPRKFIHCLKVGIALTAVSLFYYLNPLYDGVGRNAMWAVMTVVVV  101

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FEYT G+T+ K VNR   T LAG L  GV WVA+++G++L+P+I+   +FLL +AATFSR
Sbjct  102   FEYTAGSTIYKSVNRICGTTLAGLLAFGVQWVASKAGKQLEPVIVGVLLFLLGSAATFSR  161

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             FIP+IKARFDYG  IFILTFSLVS+SGYR+D+L D+AQQR+STI +GTS+CI ++M++ P
Sbjct  162   FIPTIKARFDYGVLIFILTFSLVSISGYRIDELFDMAQQRISTIIIGTSLCIIVSMIIRP  221

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG +L+ L+T NL+KLA+SLEGC++ Y        + +   + S KKL+ YKCVLN+K
Sbjct  222   VWAGLELYVLVTGNLDKLANSLEGCVAQYF-------EAQSTSEESNKKLMDYKCVLNSK  274

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             A+E +MAN A WEP HGRFNFRHPWKQYL+IGA+MR CA CI+ L G INS  +  S++ 
Sbjct  275   ATEVSMANLARWEPAHGRFNFRHPWKQYLEIGATMRRCASCIDALVGCINSENK--SSDE  332

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
             I K +S    +V +    VLR+LS  + + TKS   D LV +MN A + LQ   K     
Sbjct  333   IKKIMSTTSMKVGANSASVLRELSITINNMTKSKKLDSLVKEMNIATQELQNLLK-----  387

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
              S S T  V   +  S    K E             + +ME+ Q+ TV SLL+E  AR E
Sbjct  388   -SYSNTHNVNAKETSSLGDAKME-------------IPIMEVIQVVTVISLLIETVARVE  433

Query  416   GVVKEVNQLANLAQFRGQSDK-KMAKQSQSQHK  321
              +VK V +L+ LA+F+ +  K   +KQ  +Q+K
Sbjct  434   DIVKSVEELSKLAKFKPEMSKCDKSKQRSTQNK  466



>gb|EAY87040.1| hypothetical protein OsI_08439 [Oryza sativa Indica Group]
Length=488

 Score =   410 bits (1054),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 237/487 (49%), Positives = 311/487 (64%), Gaps = 46/487 (9%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSES----RRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             RV +P+G+   +  E+    R    V  ++      +  F  K W++G  +PR+ +H +K
Sbjct  17    RVTVPEGSPVTVEHEAGVAERAWAWVVRMLVAVRAAVAGFARKVWKIGADDPRRAVHSLK  76

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VGLAL+LVS+ YY RP+YD VGGNAMWAVMTVVVVFEYTVG  + K  NR VAT  AG L
Sbjct  77    VGLALTLVSIVYYTRPVYDGVGGNAMWAVMTVVVVFEYTVGGCMYKGFNRAVATASAGLL  136

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +GV+WVA++SG KL+P IL  S+FLLAAAATFSRFIP++KARFDYG TIFILTFSLV+V
Sbjct  137   ALGVNWVADKSGDKLEPFILSGSLFLLAAAATFSRFIPTVKARFDYGVTIFILTFSLVAV  196

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVD+LLDLAQQR+STI +G  IC+ + +++ PVWAG +LH L   N+EKLA ++EGC
Sbjct  197   SGYRVDQLLDLAQQRMSTIGIGIVICLAVCVVIWPVWAGHELHLLTVRNMEKLAGAVEGC  256

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             + DY              K +  K  GYKCVLN+KASED+ AN A WEP HGRF FRHP+
Sbjct  257   VEDYF-----------AAKPAAAKSEGYKCVLNSKASEDSQANLARWEPPHGRFGFRHPY  305

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
              QY K+GA+MR CAYC+E L+  +   A+V + E++ + + + C R+ S C +VLR+ S 
Sbjct  306   AQYTKVGAAMRHCAYCVEALNSCVR--AEVQAPEHVKRLLGDVCTRLASQCARVLREAST  363

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
              + + T     D  V DMN+AV  LQ   + L PP                   L  E  
Sbjct  364   SVAAMTSPKTLDFAVADMNTAVHELQGDLRAL-PPV------------------LALEPA  404

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAK  342
             + +S         LM+   L TVASLL+EI+AR EGVV  V  LA+LA F+ Q +    K
Sbjct  405   AEMS---------LMDAMPLFTVASLLIEISARIEGVVDAVETLASLASFK-QVEDDDDK  454

Query  341   QSQSQHK  321
             + Q++ K
Sbjct  455   KGQTEMK  461



>ref|XP_009334385.1| PREDICTED: aluminum-activated malate transporter 10 [Pyrus x 
bretschneideri]
Length=507

 Score =   410 bits (1055),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 243/495 (49%), Positives = 325/495 (66%), Gaps = 47/495 (9%)
 Frame = -3

Query  1766  VNMPDGTSRVLVSESRRRGK----VYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKV  1599
             +N+ DGT+   V ES    K    +   VGG VL++W F+ KAW+LG  EPRK IH +KV
Sbjct  15    INVADGTNNASVPESELVDKALLGLKGAVGGLVLKVWRFLVKAWKLGVAEPRKAIHALKV  74

Query  1598  GLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLG  1419
             GLA+S+V LFYY+R LY+ VGGNAMWAVMTVVVVFE TVGATL K +NR   TFLAGSLG
Sbjct  75    GLAISVVLLFYYMRSLYEGVGGNAMWAVMTVVVVFESTVGATLYKSINRAAGTFLAGSLG  134

Query  1418  IGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVS  1239
             +GVHW++ ++GQ  + II+  SVFLLA+AATFSRFIP +K+RFDYG  IFILTF+LVS+S
Sbjct  135   LGVHWISCKAGQNFEAIIIGTSVFLLASAATFSRFIPPVKSRFDYGALIFILTFTLVSIS  194

Query  1238  GYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCI  1059
             GYRV++L +LA  RL T+ +GT  CI I++L  P WAG  LH +I NNLEKLADSL+G +
Sbjct  195   GYRVEELFELAYDRLLTVGIGTFFCILISILFYPNWAGQQLHCVIYNNLEKLADSLDGYV  254

Query  1058  SDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWK  879
              +Y       ++    +  S K++ GYKCVL++KA+ED MA FA WEP HG FNF+HPWK
Sbjct  255   LEYF----KDNEAVTENNCSTKQINGYKCVLDSKATEDNMAKFARWEPAHGSFNFKHPWK  310

Query  878   QYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKP-VSEECRRVCSTCGKVLRDlsk  702
             QYLKIGASMR+CAYC+E L   + S  ++ +    LK   S  C+        +LR+L+K
Sbjct  311   QYLKIGASMRSCAYCVEALSACMESEIKMPAGIGNLKKHFSNACKTTNKHSSDILRELAK  370

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKT----LIPPSSQSLTTQVEEAQKPSSDHLK  534
              +K+  KSS  D LV +MN AV+ LQ + K+    L+ P+S++                 
Sbjct  371   TIKTMKKSSEIDSLVWEMNKAVQELQKSLKSVPIWLVLPTSEA-----------------  413

Query  533   QETKSALSDDDDHD---LVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQ  363
                    +DDD      +  L+E+  ++T+ SLL+E AAR  G+V  VN+L+       Q
Sbjct  414   -------TDDDGKGEPIVAPLVEVLPVTTLVSLLIENAARISGIVDAVNELSV------Q  460

Query  362   SDKKMAKQ-SQSQHK  321
             +D K A Q +++QH+
Sbjct  461   ADMKPAPQGNKTQHQ  475



>gb|KEH42890.1| aluminum activated malate transporter family protein [Medicago 
truncatula]
Length=473

 Score =   409 bits (1050),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 233/463 (50%), Positives = 313/463 (68%), Gaps = 35/463 (8%)
 Frame = -3

Query  1706  VYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNA  1527
             ++  +     ++  F+ KAW++G  +PRK IH +KVG+AL+ VSLFYYL+PLYD VG NA
Sbjct  26    MWSFISSLYSKLCKFVKKAWEIGVNDPRKFIHCLKVGIALTAVSLFYYLKPLYDGVGRNA  85

Query  1526  MWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVF  1347
             MWAVMTV+VVFEYT GAT+ K VNR   T LAG L  GVHWVA+++G + +P+I+ AS+F
Sbjct  86    MWAVMTVIVVFEYTAGATIYKSVNRIFGTTLAGLLAFGVHWVASKAGDQWEPVIVGASLF  145

Query  1346  LLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSI  1167
             LLA+A TFSRFIP+IKARFDYG  IFILTFSLVSVSGYRVD+L +LAQQR+STI +GTS+
Sbjct  146   LLASATTFSRFIPTIKARFDYGALIFILTFSLVSVSGYRVDELFNLAQQRISTIIIGTSL  205

Query  1166  CIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKL  987
             CI ++  + PVWAG +LH L+T NL+KLA+SL+GC + Y         +      S K L
Sbjct  206   CIIVSTAVLPVWAGLELHVLVTGNLDKLANSLQGCAAQYF--------EAQAASESNKNL  257

Query  986   LGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSIN  807
             +GYKC LN+KA+E+++AN A WEP HGRFNFRHPWKQYLKIGA+MR+CA CI+ L G IN
Sbjct  258   MGYKCALNSKATEESLANLARWEPAHGRFNFRHPWKQYLKIGATMRSCASCIDALIGCIN  317

Query  806   SSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEAL  627
             S  +  +++ I+K +S    +V      VLR+L+  +K   KS+  DILV +MN+A   L
Sbjct  318   SENK--TSDDIMKIMSRTSIKVGDNSANVLRELASTIKKMKKSNKLDILVIEMNNAALEL  375

Query  626   QLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVAS  447
             Q   K+   P++Q                     K+A  D D    + ++E+ Q+ TV S
Sbjct  376   QNLLKSY--PNTQ---------------------KNA-KDGDAKLEIPIIELIQVVTVVS  411

Query  446   LLVEIAARTEGVVKEVNQLANLAQFRGQSDK-KMAKQSQSQHK  321
             LL EI AR E +VK V +L++LA+F+ +  K    KQ  + +K
Sbjct  412   LLSEIVARVEDIVKCVEELSDLAKFKPEMSKCDKTKQHSTDNK  454



>ref|XP_008810443.1| PREDICTED: aluminum-activated malate transporter 10-like [Phoenix 
dactylifera]
Length=463

 Score =   406 bits (1043),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 236/474 (50%), Positives = 324/474 (68%), Gaps = 44/474 (9%)
 Frame = -3

Query  1760  MPDGTSRVLVSES----RRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGL  1593
             +P G+S  L  ES    R    +Y +V    L++  F+ +AW++G  +PRK +H +KVGL
Sbjct  2     VPGGSSVRLEMESGPVDREWPWLYHLVLAAKLKVSGFMKRAWKIGADDPRKAVHCIKVGL  61

Query  1592  ALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIG  1413
             AL+LVS+FYY+RPLYD VGG AMWA+MTVVV+FE+TVG +L K +NR +AT  AG+L +G
Sbjct  62    ALTLVSVFYYIRPLYDGVGGTAMWAIMTVVVIFEFTVGGSLYKGLNRAIATLSAGALAVG  121

Query  1412  VHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGY  1233
             +HW+A++SG+  + +IL ++VFLL++AATFSRFIP+IK +FDYG TIFILTF+LV++SGY
Sbjct  122   IHWLASKSGETAEHMILGSAVFLLSSAATFSRFIPTIKVQFDYGITIFILTFNLVALSGY  181

Query  1232  RVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISD  1053
             RVD+LL+LA+QRL+T+A+G SIC+ + +L CPVWAG++LH LIT N+EKLADSL  C+  
Sbjct  182   RVDELLELAEQRLTTVAIGISICLLVCILGCPVWAGEELHLLITCNMEKLADSLVVCVDK  241

Query  1052  YLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQY  873
             YL           + +AS + L GYKCVLN+KASED++AN A WEP HGRF FR+PW+QY
Sbjct  242   YL----QEGGIDGDKEASHQNLQGYKCVLNSKASEDSLANLARWEPAHGRFRFRYPWRQY  297

Query  872   LKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmk  693
             LK+GA+MR CAYCIETL+  +NS ++  + EYI K + + C ++   C +VL++L+  +K
Sbjct  298   LKVGAAMRYCAYCIETLNSCMNSESR--APEYIKKHIRDGCVKLSLECSEVLKELASSIK  355

Query  692   sttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSAL  513
             S  KSS  + LV + N+AVE L  AFK+L                        Q+  SA 
Sbjct  356   SMKKSSRINYLVGEKNNAVEELLDAFKSL------------------------QQADSA-  390

Query  512   SDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKK  351
                       L+    L TVASLL+EI+ RT+GVV  V  LA+LA F     +K
Sbjct  391   ---------PLLGSLPLVTVASLLIEISVRTDGVVDAVETLASLACFEPVDGEK  435



>ref|XP_004495501.1| PREDICTED: aluminum-activated malate transporter 10-like [Cicer 
arietinum]
Length=473

 Score =   406 bits (1043),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 236/487 (48%), Positives = 326/487 (67%), Gaps = 45/487 (9%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLA  1590
             R+ + DG  +  V+       ++ ++  F  ++  FI KAW++G  +PRK IH +KVG+A
Sbjct  10    RIKVEDGRWKKAVTSC----SMWTLIASFYSKLSKFIKKAWEIGVNDPRKFIHCLKVGIA  65

Query  1589  LSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGV  1410
             L+ VSLFYYL+PLYD VG NAMWAVMTV+VVFEYT GAT+ K +NR   T LAG L  GV
Sbjct  66    LTSVSLFYYLKPLYDGVGRNAMWAVMTVIVVFEYTAGATIYKSINRICGTTLAGLLAFGV  125

Query  1409  HWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYR  1230
             HWVA+++G++ +P+I+  S+FLLA+AATFSRFIP+IKARFDYG  IFILTFSLVSVSGYR
Sbjct  126   HWVASRAGEQWEPVIVGFSLFLLASAATFSRFIPTIKARFDYGAMIFILTFSLVSVSGYR  185

Query  1229  VDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDY  1050
             +D+L  +AQQR+STI +GTS+CI +++ + PVWAG +L+ L+T NL KLA+SL+GC+  Y
Sbjct  186   IDELFAMAQQRISTIIIGTSLCIIVSITIRPVWAGLELYVLVTGNLHKLANSLQGCVDQY  245

Query  1049  LnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYL  870
                     + +  ++ S KKL+GYKCVLN+KASED+MAN A WEP HG FNF HPWKQYL
Sbjct  246   F-------EAQTANEESNKKLMGYKCVLNSKASEDSMANLARWEPAHGNFNFCHPWKQYL  298

Query  869   KIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmks  690
             KIGA+MR CA CI+ L G I+S  +  +++ + K +S+   +V +    VLR+L+  +KS
Sbjct  299   KIGATMRRCASCIDALIGCIHSENK--TSDNMKKIMSQSSMKVGTNSACVLRELAITIKS  356

Query  689   ttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALS  510
              TKS+  DILV +MN++ + LQ   K+  P +  +   ++E                   
Sbjct  357   MTKSNKLDILVVEMNNSAQELQNLLKSY-PDTHNNSNAKME-------------------  396

Query  509   DDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQS  330
                    + ++EI Q+ TV SL+ EI AR E +VK V +L+NLA+F    +  M K  +S
Sbjct  397   -------IPIIEIIQVVTVVSLITEIVARVEDIVKSVEELSNLAKF----EPAMFKCDKS  445

Query  329   -QHKEQN  312
              QH   N
Sbjct  446   KQHSTDN  452



>gb|ACU21022.1| unknown [Glycine max]
Length=509

 Score =   406 bits (1044),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 243/471 (52%), Positives = 335/471 (71%), Gaps = 19/471 (4%)
 Frame = -3

Query  1712  GKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGG  1533
             G ++ +  G  L++  F+ KAW+LG  +PRK IH +KVG+ALS VSLFYY +PLYD VGG
Sbjct  29    GCIWAVTAGVALKLCKFVKKAWELGVNDPRKFIHCLKVGIALSAVSLFYYWKPLYDGVGG  88

Query  1532  NAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQAS  1353
             NAMWAVMTVVVVFEYT GAT+ K VNR   T LAG LGIGVHWVA+++G++ +P+I+  S
Sbjct  89    NAMWAVMTVVVVFEYTAGATICKTVNRMFGTSLAGFLGIGVHWVASRAGEQWEPVIVGVS  148

Query  1352  VFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGT  1173
             +FLLA+AATFSRFIP++KARFDYG  IFILTFSLVSVSGYRVD+LL +AQ R+ TI +G+
Sbjct  149   LFLLASAATFSRFIPTLKARFDYGILIFILTFSLVSVSGYRVDELLVMAQYRICTIIIGS  208

Query  1172  SICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEK  993
              +CI I++++ P+WAG +L  L+T NL+KLA+SL+ C++ Y    G  +  +D+D+ S+K
Sbjct  209   ILCIIISVIIRPIWAGFELFVLVTGNLDKLANSLQCCVAQYF---GGSEASEDSDEMSDK  265

Query  992   KLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGS  813
             KLLGYKCVL++KA+E+ MANFA WEP HGRFNFRHPW+QY+KIGASMR+CA C++ L G 
Sbjct  266   KLLGYKCVLSSKATEETMANFARWEPAHGRFNFRHPWRQYVKIGASMRSCASCLDALIGC  325

Query  812   INSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVE  633
             INS  Q  +++ + K +S    ++ + C  V+R+L+  ++   KSS  DILV DMNSA +
Sbjct  326   INSDNQ--ASDDMKKNMSSISMKLGANCASVIRELATTIRKMAKSSKLDILVTDMNSAAQ  383

Query  632   ALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDL-VYLMEIAQLST  456
              L    ++L+ P    +      A+      +  +T++A  DD    + + LMEI Q+ T
Sbjct  384   EL----RSLLNPYPNLVNAPSHNAK------ISTQTETASPDDQAAKIEIPLMEIIQVVT  433

Query  455   VASLLVEIAARTEGVVKEVNQLANLAQFRGQ---SDKKMAKQSQSQHKEQN  312
             VASLL+EI AR EG+V+ V +L+ LA F+ +     K+    S+    +QN
Sbjct  434   VASLLIEIVARVEGIVENVEELSVLANFQAEMCVKSKQHTSDSKVSPDQQN  484



>ref|XP_003556423.1| PREDICTED: aluminum-activated malate transporter 10 [Glycine 
max]
Length=495

 Score =   404 bits (1039),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 245/475 (52%), Positives = 334/475 (70%), Gaps = 27/475 (6%)
 Frame = -3

Query  1712  GKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGG  1533
             G ++ +  G  L++  F+ KAW+LG  +PRK IH +KVG+ALS VSLFYY +PLYD VGG
Sbjct  29    GCIWAVTAGVALKLCKFVKKAWELGVNDPRKFIHCLKVGIALSAVSLFYYWKPLYDGVGG  88

Query  1532  NAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQAS  1353
             NAMWAVMTVVVVFEYT GAT+ K VNR   T LAG LGIGVHWVA+++G++ +P+I+  S
Sbjct  89    NAMWAVMTVVVVFEYTAGATICKTVNRMFGTSLAGFLGIGVHWVASRAGEQWEPVIVGVS  148

Query  1352  VFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGT  1173
             +FLLA+AATFSRFIP++KARFDYG  IFILTFSLVSVSGYRVD+LL +AQ R+ TI +G+
Sbjct  149   LFLLASAATFSRFIPTLKARFDYGILIFILTFSLVSVSGYRVDELLVMAQYRICTIIIGS  208

Query  1172  SICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEK  993
              +CI I++++ P+WAG +L  L+T NL+KLA+SL+ C++ Y    G  +  +D+D+ S+K
Sbjct  209   ILCIIISVIIRPIWAGFELFVLVTGNLDKLANSLQCCVAQYF---GGSEASEDSDEMSDK  265

Query  992   KLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGS  813
             KLLGYKCVL++KA+E+ MANFA WEP HGRFNFRHPW+QY+KIGASMR+CA C++ L G 
Sbjct  266   KLLGYKCVLSSKATEETMANFARWEPAHGRFNFRHPWRQYVKIGASMRSCASCLDALIGC  325

Query  812   INSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVE  633
             INS  Q  +++ + K +S    ++ + C  V+R+L+  ++   KSS  DILV DMNSA +
Sbjct  326   INSDNQ--ASDDMKKNMSSISMKLGANCASVIRELATTIRKMAKSSKLDILVTDMNSAAQ  383

Query  632   ALQL---AFKTLI--PPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIA  468
              L+    ++  L+  P  +  ++TQ E A  P     K E             + LMEI 
Sbjct  384   ELRSLLNSYPNLVNAPSHNAKISTQTETAS-PDDQAAKIE-------------IPLMEII  429

Query  467   QLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQ---SDKKMAKQSQSQHKEQN  312
             Q+ TVASLL+EI AR EG+V+ V +L+ LA F+ +     K+    S+    +QN
Sbjct  430   QVVTVASLLIEIVARVEGIVENVEELSVLANFQAEMCVKSKQHTSDSKVSPDQQN  484



>gb|KHN05000.1| Aluminum-activated malate transporter 10 [Glycine soja]
Length=495

 Score =   404 bits (1037),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 245/475 (52%), Positives = 334/475 (70%), Gaps = 27/475 (6%)
 Frame = -3

Query  1712  GKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGG  1533
             G ++ +  G  L++  F+ KAW+LG  +PRK IH +KVG+ALS VSLFYY +PLYD VGG
Sbjct  29    GCMWAVTAGVALKLCKFVKKAWELGVNDPRKFIHCLKVGIALSAVSLFYYWKPLYDGVGG  88

Query  1532  NAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQAS  1353
             NAMWAVMTVVVVFEYT GAT+ K VNR   T LAG LGIGVHWVA+++G++ +P+I+  S
Sbjct  89    NAMWAVMTVVVVFEYTAGATICKTVNRMFGTSLAGFLGIGVHWVASRAGEQWEPVIVGVS  148

Query  1352  VFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGT  1173
             +FLLA+AATFSRFIP++KARFDYG  IFILTFSLVSVSGYRVD+LL +AQ R+ TI +G+
Sbjct  149   LFLLASAATFSRFIPTLKARFDYGILIFILTFSLVSVSGYRVDELLVMAQYRICTIIIGS  208

Query  1172  SICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEK  993
              +CI I++++ P+WAG +L  L+T NL+KLA+SL+ C++ Y    G  +  +D+D+ S+K
Sbjct  209   ILCIIISVIIRPIWAGFELFVLVTGNLDKLANSLQCCVAQYF---GGSEASEDSDEMSDK  265

Query  992   KLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGS  813
             KLLGYKCVL++KA+E+ MANFA WEP HGRFNFRHPW+QY+KIGASMR+CA C++ L G 
Sbjct  266   KLLGYKCVLSSKATEETMANFARWEPAHGRFNFRHPWRQYVKIGASMRSCASCLDALIGC  325

Query  812   INSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVE  633
             INS  Q  +++ + K +S    ++ + C  V+R+L+  ++   KSS  DILV DMNSA +
Sbjct  326   INSDNQ--ASDDMKKNMSSISMKLGANCASVIRELATTIRKMAKSSKLDILVTDMNSAAQ  383

Query  632   ALQL---AFKTLI--PPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIA  468
              L+    ++  L+  P  +  ++TQ E A  P     K E             + LMEI 
Sbjct  384   ELRSLLNSYPNLVNAPSHNAKISTQTETAS-PDDQAAKIE-------------IPLMEII  429

Query  467   QLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQ---SDKKMAKQSQSQHKEQN  312
             Q+ TVASLL+EI AR EG+V+ V +L+ LA F+ +     K+    S+    +QN
Sbjct  430   QVVTVASLLIEIVARVEGIVENVEELSVLANFQAEMCVKSKQHTSDSKVSPDQQN  484



>ref|XP_003570082.1| PREDICTED: aluminum-activated malate transporter 10 [Brachypodium 
distachyon]
Length=493

 Score =   403 bits (1036),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 227/470 (48%), Positives = 309/470 (66%), Gaps = 35/470 (7%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             RV +P+G +  +  E+    + +      V  F  ++  F  KAW++G  +PRK +HG+K
Sbjct  15    RVTVPEGATVTVEYEAGPAARAWAWLASCVAMFGTKVSGFGKKAWKIGADDPRKAVHGLK  74

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VGLAL+LVS+FYY RPLYD VGG AMWA+MTVVV+FEYTVG ++ K  NR +AT  AG +
Sbjct  75    VGLALTLVSVFYYTRPLYDGVGGAAMWAIMTVVVIFEYTVGGSVYKGFNRAIATASAGVI  134

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +GV+WVA++SG KL+P+I   S+F+LAAAATFSRFIP++KARFDYG TIFILT+SLV+V
Sbjct  135   ALGVNWVASKSGDKLEPVITCGSLFILAAAATFSRFIPTVKARFDYGVTIFILTYSLVAV  194

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVD+L  LAQQRL TIA+G  IC+ + +L+ PVWAG +LH L   N+EKLAD++EGC
Sbjct  195   SGYRVDELAALAQQRLVTIAIGIFICLAVCVLIWPVWAGQELHLLAVRNMEKLADAVEGC  254

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             + DY +        +    +S+ +  GYKCVLN+KASED+ AN A WEP HG+F FRHP+
Sbjct  255   VEDYFSDADADAAKRARVSSSKSE--GYKCVLNSKASEDSQANLARWEPAHGKFGFRHPY  312

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
              QY K+GA+MR CAYC+ETL+  + +  Q  + E++ + + + C R+   CG+VLR+ S 
Sbjct  313   GQYAKLGAAMRHCAYCVETLNSCVGADVQ--APEHVKRLLGDVCTRLGVQCGRVLREASS  370

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
                  T S   D +V DMN+AV  LQ   + L  P S                 L +E+ 
Sbjct  371   SFAEMTVSRTLDFVVADMNTAVHELQGDLREL--PVS-----------------LAKESA  411

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQF  372
             +  +         L++   L TVASLLVEI+AR E VV  V+ +A+LA F
Sbjct  412   AGSAS--------LIDAMPLFTVASLLVEISARVETVVDAVDTMASLASF  453



>ref|XP_006647674.1| PREDICTED: aluminum-activated malate transporter 10-like [Oryza 
brachyantha]
Length=488

 Score =   402 bits (1034),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 237/492 (48%), Positives = 308/492 (63%), Gaps = 52/492 (11%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIV--GGFVLR--IWSFIDKAWQLGKKEPRKVIHGVK  1602
             RV +P+G S  +  E+   G+ +  V      LR  +  F  K W++G  +PR+ +HG+K
Sbjct  15    RVTVPEGASVAVEHEAGAAGRAWAWVVACAVALRAAVAGFAGKVWKIGADDPRRAVHGLK  74

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VGLAL+LVS+ YY RP+YD VGGNAMWAVMT  VV EYTVG  + K  NR VAT  AG L
Sbjct  75    VGLALTLVSVVYYARPVYDGVGGNAMWAVMTGGVVSEYTVGGCMYKGFNRAVATASAGLL  134

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +GV+WVA++SG KL+P IL  S+FLLAAAATFSRFIP++KARFDYG TIFILTFSLV+V
Sbjct  135   ALGVNWVADKSGDKLEPFILSGSLFLLAAAATFSRFIPTVKARFDYGVTIFILTFSLVAV  194

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVD+LLDLAQQR+STI +G  IC+ I +++ PVWAG +LH L   N+EKLA ++EGC
Sbjct  195   SGYRVDQLLDLAQQRMSTIGIGIVICLAICVVIWPVWAGQELHLLTVRNMEKLAGAVEGC  254

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             + DY          K + +A+  +  GYKCVLN+KASEDA AN A WEP HGRF+FRHP 
Sbjct  255   VEDYF------AAAKPSSQAAGGRSEGYKCVLNSKASEDAQANLARWEPAHGRFSFRHPX  308

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
               Y + GA+MR CAYC+E L  S  + A+V + E+  + + + C R+ + C +VLR+ S 
Sbjct  309   XXYARGGAAMRHCAYCVEAL--SSCARAEVQAPEHAKRMLGDVCTRLAAQCARVLREASS  366

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIP-----PSSQSLTTQVEEAQKPSSDHL  537
              + + T     D  V DMN+AV  LQ+  + L P     P+  S                
Sbjct  367   SVAAMTDPKTLDFAVADMNTAVHELQVDLRALPPVLALGPAEMS----------------  410

Query  536   KQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSD  357
                               LM+   L TVASLL+EI+AR EGVV  V  LA LA FR Q +
Sbjct  411   ------------------LMDAMPLFTVASLLIEISARVEGVVDAVETLATLANFR-QVE  451

Query  356   KKMAKQSQSQHK  321
                 K+ Q++ K
Sbjct  452   DDDDKKGQTEMK  463



>gb|KHN14754.1| Aluminum-activated malate transporter 10 [Glycine soja]
Length=663

 Score =   408 bits (1048),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 241/468 (51%), Positives = 330/468 (71%), Gaps = 23/468 (5%)
 Frame = -3

Query  1712  GKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGG  1533
             G ++ +  G  L++  F+ KAW+LG  +PRK IH +KVG+ALS VSLFYY +PLYD VGG
Sbjct  197   GCMWAVTAGVALKLCKFVKKAWELGVNDPRKFIHCLKVGIALSAVSLFYYWKPLYDGVGG  256

Query  1532  NAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQAS  1353
             NAMWAVMTVVVVFEYT GAT+ K VNR   T LAG LGIGVHWVA+++G++ +P+I+  S
Sbjct  257   NAMWAVMTVVVVFEYTAGATICKTVNRMFGTSLAGFLGIGVHWVASRAGEQWEPVIVGVS  316

Query  1352  VFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGT  1173
             +FLLA+AATFSRFIP++KARFDYG  IFILTFSLVS+SGYRVD+LL +AQ R+ TI +G+
Sbjct  317   LFLLASAATFSRFIPTLKARFDYGILIFILTFSLVSISGYRVDELLVMAQYRVCTIIIGS  376

Query  1172  SICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEK  993
              +CI +++++ P+WAG +L  L+T NL+KLA+SL  C+  Y    G    + ++D+ S+K
Sbjct  377   IMCIIVSVIIRPIWAGFELFVLVTGNLDKLANSLRCCVVQYF--GGSEASEAESDEVSDK  434

Query  992   KLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGS  813
             KLLGYKCVL++KA+E+ MANFA WEP HGRFNFRHPW+QY+KIGASMR+CA C++ L G 
Sbjct  435   KLLGYKCVLSSKATEETMANFARWEPAHGRFNFRHPWRQYVKIGASMRSCASCLDALIGC  494

Query  812   INSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVE  633
             INS  Q  +++ + K +S    +V + C  V+R+L+  ++   KSS  DILV  MNSA +
Sbjct  495   INSDNQ--ASDDMKKNMSSISMKVGANCASVIRELATTIRKMKKSSKLDILVTQMNSAAQ  552

Query  632   ALQLAFKT----LIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQ  465
              L+    +    + PP +   +T+ E A   S D L  + +           + LMEI Q
Sbjct  553   ELRSLLNSCPYLVNPPHNSKRSTRTETA---SPDDLAPKIE-----------IPLMEIIQ  598

Query  464   LSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHK  321
             + TVASLL+EI AR E +V+ V +L++LA F+ + + K +KQ  S  K
Sbjct  599   VVTVASLLIEIVARVEDIVENVEELSDLANFQPEMNVK-SKQHTSDSK  645


 Score =   135 bits (341),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = -3

Query  1712  GKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGG  1533
             G ++ +  G  L++  F+ KAW++G  +PRK IH +KVG+ALS VSLFYY +PLYD VGG
Sbjct  30    GCMWAVTAGLALKLCKFVKKAWEVGVNDPRKFIHCLKVGIALSAVSLFYYWKPLYDGVGG  89

Query  1532  NAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQAS  1353
             NAMWAVMTVVVVFEYT GAT+ K VNR   T LAG LGIGVHWVA+++G++ +P+I   S
Sbjct  90    NAMWAVMTVVVVFEYTAGATICKTVNRMCGTSLAGFLGIGVHWVASRAGEQWEPVIAGVS  149

Query  1352  VFLLA  1338
             VFLLA
Sbjct  150   VFLLA  154



>emb|CDY07155.1| BnaCnng01700D [Brassica napus]
Length=469

 Score =   400 bits (1029),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 239/483 (49%), Positives = 323/483 (67%), Gaps = 33/483 (7%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVLRIW--SFIDKAWQLGKKEPRKVIHGVKVG  1596
             R+++ + T++ LV +S    +++         IW    I K W++G  +P KV+H +KVG
Sbjct  13    RISVDNETTKRLVPKSGPSERIF---------IWLKGLITKTWRIGADDPAKVVHCLKVG  63

Query  1595  LALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGI  1416
             LALSLV +FYY+RPLYD VGGNAMWA+MTVVVVFE  VGAT SKCVNR VAT LAGSLGI
Sbjct  64    LALSLVCIFYYMRPLYDGVGGNAMWAIMTVVVVFESNVGATFSKCVNRVVATILAGSLGI  123

Query  1415  GVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSG  1236
              VHWVA QSG+  +  ++ +SVFL A AAT+SRF+PS K+RFDYG  IFILTFSLVSV G
Sbjct  124   AVHWVATQSGEA-EIFVIGSSVFLFAFAATYSRFVPSFKSRFDYGAMIFILTFSLVSVGG  182

Query  1235  YRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCIS  1056
             YRVDKL+D+AQQR+STIA+GTSICI I + +CP+WAG  LHRL+ +N  KLADSL+GC++
Sbjct  183   YRVDKLVDMAQQRVSTIAVGTSICIIITIFICPIWAGTQLHRLVQHNFIKLADSLDGCVA  242

Query  1055  DYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQ  876
             +Y           +N+  +  K+ G+KCVLN K +E+AMAN A WEP HG FNFRHPW+Q
Sbjct  243   EYF--KKRDVSTNENEYETNTKVQGFKCVLNPKGTEEAMANLARWEPAHGSFNFRHPWQQ  300

Query  875   YLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklm  696
             Y+KIGA+MR CAYC+E L   +N   +V   + + K   E C ++ +   K++R+L+ ++
Sbjct  301   YVKIGAAMRRCAYCLENLSICMNYETEV--PDQVKKHFREACMKLSAASSKIMRELADIL  358

Query  695   ksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSA  516
             K+T +SS  D LV DMNSAV+ LQ   KT+                 P   +  +E +  
Sbjct  359   KNTRRSSKMDFLVFDMNSAVQELQETLKTI-----------------PIQTNKPEEEEEV  401

Query  515   LSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQS  336
              S +D    + L E+  ++T+ SLL+E AAR +  V+ V+ LA+LA F+  S KK    +
Sbjct  402   PSAEDRTIPMTLHEVLPVATLVSLLIENAARIQTTVEAVDVLASLADFKQDSKKKTGDNN  461

Query  335   QSQ  327
              +Q
Sbjct  462   TNQ  464



>ref|XP_006344005.1| PREDICTED: aluminum-activated malate transporter 10-like [Solanum 
tuberosum]
Length=457

 Score =   399 bits (1025),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 207/483 (43%), Positives = 313/483 (65%), Gaps = 47/483 (10%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             R+ M DG+   L  ES    ++Y      +   +L +  F++K+W +GK EPRKVIH +K
Sbjct  10    RIRMADGSFENLAPESSLVTRMYLSFERFLKNLILIVRRFLEKSWNIGKNEPRKVIHCLK  69

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG+ALS+VSLFYY+RPLY+ VGG AMWA                   V   V  F     
Sbjct  70    VGIALSVVSLFYYMRPLYNGVGGTAMWA-------------------VMTVVVVF---EY  107

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +G+HW+ANQSG++ +PII+  S+F+LA+AATF+RFIP++KARFDYG  IFILTF+LVS+
Sbjct  108   TVGIHWIANQSGKRFEPIIMGVSIFILASAATFTRFIPAVKARFDYGTMIFILTFTLVSI  167

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYR+  LL++A +R+STI +G S+C+  ++L+ P+WAG++LH+L+ +NLEKLA+SL+ C
Sbjct  168   SGYRIANLLNMAHERVSTIIIGASLCVITSILIFPIWAGEELHKLVISNLEKLAESLDCC  227

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             ++++         D ++   + KK+L +KCVLN+KASE+ MANFA WEP HG FNF+HPW
Sbjct  228   VAEFF-------SDSEDTTTNTKKMLAFKCVLNSKASEETMANFARWEPAHGLFNFQHPW  280

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
              +YLKI ASMR+CA CIE L   IN   Q  ++E +   ++  C++V S+  ++L++L+ 
Sbjct  281   GKYLKISASMRSCACCIEALTSCINQKDQ--ASELLKNQLTNTCQQVSSSTSEILKELAL  338

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
              MK+  KSS  D+L+ + ++A++ L+    TL+   S  L  Q          ++K + +
Sbjct  339   NMKTMRKSSRMDMLIQEKSNAIQELE----TLMEQLSGLLIIQ--------PKNVKDDQE  386

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAK  342
               +      +++ L+EI   +T ASL++EIA R EGVV  V +L+ LA+F+ +    M K
Sbjct  387   KPVIRTSSTNVIPLIEIIPTATFASLVIEIATRIEGVVDVVEELSKLAKFKLEDADMMIK  446

Query  341   QSQ  333
             Q++
Sbjct  447   QNK  449



>ref|XP_007161574.1| hypothetical protein PHAVU_001G081000g [Phaseolus vulgaris]
 gb|ESW33568.1| hypothetical protein PHAVU_001G081000g [Phaseolus vulgaris]
Length=489

 Score =   399 bits (1025),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 238/478 (50%), Positives = 333/478 (70%), Gaps = 29/478 (6%)
 Frame = -3

Query  1727  ESRRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLY  1548
             +S+  G ++ +  G  L++  F+ KAW+LG  +PRK IH +KVG+ALS VSLFYY +PLY
Sbjct  24    KSKVVGCMWAVTAGLALKLCKFVKKAWELGVNDPRKFIHCLKVGMALSAVSLFYYWKPLY  83

Query  1547  DDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPI  1368
             D VGGNAMWAVMTVVVVFEYT GAT+ K VNR   T LAG LGIGVHWVA+++G++ +PI
Sbjct  84    DGVGGNAMWAVMTVVVVFEYTAGATIYKTVNRMCGTSLAGFLGIGVHWVASRAGEQFEPI  143

Query  1367  ILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLST  1188
             I+  S+FLLA+AATFSRFIP+IKARFDYG  IFILTF LVS+SGYRVD+LL +AQ R+ T
Sbjct  144   IVGVSLFLLASAATFSRFIPTIKARFDYGAMIFILTFCLVSISGYRVDELLVMAQYRMFT  203

Query  1187  IALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdnd  1008
             I +G+ +CI +++++ P+WAG +L  L+T NL+KLA+SL+ C++ Y       D  +  D
Sbjct  204   IIIGSILCIIVSLVIRPIWAGFELFVLVTGNLDKLANSLQCCVAQYF------DGSETPD  257

Query  1007  kASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIE  828
             + S+K+LLGYKCVL++KA+E++MAN A WEP HGRFNFRHPW+QY+KIGASMR+CA C++
Sbjct  258   EDSDKQLLGYKCVLSSKATEESMANLARWEPTHGRFNFRHPWRQYVKIGASMRSCASCLD  317

Query  827   TLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDM  648
              L G INS  +  +++ + K +     +V + C  V+R+++  M+   KSS  DI V +M
Sbjct  318   ALIGCINSDNK--ASDEMKKNMRSISLKVGADCASVIREVANTMRKMRKSSKLDIRVTEM  375

Query  647   NSAVEALQ---LAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLM  477
             NSA + L+     +  L+  + +S  TQ E A  PS   L  + +           + LM
Sbjct  376   NSAAQELRSLLSCYPNLVHNAKRS--TQTETA--PSDIPLPAKVE-----------ISLM  420

Query  476   EIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQ---SDKKMAKQSQSQHKEQN  312
             +I Q+ TVASLL+EI AR EG+V+ V +L++LA F+ +     K+ +  S+    +QN
Sbjct  421   QIVQVVTVASLLIEIVARVEGIVEAVEELSDLANFQPEMCVKSKQHSPDSKISPDQQN  478



>dbj|BAK00121.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   398 bits (1023),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 227/475 (48%), Positives = 308/475 (65%), Gaps = 46/475 (10%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYD-IVGGFVL---RIWSFIDKAWQLGKKEPRKVIHGVK  1602
             RV +P+G S  +  E+   G+ +  +V G ++    +  F  K W++G  +PR+V+HGVK
Sbjct  15    RVTVPEGASVTVEYEAGPAGRAWAWLVAGVLMLGATVSGFAKKVWKIGADDPRRVVHGVK  74

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG+AL+LVS+FYY RPLYD VGG +MWA+MTVVV+FEYTVG ++ K  NR VAT  AG L
Sbjct  75    VGVALTLVSVFYYTRPLYDGVGGASMWAIMTVVVIFEYTVGGSVYKGFNRAVATASAGVL  134

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +GV+WVA++SG KL+P I   S+FLLAAAATFSRFIP++KARFDYG TIFILT+SLV+V
Sbjct  135   ALGVNWVASKSGDKLEPFITSGSLFLLAAAATFSRFIPTVKARFDYGVTIFILTYSLVAV  194

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVD+L+ LAQQRL TIA+G  IC+ + +L+ PVWAG +LH+L   N+EKLA ++EGC
Sbjct  195   SGYRVDELVALAQQRLVTIAIGIFICLAVCVLIWPVWAGQELHQLTVRNMEKLAAAVEGC  254

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
               DY             ++ ++ K  GY CVLN+KASED+ AN A WEP HG+F FRHP+
Sbjct  255   AEDYF-----------AEEGAQAKSEGYNCVLNSKASEDSQANLARWEPAHGKFGFRHPY  303

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
              QY K+GA+MR CAYC+ETL+  +   A+V + E + + +++ C R+ + CG+VLR+ S 
Sbjct  304   AQYTKLGAAMRQCAYCVETLNSCVG--AEVQAPENVKRLLADVCTRLGAQCGRVLREASS  361

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
              + + T S   D  V DMN+AV  LQ   + L      +L  +  EA             
Sbjct  362   SIANMTTSPTLDFAVADMNTAVHELQGDMREL----PFTLAGEPGEAS------------  405

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSD  357
                          L++   L TVASLL EI+ R E VV  V+ +A LA F+   D
Sbjct  406   -------------LIDAMPLFTVASLLTEISTRIENVVDAVDTMACLASFKQAED  447



>ref|NP_001053586.1| Os04g0567200 [Oryza sativa Japonica Group]
 emb|CAE02072.2| OSJNBa0005N02.7 [Oryza sativa Japonica Group]
 dbj|BAF15500.1| Os04g0567200 [Oryza sativa Japonica Group]
 gb|EAZ31667.1| hypothetical protein OsJ_15815 [Oryza sativa Japonica Group]
Length=513

 Score =   397 bits (1021),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 230/478 (48%), Positives = 301/478 (63%), Gaps = 37/478 (8%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSES---RRRGKVY-----DIVGGFVLRIWSFIDKAWQLGKKEPRKVI  1614
             RV +P+G +  +  E+   RR   V+       V     R      + W++G  +PR+ +
Sbjct  14    RVTVPEGATVTVEREAGRCRRAAVVWAWQLVSCVAALGSRASGLAGRVWKIGADDPRRAV  73

Query  1613  HGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFL  1434
             HGVKVGLAL+LVS+FYY RPLYD VGG AMWAVMTVVVVFE+TVG  + K  NR  AT  
Sbjct  74    HGVKVGLALALVSVFYYTRPLYDGVGGAAMWAVMTVVVVFEFTVGGCVYKGFNRATATVS  133

Query  1433  AGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFS  1254
             AG++ +GVHW+A++SG KL+P++   SVFLLAAAATFSRFIP++KARFDYG TIFILT+S
Sbjct  134   AGAVALGVHWIASKSGDKLEPVVRSGSVFLLAAAATFSRFIPTVKARFDYGVTIFILTYS  193

Query  1253  LVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADS  1074
             LV+VSGYRVD L+ +AQQR+STIA+G  IC+ + +L+CPVWAG +LHRL   N++KLA +
Sbjct  194   LVAVSGYRVDALVAMAQQRVSTIAIGIFICLAVCLLICPVWAGQELHRLTARNMDKLAGA  253

Query  1073  LEGCISDYLnadgdgdddkdndkASEKKLL--GYKCVLNTKASEDAMANFAVWEPGHGRF  900
             +E C+  Y  A  +     +  +         GYKCVLN+KASEDA AN A WEP HGRF
Sbjct  254   VEACVEGYFVAGEEEAAGPEYKRRPAAAAAAEGYKCVLNSKASEDAQANLARWEPAHGRF  313

Query  899   NFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKV  720
              FRHP+ QY  +GA+MR CAYC+E L G I  SA+  S E + + ++    RV + C  V
Sbjct  314   GFRHPYAQYKAVGAAMRHCAYCVEALSGCIR-SAEAQSPEGVNRHLAGASTRVATRCAAV  372

Query  719   LRDlsklmksttksSIQ-DILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSD  543
             LR+ S  + + T  S   D  V DMN+AV+ LQ   + L P    +   +   AQ+    
Sbjct  373   LREASSSVAAMTTPSRGLDFAVADMNTAVQELQSEVREL-PSKLAAAAGEPAAAQQ----  427

Query  542   HLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFR  369
                                 LM+  QL TV SLL+E++AR EGVV  V+ LA LA FR
Sbjct  428   --------------------LMDAVQLLTVTSLLIEVSARIEGVVDAVDTLATLAAFR  465



>ref|XP_004953423.1| PREDICTED: aluminum-activated malate transporter 10-like [Setaria 
italica]
Length=496

 Score =   396 bits (1018),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 224/437 (51%), Positives = 292/437 (67%), Gaps = 41/437 (9%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             R+  F  K W++G  +PRKV+HG+KVGL+L+LVS+FYY RPLYD VGG AMWA+MTVVV+
Sbjct  52    RVAGFARKVWRIGADDPRKVVHGLKVGLSLALVSIFYYTRPLYDGVGGAAMWAIMTVVVI  111

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FEYTVG ++ K  NR VAT  AG L +GVHWVA ++G+  +P IL  S+FLLAAAATFSR
Sbjct  112   FEYTVGGSVYKSFNRVVATASAGVLALGVHWVAGKTGE-FEPYILTGSLFLLAAAATFSR  170

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             FIP++KARFDYG TIFILT+SLV+VSGYRVD+L  LAQQR+STIA+G  +C+ +A+ +CP
Sbjct  171   FIPTVKARFDYGVTIFILTYSLVAVSGYRVDELAVLAQQRVSTIAIGIFMCLAVAIFVCP  230

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG +LH L T N++KLA +LEGC+ DY          +      + +  GY+CVLN+K
Sbjct  231   VWAGQELHLLTTRNMDKLAAALEGCVEDYF--------AEGPAAQPQARSDGYRCVLNSK  282

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             ASEDA AN A WEP HGRF FRHP+ QY K+GA+MRACA C+E L  S  +SA+  + E+
Sbjct  283   ASEDAQANLARWEPAHGRFGFRHPYGQYGKVGAAMRACACCVEAL--SSCASAEARAPEH  340

Query  776   ILKPVSEECRRVCSTCGKVLRDls-klmksttksSIQDILVHDMNSAVEALQLAFKTLIP  600
             + + + + C R  + C +VLR+ S  +   T  S   D+ V DMN+AV  LQ   ++L  
Sbjct  341   VKRLLRDACTRAGARCARVLREASCSVATMTASSRALDLAVADMNTAVHDLQGDMRSL--  398

Query  599   PSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAART  420
                            PS   +K    S            L++   + TVASLLVEIAAR 
Sbjct  399   ---------------PSMLAVKLAETS------------LVDTMPVFTVASLLVEIAARV  431

Query  419   EGVVKEVNQLANLAQFR  369
             EGVV  V++LA LA F+
Sbjct  432   EGVVDAVDELATLANFK  448



>ref|XP_008646046.1| PREDICTED: aluminum-activated malate transporter 10-like [Zea 
mays]
 gb|AFW72760.1| hypothetical protein ZEAMMB73_827579 [Zea mays]
Length=488

 Score =   395 bits (1016),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 231/473 (49%), Positives = 305/473 (64%), Gaps = 46/473 (10%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYD-IVGGFVL---RIWSFIDKAWQLGKKEPRKVIHGVK  1602
             RV +P+GTS  +  E+    + +  +V  F +   R+  F  K W++G  +PRK +HG+K
Sbjct  16    RVTVPEGTSVTVEHEAGPAARAWTWLVACFAMAWSRVAGFARKVWRIGTDDPRKAVHGLK  75

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VGLAL LVS+FYY RPLYD VGG+AMWA+MTVVVVFEYTVG ++ KC NR VAT  AG L
Sbjct  76    VGLALVLVSVFYYTRPLYDGVGGSAMWAIMTVVVVFEYTVGGSVYKCFNRVVATASAGVL  135

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +GVHW A++ G+ L+P IL  S+FLLAAAATFSRFIP++KARFDYG TIFILT+SLV+V
Sbjct  136   ALGVHWAADKFGE-LEPYILSGSLFLLAAAATFSRFIPTVKARFDYGVTIFILTYSLVAV  194

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVD+L  LAQQRLSTIA+G  +C+ +++L+CPVWAG +LH L T N++KLA ++  C
Sbjct  195   SGYRVDELAALAQQRLSTIAIGIFLCLAVSVLICPVWAGQELHLLTTRNMDKLAAAVVAC  254

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             +  Y          +    +S     GYKCVLN+KASEDA AN A WEP HGRF FRHP+
Sbjct  255   VEGYF--------AEGPASSSRAGADGYKCVLNSKASEDAQANLARWEPAHGRFGFRHPY  306

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
              QY ++GA+MRACAYC+E L     + AQ  +  ++ + + + C  V   C +VL + S+
Sbjct  307   GQYARVGAAMRACAYCVEALCSCAGAEAQ--APPHVKRLLRDACATVAVRCARVLGEASR  364

Query  701   lmksttksSIQ--DILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQE  528
              + + + SS +  D  V DMN+AV+ LQ   + L                 PS   +K  
Sbjct  365   SVATMSTSSSRALDFAVADMNTAVQELQADLRAL-----------------PSMLAVKLG  407

Query  527   TKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFR  369
               S            LM+   + TVASLLVEI+AR EGVV  V+ LA LA F+
Sbjct  408   ETS------------LMDTMPVFTVASLLVEISARVEGVVDAVDALATLANFK  448



>ref|XP_004495500.1| PREDICTED: aluminum-activated malate transporter 10-like [Cicer 
arietinum]
Length=484

 Score =   395 bits (1015),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 223/479 (47%), Positives = 320/479 (67%), Gaps = 37/479 (8%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLA  1590
             R+ + DG  +  V+       +++ +     ++  FI K W +G  +PRK IH +KVG+A
Sbjct  10    RIKVEDGPWKTAVTCC----SIWEFIANRYSKLCKFIKKIWMIGVNDPRKFIHCLKVGMA  65

Query  1589  LSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGV  1410
             L++V+LFYYL+PLY+ VGGNA+WAVMTVVV  EYT GAT+ K +NR   T +AG L   V
Sbjct  66    LTIVTLFYYLKPLYNGVGGNAIWAVMTVVVALEYTAGATIYKSINRICGTIVAGLLAFSV  125

Query  1409  HWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYR  1230
             HWVAN++G++ + +I+ A++F+LA+AATFSRFIP++KARFDYG  IFILTFSLV+VSGYR
Sbjct  126   HWVANKAGEQFEIVIVGAALFILASAATFSRFIPTVKARFDYGAMIFILTFSLVAVSGYR  185

Query  1229  VDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDY  1050
             +D++  LA QR+ST+ +GTS+CI I++ +CPVWAG +L+ L+  NL+KLA+SL+GC+  Y
Sbjct  186   IDEVFPLAIQRISTVIIGTSLCIIISITICPVWAGLELYVLVIGNLDKLANSLQGCVDQY  245

Query  1049  LnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYL  870
                     + +  ++ S KKL+GYKCVLN+KASED+MAN A WEP HG F+FRHPWKQYL
Sbjct  246   F-------EAQTANEESNKKLMGYKCVLNSKASEDSMANLARWEPAHGNFHFRHPWKQYL  298

Query  869   KIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmks  690
             KIGA+MR CA CI+ L G I+S  +   ++ + K +S    +V +    VL +L+  +K+
Sbjct  299   KIGATMRRCAACIDALVGCIHSENK--KSDDMKKLMSTISIKVGAKSASVLSELAITIKN  356

Query  689   ttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALS  510
              TKS+  +ILV +MN+A E L    K+   P+  +      EA K               
Sbjct  357   MTKSNKLEILVTEMNNAAEELHNILKSY--PNINNKNEASPEAAKIE-------------  401

Query  509   DDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQ  333
                    + +MEI Q+ TV SL++EI AR E +VK V +L++LA+F+  S K M+ +S+
Sbjct  402   -------IPMMEIIQVGTVVSLIIEIVARVEDIVKGVEELSDLAKFK--STKGMSHKSK  451



>gb|EAY95197.1| hypothetical protein OsI_17017 [Oryza sativa Indica Group]
Length=516

 Score =   396 bits (1017),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 230/478 (48%), Positives = 300/478 (63%), Gaps = 37/478 (8%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSES---RRRGKVY-----DIVGGFVLRIWSFIDKAWQLGKKEPRKVI  1614
             RV +P+G +  +  E+   RR   V+       V     R      + W++G  +PR+ +
Sbjct  14    RVTVPEGATVTVEREAGRCRRAAVVWAWQLVSCVAALGSRASGLAGRVWKIGADDPRRAV  73

Query  1613  HGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFL  1434
             HGVKVGLAL+LVS+FYY RPLYD VGG AMWAVMTVVVVFE+TVG  + K  NR  AT  
Sbjct  74    HGVKVGLALALVSVFYYTRPLYDGVGGAAMWAVMTVVVVFEFTVGGCVYKGFNRATATVS  133

Query  1433  AGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFS  1254
             AG + +GVHW+A++SG KL+P++   SVFLLAAAATFSRFIP++KARFDYG TIFILT+S
Sbjct  134   AGVVALGVHWIASKSGDKLEPVVRSGSVFLLAAAATFSRFIPTVKARFDYGVTIFILTYS  193

Query  1253  LVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADS  1074
             LV+VSGYRVD L+ +AQQR+STIA+G  IC+ + +L+CPVWAG +LHRL   N++KLA +
Sbjct  194   LVAVSGYRVDALVAMAQQRVSTIAIGIFICLAVCVLICPVWAGQELHRLTARNMDKLAGA  253

Query  1073  LEGCISDYLnadgdgdddkdndkASEKKLL--GYKCVLNTKASEDAMANFAVWEPGHGRF  900
             +E C+  Y  A  +     +  +         GYKCVLN+KASEDA AN A WEP HGRF
Sbjct  254   VEACVEGYFVAGEEEAAGPEYKRRPAAAAAAEGYKCVLNSKASEDAQANLARWEPAHGRF  313

Query  899   NFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKV  720
              FRHP+ QY  +GA+MR CAYC+E L G I  SA+  S E + + ++    RV + C  V
Sbjct  314   GFRHPYAQYKAVGAAMRHCAYCVEALSGCIR-SAEAQSPEGVKRHLAGASTRVATRCAAV  372

Query  719   LRDlsklmksttksSIQ-DILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSD  543
             LR+ S  + + T  S   D  V DMN+AV+ LQ   + L P    +   +   AQ+    
Sbjct  373   LREASSSVAAMTTPSRGLDFAVADMNTAVQELQSEVREL-PSKLAAAAGEPAAAQQ----  427

Query  542   HLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFR  369
                                 LM+  QL TV SLL+E++AR EGVV  V+ LA LA FR
Sbjct  428   --------------------LMDAVQLLTVTSLLIEVSARIEGVVDAVDTLATLAAFR  465



>emb|CAN74601.1| hypothetical protein VITISV_028111 [Vitis vinifera]
Length=843

 Score =   405 bits (1042),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 224/459 (49%), Positives = 302/459 (66%), Gaps = 44/459 (10%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             ++ + DG+S+ LV ES   G+ +     ++ G VL++     KAW L   +PRKVIH +K
Sbjct  14    KIRVADGSSKDLVPESGPAGRAWLGIQGLIAGLVLKMGRCFKKAWDLAVDDPRKVIHCLK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG AL++VSLFYY RPLY+ +G NAMW VMT VVVFE TVGATLSK +NR   T LAGSL
Sbjct  74    VGTALTVVSLFYYTRPLYEGLGRNAMWGVMTAVVVFENTVGATLSKSLNRACGTLLAGSL  133

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +GVHW+A+QSG+KL+P +  ASVFLLA+AATFSRFIP+++ RFDYG  +FILTFSL+S+
Sbjct  134   AVGVHWIASQSGEKLEPFVNGASVFLLASAATFSRFIPTVRTRFDYGALVFILTFSLISI  193

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRV+KLL +A QRLSTIA+G  +CI I++L+CP+WAG +LH LIT N++KLA SL+GC
Sbjct  194   SGYRVEKLLKMAHQRLSTIAIGGFMCILISILVCPIWAGKELHLLITRNMDKLAYSLDGC  253

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             +++Y N  G             +K  GYKCVLN+KA+E+ MANFA WEP HG F F+HPW
Sbjct  254   VAEYFNNSGIPV----------EKSQGYKCVLNSKAAEETMANFARWEPAHGHFKFKHPW  303

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
             +QYLK+GASMR CAYCIE L+G INS  QV   E I + +S  C R+ S    V+R+   
Sbjct  304   RQYLKVGASMRRCAYCIEALNGCINSENQV--PESIKQHLSGNCLRLGSVSSSVIRE---  358

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIP-PSSQSLTTQVEEAQKPSSDHLKQET  525
                                     L +  +T+   P +Q+L  +++ + +   + L    
Sbjct  359   ------------------------LAITMRTMKKSPRTQNLLKEMKNSVQELHNELGSLP  394

Query  524   KSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVV  408
                L        + L E+  ++TVASLL+E+AAR EG++
Sbjct  395   NLLLPPPSIEATLPLEEVIPIATVASLLIEVAARIEGIL  433



>emb|CDY51721.1| BnaA09g52080D [Brassica napus]
Length=471

 Score =   393 bits (1010),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 237/484 (49%), Positives = 322/484 (67%), Gaps = 33/484 (7%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLA  1590
             R+++ + T+  LV +S    +++  + G ++       K W++G  +P KV+H +KVGLA
Sbjct  13    RISVDNETTNRLVPKSGPSERIFLWLKGLIM-------KTWRIGADDPAKVVHCLKVGLA  65

Query  1589  LSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGV  1410
             LSLV +FYY+RPLYD VGGNAMWA+MTVVVVFE  VGAT SKCVNR VAT LAGSLGI V
Sbjct  66    LSLVCIFYYMRPLYDGVGGNAMWAIMTVVVVFESNVGATFSKCVNRVVATILAGSLGIAV  125

Query  1409  HWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYR  1230
             HWVA +SG+  +  ++ +SVFL A  AT+SRF+PS K+RFDYG  IFILTFSLVSV GYR
Sbjct  126   HWVATKSGEA-EIFVIGSSVFLFAFTATYSRFVPSFKSRFDYGAMIFILTFSLVSVGGYR  184

Query  1229  VDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDY  1050
             VDKL+D+AQQR+STIA+GT+ICI I + +CP+W+G  LHRL+  N  KLADSL+GC+++Y
Sbjct  185   VDKLVDMAQQRVSTIAVGTTICIIITIFICPIWSGTQLHRLVQCNFVKLADSLDGCVAEY  244

Query  1049  LnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYL  870
                        +N+  +  K+ G+KCVLN+K +E+AMAN A WEP HG FNFRHPW+QY+
Sbjct  245   F--KKRDVSTNENEDETNMKVQGFKCVLNSKGTEEAMANLARWEPAHGSFNFRHPWQQYV  302

Query  869   KIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmks  690
             KIGA+MR CAYC+E L   +N   +V   + + K   E C ++ +   K+LR+L+ ++K+
Sbjct  303   KIGAAMRRCAYCLENLSICMNYETEV--PDQVKKHFRETCMKLTAASSKILRELADILKN  360

Query  689   ttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALS  510
             T +SS  D LV DMNSAV+ LQ   KT IP  +                  K E +  + 
Sbjct  361   TRRSSKMDFLVFDMNSAVQELQETLKT-IPIQTN-----------------KPEEEEEVP  402

Query  509   DDDDHDLVYLM---EIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQ  339
              D+  D    M   E+  ++T+ SLL+E AAR +  V+ V+ LANLA F+  S KK    
Sbjct  403   SDEGEDRTIPMSLHEVLPVATLVSLLIENAARIQTTVEAVDVLANLADFKQDSKKKTGDN  462

Query  338   SQSQ  327
             + +Q
Sbjct  463   NTNQ  466



>ref|XP_008663483.1| PREDICTED: aluminum-activated malate transporter 10-like [Zea 
mays]
 gb|AFW59169.1| hypothetical protein ZEAMMB73_334212 [Zea mays]
Length=506

 Score =   394 bits (1013),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 237/499 (47%), Positives = 310/499 (62%), Gaps = 35/499 (7%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGK------VYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHG  1608
             RV +P+G S  +  E+           +   V  F  R   F  + W++G  +PR+ +HG
Sbjct  19    RVTVPEGASVAVEHEAAACRAARAWAWLVSCVLAFWDRGLGFGRRVWRIGADDPRRAVHG  78

Query  1607  VKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAG  1428
             +KVGLAL+LVS+FYY R LYD VGG AMWAV+TVVVVFEYTVG  + K  NR  AT  AG
Sbjct  79    LKVGLALTLVSVFYYSRTLYDGVGGAAMWAVLTVVVVFEYTVGGCVYKGFNRAFATASAG  138

Query  1427  SLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLV  1248
             ++ +GVHW+A++SG KLQP I   SVFLLAA ATFSRFIP++KARFDYG TIFILT+SLV
Sbjct  139   AVALGVHWIASKSGDKLQPFITSGSVFLLAAMATFSRFIPTVKARFDYGVTIFILTYSLV  198

Query  1247  SVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLE  1068
             +VSGYRVD LL +AQQR+ TIA+G S+CI I  L+CPVWAG +LHR    N+++LAD++E
Sbjct  199   AVSGYRVDALLAMAQQRMCTIAIGVSMCIAICALICPVWAGQELHRATVRNMDRLADAVE  258

Query  1067  GCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRH  888
              C+ DY  A    +     +  +++   GYKCVLN+KASEDA AN A WEP HGRF FRH
Sbjct  259   ACVDDYFAAGAGAEASSKPNTKADE---GYKCVLNSKASEDAQANLARWEPAHGRFAFRH  315

Query  887   PWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDl  708
             P+ QY  +GA+MR CAYC+E L G + SSA         + ++  C RV   C  VLR  
Sbjct  316   PYDQYRSVGAAMRHCAYCVEALRGCVRSSA-AAPCHASRRHLAGACTRVAGQCAAVLRAA  374

Query  707   sklmksttksSIQ-DILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQ  531
             S  + +    S   D+ V +M +AVE LQ   +TL                 PSS  L  
Sbjct  375   STSVNTMAAPSRGLDLAVLEMGAAVEELQADLRTL-----------------PSSLLLAA  417

Query  530   ETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQF----RGQ  363
             E  +A        +V ++  AQL T+ASLLVE++ R EGVV  V+ LANLA F     G 
Sbjct  418   EATAAAEPAAPTTMV-MVGAAQLFTIASLLVEVSVRIEGVVDAVDTLANLAGFDLESAGD  476

Query  362   SDKKMAKQSQ--SQHKEQN  312
              ++K A+ ++  ++  E N
Sbjct  477   ENEKPAEPAKNVTEQSEGN  495



>ref|XP_008646045.1| PREDICTED: aluminum-activated malate transporter 10-like [Zea 
mays]
 gb|AFW72759.1| hypothetical protein ZEAMMB73_069368 [Zea mays]
Length=489

 Score =   394 bits (1011),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 233/496 (47%), Positives = 313/496 (63%), Gaps = 48/496 (10%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVLRIWS----FIDKAWQLGKKEPRKVIHGVK  1602
             RV +P+G S  +  E+    +    +     + WS    F  K W++G  +PRK +HG+K
Sbjct  17    RVTVPEGASVTVEHEAGPAARALAWLLACFAKAWSRVAGFARKVWRIGADDPRKAVHGLK  76

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VGLAL+LVS+FYY RPLYD VGG AMWA+MTVVVVFEYTVG ++ KC NR VAT  AG L
Sbjct  77    VGLALALVSVFYYTRPLYDGVGGAAMWAIMTVVVVFEYTVGGSVYKCFNRVVATASAGVL  136

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +GVHW A++SG+ L+P IL  S+FLLAAAATFSRFIP++KARFDYG TIFILT+SLV+V
Sbjct  137   ALGVHWAADKSGE-LEPYILSGSLFLLAAAATFSRFIPTVKARFDYGVTIFILTYSLVAV  195

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVD+L  LAQQR+STIA+G  +C+ ++ML+CPVWAG +LH L T N++KLA ++  C
Sbjct  196   SGYRVDELAALAQQRVSTIAIGIFLCLAVSMLICPVWAGKELHLLTTRNMDKLAAAVVAC  255

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             +  Y          +     +     GYKCVLN+KASEDA AN A WEP HG F FRHP+
Sbjct  256   VESYF--------AEGPASGAGAGADGYKCVLNSKASEDAQANLARWEPAHGPFGFRHPY  307

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
              QY ++GA+MRACAYC+E L  S  + A+V +  ++ + + + C  V + C +VLR+ S+
Sbjct  308   GQYARVGAAMRACAYCVEAL--SSCAGAEVQAPPHVKRLLRDACSAVAARCARVLREASR  365

Query  701   lmksttksSIQ--DILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQE  528
              + + + SS +  D  V DMN+AV+ LQ   + L                 PS   +K  
Sbjct  366   SVATMSTSSSRALDFAVADMNTAVQELQADLRAL-----------------PSMLAVKLG  408

Query  527   TKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKM  348
               S            LM+   + TVASLLVEI+AR EGVV  V+ LA LA F+ Q++   
Sbjct  409   ETS------------LMDTMPVFTVASLLVEISARVEGVVDAVDALATLANFK-QTEDDD  455

Query  347   AKQSQSQHKEQNVQTH  300
                 + +  E  ++ H
Sbjct  456   DDDKKGE-AEMTIKVH  470



>gb|EEE57558.1| hypothetical protein OsJ_07901 [Oryza sativa Japonica Group]
Length=467

 Score =   392 bits (1008),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 232/487 (48%), Positives = 299/487 (61%), Gaps = 67/487 (14%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSES----RRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             RV +P+G+S  +  E+    R    V  ++      +  F  K W++G  +PR+ +H +K
Sbjct  17    RVTVPEGSSVTVEHEAGVAERAWAWVVRMLVAVRAAVAGFARKVWKIGADDPRRAVHSLK  76

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VGLAL+LVS+ YY RP+YD VGGNAMWAVMTVVVVFEYTVG  + K  NR VAT  AG L
Sbjct  77    VGLALTLVSIVYYTRPVYDGVGGNAMWAVMTVVVVFEYTVGGCMYKGFNRAVATASAGLL  136

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +GV+WVA++SG KL+P IL  S+FLLAAAATFSRFIP++KARFDYG TIFILTFSLV+V
Sbjct  137   ALGVNWVADKSGDKLEPFILSGSLFLLAAAATFSRFIPTVKARFDYGVTIFILTFSLVAV  196

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRVD+LLDLAQQR+STI +G  IC+ + +++ PVWAG +LH L   N+EKLA ++EGC
Sbjct  197   SGYRVDQLLDLAQQRMSTIGIGIVICLAVCVVIWPVWAGQELHLLTVRNMEKLAGAVEGC  256

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             + DY              K +  K  GYKCVLN+KASED+ AN A WEP HGRF FRHP+
Sbjct  257   VEDYF-----------AAKPAAAKSEGYKCVLNSKASEDSQANLARWEPPHGRFGFRHPY  305

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsk  702
              QY K+GA+MR CAYC+E L+  + +                        C +VLR+ S 
Sbjct  306   AQYTKVGAAMRHCAYCVEALNSCVRAE-----------------------CARVLREAST  342

Query  701   lmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETK  522
              + + T     D  V DMN+AV  LQ   + L PP                   L  E  
Sbjct  343   SVAAMTSPKTLDFAVADMNTAVHELQGDLRAL-PPV------------------LALEPA  383

Query  521   SALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAK  342
             + +S         LM+   L TVASLL+EI+AR EGVV  V  LA+LA F+ Q +    K
Sbjct  384   AEMS---------LMDAMPLFTVASLLIEISARIEGVVDAVETLASLASFK-QVEDDDDK  433

Query  341   QSQSQHK  321
             + Q++ K
Sbjct  434   KGQTEMK  440



>gb|EMT25761.1| hypothetical protein F775_14692 [Aegilops tauschii]
Length=545

 Score =   392 bits (1007),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 219/436 (50%), Positives = 292/436 (67%), Gaps = 41/436 (9%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             R+  F  K W++G  +PR+V+HG+KVG+AL+LVS+FYY RPLYD VGG AMWA+MTVVVV
Sbjct  16    RVSGFAKKVWKIGADDPRRVVHGLKVGVALTLVSVFYYTRPLYDGVGGAAMWAIMTVVVV  75

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FEYTVG ++ K  NR VAT  AG LG+GV WVA++SG KL+P+I   S+FLLAAAATFSR
Sbjct  76    FEYTVGGSVYKGFNRAVATASAGVLGLGVSWVASKSGDKLEPVITCGSLFLLAAAATFSR  135

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             FIP++KARFDYG TIFILT+SLV+VSGYRVD+L+ LAQQRL TIA+G  IC+ + +L+ P
Sbjct  136   FIPTVKARFDYGVTIFILTYSLVAVSGYRVDELVALAQQRLVTIAIGIFICLAVCVLIWP  195

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG +LH+L   N+EKLA ++EGC+ DY             ++ ++ K  GYKCVLN+K
Sbjct  196   VWAGQELHQLTVRNMEKLAAAVEGCVEDYF----------GEEEGAQAKSEGYKCVLNSK  245

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             ASED+ AN A WEP HG+F FR P+ QY K+GA+MR CAYC+ETL+  + +  Q  + E 
Sbjct  246   ASEDSQANLARWEPAHGKFGFRRPYAQYAKLGAAMRHCAYCVETLNSCVGAELQ--APES  303

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
             + + +++ C R+ + CG+VLR+ S  + + T S   D  V DMN+AV  LQ   + L   
Sbjct  304   VKRLLTDVCTRLGAQCGRVLREASSSVATMTTSPALDFAVADMNTAVHELQGDMREL---  360

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
                +L  +  EA                          L++   L TVASLL EI+ R E
Sbjct  361   -PFTLAGEPGEAS-------------------------LIDAMPLFTVASLLTEISTRIE  394

Query  416   GVVKEVNQLANLAQFR  369
              VV  V+ +A+LA F+
Sbjct  395   SVVDAVDTMASLASFK  410



>ref|XP_004978184.1| PREDICTED: aluminum-activated malate transporter 10-like [Setaria 
italica]
Length=506

 Score =   388 bits (996),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 226/470 (48%), Positives = 295/470 (63%), Gaps = 38/470 (8%)
 Frame = -3

Query  1685  FVLRIWSFIDKA-------WQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNA  1527
              V R+ +F DKA       W++G  +PR+ +HG+KVGLAL++VS+FYY RPLYD VGG A
Sbjct  45    LVARLLAFGDKALGFGGRVWRIGADDPRRAVHGLKVGLALAMVSVFYYTRPLYDGVGGAA  104

Query  1526  MWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVF  1347
             MWA++TVVVVFEYTVG  + K  NR +AT  A  + +GVHW+A++SG K +P I   SVF
Sbjct  105   MWALLTVVVVFEYTVGGCVYKGFNRAIATASAAVIALGVHWIASKSGDKFEPFIRSGSVF  164

Query  1346  LLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSI  1167
             LLAA ATFSRFIP++KARFDYG TIFILT+SLV+VSGYRV  L+ LAQQR+ TI++G SI
Sbjct  165   LLAAMATFSRFIPTVKARFDYGVTIFILTYSLVAVSGYRVGALVALAQQRVCTISIGVSI  224

Query  1166  CIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDY-LnadgdgdddkdndkASEKK  990
             C  I +L+CPVWAG +LHR    N+E LA +LE  +  Y L    + +   D   +S   
Sbjct  225   CFAICVLICPVWAGQELHRATARNMESLAGALEAIVEGYFLADAAEEEASGDKRPSSSNA  284

Query  989   LLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSI  810
               GY+CVLN+KASED+ AN A WEP HG F FRHP+ QY  +GA+MR CAYC+E L G  
Sbjct  285   TEGYRCVLNSKASEDSQANLARWEPPHGSFGFRHPYGQYRNVGAAMRHCAYCVEALAGCA  344

Query  809   NSSAQVGSAE---YILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSA  639
              S+    +A    +  + ++  C RV + C +VLR+ S  + S T S I D  V DMN+A
Sbjct  345   RSAEAQPAAPHGGHSRRHLAGACTRVAALCARVLREASASVTSMTASGILDFAVADMNAA  404

Query  638   VEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLS  459
             V+ L+   + L  PS   L      A                          L++ AQL 
Sbjct  405   VQDLRDDLRAL--PSGLLLAGAGSAAST----------------------ALLVDAAQLF  440

Query  458   TVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHKEQNV  309
             TV SLL+E++AR EGVV  V+ LA+LA FR   D K A   +S  KEQ++
Sbjct  441   TVTSLLIEVSARVEGVVDAVDTLASLANFRSADDGKPA---ESATKEQSM  487



>gb|ABQ59607.1| ALMT3 [Aegilops tauschii]
Length=469

 Score =   381 bits (978),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 222/494 (45%), Positives = 298/494 (60%), Gaps = 66/494 (13%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY-----------DIVGGFVLRIWSFIDKAWQLGKKEPR  1623
             RV +P+G S  +  ES R  + +           D V GF  RIW       ++G  +PR
Sbjct  19    RVTVPEGASVTVEHESCRAARAWAWMVSCVVVLGDKVSGFAKRIW-------KIGADDPR  71

Query  1622  KVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVA  1443
             + +HG+KVGLAL+LVS+FYY RPLYD VGG AMWA+MTVVV+FEYTVG  + K  NR  A
Sbjct  72    RAVHGLKVGLALALVSVFYYTRPLYDGVGGAAMWAIMTVVVIFEYTVGGCVYKGFNRAAA  131

Query  1442  TFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLA-----------AAATFSRFIPSIKA  1296
             T  AG++ +GVHW+A  +G + +P I   SVFLLA           + ATFSRFIP++KA
Sbjct  132   TVSAGAIALGVHWIAANAGHEFEPFIRSGSVFLLANGLATRSVRAASMATFSRFIPTVKA  191

Query  1295  RFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDL  1116
             RFDYG TIFILT+SLV+VSGYRV+ LL +AQQR+ TI +G  +C+ + +L+CPVWAG +L
Sbjct  192   RFDYGVTIFILTYSLVAVSGYRVEALLAMAQQRVCTIGIGVFMCLSVCVLICPVWAGQEL  251

Query  1115  HRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMA  936
             HRL   N+ KLA ++E C+ DY     DG     +  A      GYKCVLN+KASED+ A
Sbjct  252   HRLTVRNMGKLAGAVEACVEDYFAEQADGKQQPPSAGAD-----GYKCVLNSKASEDSQA  306

Query  935   NFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSE  756
             N A WEP HGRF FRHP++QY  +GA+MR CAYC+E L G + S  Q  + E++ + +++
Sbjct  307   NLARWEPAHGRFGFRHPYEQYKNVGAAMRHCAYCVEALSGCVRSEIQ--APEHVKRHLAD  364

Query  755   ECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTT  576
              C  V + C +VL +    + + T S   +  V DMN+AV+ LQ   + L  PS      
Sbjct  365   GCTTVAARCARVLGEAESSVSAMTTSWFLEFAVADMNTAVQELQSDLREL--PSK-----  417

Query  575   QVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVN  396
                         L +E+ + + D             QL TV SLL+E++ R EGVV  V+
Sbjct  418   ------------LAEESPATVID-----------AVQLFTVTSLLIEVSTRVEGVVDAVD  454

Query  395   QLANLAQFRGQSDK  354
              LA+LA FR    K
Sbjct  455   TLASLAGFRSADAK  468



>ref|XP_006854629.1| hypothetical protein AMTR_s00030p00178130 [Amborella trichopoda]
 gb|ERN16096.1| hypothetical protein AMTR_s00030p00178130 [Amborella trichopoda]
Length=463

 Score =   380 bits (975),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 223/472 (47%), Positives = 300/472 (64%), Gaps = 59/472 (13%)
 Frame = -3

Query  1688  GFVLRIW---------------SFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRP  1554
             GF+ R+W                F ++ W+LGK +PR+V+H +KVGLAL+LVSLFY++RP
Sbjct  13    GFLTRVWQGIISIFAMVKSCFRGFFERVWKLGKDDPRRVVHSLKVGLALTLVSLFYFMRP  72

Query  1553  LYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQ  1374
             LYD VGG A+WAVMTVVVVFEY+VGATLSK +NR  AT LAGSL +GVH +A+ SG K +
Sbjct  73    LYDGVGGMAIWAVMTVVVVFEYSVGATLSKGLNRGFATLLAGSLAVGVHELASLSGDKSE  132

Query  1373  PIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRL  1194
             PIIL  SVFL A   TF RF P+IK R+DYG  IFILTFSLVSVSGYRVDKLL++A QRL
Sbjct  133   PIILGISVFLQATVFTFLRFFPTIKTRYDYGAMIFILTFSLVSVSGYRVDKLLEMAHQRL  192

Query  1193  STIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkd  1014
             STI +G+++C+ ++ML+CPVWAG+DLH LI  NL+KLA S+EG +++  N      +++ 
Sbjct  193   STILIGSALCVLVSMLVCPVWAGEDLHNLIAKNLDKLAASVEGVVAE--NFKEGEGEEEG  250

Query  1013  ndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYC  834
                     +LGYKCVLN+K +E+A+ANFA WEP HG F FRHPWKQYLKIG + R CAY 
Sbjct  251   EINEENPSVLGYKCVLNSKPTEEALANFARWEPAHGPFGFRHPWKQYLKIGMAARYCAYS  310

Query  833   IETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQ----D  666
             +E L+   NS +Q        + +++  + VC+  G V  DL   + ST K        D
Sbjct  311   LEALNACTNSDSQAA------QELTQHLKAVCTKVGHVSSDLLLDLSSTVKKMTTSSHTD  364

Query  665   ILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLV  486
             +LV  +N AV+ LQLA K L                 P   H                 V
Sbjct  365   LLVAQLNIAVQELQLALKIL---------------SNPLPVH-----------------V  392

Query  485   YLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQS  330
              + +I  ++TVASL VEI+AR E V + V +L+ +A F+ ++ ++  +++ +
Sbjct  393   SIPDIVLIATVASLTVEISARVEDVAEAVEELSRIAHFKTETAEENKQKAAT  444



>ref|XP_002448354.1| hypothetical protein SORBIDRAFT_06g025640 [Sorghum bicolor]
 gb|EES12682.1| hypothetical protein SORBIDRAFT_06g025640 [Sorghum bicolor]
Length=493

 Score =   381 bits (978),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 223/479 (47%), Positives = 297/479 (62%), Gaps = 31/479 (6%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGK-----VYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGV  1605
             RV +P+G S V V     R       +      F  R+  F  + W++G  +PR+ +HG+
Sbjct  17    RVTVPEGASAVAVEHEACRAARAWAWLVSCALAFRDRVLGFGRRVWRIGADDPRRAVHGL  76

Query  1604  KVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGS  1425
             KVGLAL+LVS+FYY RPLYD VGG AMWAV+TVVVVFEYTVG  + K  NR  AT  AG 
Sbjct  77    KVGLALTLVSVFYYTRPLYDGVGGAAMWAVLTVVVVFEYTVGGCVYKGFNRAFATASAGV  136

Query  1424  LGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVS  1245
             + +GVHW+A+++ +K QP I   SVF+LAA ATFSRFIP++KARFDYG TIFILT+SLV+
Sbjct  137   IALGVHWIASKTDEKFQPFIRSGSVFVLAAMATFSRFIPTVKARFDYGVTIFILTYSLVA  196

Query  1244  VSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEG  1065
             VSGYRVD L+ +AQQR+ TIA+G S+C+ I  L+CPVWAG +LHR    N++KLAD++E 
Sbjct  197   VSGYRVDALVAMAQQRVCTIAIGVSMCVAICALICPVWAGQELHRATVRNMDKLADAVEA  256

Query  1064  CISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHP  885
             C+ DY      G+      ++S+K   GYKCVLN+KASED+ AN A WEP HGRF FRHP
Sbjct  257   CVQDYF--VAAGEQANKQQQSSKKAAEGYKCVLNSKASEDSQANLARWEPAHGRFAFRHP  314

Query  884   WKQYLKIGASMRACAYCIETLHGSINSS-AQVGSAEYILKPVSEECRRVCSTCGKVLRDl  708
             + QY  +GA+MR CAYC+E L G + S+  Q  +  +  + ++  C RV + C   LR  
Sbjct  315   YGQYRNVGAAMRHCAYCVEALRGCVRSAETQAAAPCHARRHLAGACARVAARCATALRAA  374

Query  707   sklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQE  528
             S  + + T S   D+ V +MN+AVE LQ   ++L      +  T   E   P        
Sbjct  375   SSSVDTMTTSRGLDLAVVEMNAAVEELQADLRSLPSRLLLADATTTAEPAAP--------  426

Query  527   TKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKK  351
                            ++  AQL T+ SLL+E++ R EGV   V+ LANLA F    D+ 
Sbjct  427   ---------------MVGAAQLFTITSLLIEVSLRIEGVADAVDMLANLANFESADDEN  470



>ref|XP_003580342.1| PREDICTED: aluminum-activated malate transporter 10-like [Brachypodium 
distachyon]
Length=489

 Score =   379 bits (972),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 221/504 (44%), Positives = 300/504 (60%), Gaps = 47/504 (9%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSES----RRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             RV +P+G S  +  E+    R    +   V     ++    ++ W++G  +PR+ +HG+K
Sbjct  16    RVTVPEGASVTVEHEACLAARAWAWLASCVAMLGAKVCGLGERVWKIGADDPRRAVHGLK  75

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VGLAL+LVS+FYY RPLYD VGG AMWA+MTVVV+FEYTVG  + K  NR  AT  AG++
Sbjct  76    VGLALALVSVFYYTRPLYDGVGGAAMWAIMTVVVIFEYTVGGCVYKGFNRAAATVSAGAI  135

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
              +GVHW+A+ +G   +P I   SVFLLA+ ATFSRFIP++KARFDYG TIFILT+SLV+V
Sbjct  136   ALGVHWIASHAGHTFEPFIRSGSVFLLASLATFSRFIPTVKARFDYGVTIFILTYSLVAV  195

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRV  +L +AQQR+ T+ +G S+C+ +A  +CPVWAG +LH L   N+  LA ++E C
Sbjct  196   SGYRVSTVLAMAQQRVCTVGIGISMCLSVATFVCPVWAGQELHGLTARNMSNLAGAVEAC  255

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             + DY     +G D      +S  K  GYKCVL +KASEDA AN A WEP HGRF FRHP+
Sbjct  256   VEDYF---AEGTDQYKQHSSSAAKAEGYKCVLGSKASEDAQANLARWEPAHGRFGFRHPY  312

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEE-----------CRRVCS  735
             +QY  +GA+MR CAYC+E L G + SS    S E    P  ++           C  V  
Sbjct  313   EQYKSVGAAMRRCAYCVEALRGCVRSSGY--SEESTQAPEDDDQHAVKRHLAGACTSVAQ  370

Query  734   TCGKVLRDlsklmksttksSI-QDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQ  558
              C +V+R+ +  + +   S I  ++ V +MN+AV+ LQ   + L  PS  +         
Sbjct  371   QCARVMREAAGSVGAMEISRIGMELAVAEMNAAVQELQCDLRAL--PSKLAAEG------  422

Query  557   KPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLA  378
                    K+E +SA           +M+  QL TV SLL+E++AR EGVV+ V  LA LA
Sbjct  423   -------KEEEESA-----------VMDAVQLFTVTSLLIEVSARVEGVVEAVETLACLA  464

Query  377   QFRGQSDKKMAKQSQSQHKEQNVQ  306
              FR    K  A        +  VQ
Sbjct  465   GFRSLDVKAEASDGMDAKVQDYVQ  488



>ref|XP_011042657.1| PREDICTED: LOW QUALITY PROTEIN: aluminum-activated malate transporter 
10 [Populus euphratica]
Length=470

 Score =   377 bits (967),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 234/492 (48%), Positives = 309/492 (63%), Gaps = 51/492 (10%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLA  1590
             R+N+PDG  ++L  ES       D+          F++ A      EP+KVIH +KVG+ 
Sbjct  14    RINVPDGALKILKPES-------DL----------FLEVA------EPKKVIHCLKVGME  50

Query  1589  LSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvga------TLSKCVNRTVATFLAG  1428
             LS VSLFYY+RPLYD V GN +WA+MT VVVFE T  A      T  KC+NR + TFLAG
Sbjct  51    LSTVSLFYYMRPLYDGVXGNVVWAIMTAVVVFENTAVARYISGATFYKCINRGIGTFLAG  110

Query  1427  SLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLV  1248
             SLG+GVHW AN SG  ++PIIL  SVF LA+AATFSRFIPS+ +RF+YG  IFILTFSLV
Sbjct  111   SLGVGVHWAANHSG--VEPIILGISVFFLASAATFSRFIPSVISRFEYGAMIFILTFSLV  168

Query  1247  SVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLE  1068
             SVSGYRVDK++D+A QRLS IA+G S+ I ++ML  P+WAG++LH LI  NLEKLAD+L+
Sbjct  169   SVSGYRVDKVIDIAHQRLSAIAIGASLGILMSMLFYPIWAGEELHNLIHRNLEKLADALD  228

Query  1067  GCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRH  888
             G    Y ++     +   + + S KK+ GYK VLN+K +ED+ A FA WEP HGRFNFRH
Sbjct  229   GI---YAHSQPLKLNSSVSTEDSCKKMEGYKFVLNSKVAEDSTAGFARWEPAHGRFNFRH  285

Query  887   PWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY---ILKPVSEECRRVCSTCGKVL  717
             PW QYLK+GAS+R+CAYCI TL+G +NS        +   + K +S+    + S    VL
Sbjct  286   PWNQYLKVGASLRSCAYCIGTLNGCLNSENSGKPRIWNSLLSKYLSDISITLSSYALHVL  345

Query  716   RDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHL  537
             ++L+  +K+T KSS  D  +  M  AV+ LQ A ++L P    +  +   +    +    
Sbjct  346   KELAVAVKTTKKSSKIDYSIGKMRYAVKELQKALESL-PNHLVAAPSSTSDGDATAEPIR  404

Query  536   KQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSD  357
             K  T S            +MEI +L+T+ S+L E  AR E V  EVN+LA LA  +  + 
Sbjct  405   KTATPS------------VMEILRLATLVSMLTETTARIEEVADEVNELAKLADLKPPTS  452

Query  356   KKMAKQSQSQHK  321
             KK A  SQ + K
Sbjct  453   KK-ANSSQPRKK  463



>ref|XP_008376196.1| PREDICTED: aluminum-activated malate transporter 10 [Malus domestica]
Length=497

 Score =   377 bits (967),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 233/498 (47%), Positives = 314/498 (63%), Gaps = 68/498 (14%)
 Frame = -3

Query  1766  VNMPDGTSRVLVSESRRRGK----VYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKV  1599
             +N+ DGT+   V ES    K    +  +VGG VL++W F+ KAW+LG  EPRK IH +KV
Sbjct  20    INVADGTNNASVPESGLVDKALLGLKGMVGGLVLKVWRFLVKAWKLGVDEPRKAIHALKV  79

Query  1598  GLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLG  1419
             GLA+S+V LFYY+R LY+ VGGNA+WA MTVVVVFE TVGATL K +NR   TFLAGSLG
Sbjct  80    GLAISVVLLFYYMRSLYEGVGGNAVWADMTVVVVFESTVGATLYKSINRAAGTFLAGSLG  139

Query  1418  IGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVS  1239
             +GVHW++ ++GQ  +PII+  SVFLLA+AATFSR               FILTFSLVS+S
Sbjct  140   LGVHWISCKAGQNFEPIIIGTSVFLLASAATFSR---------------FILTFSLVSIS  184

Query  1238  GYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCI  1059
             GYRV++L +LA  RL T+ +GT  CI I++L  P WAG  LH LI NNLEKLADSL+G +
Sbjct  185   GYRVEELFELAYHRLLTVGIGTFFCILISILFYPNWAGQQLHCLIYNNLEKLADSLDGYV  244

Query  1058  SDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWK  879
              +Y       ++    D  S K++ GYKCVL++KA+ED +  FA WEP HG FNF+HPWK
Sbjct  245   LEYF----KDNEAVTEDNCSTKQIKGYKCVLDSKATEDNLDKFARWEPAHGSFNFKHPWK  300

Query  878   QYLKIGASMRACAYCIETL----HGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRD  711
             QYLKIGASMR+CAYC++ L       I + A++G+ +   K  S  C+        +L +
Sbjct  301   QYLKIGASMRSCAYCVKALSACMESEIKTPARIGNLK---KHFSNACKTTNIHSSDILTE  357

Query  710   lsklmksttksSIQDILVHDMNSAVEALQLAFKT----LIPPSSQSLTTQVEEAQKPSSD  543
             + K +K+  KSS  D LV +MN AV+ LQ + K+    L+ P+S++              
Sbjct  358   MVKTIKTMKKSSEIDSLVWEMNKAVQELQKSLKSVPIWLVLPTSEA--------------  403

Query  542   HLKQETKSALSDDDDHD---LVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQF  372
                       +DDD      +  L+E+  ++T+ SLL+E AAR  G+V  VN+LA     
Sbjct  404   ----------TDDDGKGEPIVAPLVEVLPVTTLVSLLIENAARISGIVDAVNELA-----  448

Query  371   RGQSDKKMAKQ-SQSQHK  321
              GQ+D K A Q +++QH+
Sbjct  449   -GQADMKPAPQGNKTQHQ  465



>ref|XP_010543061.1| PREDICTED: aluminum-activated malate transporter 10 [Tarenaya 
hassleriana]
Length=431

 Score =   367 bits (942),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 218/476 (46%), Positives = 294/476 (62%), Gaps = 66/476 (14%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSES-RRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGL  1593
             ++N  DGTS  LV ES    G+    + G V R+   ++KAW++G +EPRKV+H +KVGL
Sbjct  13    KINAGDGTSERLVPESWGLNGRAAVWLKGLVKRMVVSMEKAWRIGAEEPRKVVHCLKVGL  72

Query  1592  ALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIG  1413
             ALSLVS+FYY+RPLY+ VGGN++W                        V T +       
Sbjct  73    ALSLVSVFYYMRPLYEGVGGNSLW-----------------------IVMTVV-------  102

Query  1412  VHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGY  1233
                           ++ + +V   A+ ATFSRF+PS KARFDYG  IFILTFSLVSVSGY
Sbjct  103   --------------VVFEPNV---ASMATFSRFVPSFKARFDYGAMIFILTFSLVSVSGY  145

Query  1232  RVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISD  1053
             RVDKL+ LAQQR+STIA+GTSICI I++  CPVWAG  LHRL+ +NLEKLA SL+GC+++
Sbjct  146   RVDKLVALAQQRVSTIAIGTSICIVISIFFCPVWAGVQLHRLLQHNLEKLAHSLDGCVAE  205

Query  1052  YLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQY  873
             +   + +    K+ ++ + KK+LG+KCVLN+K  E++MAN A WEPGHG FNF HPWKQY
Sbjct  206   FF-KEKEALTQKEGEEETNKKMLGFKCVLNSKGPEESMANLARWEPGHGSFNFWHPWKQY  264

Query  872   LKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmk  693
             LK GA+MR CAYC+E L   I S  +V   + +   + E C +V S   K+LR+L+ +MK
Sbjct  265   LKTGAAMRRCAYCLENLTICIISETEV--PDRLKNHLREGCTKVGSASSKILRELATMMK  322

Query  692   sttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSAL  513
              T KSS  D  +  +NSAV+ LQ   KT+     ++ T   EE   P+ D    E++   
Sbjct  323   KTRKSSNMDFQLFQLNSAVQELQETLKTV-----KNQTDMPEE--DPAQDKGGGESRIV-  374

Query  512   SDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMA  345
                     + L E+  L+T+ SLL+E A R + +VKEV +LANLA F+  S KK A
Sbjct  375   -------SISLHEVLPLATMVSLLIENATRIQEIVKEVEELANLACFKRDSKKKAA  423



>ref|XP_009111397.1| PREDICTED: LOW QUALITY PROTEIN: aluminum-activated malate transporter 
10 [Brassica rapa]
Length=501

 Score =   369 bits (948),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 236/514 (46%), Positives = 320/514 (62%), Gaps = 63/514 (12%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLA  1590
             R+++ + T++ LV +S    +++  + G ++       K W++G  +P KV+H +KVGLA
Sbjct  13    RISVDNETTKRLVPKSGPSERIFLWLKGLIM-------KTWRIGADDPAKVVHCLKVGLA  65

Query  1589  LSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGV  1410
             LSLV +FYY+R LYD VGGNAMWA+MTVVVVFE  VGAT SKCVNR VAT LAGSLGI V
Sbjct  66    LSLVCIFYYMRSLYDGVGGNAMWAIMTVVVVFESNVGATFSKCVNRVVATILAGSLGIAV  125

Query  1409  HWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYR  1230
             HWVA +SG+  +  ++ +SVFL A  AT+SRF+PS K+RFDYG  IFILTFSLVSV GYR
Sbjct  126   HWVATKSGEA-EIFVIGSSVFLFAFTATYSRFVPSFKSRFDYGAMIFILTFSLVSVGGYR  184

Query  1229  VDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDY  1050
             VDKL+D+AQQR+STIA+GT+ICI I + +CP+W+G  LHRL+  N  KLADSL+GC+++Y
Sbjct  185   VDKLVDMAQQRVSTIAVGTTICIIITIFICPIWSGTQLHRLVQCNFVKLADSLDGCVAEY  244

Query  1049  LnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAM-----------------------  939
                        +N+  +  K+ G+KCVLN+K  E+AM                       
Sbjct  245   F--KKRDVSTNENEDETNLKVQGFKCVLNSKGIEEAMVTSHIILGDDVKFLPYXFAVTYG  302

Query  938   -------ANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAE  780
                    AN A WEP HG FNFRHPW+QY+KIGA+M  CAYC+E L   +N   +V   +
Sbjct  303   YFFKSLKANLARWEPAHGSFNFRHPWQQYVKIGAAMCRCAYCLENLSICMNYETEV--PD  360

Query  779   YILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIP  600
              + K   E C ++ +   K+LR+L+ ++K+T +SS  D LV DMNSAV+ LQ   KT IP
Sbjct  361   QVKKHFRETCMKLTAASSKILRELADILKNTRRSSKMDFLVFDMNSAVQELQETLKT-IP  419

Query  599   PSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLM---EIAQLSTVASLLVEIA  429
               +                  K E +  +  D+  D    M   E+  ++T+ SLL+EIA
Sbjct  420   IQTN-----------------KPEEEEEVPSDEGEDRTIPMSLHEVLPVATLVSLLIEIA  462

Query  428   ARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQ  327
             AR +  V+ V  LANLA F+  S KK    + +Q
Sbjct  463   ARIQTTVEAVVVLANLADFKQDSKKKTEDNNTNQ  496



>ref|XP_009415830.1| PREDICTED: aluminum-activated malate transporter 10-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=461

 Score =   367 bits (943),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 218/483 (45%), Positives = 311/483 (64%), Gaps = 43/483 (9%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRG---KVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKV  1599
             +V +P G+S  L S+S       +++ +      +++ F     ++   +PRKV+H +KV
Sbjct  14    QVTVPGGSSVKLESDSVPTAAGWRMHRLKSALTSKVFDFASTVRKIAADDPRKVVHCMKV  73

Query  1598  GLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLG  1419
             GLAL+LVS+FYY RPLYD VGG AMWAVMTVVVVFE+TVG +L K +NR  AT  AGS+ 
Sbjct  74    GLALALVSVFYYTRPLYDGVGGAAMWAVMTVVVVFEFTVGGSLYKGLNRATATLSAGSVA  133

Query  1418  IGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVS  1239
              G+HW+A +SG+    IIL ASVFLL++AATFS+FIP+IKARFDYG TIFILTF+LV+VS
Sbjct  134   FGIHWLAIKSGRTADHIILGASVFLLSSAATFSKFIPTIKARFDYGVTIFILTFNLVAVS  193

Query  1238  GYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCI  1059
              YRV+KLL LAQ R  TI +G  IC+ + +++CPVWAG++LHRL+  N+EKLADSLE  +
Sbjct  194   SYRVEKLLALAQWRFCTITIGFCICLTVCVVICPVWAGEELHRLVMRNMEKLADSLEESV  253

Query  1058  SDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWK  879
             ++YL  +G  D ++   + S+    GYKCVLN+K+SED++AN A WEP HG F+F+HPW+
Sbjct  254   AEYLEEEGGVDCNQKLGQKSQ----GYKCVLNSKSSEDSLANLARWEPSHGCFSFQHPWR  309

Query  878   QYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlskl  699
             +YL++GA+MR CAYCIE+L   INS  Q    + + K +++   +V +   KVL++L+  
Sbjct  310   RYLEVGAAMRQCAYCIESLDSCINSENQ--PPDSVKKHLAKVYAKVTTESSKVLKELASS  367

Query  698   mksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKS  519
              +S  K S  D LV DM +  + LQ A  +L P  + SL                     
Sbjct  368   FRSMRKPSSIDYLVEDMKNTADELQNALGSL-PQEATSL---------------------  405

Query  518   ALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQ  339
                         ++E   L T ASLL+E++ R EGVV  V ++  L  F+  + +++  Q
Sbjct  406   ------------IVETLPLITAASLLIEVSVRVEGVVHAVKEITALPCFKPTNGEELKAQ  453

Query  338   SQS  330
             +++
Sbjct  454   NKA  456



>ref|XP_009415828.1| PREDICTED: aluminum-activated malate transporter 10-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=462

 Score =   367 bits (942),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 218/483 (45%), Positives = 311/483 (64%), Gaps = 42/483 (9%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRG---KVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKV  1599
             +V +P G+S  L S+S       +++ +      +++ F     ++   +PRKV+H +KV
Sbjct  14    QVTVPGGSSVKLESDSVPTAAGWRMHRLKSALTSKVFDFASTVRKIAADDPRKVVHCMKV  73

Query  1598  GLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLG  1419
             GLAL+LVS+FYY RPLYD VGG AMWAVMTVVVVFE+TVG +L K +NR  AT  AGS+ 
Sbjct  74    GLALALVSVFYYTRPLYDGVGGAAMWAVMTVVVVFEFTVGGSLYKGLNRATATLSAGSVA  133

Query  1418  IGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVS  1239
              G+HW+A +SG+    IIL ASVFLL++AATFS+FIP+IKARFDYG TIFILTF+LV+VS
Sbjct  134   FGIHWLAIKSGRTADHIILGASVFLLSSAATFSKFIPTIKARFDYGVTIFILTFNLVAVS  193

Query  1238  GYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCI  1059
              YRV+KLL LAQ R  TI +G  IC+ + +++CPVWAG++LHRL+  N+EKLADSLE  +
Sbjct  194   SYRVEKLLALAQWRFCTITIGFCICLTVCVVICPVWAGEELHRLVMRNMEKLADSLEESV  253

Query  1058  SDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWK  879
             ++YL  +G  D ++   + S+    GYKCVLN+K+SED++AN A WEP HG F+F+HPW+
Sbjct  254   AEYLEEEGGVDCNQKLGQKSQ----GYKCVLNSKSSEDSLANLARWEPSHGCFSFQHPWR  309

Query  878   QYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlskl  699
             +YL++GA+MR CAYCIE+L   INS  Q    + + K +++   +V +   KVL++L+  
Sbjct  310   RYLEVGAAMRQCAYCIESLDSCINSENQ-QPPDSVKKHLAKVYAKVTTESSKVLKELASS  368

Query  698   mksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKS  519
              +S  K S  D LV DM +  + LQ A  +L P  + SL                     
Sbjct  369   FRSMRKPSSIDYLVEDMKNTADELQNALGSL-PQEATSL---------------------  406

Query  518   ALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQ  339
                         ++E   L T ASLL+E++ R EGVV  V ++  L  F+  + +++  Q
Sbjct  407   ------------IVETLPLITAASLLIEVSVRVEGVVHAVKEITALPCFKPTNGEELKAQ  454

Query  338   SQS  330
             +++
Sbjct  455   NKA  457



>ref|XP_006857836.1| hypothetical protein AMTR_s00069p00044130 [Amborella trichopoda]
 gb|ERN19303.1| hypothetical protein AMTR_s00069p00044130 [Amborella trichopoda]
Length=420

 Score =   363 bits (932),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 189/330 (57%), Positives = 244/330 (74%), Gaps = 8/330 (2%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGK----VYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             RV + DG+S  L S+ R        V+++V G+ + +   I +  ++GK++PRKV H  K
Sbjct  15    RVTIGDGSSMQLRSDPRCFQTAWEWVFEVVLGWKMEVEELIQRICKIGKEDPRKVAHCFK  74

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VGLAL+LVSLFYY+RPLY+ VGGNAMWAVMTVVVVFE +VGATL K +NR + T LAG+L
Sbjct  75    VGLALTLVSLFYYMRPLYEGVGGNAMWAVMTVVVVFESSVGATLGKGLNRALGTILAGAL  134

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSV  1242
             GIGVH+VA +SG  ++PIIL  SVFL+A+AATFSRFIP +K R+DYG  IFILTFSLVS 
Sbjct  135   GIGVHYVAEKSGPTIEPIILGLSVFLIASAATFSRFIPKVKQRYDYGVMIFILTFSLVSE  194

Query  1241  SGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGC  1062
             SGYRV+KL D+A +RLST+A+G+  C+ I+ML+CP WAG DLH+LI  NL+KLA SL+G 
Sbjct  195   SGYRVEKLFDMAHERLSTVAIGSCACVLISMLICPTWAGQDLHKLIAKNLQKLAASLDGY  254

Query  1061  ISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPW  882
             +++Y     +  D +      +  L GYKCVLN+KA+E+++ANFA WEP HG F FRHPW
Sbjct  255   VAEYF----EEKDVEGISIIDKATLKGYKCVLNSKATEESLANFATWEPAHGNFGFRHPW  310

Query  881   KQYLKIGASMRACAYCIETLHGSINSSAQV  792
             KQYLKIG + R  AYCIE L    +S  Q+
Sbjct  311   KQYLKIGTTSRFSAYCIEALSACTSSEVQI  340



>gb|ACJ12884.1| ALMT2 [Hordeum vulgare subsp. vulgare]
Length=403

 Score =   357 bits (917),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 206/433 (48%), Positives = 275/433 (64%), Gaps = 38/433 (9%)
 Frame = -3

Query  1610  GVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLA  1431
             G +VGLAL+LVS+FYY RPLYD VGG+AMWA+MTVVVVFEYTVG  + K  NR  AT  A
Sbjct  1     GTRVGLALALVSVFYYTRPLYDGVGGSAMWAIMTVVVVFEYTVGGCVYKGFNRAAATVSA  60

Query  1430  GSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSL  1251
             G++ +GVHW+A  +G +L P I   SVFLLA+ ATFSRFIP++KARFDYG TIFILT+SL
Sbjct  61    GAIALGVHWIAANAGHELGPFIRSGSVFLLASMATFSRFIPTVKARFDYGVTIFILTYSL  120

Query  1250  VSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSL  1071
             V+VSGYRV+ LL LAQQR+ TI +G  +C+ + +L+CPVWAG +LH L   N++KLA ++
Sbjct  121   VAVSGYRVESLLALAQQRVCTIGIGIFMCLCVCVLICPVWAGQELHGLTARNMDKLAGAV  180

Query  1070  EGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFR  891
             E C+ DY     DG     +  A      GYKCVLN+KASED+ AN A WEPGHGRF FR
Sbjct  181   EACVEDYFADQADGKQQPPSAAAE-----GYKCVLNSKASEDSQANLARWEPGHGRFGFR  235

Query  890   HPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRD  711
             HP++QY   GA+MR CAYC+E   G + S  Q  + E++ + +++ C      C +VL +
Sbjct  236   HPYEQYKXXGAAMRHCAYCVEAXSGCVRSEIQ--APEHVKRHLADXCTTCAXXCARVLGE  293

Query  710   lsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQ  531
              +  + + T S   D  V DMN+AV+ LQ   + L  PS                  L +
Sbjct  294   XASSVSAMTTSWSLDFAVADMNTAVQELQSDLREL--PSK-----------------LAE  334

Query  530   ETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKK  351
             E+ +            +++  QL TV SLL+E++ R EGVV  V+ LA+LA F    D K
Sbjct  335   ESPA-----------LVIDAVQLFTVTSLLIEVSTRVEGVVDAVDTLASLAGFTSADDTK  383

Query  350   MAKQSQSQHKEQN  312
               + S+++ K  N
Sbjct  384   -PEASETETKVIN  395



>ref|XP_007027980.1| Aluminum activated malate transporter family protein [Theobroma 
cacao]
 gb|EOY08482.1| Aluminum activated malate transporter family protein [Theobroma 
cacao]
Length=488

 Score =   354 bits (909),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 214/436 (49%), Positives = 275/436 (63%), Gaps = 41/436 (9%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++ S      +LG+ +PR++IH +KVGLAL+LVSL YY RPLYD  G + MWAV+TVVVV
Sbjct  31    KVISIAKSIMKLGQDDPRRLIHSLKVGLALTLVSLLYYARPLYDGFGVSGMWAVLTVVVV  90

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE+TVG TLSK +NR  ATF AG+LGIG  + A   G++ +PI+L   VFLLA AATFSR
Sbjct  91    FEFTVGGTLSKSLNRGFATFSAGALGIGADYFAGLFGKQGEPIVLGILVFLLATAATFSR  150

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P IKAR+DYG  IFILTFSLV+VSGYRVD+L+ LA QRLSTI +G + C+ I++ +CP
Sbjct  151   FFPRIKARYDYGVLIFILTFSLVAVSGYRVDELVVLAHQRLSTIIMGGATCMLISIFVCP  210

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG+DLHR + +NLEKLA  LEG    Y   DG G   KD     +    GYK +LN+K
Sbjct  211   VWAGEDLHRAVASNLEKLASYLEGFGGAYFQYDGSGVVSKDGKSFHQ----GYKSILNSK  266

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
              SE+++ANFA WEPGHGRF  RHPWK YLKIGA  R CAY IE ++G I+S  Q  S E+
Sbjct  267   NSEESLANFARWEPGHGRFRLRHPWKHYLKIGALARQCAYQIEAINGCIDSDIQA-SQEF  325

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
               K +   C+R+ + CGK L+                           AL  A KT+  P
Sbjct  326   KSK-IEGSCKRMSAECGKALK---------------------------ALATAMKTMTDP  357

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
             SS   T    E  K +   LK   K+A  +D+D      + I   +TVAS+LVEI    E
Sbjct  358   SS---TNPHVENSKAAMKDLKFALKAASLEDED-----FLAIVPAATVASILVEIVKSVE  409

Query  416   GVVKEVNQLANLAQFR  369
              + +  N+L+ LA+F+
Sbjct  410   KISEAANELSQLARFK  425



>ref|XP_002320432.2| hypothetical protein POPTR_0014s09670g [Populus trichocarpa]
 gb|EEE98747.2| hypothetical protein POPTR_0014s09670g [Populus trichocarpa]
Length=424

 Score =   350 bits (898),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 214/492 (43%), Positives = 281/492 (57%), Gaps = 97/492 (20%)
 Frame = -3

Query  1769  RVNMPDGTSRVLVSESRRRGKVY----DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVK  1602
             R+N+PDGT  +L  ES    +++     ++G F+L+IW F++KA  +   EP+KVIH +K
Sbjct  14    RINVPDGTLEILQPESDLVHRIWLGLKGLLGEFILKIWKFLEKARNIAVAEPKKVIHCLK  73

Query  1601  VGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSL  1422
             VG+ LS+VSLFYY+RPLY+               V  Y  GATL KC NR + TF AGSL
Sbjct  74    VGMELSIVSLFYYMRPLYE---------------VARYIAGATLYKCTNRGIGTFRAGSL  118

Query  1421  GIGVHWVANQSGQKLQPIILQASVFLLAA-----AATFSRFIPSIKARFDYGCTIFILTF  1257
             G+GVHW AN SG  ++PIIL  SVFLL          F RFIPS+KARFDYG TIFILTF
Sbjct  119   GVGVHWAANHSG--VEPIILGISVFLLGELEPLQQQPFRRFIPSVKARFDYGATIFILTF  176

Query  1256  SLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLAD  1077
             SLVSVSGYR DK++D+A Q LS IA+G S+CI I+ML  P+WAG++LH LI  NLEKLAD
Sbjct  177   SLVSVSGYREDKVIDIAHQSLSAIAIGASLCILISMLFYPIWAGEELHNLIHRNLEKLAD  236

Query  1076  SLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFN  897
             +L+GCI+ Y            +D  S KK+ GYK VLN+KA+ED+MA F  WEP HGRFN
Sbjct  237   ALDGCIAGYF--------TGSSDGDSCKKMEGYKFVLNSKAAEDSMAGFTRWEPAHGRFN  288

Query  896   FRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVL  717
             FRHPW QYLK                          + E++ + +S+    + S    VL
Sbjct  289   FRHPWNQYLK--------------------------APEHLKRYLSDVSNTLSSYASHVL  322

Query  716   RDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHL  537
             ++L+  +K+  KSS  D  +  M  AV+ LQ                 + +   PS    
Sbjct  323   KELAVAVKTMKKSSKIDYSIGKMQHAVKELQ--------------KEPIRKTATPS----  364

Query  536   KQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSD  357
                               +MEI +L+T+  +L E  AR E V  EVN+LA LA  +  + 
Sbjct  365   ------------------VMEILRLATLVPMLTETTARIEEVADEVNELAKLADLKPPTS  406

Query  356   KKMAKQSQSQHK  321
             KK A QSQ ++K
Sbjct  407   KK-ANQSQPRNK  417



>gb|KHG00783.1| Aluminum-activated malate transporter 8 -like protein [Gossypium 
arboreum]
Length=498

 Score =   352 bits (903),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 213/467 (46%), Positives = 285/467 (61%), Gaps = 39/467 (8%)
 Frame = -3

Query  1712  GKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGG  1533
             G+   + G  + RI S      +LG+ +PR++IH  KVGLALSLVSL YY RPLYD  G 
Sbjct  19    GRFKALPGKLMARIISIAMSIKKLGQDDPRRLIHSFKVGLALSLVSLLYYARPLYDGFGV  78

Query  1532  NAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQAS  1353
               MWAV+TVVVVFE+TVG TLSKC+NR  ATFLAG LGIG  + A+  G++ +PI+L   
Sbjct  79    AGMWAVLTVVVVFEFTVGGTLSKCLNRGFATFLAGGLGIGADYFASLFGKQGEPIVLGIL  138

Query  1352  VFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGT  1173
             VF+LAAAATFSRF P IKAR+DYG  IFILTFSLV+VSGYRVD+L+ LA QRLSTI +G 
Sbjct  139   VFVLAAAATFSRFFPRIKARYDYGVLIFILTFSLVAVSGYRVDELVVLAHQRLSTIIMGG  198

Query  1172  SICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEK  993
             + C+ I++ +CPVWAG+DLH+ + +NLEKLA  LEG    Y  +  DG     +   + K
Sbjct  199   ATCMLISIFICPVWAGEDLHKAVASNLEKLATYLEGFGDVYFQSCKDGGSGVGSKDGNGK  258

Query  992   KLL--GYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLH  819
               L  GYK +LN+K SE+++ANFA WEPGHGRF  R+PWK YLKIGA  R CAY IE ++
Sbjct  259   SFLHQGYKSILNSKNSEESLANFARWEPGHGRFPLRYPWKHYLKIGALARQCAYQIEAIN  318

Query  818   GSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSA  639
             G INS  Q  ++E     +   C R+ + CGK L+                         
Sbjct  319   GCINSDIQ--ASEEFKSKIEGPCSRMSAECGKALK-------------------------  351

Query  638   VEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLS  459
               AL  + K +  PSS +    VE ++    D LK   K++  ++ D      + I  +S
Sbjct  352   --ALATSMKMMTDPSSAN--PHVENSKAAMKD-LKFALKASSMENAD-----FLAIVPVS  401

Query  458   TVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHKE  318
             TV S+LVEI    E + + V++L+  A F    +  ++ +   Q ++
Sbjct  402   TVGSVLVEITKCIEKISEAVHELSQRAHFSKTMEPTVSPEKPQQQQQ  448



>ref|XP_008241057.1| PREDICTED: aluminum-activated malate transporter 8 [Prunus mume]
Length=481

 Score =   350 bits (898),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 213/469 (45%), Positives = 290/469 (62%), Gaps = 43/469 (9%)
 Frame = -3

Query  1721  RRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDD  1542
             R  G +  + G F  ++   +    +LG+ +PR+VIH +KV LAL+LVSL YY R L+DD
Sbjct  19    RWWGWLKALPGKFNTKVVKVVKGTIKLGRDDPRRVIHSLKVALALTLVSLLYYWRALFDD  78

Query  1541  VGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIIL  1362
              G   +WAV+TVVVVFE+TVGATLSK +NR  AT LAG+LG+G   +A+  G+K +PI+L
Sbjct  79    FGVAGIWAVLTVVVVFEFTVGATLSKSLNRGFATLLAGALGVGAQHLASLFGEKGEPIVL  138

Query  1361  QASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIA  1182
                VFLLAAA+TFSRF P IKAR+DYG  IFILTFS+V++SGYRV++LL++A +RL TI 
Sbjct  139   GIFVFLLAAASTFSRFFPRIKARYDYGVLIFILTFSMVTISGYRVEELLEMAHERLLTII  198

Query  1181  LGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkA  1002
             +G   C+ I++ LCPVWAG+DLH+LI +N EKLA+ LEG   +Y        +     K 
Sbjct  199   IGGGTCMIISVFLCPVWAGEDLHKLIASNTEKLANCLEGFGGEYF-QTPKDGNCGMVPKN  257

Query  1001  SEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETL  822
              +  L GYK VLN+K +E+++ANFA WEPGHGRF FRHPWKQYLKIGA  R CAY IETL
Sbjct  258   EDSFLQGYKSVLNSKTTEESLANFAAWEPGHGRFKFRHPWKQYLKIGALARQCAYQIETL  317

Query  821   HGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNS  642
             +G +NS+ QV   E+ L+ + + CR +    GK L+                        
Sbjct  318   NGHVNSNVQV-PPEF-LQIIQDSCRTMSIETGKALK------------------------  351

Query  641   AVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQL  462
                AL +A KT+  P       +  E  K +   LK   K+A  ++ D     ++ I   
Sbjct  352   ---ALAIAIKTMKEPKH---ACEHLEKSKTAVKDLKTALKAASLENAD-----ILAIVPA  400

Query  461   STVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHKEQ  315
             + VAS+LVEI    E + K V++L+ LA+F     KK+ + + S  K Q
Sbjct  401   AAVASILVEIVKGAEKISKSVHELSELARF-----KKVVEPTVSAEKPQ  444



>emb|CBI22787.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   348 bits (893),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 211/439 (48%), Positives = 281/439 (64%), Gaps = 41/439 (9%)
 Frame = -3

Query  1652  AWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaT  1473
             A + G+ +PRK+IH +KVGLAL+L+S+FYY RPLYD  G + MWAV+TVVVVFE+TVGAT
Sbjct  35    AQKQGQDDPRKIIHSLKVGLALTLISMFYYFRPLYDSFGVSGMWAVLTVVVVFEFTVGAT  94

Query  1472  LSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKAR  1293
             LSK +NR  AT +AG+LG+G   +A+  G++ +PI+L   VFLLA A+TFSRF P IKAR
Sbjct  95    LSKSLNRGFATMVAGALGVGAQELASLFGEEGEPIVLGILVFLLATASTFSRFFPRIKAR  154

Query  1292  FDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLH  1113
             +DYG  IFILTFSLV+VSGYRV+++++LA QRLSTI +G + CI IA+ +CPVWAG+DLH
Sbjct  155   YDYGVLIFILTFSLVAVSGYRVNEIIELAHQRLSTILVGGATCIIIAIFVCPVWAGEDLH  214

Query  1112  RLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNTKASEDAMA  936
              +   N+EKLA+ LEG   +Y       D +   +   +K  L GYK  LN+K+SE+++A
Sbjct  215   NMTVRNMEKLANFLEGFGGEYF--KEPFDGESVVESKDDKSFLQGYKSALNSKSSEESLA  272

Query  935   NFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSE  756
             NFA WEP HGRF FRHPWKQYL IGA  R CAY IE +   INS  QV SAE+ +K + E
Sbjct  273   NFASWEPCHGRFRFRHPWKQYLMIGALTRQCAYHIEAISSYINSEIQV-SAEFRMK-IQE  330

Query  755   ECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTT  576
              C ++ S  G+ L+                           AL  A KT+  PSS     
Sbjct  331   PCTKISSESGEALK---------------------------ALASAIKTMTDPSSAD--P  361

Query  575   QVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVN  396
              V  A+    D L+    +A  D+ D     L+EI   +TVAS+L+EI    E V + V+
Sbjct  362   HVANAKAAVKD-LEIALNAASLDETD-----LLEIIPDATVASILIEIVKCMEKVSESVH  415

Query  395   QLANLAQFRG-QSDKKMAK  342
             +L+ LA F+  Q  +KM +
Sbjct  416   ELSGLAHFKHPQFHQKMTR  434



>ref|XP_002264700.2| PREDICTED: aluminum-activated malate transporter 8-like [Vitis 
vinifera]
Length=485

 Score =   348 bits (892),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 210/445 (47%), Positives = 281/445 (63%), Gaps = 40/445 (9%)
 Frame = -3

Query  1652  AWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaT  1473
             A + G+ +PRK+IH +KVGLAL+L+S+FYY RPLYD  G + MWAV+TVVVVFE+TVGAT
Sbjct  35    AQKQGQDDPRKIIHSLKVGLALTLISMFYYFRPLYDSFGVSGMWAVLTVVVVFEFTVGAT  94

Query  1472  LSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKAR  1293
             LSK +NR  AT +AG+LG+G   +A+  G++ +PI+L   VFLLA A+TFSRF P IKAR
Sbjct  95    LSKSLNRGFATMVAGALGVGAQELASLFGEEGEPIVLGILVFLLATASTFSRFFPRIKAR  154

Query  1292  FDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLH  1113
             +DYG  IFILTFSLV+VSGYRV+++++LA QRLSTI +G + CI IA+ +CPVWAG+DLH
Sbjct  155   YDYGVLIFILTFSLVAVSGYRVNEIIELAHQRLSTILVGGATCIIIAIFVCPVWAGEDLH  214

Query  1112  RLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNTKASEDAMA  936
              +   N+EKLA+ LEG   +Y       D +   +   +K  L GYK  LN+K+SE+++A
Sbjct  215   NMTVRNMEKLANFLEGFGGEYF--KEPFDGESVVESKDDKSFLQGYKSALNSKSSEESLA  272

Query  935   NFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSE  756
             NFA WEP HGRF FRHPWKQYL IGA  R CAY IE +   INS  QV SAE+ +K + E
Sbjct  273   NFASWEPCHGRFRFRHPWKQYLMIGALTRQCAYHIEAISSYINSEIQV-SAEFRMK-IQE  330

Query  755   ECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTT  576
              C ++ S  G+ L+                           AL  A KT+  PSS     
Sbjct  331   PCTKISSESGEALK---------------------------ALASAIKTMTDPSSAD--P  361

Query  575   QVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVN  396
              V  A+    D L+    +A  D+ D     L+EI   +TVAS+L+EI    E V + V+
Sbjct  362   HVANAKAAVKD-LEIALNAASLDETD-----LLEIIPDATVASILIEIVKCMEKVSESVH  415

Query  395   QLANLAQFRGQSDKKMAKQSQSQHK  321
             +L+ LA F+        ++ Q  H+
Sbjct  416   ELSGLAHFKVVEPNVTPEKPQLLHR  440



>ref|NP_001057543.1| Os06g0331900 [Oryza sativa Japonica Group]
 dbj|BAD32889.1| putative aluminum-activated malate transporter [Oryza sativa 
Japonica Group]
 dbj|BAD32958.1| putative aluminum-activated malate transporter [Oryza sativa 
Japonica Group]
 dbj|BAF19457.1| Os06g0331900 [Oryza sativa Japonica Group]
Length=668

 Score =   353 bits (907),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 204/432 (47%), Positives = 280/432 (65%), Gaps = 12/432 (3%)
 Frame = -3

Query  1664  FIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeyt  1485
             F   AW++G  +PR+V+HG KV LAL+L S FYY+RPLY   G  AMWAV+TVVVVFEYT
Sbjct  66    FGRTAWKVGADDPRRVVHGFKVALALTLCSAFYYVRPLYVFTGQTAMWAVLTVVVVFEYT  125

Query  1484  vgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPS  1305
             VG  + K +NR +AT   G+L +GVHWVA++SG   +P +L AS+F+LAAAA+FSRFIP+
Sbjct  126   VGGCMYKGLNRAMATVAGGALALGVHWVADKSGDDAEPFVLTASLFVLAAAASFSRFIPT  185

Query  1304  IKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAG  1125
             +KARFDYG TIFILT+SLV+VSGYRVD L+ +AQQRL TIA+G  IC  +  L+ PVWAG
Sbjct  186   LKARFDYGVTIFILTYSLVAVSGYRVDTLVTMAQQRLITIAIGAFICFAVCTLVFPVWAG  245

Query  1124  DDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASED  945
              +LH L+  N++KLA ++E C+ DY ++        D   A  +K  GY+ VLN KASED
Sbjct  246   QELHVLVARNMDKLAAAIEACVDDYFSSAEHAGGGGDAATALSEKARGYRAVLNAKASED  305

Query  944   AMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKP  765
             ++AN A WEPGHG+F FRHP+ QY  +GA+MR CAYCI+ L   + +  Q  +  ++ + 
Sbjct  306   SLANLARWEPGHGKFGFRHPYGQYQNVGAAMRCCAYCIDALAACVGAGGQ--APAHVKRH  363

Query  764   VSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQS  585
             ++  C  +   C  VLR+ S  + S T+S    ++V DMN+A + L+   + L       
Sbjct  364   LAGACVALSQHCAAVLREASGSVTSMTRSGRLALVVGDMNAAAQDLRNELRCL-----AE  418

Query  584   LTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVK  405
             +    EE +  SS+  + E  +A           L+E   L T ASLL+EI+ R EGVV 
Sbjct  419   ILDDDEEEEAASSEAEQHEHNTAPP-----PPPPLIEALPLFTAASLLLEISTRAEGVVA  473

Query  404   EVNQLANLAQFR  369
              V+ L   A+F+
Sbjct  474   AVDALGTTAKFK  485



>ref|XP_004980110.1| PREDICTED: aluminum-activated malate transporter 10-like [Setaria 
italica]
Length=438

 Score =   346 bits (887),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 205/434 (47%), Positives = 277/434 (64%), Gaps = 50/434 (12%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             R+  F  + W++G  +PRK +HG+KVGL+L+LVS+FYY+RPLYD VGG AM A+MTVV V
Sbjct  53    RVAGFATEVWRIGADDPRKAVHGLKVGLSLALVSIFYYIRPLYDGVGGAAMSAIMTVVAV  112

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FEYTVG ++ K  NR VAT  AG L +GVHWVA+++G+  +P IL  S+FLL+AAATFSR
Sbjct  113   FEYTVGGSVYKSFNRAVATASAGVLALGVHWVADKTGE-FEPYILTGSIFLLSAAATFSR  171

Query  1316  FIPSIKARFDYGCTIFILTFS-LVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLC  1140
             FIP+++A FDYG TIFILT+S LV+VSGYRVD+L  L QQR+ T+A+G  +C+ +A+ +C
Sbjct  172   FIPTVEALFDYGVTIFILTYSQLVAVSGYRVDELAALVQQRIFTVAIGIFMCLAVAIFVC  231

Query  1139  PVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNT  960
             PVWAG +LH L T N+E+LA +L+ C+ DY                 + +  GY+CVLN+
Sbjct  232   PVWAGQELHLLTTLNMEELAAALD-CVEDYFAEGPAAQ--------PQARSDGYRCVLNS  282

Query  959   KASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAE  780
             K SED  AN A WEP HGRF FRHP+ +Y K+GA+MRACA C++ L  S  +SA+  + E
Sbjct  283   KDSEDEQANLAWWEPAHGRFGFRHPYGKYGKVGAAMRACACCVKAL--STCASAEAPAPE  340

Query  779   YILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIP  600
             ++ + V + C R  + C +VLR+ S+              V  M ++  AL LA      
Sbjct  341   HVKRLVRDACTRAGARCAQVLREASRS-------------VATMTTSSRALSLAVA----  383

Query  599   PSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAART  420
                  + T V E        L+ + +S  S  DD   V+        TVAS LVE+AAR 
Sbjct  384   ----DMNTAVHE--------LQGDMRSLPSLVDDTMPVF--------TVASQLVELAARV  423

Query  419   EGVVKEVNQLANLA  378
             EGVV  V +LA LA
Sbjct  424   EGVVDAVKELATLA  437



>ref|XP_004964055.1| PREDICTED: aluminum-activated malate transporter 10-like [Setaria 
italica]
 ref|XP_004987337.1| PREDICTED: aluminum-activated malate transporter 10-like [Setaria 
italica]
Length=445

 Score =   346 bits (888),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 202/434 (47%), Positives = 275/434 (63%), Gaps = 47/434 (11%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             R+  F  + W++G  +PRKV+HG+KVGL+L+LVS+FYY RPLYD VGG A WA+MTVV V
Sbjct  52    RVAGFAREVWRIGADDPRKVVHGLKVGLSLALVSIFYYTRPLYDGVGGAATWAIMTVVAV  111

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FEYTVG ++ K  NR VAT  AG L +GVHWVA+++G+  +P IL  S+FLLAAAATFSR
Sbjct  112   FEYTVGGSVQKSFNRAVATASAGVLALGVHWVADKTGE-FEPYILTGSLFLLAAAATFSR  170

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYR---VDKLLDLAQQRLSTIALGTSICIFIAML  1146
             FIP++KA+FDYG TIFILT++LV+VSGYR   VD+L  L QQR+STIA+G   C+ +A+ 
Sbjct  171   FIPTVKAQFDYGVTIFILTYNLVAVSGYRVESVDELAALVQQRISTIAIGILTCLAVAIF  230

Query  1145  LCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVL  966
             +CPVWAG +LH L T N++KLA +L+GC+  Y          +      + +    +CVL
Sbjct  231   VCPVWAGQELHLLTTRNMDKLAAALQGCVEHYF--------AEGPAAQPQARSDCDRCVL  282

Query  965   NTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGS  786
             N+ A ED   N A+WEP HGRF F H + QY K+GA+MRACA C+E L  S  +SA+  +
Sbjct  283   NSMAYEDEQVNLALWEPAHGRFGFCHSYDQYGKVGAAMRACACCVEAL--SSCASAETQA  340

Query  785   AEYILKPVSEECRRVCSTCGKVLRDls-klmksttksSIQDILVHDMNSAVEALQLAFKT  609
              E++ + + + C R  + C +VLR+ S  +   T  S   D+ V DMN+AV  LQ   ++
Sbjct  341   PEHVKRLLRDACTRAGARCAQVLREASRSVATMTASSRALDVAVADMNTAVHELQGDMRS  400

Query  608   LIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIA  429
             L  PS  + T+ V                              M+   + TV SL+VEIA
Sbjct  401   L--PSMLAETSLV------------------------------MDTMPVFTVGSLMVEIA  428

Query  428   ARTEGVVKEVNQLA  387
              R +G+V  VN+LA
Sbjct  429   VRVQGIVDVVNKLA  442



>gb|EAZ00777.1| hypothetical protein OsI_22802 [Oryza sativa Indica Group]
Length=668

 Score =   353 bits (906),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 204/432 (47%), Positives = 280/432 (65%), Gaps = 12/432 (3%)
 Frame = -3

Query  1664  FIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeyt  1485
             F   AW++G  +PR+V+HG KV LAL+L S FYY+RPLY   G  AMWAV+TVVVVFEYT
Sbjct  66    FGRTAWKVGADDPRRVVHGFKVALALTLCSAFYYVRPLYVFTGQTAMWAVLTVVVVFEYT  125

Query  1484  vgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPS  1305
             VG  + K +NR +AT   G+L +GVHWVA++SG   +P +L AS+F+LAAAA+FSRFIP+
Sbjct  126   VGGCMYKGLNRAMATVAGGALALGVHWVADKSGDDAEPFVLTASLFVLAAAASFSRFIPT  185

Query  1304  IKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAG  1125
             +KARFDYG TIFILT+SLV+VSGYRVD L+ +AQQRL TIA+G  IC  +  L+ PVWAG
Sbjct  186   LKARFDYGVTIFILTYSLVAVSGYRVDTLVTMAQQRLITIAIGAFICFAVCTLVFPVWAG  245

Query  1124  DDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASED  945
              +LH L+  N++KLA ++E C+ DY ++        D   A  +K  GY+ VLN KASED
Sbjct  246   QELHVLVARNMDKLAAAIEACVDDYFSSAEHAGGGGDAATALSEKARGYRAVLNAKASED  305

Query  944   AMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKP  765
             ++AN A WEPGHG+F FRHP+ QY  +GA+MR CAYCI+ L   + +  Q  +  ++ + 
Sbjct  306   SLANLARWEPGHGKFGFRHPYGQYQNVGAAMRCCAYCIDALAACVGAGGQ--APAHVKRH  363

Query  764   VSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQS  585
             ++  C  +   C  VLR+ S  + S T+S    ++V DMN+A + L+   + L       
Sbjct  364   LAGACVALSQHCAAVLREASGSVTSMTRSGRLALVVGDMNAAAQDLRNELRCL-----AE  418

Query  584   LTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVK  405
             +    EE +  SS+  + E  +A           L+E   L T ASLL+EI+ R EGVV 
Sbjct  419   ILDDDEEEEAASSEAEQHEHNTAPP-----PPPPLIEALPLFTAASLLLEISTRAEGVVA  473

Query  404   EVNQLANLAQFR  369
              V+ L   A+F+
Sbjct  474   AVDALGTTAKFK  485



>ref|XP_010088638.1| Aluminum-activated malate transporter 2 [Morus notabilis]
 gb|EXC36051.1| Aluminum-activated malate transporter 2 [Morus notabilis]
Length=489

 Score =   347 bits (891),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 205/449 (46%), Positives = 287/449 (64%), Gaps = 42/449 (9%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             +LGK +PR++IH +KVG++LSLVS+FYY +PLYD+ G +AMWAVMTVVVVFEYTVGATL 
Sbjct  45    KLGKDDPRRIIHSLKVGVSLSLVSIFYYYQPLYDNFGVSAMWAVMTVVVVFEYTVGATLG  104

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR +AT LAG+LG+G H +A+ SG   +PI+L   VFL AA +TF RF P +KAR+D
Sbjct  105   KGLNRGLATLLAGALGVGAHHLASLSGDIGEPILLGFFVFLQAATSTFIRFFPKVKARYD  164

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFSL+SVSG+R D++L++A +RLSTI +G S C+ I++L+CPVWAG+DLH L
Sbjct  165   YGLLIFILTFSLISVSGFRDDEILEMAHKRLSTILIGGSACVVISILVCPVWAGEDLHNL  224

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFA  927
             I  NLEKL + LEG   +Y     +     +  K  +  L GYK VLN+K+SE+++ANFA
Sbjct  225   IALNLEKLGNFLEGFGDEYF----NNTAMNEESKDDKAYLQGYKSVLNSKSSEESLANFA  280

Query  926   VWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECR  747
              WEPGHGRF FRHPWKQYLK+G   R CAY IE LHG + S+ ++ ++  I + + E C 
Sbjct  281   RWEPGHGRFKFRHPWKQYLKVGTLTRQCAYRIEALHGRL-SADKIQTSPEIREQIQEACM  339

Query  746   RVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVE  567
             +V S  GK L++                           L  + K +  PSS +      
Sbjct  340   KVSSESGKALKE---------------------------LATSVKKMTKPSSANPHLA--  370

Query  566   EAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLA  387
              + K ++  L+   KS   D+ D     L+E+    TVAS+L+++   TE + + VN+LA
Sbjct  371   -SSKVAAKSLRSLLKSGSWDNID-----LLEVIPSVTVASILLDVVNCTEKIAESVNELA  424

Query  386   NLAQFRGQS--DKKMAKQSQSQHKEQNVQ  306
             +LA F+  +  D K++ +      + +V 
Sbjct  425   SLAHFKSTTTMDPKVSPEKSPASGKPDVH  453



>emb|CAN68984.1| hypothetical protein VITISV_017207 [Vitis vinifera]
Length=542

 Score =   348 bits (892),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 210/445 (47%), Positives = 280/445 (63%), Gaps = 40/445 (9%)
 Frame = -3

Query  1652  AWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaT  1473
             A + G+ +PRK+IH +KVGLAL+L+S+FYY RPLYD  G + MWAV+TVVVVFE+TVGAT
Sbjct  35    AQKQGQDDPRKIIHSLKVGLALTLISMFYYFRPLYDSFGVSGMWAVLTVVVVFEFTVGAT  94

Query  1472  LSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKAR  1293
             LSK +NR  AT +AG+LG+G   +A+  G++ +PI+L   VFLLA A+TFSRF P IKAR
Sbjct  95    LSKSLNRGFATMVAGALGVGAQELASLFGEEGEPIVLGILVFLLATASTFSRFFPRIKAR  154

Query  1292  FDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLH  1113
             +DYG  IFILTFSLV+VSGYRV+++++LA QRLSTI +G + CI IA+ +CPVWAG+DLH
Sbjct  155   YDYGVLIFILTFSLVAVSGYRVNEIIELAHQRLSTILVGGATCIIIAIFVCPVWAGEDLH  214

Query  1112  RLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNTKASEDAMA  936
              +   N+EKLA+ LEG   +Y       D +       +K  L GYK  LN+K+SE+++A
Sbjct  215   NMTVRNMEKLANFLEGFGGEYF--KEPFDGESVVXSKDDKSFLQGYKSALNSKSSEESLA  272

Query  935   NFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSE  756
             NFA WEP HGRF FRHPWKQYL IGA  R CAY IE +   INS  QV SAE+ +K + E
Sbjct  273   NFASWEPCHGRFRFRHPWKQYLMIGALTRQCAYHIEAISSYINSEIQV-SAEFRMK-IQE  330

Query  755   ECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTT  576
              C ++ S  G+ L+                           AL  A KT+  PSS     
Sbjct  331   PCTKISSESGEALK---------------------------ALASAIKTMTDPSSAD--P  361

Query  575   QVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVN  396
              V  A+    D L+    +A  D+ D     L+EI   +TVAS+L+EI    E V + V+
Sbjct  362   HVANAKAAVKD-LEIALNAASLDETD-----LLEIIPDATVASILIEIVKCMEKVSESVH  415

Query  395   QLANLAQFRGQSDKKMAKQSQSQHK  321
             +L+ LA F+        ++ Q  H+
Sbjct  416   ELSGLAHFKXVEPNVTPEKPQLLHR  440



>gb|KHG24514.1| Aluminum-activated malate transporter 8 -like protein [Gossypium 
arboreum]
Length=496

 Score =   346 bits (887),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 209/451 (46%), Positives = 276/451 (61%), Gaps = 40/451 (9%)
 Frame = -3

Query  1712  GKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGG  1533
             G+V  + G    ++ S      +LG+ +PR++ H +KVGLAL+LVSL YY RP+YD  G 
Sbjct  19    GRVKALPGKLKAKVTSTAKSIKKLGQDDPRRLTHSLKVGLALTLVSLLYYARPIYDGFGV  78

Query  1532  NAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQAS  1353
             + MWAV+TVVVVFE+TVG TLSK +NR  ATFLAG+LG+G  + A+  G+  +PI+L   
Sbjct  79    SGMWAVLTVVVVFEFTVGGTLSKSLNRGFATFLAGALGLGADYFASLFGKNGEPIVLGIL  138

Query  1352  VFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGT  1173
             VFLLAAAATFSRF P IKAR+DYG  IFILTFSLV+VSGYRV++L+ LA QRLSTI +G 
Sbjct  139   VFLLAAAATFSRFFPRIKARYDYGVLIFILTFSLVAVSGYRVNELVVLAHQRLSTIIMGG  198

Query  1172  SICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEK  993
             + C+ I++ +CPVWAG+DLH+ I +NLEKLA  LEG    Y  +                
Sbjct  199   ATCMLISIFVCPVWAGEDLHKAIASNLEKLATYLEGFGGVYFQSSEIDGMGTGKSFPQ--  256

Query  992   KLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGS  813
                GYK +LN+K+SE+++ANFA WEPGHGRF  RHPWK YLKIGA  R CAY IE ++G 
Sbjct  257   ---GYKSILNSKSSEESLANFARWEPGHGRFRLRHPWKHYLKIGALARQCAYQIEAINGC  313

Query  812   INSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVE  633
             I S    GS E+  K +   C R+ + CGK L+                           
Sbjct  314   IGSDHIHGSEEFKGK-IEGSCTRMSAECGKTLK---------------------------  345

Query  632   ALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTV  453
             AL  + KT+  P S S  T VE ++    D LK   K+A  ++ D     L  I   +TV
Sbjct  346   ALAKSMKTMTDPYS-SANTHVENSKAAMKD-LKFALKAASLENAD-----LAAILPAATV  398

Query  452   ASLLVEIAARTEGVVKEVNQLANLAQFRGQS  360
              S+LVEI    E + + V++L+ LA F  ++
Sbjct  399   GSILVEIVKCVEKISEAVHELSQLAHFEKET  429



>ref|XP_010107005.1| Aluminum-activated malate transporter 8 [Morus notabilis]
 gb|EXC13003.1| Aluminum-activated malate transporter 8 [Morus notabilis]
Length=499

 Score =   346 bits (887),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 211/472 (45%), Positives = 291/472 (62%), Gaps = 55/472 (12%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             +LGK +PR+VIH +KVGLAL+LVSL Y+ RPLYD  G + MWAV+TVVVVFE++VGATL 
Sbjct  37    KLGKDDPRRVIHSLKVGLALTLVSLLYFWRPLYDGFGMSGMWAVLTVVVVFEFSVGATLG  96

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR  AT LAG+LG+G   +++  G++ +P++L   VFLLAAAATF+RF P IKAR+D
Sbjct  97    KGLNRGFATLLAGALGVGALHLSSLFGKEGEPVVLGILVFLLAAAATFTRFFPKIKARYD  156

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFS++SVSGYRV++LL++A QRLSTI +G + CIF++M +CPVWAG DLH L
Sbjct  157   YGVLIFILTFSMISVSGYRVEELLEMAHQRLSTILIGGTTCIFVSMFVCPVWAGQDLHNL  216

Query  1106  ITNNLEKLADSLEGCIS----------DYLnadgdgdddkdndkASEKKLL-GYKCVLNT  960
             I +N+EKLA+ LEG +           +Y       D D      ++K  L GYK VLNT
Sbjct  217   IASNIEKLANYLEGLLRTRKLIAGFGCEYF--QASEDKDCIEALKNDKSFLNGYKSVLNT  274

Query  959   KASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAE  780
             K +E+++ANFA WEPGHGRF FRHPWKQYLKIG  +R CAY IE L+    S  Q    E
Sbjct  275   KGTEESLANFAKWEPGHGRFLFRHPWKQYLKIGVLVRQCAYQIEALNSHFTSDIQ-APVE  333

Query  779   YILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIP  600
             +I + + E C ++ S  GKVL+                     + S+++A++        
Sbjct  334   FI-RVIEESCTKMSSESGKVLK--------------------SLASSIKAMK--------  364

Query  599   PSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAART  420
                +S    VE ++    D LK   ++A   D D     L+ I   +TVAS+LVEI    
Sbjct  365   -HPESANEHVENSKAAVKD-LKTALEAAGMGDSD-----LLAIISAATVASILVEIVDCV  417

Query  419   EGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHKEQNVQTH**GLHPTLNASQ  264
             E + + V++L+ +A+F     KK+      + K + +  H   + P L+  Q
Sbjct  418   EKISEAVHELSQMARF-----KKVENTVSPETKPKQMLLHRGSVKPVLDGDQ  464



>ref|XP_010247129.1| PREDICTED: aluminum-activated malate transporter 8 isoform X1 
[Nelumbo nucifera]
Length=516

 Score =   346 bits (888),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 209/475 (44%), Positives = 285/475 (60%), Gaps = 63/475 (13%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++    +K  ++G+ +PR++ H +KVGLAL+LVSL YY RPLYD  G + MWAV+TVVVV
Sbjct  33    KVVEVANKVRKIGQDDPRRIAHALKVGLALTLVSLIYYYRPLYDGFGISGMWAVLTVVVV  92

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE++VGATL K +NR  AT LAG+LG+G H++++  G K +PI+L  SVFLLAAA+TFSR
Sbjct  93    FEFSVGATLGKGLNRGFATLLAGALGVGAHYLSSLCGNKGEPIVLGLSVFLLAAASTFSR  152

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             FIP IK R+DYG  IFILTFSLVSVSGYRVDK+++LA QRLSTI +G+ IC+ I+  + P
Sbjct  153   FIPGIKKRYDYGVVIFILTFSLVSVSGYRVDKIIELAHQRLSTIVIGSLICVIISFCIMP  212

Query  1136  VWAGDDLHRLITNNLEKLADSLEG----------------------CISDYLnadgdgdd  1023
             VWAG+DLH L+  NLEKLA  LEG                       ++DYL    + + 
Sbjct  213   VWAGEDLHNLVAQNLEKLATFLEGFGGEFFKNLDDGEIVVVSGSGKSLADYL---KNSEG  269

Query  1022  dkdndkASEKKLL-GYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRA  846
             +  +   S+K  L  YK +L +KA+ED++ANFA WEPGHGRF FRHPWKQYL I    R 
Sbjct  270   ETGSVSKSDKSFLQKYKSILTSKATEDSLANFARWEPGHGRFKFRHPWKQYLNIAGLARQ  329

Query  845   CAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQD  666
             CAY +E L+G IN+  Q+       + + + C  + S  GK L +               
Sbjct  330   CAYLLEALNGYINTEIQI--LPEFQRKIQDVCVTMSSESGKALME---------------  372

Query  665   ILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLV  486
                         L  A K +  PS   L   VE  +  + D LK   K+AL ++ D    
Sbjct  373   ------------LSAAIKAMTHPSLADL--HVENCKNAARD-LKTTLKTALLENSD----  413

Query  485   YLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHK  321
              L+ +   +TVASLLV++   TE + + V++LA LA F+        ++SQ  H+
Sbjct  414   -LLGVIPSATVASLLVDVVVCTEKIAESVHELAKLAHFKTVEPTVTPEKSQLLHR  467



>ref|XP_010247137.1| PREDICTED: aluminum-activated malate transporter 8 isoform X2 
[Nelumbo nucifera]
Length=510

 Score =   346 bits (888),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 209/475 (44%), Positives = 284/475 (60%), Gaps = 69/475 (15%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++    +K  ++G+ +PR++ H +KVGLAL+LVSL YY RPLYD  G + MWAV+TVVVV
Sbjct  33    KVVEVANKVRKIGQDDPRRIAHALKVGLALTLVSLIYYYRPLYDGFGISGMWAVLTVVVV  92

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE++VGATL K +NR  AT LAG+LG+G H++++  G K +PI+L  SVFLLAAA+TFSR
Sbjct  93    FEFSVGATLGKGLNRGFATLLAGALGVGAHYLSSLCGNKGEPIVLGLSVFLLAAASTFSR  152

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             FIP IK R+DYG  IFILTFSLVSVSGYRVDK+++LA QRLSTI +G+ IC+ I+  + P
Sbjct  153   FIPGIKKRYDYGVVIFILTFSLVSVSGYRVDKIIELAHQRLSTIVIGSLICVIISFCIMP  212

Query  1136  VWAGDDLHRLITNNLEKLADSLEG----------------------CISDYLnadgdgdd  1023
             VWAG+DLH L+  NLEKLA  LEG                       ++DYL    + + 
Sbjct  213   VWAGEDLHNLVAQNLEKLATFLEGFGGEFFKNLDDGEIVVVSGSGKSLADYL---KNSEG  269

Query  1022  dkdndkASEKKLL-GYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRA  846
             +  +   S+K  L  YK +L +KA+ED++ANFA WEPGHGRF FRHPWKQYL I    R 
Sbjct  270   ETGSVSKSDKSFLQKYKSILTSKATEDSLANFARWEPGHGRFKFRHPWKQYLNIAGLARQ  329

Query  845   CAYCIETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQD  666
             CAY +E L+G IN+  Q        + + + C  + S  GK L +               
Sbjct  330   CAYLLEALNGYINTEIQ--------RKIQDVCVTMSSESGKALME---------------  366

Query  665   ILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLV  486
                         L  A K +  PS   L   VE  +  + D LK   K+AL ++ D    
Sbjct  367   ------------LSAAIKAMTHPSLADL--HVENCKNAARD-LKTTLKTALLENSD----  407

Query  485   YLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHK  321
              L+ +   +TVASLLV++   TE + + V++LA LA F+        ++SQ  H+
Sbjct  408   -LLGVIPSATVASLLVDVVVCTEKIAESVHELAKLAHFKTVEPTVTPEKSQLLHR  461



>ref|XP_007204444.1| hypothetical protein PRUPE_ppa026645mg [Prunus persica]
 gb|EMJ05643.1| hypothetical protein PRUPE_ppa026645mg [Prunus persica]
Length=484

 Score =   345 bits (885),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 207/452 (46%), Positives = 281/452 (62%), Gaps = 38/452 (8%)
 Frame = -3

Query  1724  SRRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYD  1545
             +R  G +  + G F  ++   +    +LG+ +PR+V H +KV LAL+LVSL YY R L+D
Sbjct  18    TRWWGWLKALPGKFNTKVVKVVKGTIKLGRDDPRRVTHSLKVALALTLVSLLYYWRALFD  77

Query  1544  DVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPII  1365
               G   +WAV+TVVVVFE+TVGATLSK +NR  AT LAG+LG+G   +A+  G+K +PI+
Sbjct  78    GFGVAGIWAVLTVVVVFEFTVGATLSKSLNRGFATLLAGALGVGAQHLASLFGEKGEPIV  137

Query  1364  LQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTI  1185
             L   VFLLAAA+TFSRF P IKAR+DYG  IFILTFS+V++SGYRV++LL++A +RL TI
Sbjct  138   LGIFVFLLAAASTFSRFFPRIKARYDYGVLIFILTFSMVTISGYRVEELLEMAHERLLTI  197

Query  1184  ALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndk  1005
              +G   C+ I++ LCPVWAG+DLH+LI +N+EKLA+ LEG   +Y        +     K
Sbjct  198   IIGGGTCMIISVFLCPVWAGEDLHKLIASNIEKLANCLEGFGGEYF-QTPKDGNCGMVPK  256

Query  1004  ASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIET  825
               +  L GYK VLN+K +E+++ANFA WEPGHGRF FRHPWKQYLKIGA  R CAY IET
Sbjct  257   NEDSFLQGYKSVLNSKTTEESLANFAAWEPGHGRFKFRHPWKQYLKIGALARQCAYQIET  316

Query  824   LHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMN  645
             L+G INS+ QV   E+ L+ + + CR +    GK L+                       
Sbjct  317   LNGHINSNVQV-PPEF-LQIIQDSCRTMSIETGKALK-----------------------  351

Query  644   SAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQ  465
                 AL +A KT+  P       +  E  K +   LK   K+A  ++ D     ++ I  
Sbjct  352   ----ALAIAIKTMKEPKH---ACEHLEKSKTAVKDLKTALKAASLENAD-----ILAIVP  399

Query  464   LSTVASLLVEIAARTEGVVKEVNQLANLAQFR  369
                VAS+LVEI    E + K V++L+ LA F+
Sbjct  400   AVAVASILVEIVKGAEKISKSVHELSELAHFK  431



>ref|XP_002533902.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28484.1| conserved hypothetical protein [Ricinus communis]
Length=491

 Score =   345 bits (885),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 211/427 (49%), Positives = 268/427 (63%), Gaps = 38/427 (9%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             +LG+ +PR++ H +KVGLAL+LVSL YY R LYD  G   MWAV+TVVVVFE+TVG TLS
Sbjct  42    KLGRDDPRRITHSLKVGLALTLVSLLYYSRTLYDSFGVAGMWAVLTVVVVFEFTVGGTLS  101

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR  AT LAG+LG+G   +A   G+K QPI++   VF+LAAA+TFSRF P IKAR+D
Sbjct  102   KSLNRGFATLLAGALGVGAQHLAGLFGEKGQPIVIGFLVFILAAASTFSRFFPRIKARYD  161

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFSLVSVSG RVD+LL LA QRLSTI +G + CI I++ +CPVWAG+DLH+L
Sbjct  162   YGVLIFILTFSLVSVSGIRVDELLVLAHQRLSTIIVGGAACIVISICICPVWAGEDLHKL  221

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNTKASEDAMANF  930
             + +N+EKL + LEG   +Y     DG         ++K  L GYK VLN+K+SED+MAN 
Sbjct  222   VASNIEKLGNYLEGFGDEYFQCSEDGGKGNKVSSNNDKSFLQGYKTVLNSKSSEDSMANL  281

Query  929   AVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEEC  750
             A WEP HGRF FRHPWKQYLKIGA  R CAY IE L+G INS+ QV   E     + E C
Sbjct  282   ARWEPRHGRFGFRHPWKQYLKIGAISRKCAYHIEVLNGCINSNIQV--PEEFKNKIQESC  339

Query  749   RRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQV  570
              ++    GK L+                            L  A KT+  PS  +  T V
Sbjct  340   TKMSEESGKALK---------------------------LLSSAIKTMTHPSPAN--THV  370

Query  569   EEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQL  390
             E + K + + LK   KS   D +D     L+ I   +TVAS L EI    + + + V++L
Sbjct  371   ENS-KTAINELKVALKSCSLDYED-----LLVIVPAATVASTLTEIVKCVDKLSESVHEL  424

Query  389   ANLAQFR  369
             AN A F+
Sbjct  425   ANQAHFK  431



>ref|XP_008361572.1| PREDICTED: aluminum-activated malate transporter 2-like [Malus 
domestica]
Length=467

 Score =   344 bits (882),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 205/427 (48%), Positives = 278/427 (65%), Gaps = 44/427 (10%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             +LG+ +PR+++H  KVG AL+LVSLFYY +PLY++ G +AMWAVMTVVVVFE++VGATL 
Sbjct  39    KLGQDDPRRIVHSFKVGFALTLVSLFYYYQPLYNNFGVSAMWAVMTVVVVFEFSVGATLG  98

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NRT+AT +AG+LGIG H +A+ SGQ  +PI++   VFL AA +TF RF P IKAR+D
Sbjct  99    KGLNRTMATLVAGALGIGAHHLASLSGQIGKPIVIGVFVFLQAATSTFIRFFPKIKARYD  158

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFSL+SVSG+R D++L+LA +RLSTI +G S C+ I++L+CPVWAG+DLH L
Sbjct  159   YGLLIFILTFSLISVSGFRDDEILELAHKRLSTIFIGGSACVIISILVCPVWAGEDLHNL  218

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNTKASEDAMANF  930
             I NN+EKL + LEG    Y          +D +   +K  L GYK VLN+KASED++ANF
Sbjct  219   IANNIEKLGNFLEGFGDQYF------KTLEDVESKDDKAFLQGYKTVLNSKASEDSLANF  272

Query  929   AVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEEC  750
             A WEPGHGRF FRHPWKQYL++G S R CAY IE LH  + S  QV S E ++K + E C
Sbjct  273   ARWEPGHGRFLFRHPWKQYLQVGTSTRQCAYRIEALHSRLTSDNQV-SPEILIK-IQESC  330

Query  749   RRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQV  570
               +    GK L++                           L L F+ +    S S+ T +
Sbjct  331   TELSLETGKALKE---------------------------LALGFEEMT--KSPSVDTHI  361

Query  569   EEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQL  390
              +A+  +   L+   KS L +D       L+E+   +TV SLL+++   +E +++ VN+L
Sbjct  362   AKAKAAAKS-LRALLKSGLWED-----AALLEVMPAATVGSLLLDVFNCSEKIIESVNEL  415

Query  389   ANLAQFR  369
             A LA F 
Sbjct  416   AQLANFE  422



>ref|XP_009349949.1| PREDICTED: aluminum-activated malate transporter 8-like [Pyrus 
x bretschneideri]
Length=494

 Score =   344 bits (883),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 210/459 (46%), Positives = 286/459 (62%), Gaps = 42/459 (9%)
 Frame = -3

Query  1697  IVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWA  1518
             ++G    ++   +    +LG+ +PR+VIH +KV LAL+LVS+ YY R L+D +G   +WA
Sbjct  27    LLGKLSTKVVKVVKSIIKLGQDDPRRVIHSLKVALALTLVSILYYWRVLFDGIGIAGIWA  86

Query  1517  vmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLA  1338
             V+TVVVVFE+TVGATLSK +NR  ATF+AG+LG+G   +A+  G K +PI+L   VFLLA
Sbjct  87    VITVVVVFEFTVGATLSKGLNRGFATFIAGALGLGATHIASLFGVKGEPIVLGIFVFLLA  146

Query  1337  AAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIF  1158
             AA+TFSRF P IKAR+DYG  IFILTFS+V+VSGY V+ +L+++ +RL TIA+G   C+ 
Sbjct  147   AASTFSRFFPRIKARYDYGVLIFILTFSMVTVSGYHVEGILEMSNERLLTIAIGGGTCMI  206

Query  1157  IAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGY  978
             I+  +CPVWAG+DLH+LI++N+E LA+ LEG   +Y     DG       K+ E  L GY
Sbjct  207   ISAFVCPVWAGEDLHKLISSNIENLANYLEGFGGEYFPLPKDGKSAGIVSKSKESFLQGY  266

Query  977   KCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSA  798
             K VLN+K+SE+++ANFA WEPGHGRF FRHPWKQYLKIGA  R CAY IETL+G INS  
Sbjct  267   KSVLNSKSSEESLANFARWEPGHGRFKFRHPWKQYLKIGALARQCAYQIETLNGHINSDV  326

Query  797   QVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLA  618
             QV   E+ L+ + + C+ +    GK L+                           AL +A
Sbjct  327   QV-PPEF-LQIIQDSCKTMSIESGKALK---------------------------ALAVA  357

Query  617   FKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLV  438
              KT+  P       +  E  K +   LK   K+A  +  D     ++ I   +TVAS+LV
Sbjct  358   IKTMEEPKD---AREHLENSKTAVKDLKIALKAASLETAD-----ILAIVPAATVASILV  409

Query  437   EIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHK  321
             EI    E + K V++L+ LA F     KK  + + SQ K
Sbjct  410   EIVKGVEKISKSVHELSELAHF-----KKAVECTVSQEK  443



>ref|XP_004967034.1| PREDICTED: aluminum-activated malate transporter 10-like [Setaria 
italica]
Length=650

 Score =   348 bits (893),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 198/454 (44%), Positives = 284/454 (63%), Gaps = 14/454 (3%)
 Frame = -3

Query  1730  SESRRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPL  1551
             ++  RR      +   +  I+     AW++G  +PRKV HG K+ LAL+L S+FYY++PL
Sbjct  33    TKGSRRACCAPALSSLLFSIFGVARTAWKIGADDPRKVAHGFKMALALTLCSVFYYVQPL  92

Query  1550  YDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQP  1371
             Y   G NAMWAV+TVVVVFEYTVG  L K +NR +AT   G+L +GV W+A++SG++ +P
Sbjct  93    YVFTGHNAMWAVLTVVVVFEYTVGGCLYKGLNRAMATVTGGALALGVQWIASKSGKEFEP  152

Query  1370  IILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLS  1191
              IL  S+F+ A++AT+SRFIP++KARFDYG TIFILT++LV+V GYRVD++  +AQ RL+
Sbjct  153   FILSGSLFVFASSATYSRFIPTMKARFDYGVTIFILTYTLVAVGGYRVDEVAFMAQHRLT  212

Query  1190  TIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdn  1011
             TIA+G +IC  +  L+ PVWAG +LH  +  N++KLA ++EGC+ DY +     + +   
Sbjct  213   TIAIGAAICFAVCALIFPVWAGQELHDQVARNMDKLAAAVEGCVEDYFSEADASNGEIPV  272

Query  1010  dkASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCI  831
              +A  ++  GY+ VLN KASED++AN A WEP HG F FRHP+  Y KIGA+MR CAYCI
Sbjct  273   RRAPSERSQGYRAVLNAKASEDSLANLARWEPAHGDFRFRHPYPLYQKIGAAMRCCAYCI  332

Query  830   ETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHD  651
             + L  +   S +     ++ K ++  C  +   C  VLR+ S  + S T+S    ++V D
Sbjct  333   DALAAAAAGS-EAQEPAHVKKHLAGACVALGRHCAAVLREASGSIASMTRSGRLALVVGD  391

Query  650   MNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEI  471
             MN A E L+   +         L   +EE    ++D   ++     S D       L+E+
Sbjct  392   MNRAAEELRDELRC--------LAALLEEDDSSNADAEHEQ-----STDAPEPAPPLIEV  438

Query  470   AQLSTVASLLVEIAARTEGVVKEVNQLANLAQFR  369
               L T ASLL+EI  R EGVV  V+ LA  A+F+
Sbjct  439   LPLFTTASLLLEICTRAEGVVSAVDNLATTARFK  472



>ref|XP_003572808.1| PREDICTED: aluminum-activated malate transporter 10-like [Brachypodium 
distachyon]
Length=508

 Score =   343 bits (881),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 199/446 (45%), Positives = 278/446 (62%), Gaps = 32/446 (7%)
 Frame = -3

Query  1685  FVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGG-NAMWAvmt  1509
             F  ++  F    W++G+ +PRK ++G+KVG+AL+LVSLFYY RPLYD +GG N +WA+MT
Sbjct  50    FKCKVSGFRKMVWKIGEDDPRKTMYGIKVGIALALVSLFYYARPLYDGIGGRNVVWAIMT  109

Query  1508  vvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAA  1329
             VV+VFE TVG ++ K VNRT  T    +L +G+HWVA++SG+ L+P++   S+FLL A A
Sbjct  110   VVLVFEQTVGGSMYKGVNRTAGTISGTALALGLHWVASKSGKTLEPMVTTGSIFLLGAVA  169

Query  1328  TFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAM  1149
              FSRFIP +K+ FDYG T+FI+T+S V+VSGYRV+ L  LA QR+STI++G  IC  + +
Sbjct  170   -FSRFIPLVKSMFDYGVTVFIMTYSFVAVSGYRVEDLAMLALQRVSTISIGFFICFAVCV  228

Query  1148  LLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCV  969
             L+ PVW+G +LH L + N+EKLAD+LEGC+ DY  AD D D  K     S K   GYKCV
Sbjct  229   LIRPVWSGQELHLLTSRNMEKLADALEGCLEDYFFADADADVTKRAQVGSSKS-DGYKCV  287

Query  968   LNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVG  789
             LN+KASED+ AN A WEP HGRF F HP+++Y K+GA+MR CAYC+E LHG +    Q  
Sbjct  288   LNSKASEDSQANLARWEPAHGRFGFSHPYEEYAKVGAAMRQCAYCVEALHGCMAPEQQQQ  347

Query  788   SAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKT  609
             + + ++   ++   R    C +VLR+ S  + + T S    + V DM++AV  L+   + 
Sbjct  348   APDLLVGVYTKMGAR----CARVLREASSSLATMTTSRTLALAVADMDNAVRELKSDMRA  403

Query  608   LIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIA  429
             L  PS   L    E  +  S D +                        L  V  +L+EIA
Sbjct  404   L--PSKLLLLLAEEPTEASSIDAMA-----------------------LLPVTLMLIEIA  438

Query  428   ARTEGVVKEVNQLANLAQFRGQSDKK  351
              R +GV   V+ LA++  F+   D K
Sbjct  439   TRIKGVADAVSTLASIGGFKPADDDK  464



>ref|XP_010263008.1| PREDICTED: aluminum-activated malate transporter 8-like [Nelumbo 
nucifera]
Length=508

 Score =   343 bits (880),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 204/463 (44%), Positives = 283/463 (61%), Gaps = 58/463 (13%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             ++G+ +PR+++H +KVGLALS+VSL YY +P YD  G + MWAV+TVVVVFE++VGATLS
Sbjct  41    KVGQDDPRRIVHALKVGLALSVVSLIYYYKPFYDGFGISGMWAVLTVVVVFEFSVGATLS  100

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR  ATFLAG+LG+G H+++N  G K +PI+L  SVFLLAAA+TFSRFIP +K R+D
Sbjct  101   KGLNRGFATFLAGALGVGAHYLSNLCGDKGEPIVLGLSVFLLAAASTFSRFIPGVKQRYD  160

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFSLV+VSGYRVD++++LA QRLSTI +G   C+ I++ + PVWAG+DLH L
Sbjct  161   YGVVIFILTFSLVAVSGYRVDEIIELAHQRLSTIVIGGLTCVIISICIMPVWAGEDLHNL  220

Query  1106  ITNNLEKLADSLEGCISDYLn---------------------adgdgdddkdndkASEKK  990
             +  NLEKLA  LEG   +Y                        + +  +     K+ +  
Sbjct  221   VAQNLEKLACFLEGFGGEYFKDLEDGEIVVVSKSGKPLAEYFRNPEDGEAAVVSKSDKSS  280

Query  989   LLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSI  810
             L  YK +L +K +ED++ANFA WEPGHGRF FRHPWKQYLK+ A +R CAY +E L+G I
Sbjct  281   LQKYKSILTSKTTEDSLANFARWEPGHGRFRFRHPWKQYLKLAALIRQCAYLLEALNGYI  340

Query  809   NSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEA  630
             NS  Q+   E+  K + +EC  +    GK L++                           
Sbjct  341   NSDIQI-PPEFQRK-IQDECITMSLESGKALKE---------------------------  371

Query  629   LQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVA  450
             L  + KT+  PS       VE  +  + D LK   K+AL ++ D     L+ +   +TVA
Sbjct  372   LSESIKTMTGPSLAD--PHVENCKNAAMD-LKTTLKTALLENSD-----LLGVIPAATVA  423

Query  449   SLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHK  321
             SLL++I   TE + + V++LA LA F+        ++SQ  H+
Sbjct  424   SLLIDIVVCTEKIAESVHELAKLAHFKTVEPTVTPEKSQLLHR  466



>gb|KCW49013.1| hypothetical protein EUGRSUZ_K02622 [Eucalyptus grandis]
Length=455

 Score =   340 bits (873),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 202/443 (46%), Positives = 281/443 (63%), Gaps = 43/443 (10%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             +LG+ +PR+V+H +KVGLAL+LVSL YY+RP YD  G + MWAV+TV VVFE+TVGATLS
Sbjct  42    KLGQDDPRRVLHSLKVGLALTLVSLIYYVRPFYDSYGISGMWAVLTVTVVFEFTVGATLS  101

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR  ATF AG+LG+G   +A   G++ +PI+L   VFLLA AATF+RF P IKAR+D
Sbjct  102   KGLNRGFATFSAGALGVGAQHLACLFGEEGEPIVLGVLVFLLAGAATFTRFFPRIKARYD  161

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFS+V+VSGYRV+KLL+LA QRLSTI +G + CI +++ LCPVWAG+DLH+L
Sbjct  162   YGILIFILTFSMVTVSGYRVEKLLELAHQRLSTIIIGGATCIIVSIFLCPVWAGEDLHKL  221

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKK--LLGYKCVLNTKASEDAMAN  933
                +LEKLA  LEG  S+Y  +  +          +E+K  LLGYK +L +K  E+++AN
Sbjct  222   TILHLEKLAIFLEGFGSEYFQSVNEDKPVIS----TEEKTFLLGYKSILTSKNMEESLAN  277

Query  932   FAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEE  753
             FA WEP HGRF F HPWKQYLKIGA +R CAY IE L+G +NS  Q  +     K + E 
Sbjct  278   FARWEPRHGRFQFHHPWKQYLKIGALVRQCAYRIEALNGYLNSDLQ--APPTFKKRIQEP  335

Query  752   CRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQ  573
             C ++ S   K L  L+  +K  T  S+  + +H+   AV+ L++  KT            
Sbjct  336   CLKITSESSKALTMLASAIKLMTDPSLASLHLHNSEIAVDNLKILLKT------------  383

Query  572   VEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQ  393
                              ++L D +      L+ I   +TVAS+L+++    E + + VN+
Sbjct  384   -----------------TSLEDTE------LLSIVPAATVASILIQVVKCVEEIYQAVNE  420

Query  392   LANLAQFRGQSDKKMAKQSQSQH  324
             L++LA F+     K+  +++ Q+
Sbjct  421   LSDLANFKSAVKPKVGCETRRQY  443



>ref|XP_002298270.2| hypothetical protein POPTR_0001s22490g [Populus trichocarpa]
 gb|EEE83075.2| hypothetical protein POPTR_0001s22490g [Populus trichocarpa]
Length=485

 Score =   341 bits (874),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 202/453 (45%), Positives = 279/453 (62%), Gaps = 47/453 (10%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             +LG+ +PR+VIH +KVGLAL+LVS+FYY +PLY + G  AMWA+MTVVVVFE++VGATL 
Sbjct  41    KLGQDDPRRVIHSLKVGLALTLVSMFYYCQPLYSNFGVTAMWAIMTVVVVFEFSVGATLG  100

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR +AT +AG LGIG H +AN SG   +PI+L   VFL A  +TF RF P IK+R+D
Sbjct  101   KGLNRGMATLMAGGLGIGAHHLANLSGHIGEPILLGFFVFLQATISTFLRFFPKIKSRYD  160

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFSL+SVSGYR D++L+ A +RLSTI++G S C+ I+ ++CPVWAG+DLH L
Sbjct  161   YGMLIFILTFSLISVSGYRDDEILEFAHKRLSTISIGGSACVIISTVVCPVWAGEDLHNL  220

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNTKASEDAMANF  930
             I  N+EKL + LEG   +Y             +   +KK L GYK VLN+K SE+++ANF
Sbjct  221   IALNIEKLGNFLEGFGDEYF------KRTGGEESKDDKKFLEGYKSVLNSKNSEESLANF  274

Query  929   AVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEEC  750
             A WEPGHGRF FRHPWK YLK+G   R CAY IE L+G +N+  Q  S   +   + E C
Sbjct  275   AAWEPGHGRFPFRHPWKLYLKVGTLARECAYRIEALNGCLNADIQASSE--VGSIIQEAC  332

Query  749   RRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQV  570
               +    GK L++                           L LA K ++     S  + +
Sbjct  333   TNLSIESGKALKE---------------------------LALAIKIMVQVQPSSADSHI  365

Query  569   EEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQL  390
             E A K ++ +LK   KS + +D D     L+++    TVAS+L+++   TE + + +++L
Sbjct  366   ENA-KSAAKNLKSLLKSGIWEDID-----LLKVIPGVTVASILIDVVTCTEKIAESIHEL  419

Query  389   ANLAQFRG-----QSDKKMAKQSQSQHKEQNVQ  306
             A+ AQF+       ++K  + Q QS    Q V 
Sbjct  420   ASKAQFKSVEPTLSTEKLHSGQIQSVKSAQMVN  452



>ref|XP_011042181.1| PREDICTED: aluminum-activated malate transporter 2-like [Populus 
euphratica]
Length=481

 Score =   340 bits (872),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 203/453 (45%), Positives = 281/453 (62%), Gaps = 49/453 (11%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             +LG+ +PR++IH +KVGLAL+LVS FYY +PLY + G  AMWA+MTVVVVFE++VGATL 
Sbjct  41    KLGQDDPRRIIHSLKVGLALTLVSTFYYCQPLYSNFGVTAMWAIMTVVVVFEFSVGATLG  100

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR +AT +AG LGIG H +AN SG   +PI+L   VFL A  +TF RF P IK+R+D
Sbjct  101   KGLNRGMATLMAGGLGIGAHHLANLSGHIGEPILLGFFVFLQATISTFLRFFPKIKSRYD  160

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFSL+SVSGYR D++L+ A +RLSTI++G S C+ I+ ++CPVWAG+DLH L
Sbjct  161   YGMLIFILTFSLISVSGYRDDEILEFAHKRLSTISIGGSTCVIISTVVCPVWAGEDLHNL  220

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNTKASEDAMANF  930
             I  N+EKL + LEG   +Y             +   +KK L GYK VLN+K SE+++ANF
Sbjct  221   IALNIEKLGNFLEGFGDEYF------KRTWGEESKDDKKFLEGYKSVLNSKNSEESLANF  274

Query  929   AVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEEC  750
             A W+PGHGRF FRHPWK YLK+G   R CAY IE L+G +N+  Q  S   +   + E C
Sbjct  275   AAWQPGHGRFPFRHPWKLYLKVGTLARECAYRIEALNGCLNADIQASSE--VGSIIQEAC  332

Query  749   RRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQV  570
               +    GK L++                           L LA K ++ PSS    + +
Sbjct  333   TNLSIESGKALKE---------------------------LALAIKIMVQPSSAD--SHI  363

Query  569   EEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQL  390
             E A K ++ +LK   KS + +D D     L++I    TVAS+L+++   TE + + +++L
Sbjct  364   ENA-KSAAKNLKSLLKSGIWEDID-----LLKIIPGVTVASILIDVVTCTEKIAESIHEL  417

Query  389   ANLAQFRG-----QSDKKMAKQSQSQHKEQNVQ  306
             A+ AQF+       ++K  + Q QS+   Q V 
Sbjct  418   ASKAQFKCVKPTLSTEKLHSGQIQSEKSAQMVN  450



>ref|XP_004293111.1| PREDICTED: aluminum-activated malate transporter 2-like [Fragaria 
vesca subsp. vesca]
Length=475

 Score =   340 bits (871),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 203/440 (46%), Positives = 274/440 (62%), Gaps = 42/440 (10%)
 Frame = -3

Query  1685  FVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtv  1506
             F  ++     +  +LG+ +PR++ H +KVG A++LVSLFYY +PLYD  G +AMWAV+TV
Sbjct  20    FTAKVCEIASRTKKLGQDDPRRITHSLKVGFAITLVSLFYYYQPLYDSFGASAMWAVVTV  79

Query  1505  vvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAAT  1326
             +VVFE++VGATL K +NR +AT +AG+LGIG H +A+  G   +PI+L   VFL AA +T
Sbjct  80    IVVFEFSVGATLGKGLNRGLATLVAGALGIGAHHLASLFGHIGEPILLGVFVFLQAATST  139

Query  1325  FSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAML  1146
             F RF P IKAR+DYG  IFILTFSL+SVSG+R D++L+LA +RLSTI +G S C+ + +L
Sbjct  140   FIRFFPKIKARYDYGLLIFILTFSLISVSGFRDDEVLELAHKRLSTIFIGGSACVIVTIL  199

Query  1145  LCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVL  966
             + PVWAG+DLH LI +N EKL D LEG  S Y        +D    K  +  LLGYK VL
Sbjct  200   VFPVWAGEDLHNLIASNTEKLGDFLEGFGSQYF----RTLEDSAESKDDKAFLLGYKSVL  255

Query  965   NTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGS-INSSAQVG  789
             N+K SE+++ANFA WEPGHGRF+FRHPW QYLK+GA +R CAY IE LHG  I +  QV 
Sbjct  256   NSKCSEESLANFARWEPGHGRFSFRHPWTQYLKVGALVRQCAYRIEALHGRLITADTQV-  314

Query  788   SAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKT  609
              +  IL  + E C ++    GK L+                           AL   F+T
Sbjct  315   -SPVILNRIEESCTKLSLETGKALK---------------------------ALASDFRT  346

Query  608   LIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIA  429
             +    S S    +  A K ++  LK   KS L +D D     L+E+   +TV SLL+++ 
Sbjct  347   MT--KSTSADPHIANA-KAAAKSLKSLLKSGLWEDID-----LLEVVPAATVGSLLLDVV  398

Query  428   ARTEGVVKEVNQLANLAQFR  369
               TE +V+ V +L +LA F 
Sbjct  399   NCTEKIVESVYELGSLANFE  418



>ref|XP_010039108.1| PREDICTED: aluminum-activated malate transporter 8-like [Eucalyptus 
grandis]
Length=489

 Score =   340 bits (872),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 203/443 (46%), Positives = 282/443 (64%), Gaps = 44/443 (10%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             +LG+ +PR+V+H +KVGLAL+LVSL YY+RP YD  G + MWAV+TV VVFE+TVGATLS
Sbjct  42    KLGQDDPRRVLHSLKVGLALTLVSLIYYVRPFYDSYGISGMWAVLTVTVVFEFTVGATLS  101

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR  ATF AG+LG+G   +A   G++ +PI+L   VFLLA AATF+RF P IKAR+D
Sbjct  102   KGLNRGFATFSAGALGVGAQHLACLFGEEGEPIVLGVLVFLLAGAATFTRFFPRIKARYD  161

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFS+V+VSGYRV+KLL+LA QRLSTI +G + CI +++ LCPVWAG+DLH+L
Sbjct  162   YGILIFILTFSMVTVSGYRVEKLLELAHQRLSTIIIGGATCIIVSIFLCPVWAGEDLHKL  221

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKK--LLGYKCVLNTKASEDAMAN  933
                +LEKLA  LEG  S+Y  +  +          +E+K  LLGYK +L +K  E+++AN
Sbjct  222   TILHLEKLAIFLEGFGSEYFQSVNEDKPVIS----TEEKTFLLGYKSILTSKNMEESLAN  277

Query  932   FAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEE  753
             FA WEP HGRF F HPWKQYLKIGA +R CAY IE L+G +NS  Q  +     K + E 
Sbjct  278   FARWEPRHGRFQFHHPWKQYLKIGALVRQCAYRIEALNGYLNSDLQ--APPTFKKRIQEP  335

Query  752   CRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQ  573
             C ++ S   K L  L+  +K  T  S+  + +H+   AV+ L++  KT          T 
Sbjct  336   CLKITSESSKALTMLASAIKLMTDPSLASLHLHNSEIAVDNLKILLKT----------TS  385

Query  572   VEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQ  393
             +E+ +                         L+ I   +TVAS+L+++    E + + VN+
Sbjct  386   LEDTE-------------------------LLSIVPAATVASILIQVVKCVEEIYQAVNE  420

Query  392   LANLAQFRGQSDKKMA-KQSQSQ  327
             L++LA F+     K++ ++ Q+Q
Sbjct  421   LSDLANFKSAVKPKVSPEKPQAQ  443



>gb|KEH24242.1| aluminum activated malate transporter family protein [Medicago 
truncatula]
Length=479

 Score =   340 bits (871),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 202/452 (45%), Positives = 284/452 (63%), Gaps = 44/452 (10%)
 Frame = -3

Query  1724  SRRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYD  1545
             SR  G   ++   F  ++ +  D   ++GK +PR+VIH +KVG AL++VSLFYY RPLY+
Sbjct  16    SRLGGFFKNLPMNFKSKVMNAKDSVKKIGKDDPRRVIHSLKVGFALTVVSLFYYSRPLYN  75

Query  1544  DVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPII  1365
               G   MWAV+TVVVVFE+TVGATLSK +NR  AT LAG+LG+G H +A   G++ + I+
Sbjct  76    GFGVAGMWAVLTVVVVFEFTVGATLSKSLNRGCATLLAGALGVGGHHLATAVGKRGEAIV  135

Query  1364  LQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTI  1185
             L   VF+LAA ATF RF+P IKAR+DYG  IFILTF LV+VSGYRV++LL+LA QRL+TI
Sbjct  136   LGTLVFILAAGATFLRFVPKIKARYDYGMVIFILTFCLVTVSGYRVEELLELAHQRLTTI  195

Query  1184  ALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndk  1005
              +G S C+ I++ +CPVWAG+DLH+L+ +N+EKLA+ LEG   +Y           ++ +
Sbjct  196   IIGASTCMVISIFVCPVWAGEDLHKLVASNIEKLANYLEGFEGEYF-------HSLEDKE  248

Query  1004  ASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIET  825
              S+  L GYK VLN+KASE+++ANFA WEPGHG F+ RHPWK+YLKIG   R C Y IET
Sbjct  249   KSKSLLQGYKSVLNSKASEESLANFARWEPGHGGFSLRHPWKEYLKIGVLARECGYKIET  308

Query  824   LHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMN  645
             L+  +N   Q  S E+  K + E C ++ S                           + N
Sbjct  309   LNTYLNPEIQ-ASLEFKCK-IQEPCTKMSS---------------------------ESN  339

Query  644   SAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQ  465
              A++ +  + KT+  P++    + +E     +S    +E K AL      D V L+ I  
Sbjct  340   KALKVISSSMKTMTHPTTAK--SHIE-----NSKIAIEELKVALEAISLED-VELLAIIP  391

Query  464   LSTVASLLVEIAARTEGVVKEVNQLANLAQFR  369
             ++TVA++L EI    E + + V++L+NLA F+
Sbjct  392   VATVAAILEEITISVEKIYESVSELSNLAHFK  423



>ref|XP_002314250.2| hypothetical protein POPTR_0009s02300g, partial [Populus trichocarpa]
 gb|EEE88205.2| hypothetical protein POPTR_0009s02300g, partial [Populus trichocarpa]
Length=511

 Score =   340 bits (871),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 198/448 (44%), Positives = 281/448 (63%), Gaps = 43/448 (10%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             ++G+ +PR+VIH +KVGLAL+LVS+FYY +PLY + G  AMWA+MTVVVVFE++VGATL 
Sbjct  69    KVGQDDPRRVIHSLKVGLALALVSIFYYYQPLYSNFGVTAMWAIMTVVVVFEFSVGATLG  128

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR +AT LA +LG+G H +AN SG   +PI+L + VFL AA +TF RF P IKAR+D
Sbjct  129   KGLNRGMATLLASALGVGAHHLANLSGHVGEPILLGSLVFLQAAISTFLRFFPKIKARYD  188

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFSL+S+SG+R D++L+LA +R+ TI +G   C+ I++++ PVWAG+DLH L
Sbjct  189   YGLLIFILTFSLISISGFRDDEILELAHKRVLTIFVGGCACVIISIVVFPVWAGEDLHNL  248

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFA  927
             I  N+EKL + LEG   +Y              K  +K L GYK VLN+K  E+++ANFA
Sbjct  249   IALNIEKLGNFLEGFGDEYF-----KRTGDAESKDDKKYLEGYKSVLNSKTGEESLANFA  303

Query  926   VWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECR  747
              WEPGHGRF FRHPWKQYLK+G   R CAY IE L+G +N+  Q  S   +   + E C 
Sbjct  304   AWEPGHGRFQFRHPWKQYLKVGTLARECAYRIEALNGYLNADIQASSE--VRSRIQEACT  361

Query  746   RVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVE  567
              V    GK L++                           L L  K ++ PSS    + +E
Sbjct  362   NVSIESGKALKE---------------------------LSLTMKKMVQPSSAD--SHIE  392

Query  566   EAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLA  387
              A K ++ +LK   KS L +D D     L+++    TVAS+L E+   TE + + V++LA
Sbjct  393   NA-KSAAKNLKSLLKSGLWEDTD-----LLKVIPGITVASILNEVVKCTENIAESVHELA  446

Query  386   NLAQFRGQSDKKMAKQSQSQHKEQNVQT  303
             ++AQF+   ++ ++ +     + QN+++
Sbjct  447   SIAQFK-SVERTVSPEKLHSGQPQNIKS  473



>gb|KDP36114.1| hypothetical protein JCGZ_08758 [Jatropha curcas]
Length=487

 Score =   338 bits (868),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 203/441 (46%), Positives = 274/441 (62%), Gaps = 42/441 (10%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             ++G+ +PR+++H +KVGLAL+LVSL YY R LYD  G   MWAV+TVVVVFE+TVG TL 
Sbjct  42    KVGQDDPRRIVHSLKVGLALTLVSLLYYSRTLYDGFGVAGMWAVLTVVVVFEFTVGGTLC  101

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR  ATFLAG+LG+G   +A+  G K +PI+L   VFLLAAA+TF+RF P IKAR+D
Sbjct  102   KSLNRGFATFLAGALGVGAQQLASLFGNKGEPIVLGFLVFLLAAASTFTRFFPRIKARYD  161

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFSLVSVSG R +++L LA QRLSTI +G + CI +++ +CPVWAG+DLH+L
Sbjct  162   YGVLIFILTFSLVSVSGIRAEEILQLAHQRLSTIIVGGATCIVVSICICPVWAGEDLHKL  221

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNTKASEDAMANF  930
             + +N++KLA  LEG   +Y       + +     ++EK  L GYK VLN+K++ED+M N 
Sbjct  222   VASNIDKLASFLEGFGGEYF---ECLEKEDITVSSTEKSFLQGYKSVLNSKSTEDSMVNL  278

Query  929   AVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEEC  750
             A WEPGHGRF FRHPWKQYLKIGA  R CAY IE L+  INS+ QV   E     + E C
Sbjct  279   ARWEPGHGRFGFRHPWKQYLKIGAISRQCAYLIEALNSCINSNVQV--PEEFQSKIQESC  336

Query  749   RRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQV  570
              ++     K LR                           +L  + KT+  PS  S+    
Sbjct  337   IKMSEESSKALR---------------------------SLASSIKTMTNPSPASIHV--  367

Query  569   EEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQL  390
              E  K + + LK   K++  +  D     L  I   +TVAS LVE+    + + + V +L
Sbjct  368   -ENSKAAINELKVILKASSLEQAD-----LFAIVPAATVASTLVEVVKCVDKLAESVEEL  421

Query  389   ANLAQFRGQSDKKMAKQSQSQ  327
             ANLA F+   +  ++ +S+SQ
Sbjct  422   ANLAHFK-NVEATVSPESKSQ  441



>ref|XP_002309252.2| hypothetical protein POPTR_0006s21960g [Populus trichocarpa]
 gb|EEE92775.2| hypothetical protein POPTR_0006s21960g [Populus trichocarpa]
Length=505

 Score =   338 bits (868),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 218/469 (46%), Positives = 293/469 (62%), Gaps = 45/469 (10%)
 Frame = -3

Query  1724  SRRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYD  1545
             +R RG +  + G     +  F     +LG+ +PR++IH +KVGLAL+LVS  YYL+PLY 
Sbjct  16    TRARGLLKALPGKAEAEVIGFAKSVRKLGQDDPRRIIHSLKVGLALTLVSSIYYLKPLYK  75

Query  1544  DVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPII  1365
               G   +WAV+TVVV+FE+TVG TLSK +NR  AT LAG+LG+G   +A+ SG+K QPI+
Sbjct  76    SFGEAGIWAVLTVVVIFEFTVGGTLSKSLNRGFATLLAGALGLGAQHLASLSGEKGQPIV  135

Query  1364  LQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTI  1185
             L   VFLLAAA+TF+RF P IKAR+DYG  IFILTFSLVSVSGYRV++LL LA QRLSTI
Sbjct  136   LGILVFLLAAASTFTRFFPRIKARYDYGVLIFILTFSLVSVSGYRVEELLVLASQRLSTI  195

Query  1184  ALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndk  1005
              +G +ICI +++ +CPVWAG++LH  + +N+E LA  LEG   +Y  +    D       
Sbjct  196   LVGGAICIVVSICICPVWAGENLHNSVASNIENLASYLEGFGGEYFQSGEGSD-------  248

Query  1004  ASEKKLL-GYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIE  828
              S++  L GYK VLN+K +E+ MAN A WEPGHGRF FRHPWKQYLKIGA  R CAY IE
Sbjct  249   -SDRSFLQGYKKVLNSKPTEETMANLATWEPGHGRFGFRHPWKQYLKIGALSRQCAYQIE  307

Query  827   TLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDM  648
             TL+G INS  Q    E+  K + E C ++ + CGK L+                      
Sbjct  308   TLNGYINSDNQ-APLEFRCK-IQESCTQISAECGKALK----------------------  343

Query  647   NSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIA  468
                  +L  A KT+  PSS ++   VE ++    D LK   K A+S + D +L+ ++  A
Sbjct  344   -----SLASAIKTMTFPSSANV--HVENSKTAVKD-LKISLK-AVSLEHDQELLAILPDA  394

Query  467   QLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHK  321
                TVAS+LVEI    E + + V++L+NLA F+        ++ Q  H+
Sbjct  395   ---TVASILVEIVICVEKISESVHELSNLAHFKSVEPTVSPEKPQLLHR  440



>ref|XP_007162971.1| hypothetical protein PHAVU_001G195700g [Phaseolus vulgaris]
 gb|ESW34965.1| hypothetical protein PHAVU_001G195700g [Phaseolus vulgaris]
Length=482

 Score =   337 bits (865),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 199/446 (45%), Positives = 278/446 (62%), Gaps = 45/446 (10%)
 Frame = -3

Query  1673  IWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvf  1494
             + +F     ++GK +PR+V H +KV  AL+LVSLFYY RPLYD  G   MWAV+TVVVVF
Sbjct  33    VINFTRSIAKIGKDDPRRVFHSLKVAFALTLVSLFYYSRPLYDGFGVAGMWAVLTVVVVF  92

Query  1493  eytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRF  1314
             E++VGATLSK +NR  AT LAG+LG+G   +A   G++ +PI+L   VF+LAA ATF RF
Sbjct  93    EFSVGATLSKGLNRGCATLLAGALGVGGQHLATTFGEREKPIVLGILVFILAAGATFFRF  152

Query  1313  IPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPV  1134
              P IKAR+DYG  IFILTF LV+VSGYRV++L +LA QRLSTI +G + C+ I++ +CPV
Sbjct  153   FPKIKARYDYGVVIFILTFCLVTVSGYRVEQLFELAHQRLSTILIGATACMVISIFICPV  212

Query  1133  WAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNTK  957
             WAG+DLH+L+ +N+EKLA+ LEG   +Y           +  +  EK +L GYK +LN+K
Sbjct  213   WAGEDLHKLVASNVEKLANYLEGFEVEYF-------HCSEGKEKCEKSVLEGYKSILNSK  265

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             ASE+++ANFA WEPGHGRF  RHPWKQYLKIG   R CAY IETL+  +N   Q  S E+
Sbjct  266   ASEESLANFARWEPGHGRFRLRHPWKQYLKIGVLTRECAYKIETLNNYLNPEIQT-SLEF  324

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
               K V E C ++ S                           + N A+  +  + KT+  P
Sbjct  325   KCK-VQEPCTKMIS---------------------------ESNKALNVISSSVKTMTHP  356

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
             S+    + +E ++    D LK   ++   +D D     L+ I  ++TVAS+L EI    E
Sbjct  357   SAAK--SHIENSKTAVED-LKFVLETVSLEDAD-----LLTIIPVATVASILEEITKSVE  408

Query  416   GVVKEVNQLANLAQFRGQSDKKMAKQ  339
              + + V++L++LA F+   +  ++ +
Sbjct  409   KIYESVSELSDLAYFKSVVESNVSPE  434



>ref|XP_011046418.1| PREDICTED: aluminum-activated malate transporter 8 [Populus euphratica]
Length=482

 Score =   337 bits (865),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 216/469 (46%), Positives = 294/469 (63%), Gaps = 45/469 (10%)
 Frame = -3

Query  1724  SRRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYD  1545
             +R RG +  + G     +  F     +LG+ +PR++IH +KVGLAL+LVS  YYLRPLY 
Sbjct  16    TRARGLLKALPGKAEAEVIGFAKSVRKLGQDDPRRIIHSLKVGLALTLVSSIYYLRPLYK  75

Query  1544  DVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPII  1365
               G   +WAV+TVVV+FE+TVG TLSK +NR  AT LAG+LG+G   +A+ SG+K QPI+
Sbjct  76    SFGEAGIWAVLTVVVIFEFTVGGTLSKSLNRGFATLLAGALGLGAQHLASLSGEKGQPIV  135

Query  1364  LQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTI  1185
             L   VFLLAAA+TF+RF P IKAR+DYG  IFILTFSLVSVSGYRV++LL LA QRLSTI
Sbjct  136   LGILVFLLAAASTFTRFFPRIKARYDYGVLIFILTFSLVSVSGYRVEELLVLASQRLSTI  195

Query  1184  ALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndk  1005
              +G +IC+ +++ +CPVWAG++LH  + +N+E LA  LEG   +Y ++    D       
Sbjct  196   LVGGAICMIVSICICPVWAGENLHNSVASNIENLASYLEGFGGEYFHSGEGSD-------  248

Query  1004  ASEKKLL-GYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIE  828
              S++  L GYK VLN+K +++ MAN A WEPGHGRF FRHPWKQYLKIGA  R CAY IE
Sbjct  249   -SDRSFLQGYKKVLNSKPTDETMANLATWEPGHGRFGFRHPWKQYLKIGALSRQCAYQIE  307

Query  827   TLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDM  648
             TL+G INS  Q    E+  K + E C ++ + CGK L+                      
Sbjct  308   TLNGYINSDNQ-APLEFRCK-IQESCTQISAECGKALK----------------------  343

Query  647   NSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIA  468
                  +L  A K++  PSS ++   VE ++    D LK   K A+S + D +L+ ++  A
Sbjct  344   -----SLASAIKSMTFPSSANV--HVENSKTAVKD-LKISLK-AVSLEHDQELLAILPDA  394

Query  467   QLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHK  321
                TVAS+LVEI    E + + V++L+NLA F+        ++ Q  H+
Sbjct  395   ---TVASILVEIVVCVEKISESVHELSNLAHFKSVEPTVSPEKPQLLHR  440



>ref|XP_008360621.1| PREDICTED: aluminum-activated malate transporter 8-like [Malus 
domestica]
Length=494

 Score =   338 bits (866),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 208/459 (45%), Positives = 283/459 (62%), Gaps = 42/459 (9%)
 Frame = -3

Query  1697  IVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWA  1518
             ++G    ++   +    +LG+ +PR+V H +KV LAL+LVS+ YY R L+D +G   +WA
Sbjct  27    LLGKLSTKVVKVVKSIIKLGQDDPRRVTHSLKVALALTLVSILYYWRVLFDGIGIAGIWA  86

Query  1517  vmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLA  1338
             V+TVVVVFE+TVGATLSK +NR  ATF+AG+LG+G   +A+  G K +PI+L   VFLLA
Sbjct  87    VITVVVVFEFTVGATLSKGLNRGFATFIAGALGLGATHIASLFGVKGEPIVLGIFVFLLA  146

Query  1337  AAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIF  1158
             AA+TFSRF P IKAR+DYG  IFILTFS+V+VSGY V+ +L+++ QRL TIA+G   C+ 
Sbjct  147   AASTFSRFFPRIKARYDYGVLIFILTFSMVTVSGYHVEGILEMSNQRLLTIAIGGGTCMI  206

Query  1157  IAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGY  978
             I+  +CPVWAG+DLH+LI++N+E LA+ L G   +Y     DG       K+ E  L GY
Sbjct  207   ISAFVCPVWAGEDLHKLISSNIENLANYLVGFGGEYFPLPKDGKSAGIVSKSKESFLQGY  266

Query  977   KCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSA  798
             K VLN+K+SE+++ANFA WEPGHG F FRHPWKQYLKIGA  R CAY IETL+G INS  
Sbjct  267   KSVLNSKSSEESLANFARWEPGHGHFKFRHPWKQYLKIGALARQCAYQIETLNGHINSDX  326

Query  797   QVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLA  618
             QV   E+ L+ + + C+ +    GK L+                           AL +A
Sbjct  327   QV-PPEF-LQIIQDSCKTMSIESGKALK---------------------------ALAVA  357

Query  617   FKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLV  438
              KT+  P       +  E  K +   LK   K+A  +  D     ++ I   +TVAS+LV
Sbjct  358   IKTMEEPKD---ACEHLENSKTAVKDLKIALKAASLETAD-----ILAIVPAATVASILV  409

Query  437   EIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHK  321
             EI    E + K V++L+ LA F     KK  + + SQ K
Sbjct  410   EIVKGVEKISKSVHELSELAHF-----KKAVECTVSQEK  443



>gb|KDO58242.1| hypothetical protein CISIN_1g036990mg [Citrus sinensis]
Length=457

 Score =   336 bits (862),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 201/472 (43%), Positives = 295/472 (63%), Gaps = 54/472 (11%)
 Frame = -3

Query  1715  RGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVG  1536
             RG +  + G  + ++  F  K  +LG+++PR++IH  KVGLA++LVSLFYY  PLY   G
Sbjct  19    RGSIKSLPGKLMAKLVEFAKKTKRLGREDPRRIIHSFKVGLAIALVSLFYYFEPLYKGFG  78

Query  1535  GNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQA  1356
              +AMWAV+TVVVVFE++VG TLS+ +NR +ATFLA +LG G H +A+  G+K +PI+L  
Sbjct  79    ISAMWAVLTVVVVFEFSVGGTLSRGLNRGLATFLASALGFGAHHLASLPGEKGEPILLGL  138

Query  1355  SVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALG  1176
              VFLLAAA +F RF P +KAR+DYG  IFILTFSL+SVS Y  D+++ +A +R+ TI +G
Sbjct  139   FVFLLAAAVSFLRFFPEMKARYDYGLMIFILTFSLISVSAYHDDEVMRIAYERVITILIG  198

Query  1175  TSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASE  996
                 +F+ + +CPVWAGDDLH L+ NN++KLA+  E  +  YL    +G+ +        
Sbjct  199   IFTALFVCIFICPVWAGDDLHSLVANNIDKLANFFEAFVPLYLKISQEGEPEMTF-----  253

Query  995   KKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHG  816
               L GYKCVLN+K +E+++ANFA WEPGHG+F FRHPWK+YLKIG+  R CAY IE+L+G
Sbjct  254   --LEGYKCVLNSKQTEESLANFAGWEPGHGKFRFRHPWKKYLKIGSQTRDCAYRIESLNG  311

Query  815   S--INSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNS  642
                +N+  Q          + EE R      GK                +QD  ++  + 
Sbjct  312   YLILNTETQ----------IPEEIR------GK----------------MQDACINMSSE  339

Query  641   AVEAL-QLAF--KTLIPP-SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLME  474
             AV+AL +LAF  KT+  P S+ S  T+     K ++ +LK    ++L  + +     + E
Sbjct  340   AVKALKELAFSIKTMTKPCSADSHITK----SKIAAKNLKSLLSTSLCKETE-----ISE  390

Query  473   IAQLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHKE  318
             + Q  TV SLLV++ A T+ + + V +LA+ A+F+ +  K+   ++ S+  E
Sbjct  391   VMQAITVVSLLVDVVACTKKIAESVQELASFAKFKSEKPKQAPLRTSSKISE  442



>ref|XP_009374112.1| PREDICTED: aluminum-activated malate transporter 8-like [Pyrus 
x bretschneideri]
 ref|XP_009374113.1| PREDICTED: aluminum-activated malate transporter 8-like [Pyrus 
x bretschneideri]
Length=493

 Score =   337 bits (864),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 204/452 (45%), Positives = 279/452 (62%), Gaps = 38/452 (8%)
 Frame = -3

Query  1724  SRRRGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYD  1545
             SR  G +  ++G    ++   +    +LG+ +PR+V H +KV LAL+LVS+ YY + L++
Sbjct  18    SRSCGWLMALLGKLSTKVVKVVKSIIKLGQDDPRRVTHSLKVALALTLVSILYYWQALFE  77

Query  1544  DVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPII  1365
              +G   +WAV+TVVVVFE+TVGATLSK +NR  ATFL G+LG+G + +A+  G K +PI+
Sbjct  78    GIGVAGIWAVLTVVVVFEFTVGATLSKGLNRGFATFLGGALGLGANHIASLFGVKGEPIV  137

Query  1364  LQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTI  1185
             L   VFLLAAA+TFSRF P IKAR+DYG  IFILTFS+V+VSGYRV+ +L++A +RL TI
Sbjct  138   LGIFVFLLAAASTFSRFFPRIKARYDYGVLIFILTFSMVTVSGYRVEGILEMAHERLLTI  197

Query  1184  ALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndk  1005
              +G   C+ I+  +CPVWAG+DLH+LI +N+EKLA+ LE    +Y              K
Sbjct  198   VIGGGTCMIISAFVCPVWAGEDLHKLIASNIEKLANYLEDFGGEYF-PLPKNGKSGMVSK  256

Query  1004  ASEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIET  825
               E  L GYK VLN+K+SE+++ANFA WEPGHG F FRHPWKQYLKIGA  R CAY IET
Sbjct  257   NKESFLQGYKSVLNSKSSEESLANFARWEPGHGSFKFRHPWKQYLKIGALARQCAYQIET  316

Query  824   LHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMN  645
             L+G INS  QV   E+ L+ + + CR +    GK L+                       
Sbjct  317   LNGHINSDVQV-PPEF-LQIIQDSCRTMGIESGKALK-----------------------  351

Query  644   SAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQ  465
                 AL +A KT+  P       +  E  K + + LK   K+A  +  D     ++ I  
Sbjct  352   ----ALAIAIKTMKEPKD---ACEHLENSKTAVEDLKIALKAASLETAD-----ILGIVP  399

Query  464   LSTVASLLVEIAARTEGVVKEVNQLANLAQFR  369
              +TVAS+LVEI    E + K V++L+ LA F+
Sbjct  400   AATVASILVEIVKGVENISKSVHELSELAHFK  431



>ref|XP_011021454.1| PREDICTED: aluminum-activated malate transporter 2-like [Populus 
euphratica]
Length=476

 Score =   336 bits (862),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 199/445 (45%), Positives = 280/445 (63%), Gaps = 45/445 (10%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             +LG+ +PR+VIH +KVGLAL+LVS+FYY +PLY +    A+WA+MTVVVVFE++VGATL 
Sbjct  41    KLGQDDPRRVIHSLKVGLALTLVSMFYYCQPLYSNFDETAIWAIMTVVVVFEFSVGATLG  100

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR +AT +AG LGIG H +AN SG   +PI+L   VFL A  +TF RF P IK+R+D
Sbjct  101   KGLNRGMATLMAGGLGIGAHHLANLSGHIGEPILLGFFVFLQATISTFLRFFPKIKSRYD  160

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFSL+SVSGYR D++L++A +RLSTI +G + C+ I++++ PVWAG+DLH L
Sbjct  161   YGMLIFILTFSLISVSGYRDDEILEIAHRRLSTICIGGATCVIISIVIFPVWAGEDLHNL  220

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNTKASEDAMANF  930
             I  N+EKL + LEG   +Y             ++  +KK+L GYK +LN+K SE ++ANF
Sbjct  221   IALNIEKLGNFLEGFGDEYF------KRTGGEERNEDKKILEGYKSILNSKTSEGSLANF  274

Query  929   AVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEEC  750
             A WEPGHGRF FRHPWK YLK+G   R CAY IE L+G +N+  QV S   +   + E C
Sbjct  275   AAWEPGHGRFPFRHPWKLYLKVGTLARECAYRIEALNGYLNADMQVSSE--VSTIIQEAC  332

Query  749   RRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQV  570
               +    GK L++                           L LA KT++ PSS    + +
Sbjct  333   TTMSLESGKALKE---------------------------LALAIKTMVQPSSAD--SHI  363

Query  569   EEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQL  390
             E A K ++ ++K   KS + +D D     L+++    TV S+LV++   TE +    ++L
Sbjct  364   ENA-KSAAKNIKSLLKSGIWEDID-----LLKVIPGVTVCSILVDVVTCTEKIAASTHEL  417

Query  389   ANLAQFRGQSDKKMAKQSQSQHKEQ  315
             A+ AQF+  +D  +++Q QS    Q
Sbjct  418   ASKAQFK-SADSPLSEQIQSIKSAQ  441



>ref|XP_011003844.1| PREDICTED: aluminum-activated malate transporter 7-like isoform 
X1 [Populus euphratica]
Length=483

 Score =   335 bits (859),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 196/448 (44%), Positives = 279/448 (62%), Gaps = 43/448 (10%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             ++G+ +PR+VIH +KVGLAL+LVS+FYY +PLY + G  AMWA+MTVVVVFE++VGATL 
Sbjct  41    KVGQDDPRRVIHSLKVGLALALVSIFYYYQPLYSNFGVTAMWAIMTVVVVFEFSVGATLG  100

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR +AT LA +LG+G H +AN SG   +PI+L + VFL AA +TF RF P IKAR+D
Sbjct  101   KGLNRGMATLLASALGVGAHHLANLSGHVGEPILLGSLVFLQAAISTFLRFFPKIKARYD  160

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFSL+S+SG+R D++L+LA +R+ TI +G   C+ I++++ PVWAG+DLH L
Sbjct  161   YGLLIFILTFSLISISGFRDDEILELAHKRVLTIFVGGCACVIISIVVFPVWAGEDLHNL  220

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFA  927
             I  N+EKL + LEG   +Y              K  +K L GYK VLN+K  E+++ANFA
Sbjct  221   IALNIEKLGNFLEGFGDEYF-----KRTGDAGSKDDKKYLEGYKSVLNSKTGEESLANFA  275

Query  926   VWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECR  747
              WEPGHGRF FRHPWKQYLK+G   R CAY IE L+G +N+  Q  S   +   + E C 
Sbjct  276   AWEPGHGRFQFRHPWKQYLKVGTLARECAYRIEALNGYLNADIQASSE--VRSRIQEACT  333

Query  746   RVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVE  567
              +    GK L++                           L L  K ++ PSS    + +E
Sbjct  334   NMSIESGKALKE---------------------------LSLTIKKMVQPSSAD--SHIE  364

Query  566   EAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLA  387
              A K ++ +LK    S L +D D     L+++    TVAS+L E+   TE + + V++LA
Sbjct  365   NA-KSAAKNLKSLLNSGLWEDTD-----LLKVIPGITVASILNEVVKCTENIAESVHELA  418

Query  386   NLAQFRGQSDKKMAKQSQSQHKEQNVQT  303
             + AQF+   ++ ++ +     + QN+++
Sbjct  419   SKAQFK-SVERTVSPEKLHSGQPQNIKS  445



>gb|KHG16053.1| Aluminum-activated malate transporter 2 [Gossypium arboreum]
Length=448

 Score =   333 bits (855),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 196/436 (45%), Positives = 269/436 (62%), Gaps = 41/436 (9%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             +++ F     +LG+ +PR+V+H +K GLAL+LVSLFYY +PLY   G +AMWAV+TVVVV
Sbjct  33    KVFEFFSHLIKLGQDDPRRVVHSLKAGLALTLVSLFYYYQPLYKSFGVSAMWAVITVVVV  92

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE++VGATL K VNR +AT LAG L +G H +AN SG+  +PI+L   VFL AA +TF R
Sbjct  93    FEFSVGATLGKGVNRGLATLLAGGLAVGAHQLANLSGRIGEPIVLGFFVFLQAAVSTFVR  152

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P IKAR+DYG  IFILTFSL+S+SG+R D++L+L  +RL T+ +G S C+ I++LL P
Sbjct  153   FCPQIKARYDYGLLIFILTFSLISISGFRDDEVLELVHKRLLTVLIGGSTCVIISVLLFP  212

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG DLH LI +N+EKL   LEG   +Y     DG+  +         L GYK VL++K
Sbjct  213   VWAGQDLHNLIASNMEKLGIFLEGFGDEYFKMPEDGESKE-----DRPFLQGYKSVLDSK  267

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
              +EDA+ANFA WEP HGRF FRHPW+QYLKIGA  R CAY IE+L+G + +  Q  +   
Sbjct  268   TNEDALANFARWEPRHGRFQFRHPWRQYLKIGALTRKCAYRIESLNGHLYADIQ--AKRE  325

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
             I   + E C  +    GK L++                           L +A KT++ P
Sbjct  326   IRSKIQETCTTISMESGKALKE---------------------------LSMAIKTMVQP  358

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
              +  +     E  K S  +L    KS L DD+      L+E+  ++TVASLL+++   T 
Sbjct  359   FAADIHI---ENSKSSVKNLDTLLKSGLWDDETD----LLEVVPVATVASLLIDVVTCTA  411

Query  416   GVVKEVNQLANLAQFR  369
              + + VN+LA + +F 
Sbjct  412   EIAESVNELATMLKFE  427



>ref|XP_006481850.1| PREDICTED: aluminum-activated malate transporter 2-like [Citrus 
sinensis]
Length=475

 Score =   334 bits (857),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 196/437 (45%), Positives = 277/437 (63%), Gaps = 40/437 (9%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++   ++K  +LGK +PR++ H +KVGLAL++VS+FYY +PLYD+ G +AMWAVMTVVVV
Sbjct  30    KVVEVVNKVIKLGKDDPRRITHSIKVGLALTMVSIFYYYQPLYDNFGVSAMWAVMTVVVV  89

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE++VGATL K +NR +AT +AG LG+G H +A+ SG+  +PI+L   VF+ AAA+TF R
Sbjct  90    FEFSVGATLGKGLNRGLATLVAGGLGVGAHHLASLSGEIGEPILLGFFVFIQAAASTFIR  149

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P+IKAR+DYG  IFILTFSL+SVSG+R D++L+LA +RLST+ +G S CI I++L+CP
Sbjct  150   FFPTIKARYDYGLLIFILTFSLISVSGFRDDEILELAHKRLSTVIIGGSACIIISILICP  209

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLG-YKCVLNT  960
             VWAG DLH LI  NLEKL   LEG  ++Y        +D ++    EK  +  YK  LN+
Sbjct  210   VWAGQDLHNLIATNLEKLGKFLEGFGNEYF----KTLEDGESSNKDEKSFMQEYKSALNS  265

Query  959   KASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAE  780
             K+SE+++ANFA WEPGHGRF FRHPW++YLKIG   R CAY I+ L+G +N+  Q  +A 
Sbjct  266   KSSEESLANFARWEPGHGRFQFRHPWQRYLKIGNLTRQCAYRIDALNGYLNTEIQ--AAP  323

Query  779   YILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIP  600
              I   + E C  +    G+ L++                           L LA K    
Sbjct  324   EIKSKIQEACTEMSLESGRALKE---------------------------LALAIKKTSQ  356

Query  599   PSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAART  420
                 S  T ++ A K ++ +L    KS + +D D     L+ +  ++TVASLL+++   T
Sbjct  357   QPITSADTHIKNA-KSAAKNLNTLLKSGIWEDCD-----LLTVVPVATVASLLIDVVNCT  410

Query  419   EGVVKEVNQLANLAQFR  369
             E V +   +LA+ A F 
Sbjct  411   EKVAESAYELASAANFE  427



>ref|XP_004136712.1| PREDICTED: aluminum-activated malate transporter 8-like [Cucumis 
sativus]
 ref|XP_004164743.1| PREDICTED: aluminum-activated malate transporter 8-like [Cucumis 
sativus]
Length=467

 Score =   334 bits (856),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 200/437 (46%), Positives = 274/437 (63%), Gaps = 38/437 (9%)
 Frame = -3

Query  1655  KAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvga  1476
             K  +LG+ +PR++IH +KVG+AL+LVSLFYY +PLYD  G + +WAV+TVVV+FE+TVGA
Sbjct  15    KIKKLGQDDPRRIIHSIKVGVALTLVSLFYYWKPLYDGFGASGIWAVITVVVIFEFTVGA  74

Query  1475  TLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKA  1296
             TLSK +NR + T LAG+LG+GV ++AN SGQK +P +L   VFL+AA+ATFSRF P IKA
Sbjct  75    TLSKGLNRGLGTMLAGALGVGVDYLANLSGQKGEPFVLGIFVFLIAASATFSRFFPGIKA  134

Query  1295  RFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDL  1116
             R+DYG  IFILTFS+VSVSGYRVD+ L +A QRL+TI +G +ICI +++++CPVWAG+ L
Sbjct  135   RYDYGVLIFILTFSMVSVSGYRVDEFLTMAHQRLATILVGGAICIIVSIVVCPVWAGETL  194

Query  1115  HRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLG-YKCVLNTKASEDAM  939
             H  I +N+ KLA+ LEG   +Y        D+       +K  L  YK VLN+K++ED+M
Sbjct  195   HNSIISNINKLANYLEGFGGEYF----HCSDEHVTIPEKDKPFLQEYKVVLNSKSTEDSM  250

Query  938   ANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVS  759
             ANFA WEP HG F FRHPWK YLKIG+  R CAY IE L+  + S  Q+       + + 
Sbjct  251   ANFARWEPRHGNFGFRHPWKHYLKIGSVARQCAYHIEALNFHL-SPHQLQEPSQFRRMLE  309

Query  758   EECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLT  579
               C+ + S  GK L+                           AL  A K +  PS  S  
Sbjct  310   VPCKTISSESGKALK---------------------------ALATAMKKMTDPSPSS--  340

Query  578   TQVE-EAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKE  402
              Q+   A K + + LK   KS  +   D D+  L+ I   +TVAS+L++I    E + + 
Sbjct  341   -QLHLNAAKSAVNDLKNTLKSGTTQISD-DISNLLAIIPDATVASILIDIVKSVEDLSEA  398

Query  401   VNQLANLAQFRGQSDKK  351
             V +L+  A+F+  S +K
Sbjct  399   VAELSLKAKFKRVSPEK  415



>ref|XP_002322786.2| hypothetical protein POPTR_0016s07080g [Populus trichocarpa]
 gb|EEF04547.2| hypothetical protein POPTR_0016s07080g [Populus trichocarpa]
Length=480

 Score =   334 bits (856),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 208/446 (47%), Positives = 281/446 (63%), Gaps = 40/446 (9%)
 Frame = -3

Query  1655  KAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvga  1476
             KA ++G+ +PR+VIH +KVGLAL+ VS FYY RPLYD  G + MWAV+TVVV+FE+TVG 
Sbjct  32    KAIKVGEDDPRRVIHSLKVGLALTFVSFFYYSRPLYDGFGQSGMWAVLTVVVIFEFTVGG  91

Query  1475  TLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKA  1296
             TLSK + R +ATFLA +LG G   +A+  G+K QPI+L   VFLLAAA+TF+RF P IKA
Sbjct  92    TLSKGLYRGLATFLACALGFGASNLASLFGRKAQPIVLGILVFLLAAASTFTRFFPRIKA  151

Query  1295  RFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDL  1116
             R+DYG  IFILTFSLVSVSGYRV+KLL LA QRLSTI +G +ICI ++ +  PVWAG+DL
Sbjct  152   RYDYGVVIFILTFSLVSVSGYRVEKLLVLAHQRLSTILIGGAICILLSFIF-PVWAGEDL  210

Query  1115  HRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNTKASEDAM  939
             H+L+ +N+EKLA  LEG   ++       D        ++K  L GYK VLN+K++E++M
Sbjct  211   HKLVASNVEKLAKYLEGFGGEFF--QPLEDGRNVKVSNTDKSFLRGYKNVLNSKSTEESM  268

Query  938   ANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVS  759
             AN A WEP HGRF FRHPWKQYLKIG+  R CAY IE L   INS  Q         P+ 
Sbjct  269   ANLARWEPRHGRFGFRHPWKQYLKIGSLSRQCAYQIEALDAYINSHNQA--------PLK  320

Query  758   EECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLT  579
               C ++   C +                    +  + + A+E+L  A KT+  PSS ++ 
Sbjct  321   FRC-KIRGPCTR--------------------MSIECSMALESLASAIKTMTLPSSANV-  358

Query  578   TQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEV  399
               VE ++    D LK   ++ +S D D D   L+ I   +TVAS+++EI    E + + V
Sbjct  359   -HVENSKNAIKD-LKIAIET-VSLDQDQD---LLAIVPAATVASIIIEIVKCVENLSESV  412

Query  398   NQLANLAQFRGQSDKKMAKQSQSQHK  321
             ++L+NLA F+        ++ Q  H+
Sbjct  413   HELSNLAHFKSVEPTVSLEKPQFLHR  438



>gb|KDO41689.1| hypothetical protein CISIN_1g040886mg [Citrus sinensis]
Length=475

 Score =   333 bits (855),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 196/432 (45%), Positives = 275/432 (64%), Gaps = 40/432 (9%)
 Frame = -3

Query  1661  IDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytv  1482
             ++K  +LGK +PR++ H +KVGLAL++VS+FYY +PLYD+ G +AMWAVMTVVVVFE++V
Sbjct  35    VNKVIKLGKDDPRRITHSIKVGLALTMVSIFYYYQPLYDNFGVSAMWAVMTVVVVFEFSV  94

Query  1481  gaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSI  1302
             GATL K +NR +AT +AG LG+G H +A+ SG+  +PI+L   VF+ AAA+TF RF P+I
Sbjct  95    GATLGKGLNRGLATLVAGGLGVGAHHLASLSGEIGEPILLGFFVFIQAAASTFIRFFPTI  154

Query  1301  KARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGD  1122
             KAR+DYG  IFILTFSL+SVSG+R D++L+LA +RLST+ +G S CI I++L+CPVWAG 
Sbjct  155   KARYDYGLLIFILTFSLISVSGFRDDEILELAHKRLSTVIIGGSACIIISILICPVWAGQ  214

Query  1121  DLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLG-YKCVLNTKASED  945
             DLH LI  NLEKL   LEG  ++Y        +D ++    EK  +  YK  LN+K+SE+
Sbjct  215   DLHNLIATNLEKLGKFLEGFGNEYF----KTLEDGESSNKDEKSFMQEYKSALNSKSSEE  270

Query  944   AMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKP  765
             ++ANFA WEPGHGRF FRHPW++YLKIG   R CAY I+ L+G +N+  Q  +A  I   
Sbjct  271   SLANFARWEPGHGRFQFRHPWQRYLKIGNLTRQCAYRIDALNGYLNTEIQ--AAPEIKSK  328

Query  764   VSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQS  585
             + E C  +    G+ L++                           L LA K        S
Sbjct  329   IQEACTEMSLESGRALKE---------------------------LTLAIKKTSQQPITS  361

Query  584   LTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVK  405
               T ++ A K ++ +L    KS + +D D     L+ +  ++TVASLL+++   TE V +
Sbjct  362   ADTHIKNA-KSAAKNLNTLLKSGIWEDCD-----LLTVVPVATVASLLIDVVNCTEKVAE  415

Query  404   EVNQLANLAQFR  369
                +LA+ A F 
Sbjct  416   SAYELASAANFE  427



>ref|XP_006481848.1| PREDICTED: aluminum-activated malate transporter 2-like [Citrus 
sinensis]
Length=457

 Score =   332 bits (852),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 199/470 (42%), Positives = 294/470 (63%), Gaps = 50/470 (11%)
 Frame = -3

Query  1715  RGKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVG  1536
             R  +  + G  + ++  F  K  +LG+++PR++IH  KVGLA++LVSLFYY  PLY   G
Sbjct  19    RVSIKSLPGKLMAKLVEFAKKTKRLGREDPRRIIHSFKVGLAIALVSLFYYFEPLYKGFG  78

Query  1535  GNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQA  1356
              +AMWAV+TVVVVFE++VG TLS+ +NR +ATFLA +LG G H +A+  G+K +PI+L  
Sbjct  79    ISAMWAVLTVVVVFEFSVGGTLSRGLNRGLATFLASALGFGAHHLASLPGEKGEPILLGL  138

Query  1355  SVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALG  1176
              VFLLAAA +F RF P +KAR+DYG  IFILTFSL+SVS Y  D+++ +A +R+ TI +G
Sbjct  139   FVFLLAAAVSFLRFFPEMKARYDYGLMIFILTFSLISVSAYHDDEVMRIAYERVITILIG  198

Query  1175  TSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASE  996
                 +F+ + +CPVWAGDDLH L+ NN++KLA+  E  +  YL    +G+ +        
Sbjct  199   IFTALFVCIFICPVWAGDDLHSLVANNIDKLANFFEAFVPLYLKISQEGEPEMTF-----  253

Query  995   KKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHG  816
               L GYKCVLN+K +E+++ANFA WEPGHG+F FRHPWK+YLKIG+  R CAY IE+L+G
Sbjct  254   --LEGYKCVLNSKQTEESLANFAGWEPGHGKFRFRHPWKKYLKIGSLTRDCAYRIESLNG  311

Query  815   SINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAV  636
              +  +A+          + EE R      GK                +QD  ++  + AV
Sbjct  312   YLIQNAETQ--------IPEEIR------GK----------------MQDACINMSSEAV  341

Query  635   EAL-QLAF--KTLIPP-SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIA  468
             +AL +LAF  KT+  P S+ S  T+     K ++ +LK    ++L  + +     + E+ 
Sbjct  342   KALKELAFSIKTMTKPCSADSHITK----SKIAAKNLKSLLSTSLCKETE-----ISEVM  392

Query  467   QLSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHKE  318
             Q  TV SLLV++ A T+ + + V +LA+ A+F+ +  K+   ++ S+  E
Sbjct  393   QAITVVSLLVDVVACTKKIAESVQELASFAKFKSEKPKQAPLRTSSKISE  442



>ref|XP_006424112.1| hypothetical protein CICLE_v10029898mg [Citrus clementina]
 gb|ESR37352.1| hypothetical protein CICLE_v10029898mg [Citrus clementina]
Length=428

 Score =   331 bits (848),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 199/459 (43%), Positives = 289/459 (63%), Gaps = 54/459 (12%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++  F  K  +LG+++PR++IH  KVGLA++LVSLFYY  PLY   G +AMWAV+TVVVV
Sbjct  3     KLVEFAKKTKRLGREDPRRIIHSFKVGLAIALVSLFYYFEPLYKGFGISAMWAVLTVVVV  62

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE++VG TLS+ +NR +ATFLA +LG G H +A+  G+K +PI+L   VFLLAAA +F R
Sbjct  63    FEFSVGGTLSRGLNRGLATFLASALGFGAHHLASLPGEKGEPILLGLFVFLLAAAVSFLR  122

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P +KAR+DYG  IFILTFSL+SVS Y  D+++ +A +R+ TI +G    +F+ + +CP
Sbjct  123   FFPEMKARYDYGLMIFILTFSLISVSAYHDDEVMRIAYERVITILIGIFTALFVCIFICP  182

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAGDDLH L+ NN++KLA+  E  +  YL    +G+ +          L GYKCVLN+K
Sbjct  183   VWAGDDLHSLVANNIDKLANFFEAFVPLYLKISQEGEPEMTF-------LEGYKCVLNSK  235

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGS--INSSAQVGSA  783
              +E+++ANFA WEPGHG+F FRHPWK+YLKIG+  R CAY IE+L+G   +N+  Q    
Sbjct  236   QTEESLANFAGWEPGHGKFRFRHPWKKYLKIGSQTRDCAYRIESLNGYLILNTETQ----  291

Query  782   EYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEAL-QLAF--K  612
                   + EE R      GK                +QD  ++  + AV+AL +LAF  K
Sbjct  292   ------IPEEIR------GK----------------MQDACINMSSEAVKALKELAFSIK  323

Query  611   TLIPP-SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVE  435
             T+  P S+ S  T+     K ++ +LK    ++L  + +     + E+ Q  TV SLLV+
Sbjct  324   TMTKPCSADSHITK----SKIAAKNLKSLLSASLCKETE-----ISEVMQAITVVSLLVD  374

Query  434   IAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHKE  318
             + A TE + + V +LA+ A+F+ +  K+   ++ S+  E
Sbjct  375   VVACTEKIAESVQELASFAKFKSEKPKQAPLRTSSKISE  413



>ref|XP_002322785.1| hypothetical protein POPTR_0016s07070g [Populus trichocarpa]
 gb|EEF04546.1| hypothetical protein POPTR_0016s07070g [Populus trichocarpa]
Length=474

 Score =   332 bits (852),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 206/439 (47%), Positives = 275/439 (63%), Gaps = 48/439 (11%)
 Frame = -3

Query  1682  VLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvv  1503
             +LR+   I K   LGK +PR++IH +KVGLAL+L SL YYLRPLYD  G   +WAV+TVV
Sbjct  33    ILRVAKSIKK---LGKDDPRRIIHSLKVGLALTLSSLIYYLRPLYDGFGTAGIWAVLTVV  89

Query  1502  vvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATF  1323
             VVFE+TVG TLSK +NR  AT +AG+LG+G   +A+  G K  PI+L   VFLLAA +TF
Sbjct  90    VVFEFTVGGTLSKSLNRGFATLVAGALGLGAQQLASLFGDKGDPIVLGILVFLLAAVSTF  149

Query  1322  SRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLL  1143
              RF P IKAR+DYG  IFILTFSL+++SG RV++LL++A QRLSTI +G + CI +++ +
Sbjct  150   MRFFPQIKARYDYGVLIFILTFSLIALSGCRVEELLEMAHQRLSTIIVGGATCIVVSICI  209

Query  1142  CPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVL  966
             CPVWAG+ LH  +  N+EKLA  LEG   +Y                S+K  L GYK VL
Sbjct  210   CPVWAGETLHNSVAANIEKLASYLEGFGGEYF--------QSCERSNSDKSFLQGYKNVL  261

Query  965   NTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGS  786
             N+K++E+AMAN A WEP HGRF  RHPWKQYLKIG   R CAY IETL+G INS      
Sbjct  262   NSKSTEEAMANLARWEPRHGRFRSRHPWKQYLKIGELTRQCAYHIETLNGYINSDIH-AP  320

Query  785   AEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTL  606
              E+  K + E C  + + CGK L+ L+  +K+TT  S +++ V +  +AV+ L++A K  
Sbjct  321   LEFRCK-IQEPCTLISAECGKALKSLASAIKTTTVPSSENVNVENSKTAVQDLKIALK--  377

Query  605   IPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAA  426
                                          A+S + D DL+ ++  A   TVAS+LVEI  
Sbjct  378   -----------------------------AVSLEHDQDLLQILPAA---TVASILVEIVI  405

Query  425   RTEGVVKEVNQLANLAQFR  369
               E + + V+ L+NLA F+
Sbjct  406   CVEKISESVHGLSNLAHFK  424



>ref|XP_008659565.1| PREDICTED: aluminum-activated malate transporter 10-like [Zea 
mays]
 gb|AFW86626.1| hypothetical protein ZEAMMB73_527929 [Zea mays]
Length=674

 Score =   338 bits (868),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 195/437 (45%), Positives = 273/437 (62%), Gaps = 18/437 (4%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             R+      AW++G  +PRKV HG K+ LAL+L S+FYY++PLYD  G NAMWAV+TVVVV
Sbjct  79    RVVGVARMAWRIGADDPRKVAHGFKMALALTLCSVFYYVKPLYDFTGQNAMWAVLTVVVV  138

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FEYTVG  L K +NR +AT    +L +GV W+A+ S ++L+P IL  S+F+ AAAAT+SR
Sbjct  139   FEYTVGGCLYKGLNRAMATMTGAALALGVQWIASLSDKELEPFILSGSLFVFAAAATYSR  198

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F+P++KARFDYG TIFILT++LV+V GYRV+++  +A+ RL+TIA+G  IC  +  L+ P
Sbjct  199   FLPTMKARFDYGVTIFILTYTLVAVGGYRVNEVAFMARHRLTTIAIGAVICFAVCALVFP  258

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkAS--EKKLLGYKCVLN  963
             VWAG +LH  +  N++KLA ++E C+ DY +     D             K  GYK VLN
Sbjct  259   VWAGQELHNQVARNMDKLASAVESCVEDYFSEAAGVDVVAGAVPKPALSDKSHGYKAVLN  318

Query  962   TKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSA  783
              KASED++AN A WEP HGRF FRHP+  Y K+GA MR+CAYC++ L   + S AQ  + 
Sbjct  319   AKASEDSLANLATWEPAHGRFGFRHPYHLYQKVGAEMRSCAYCVDALSACVVSEAQ--TP  376

Query  782   EYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLI  603
              ++ K ++     +   C  +LR+ S  + S T+S    ++V DMN+A   L+   + L 
Sbjct  377   AHVKKHLAGASAALGRHCSAMLREASGSVASMTRSGRLALVVGDMNAAALELRDELRFLA  436

Query  602   PPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAAR  423
             P   +  +T  E+ Q     ++      A S         L+E   L T ASLL+EI  R
Sbjct  437   PLLEEDESTDTEQEQ-----NITMSPAPAPS---------LIEALPLFTAASLLLEICTR  482

Query  422   TEGVVKEVNQLANLAQF  372
              EGVV  V+ LA +A+F
Sbjct  483   AEGVVSAVDNLAIIARF  499



>ref|XP_006424110.1| hypothetical protein CICLE_v10030132mg [Citrus clementina]
 gb|ESR37350.1| hypothetical protein CICLE_v10030132mg [Citrus clementina]
Length=475

 Score =   332 bits (851),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 195/432 (45%), Positives = 274/432 (63%), Gaps = 40/432 (9%)
 Frame = -3

Query  1661  IDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytv  1482
             ++K  +LGK +PR++ H +KVGLAL++VS+FYY +PLYD+ G +AMWAVMTVVVVFE++V
Sbjct  35    VNKVIKLGKDDPRRITHSIKVGLALTMVSIFYYYQPLYDNFGVSAMWAVMTVVVVFEFSV  94

Query  1481  gaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSI  1302
             GATL K +NR +AT +AG LG+G H +A+ SG+  +PI+L   VF+ AAA+TF RF P+I
Sbjct  95    GATLGKGLNRGLATLVAGGLGVGAHHLASLSGEIGEPILLGFFVFIQAAASTFIRFFPTI  154

Query  1301  KARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGD  1122
             KAR+DYG  IFILTFSL+SVSG+R D++L+LA +RLST+ +G S CI I++L+CPVWAG 
Sbjct  155   KARYDYGLLIFILTFSLISVSGFRDDEILELAHKRLSTVIIGGSACIIISILICPVWAGQ  214

Query  1121  DLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLG-YKCVLNTKASED  945
             DLH LI  NLEKL   LEG  ++Y        +D ++    EK  +  YK  LN+K+ E+
Sbjct  215   DLHNLIATNLEKLGKFLEGFGNEYF----KTLEDGESSNKDEKSFMQEYKSALNSKSREE  270

Query  944   AMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKP  765
             ++ANFA WEPGHGRF FRHPW++YLKIG   R CAY I+ L+G +N+  Q  +A  I   
Sbjct  271   SLANFARWEPGHGRFQFRHPWQRYLKIGNLTRQCAYRIDALNGYLNTEIQ--AAPEIKSK  328

Query  764   VSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQS  585
             + E C  +    G+ L++                           L LA K        S
Sbjct  329   IQEACTEMSLESGRALKE---------------------------LTLAIKKTSQQPITS  361

Query  584   LTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVK  405
               T ++ A K ++ +L    KS + +D D     L+ +  ++TVASLL+++   TE V +
Sbjct  362   ADTHIKNA-KSAAKNLNTLLKSGIWEDCD-----LLTVVPVATVASLLIDVVNCTEKVAE  415

Query  404   EVNQLANLAQFR  369
                +LA+ A F 
Sbjct  416   SAYELASAANFE  427



>ref|XP_009629476.1| PREDICTED: aluminum-activated malate transporter 2-like [Nicotiana 
tomentosiformis]
Length=476

 Score =   332 bits (851),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 190/449 (42%), Positives = 281/449 (63%), Gaps = 42/449 (9%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             ++GK +PR+VIH +KVGLAL+LVSLFYY +PLY+  G +AMWA+MTVVVVFE++VGATL 
Sbjct  41    KIGKDDPRRVIHSLKVGLALTLVSLFYYFQPLYNSFGVSAMWAIMTVVVVFEFSVGATLG  100

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR +AT LAG+LG+G H++A+ +G+  +PI+L   VFL A  +TF RF P +KAR+D
Sbjct  101   KGLNRGMATLLAGALGVGAHYLASATGKVAEPILLGLFVFLQAFTSTFVRFFPQVKARYD  160

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTF LVS+SG+RVD+++D+A QRLSTI +G S+C+ +++ +CPVWAG+DLH+L
Sbjct  161   YGMLIFILTFCLVSISGFRVDEIVDMAHQRLSTILIGASVCVIVSIFVCPVWAGEDLHKL  220

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFA  927
             +  N+EKL   LEG        +     + +  K ++  L  YK VLN+K +E+ +ANFA
Sbjct  221   VAQNIEKLGKFLEG-----FGEEISKSSEGEESKDAKTSLAEYKSVLNSKNAEEILANFA  275

Query  926   VWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECR  747
              WEPGHG+F +RHPWKQYLKIG+  R CA  ++ L+G INS  ++ + + I   + E   
Sbjct  276   RWEPGHGQFKYRHPWKQYLKIGSLTRQCACKVDALNGYINS--EIKAPKEIKGMIKETTT  333

Query  746   RVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVE  567
             ++    GK L++                           L  + KT+  P S +    V 
Sbjct  334   KMSIESGKALKE---------------------------LARSVKTMTSPLSAN--KHVS  364

Query  566   EAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLA  387
              A K ++ +LK    S  S+D     + L+E+  ++ VAS+L +I    E + + VN+LA
Sbjct  365   NA-KTAAKNLKSLLISGFSED-----INLLEVIPVAAVASILTDIVICVEEIAESVNELA  418

Query  386   NLAQFRGQSDKKMAKQSQSQHKEQNVQTH  300
             +LA F  +  K  + +  +    Q+ + H
Sbjct  419   SLAHFSSKETKVDSTKESNIEATQSRKIH  447



>ref|XP_004251395.2| PREDICTED: aluminum-activated malate transporter 2-like [Solanum 
lycopersicum]
Length=450

 Score =   331 bits (848),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 189/430 (44%), Positives = 277/430 (64%), Gaps = 39/430 (9%)
 Frame = -3

Query  1640  GKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSKC  1461
              K +PR+VIH +KVGL+L+LVSLFYY +PLY+  G + MWA+MTVVVVFE++VGATL K 
Sbjct  45    AKDDPRRVIHSLKVGLSLTLVSLFYYFQPLYNGFGVSTMWAIMTVVVVFEFSVGATLGKG  104

Query  1460  VNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDYG  1281
             +NR +AT LAG+LG+G H++A+ SG+ ++PI+L   VFL A A TF RF P +KAR+DYG
Sbjct  105   LNRGMATLLAGALGVGAHYLASASGKVVEPILLGLFVFLQAFALTFIRFFPQVKARYDYG  164

Query  1280  CTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLIT  1101
               IFILTF LVS+SG+RVD+++D+A +R+STI +G S+CI +++ +CPVWAG+DLH+L+ 
Sbjct  165   MLIFILTFCLVSISGFRVDEIVDMAHKRISTILMGASVCIIVSIFVCPVWAGEDLHKLVA  224

Query  1100  NNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAVW  921
              N+EK+ + LEG   +         +D    K ++  L+ YK VLN+K +E+ +ANFA W
Sbjct  225   KNMEKIGNFLEGFGDEIF----KSSEDITESKVAKPSLIEYKSVLNSKNTEETLANFAKW  280

Query  920   EPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRRV  741
             EPGHG+F +RHPWKQYLKIG  +R CA  I+ L+G INS  ++ + E I + + E   R+
Sbjct  281   EPGHGQFKYRHPWKQYLKIGGLIRQCACRIDALNGYINS--EIKAPEEIKEMIKETSMRM  338

Query  740   CSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEEA  561
                CGK L++LSK              +  MN             +P S+    T  + +
Sbjct  339   SIECGKALKELSKS-------------MRKMN-------------LPISADEHVTNAKNS  372

Query  560   QKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLANL  381
              K  +  LK       S  ++ + + L+++  L+T+AS+L +I    E + + VN+LA+L
Sbjct  373   AKKLNSLLK-------SRINNWEEINLLQVIPLTTIASILRDIVTCVEEIGQGVNELASL  425

Query  380   AQFRGQSDKK  351
             A F+     K
Sbjct  426   ANFKTTKSSK  435



>ref|XP_002438441.1| hypothetical protein SORBIDRAFT_10g019680 [Sorghum bicolor]
 gb|EER89808.1| hypothetical protein SORBIDRAFT_10g019680 [Sorghum bicolor]
Length=673

 Score =   337 bits (865),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 193/436 (44%), Positives = 273/436 (63%), Gaps = 18/436 (4%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             R+      AW++G  +PRKV HG K+ LAL+L S+FYY++PLY   G NAMWAV+TVVVV
Sbjct  78    RVVGVARMAWRIGADDPRKVAHGFKMALALTLCSVFYYVQPLYVFTGQNAMWAVLTVVVV  137

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FEYTVG  L K +NR +AT    +L +GV W+A++ G++L+P IL  S+F+ AAAAT+SR
Sbjct  138   FEYTVGGCLYKGLNRAMATVTGAALALGVQWIASKCGKELEPFILSGSLFVFAAAATYSR  197

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F+P +KARFDYG TIFILT++LV+V GYRV+++  +AQ RL+TIA+G  IC  +   + P
Sbjct  198   FLPKMKARFDYGVTIFILTYTLVAVGGYRVNEVAFMAQHRLTTIAIGAMICFGVCAFVFP  257

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG +LH  + +N++KLA ++E C+ DY +    G D          K  GYK VLN K
Sbjct  258   VWAGQELHDQVAHNMDKLAAAVESCVEDYFSEAAAGADVAAPAL--SDKSHGYKAVLNAK  315

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             ASED++AN A WEP HG+F FRHP+  Y K+GA+MR+CAYC++ L  S+ S AQ  +  +
Sbjct  316   ASEDSLANLATWEPAHGKFRFRHPYHLYQKVGAAMRSCAYCVDALAASVGSEAQTPA--H  373

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
             + K ++     +   C  +LR+ S  + S T+S    ++V DMN+A + L+   + L P 
Sbjct  374   VKKHLAGASAALGRHCSAMLREASGSVASMTRSGRLALVVGDMNAAAQELRDELRCLAPL  433

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
                  +T  E+ Q  ++                     L+E   L T ASLL+EI  R E
Sbjct  434   LELDESTDTEQEQNITTSPAPAPP--------------LIEALPLFTAASLLLEICTRAE  479

Query  416   GVVKEVNQLANLAQFR  369
             GVV  V+ LA  A+F+
Sbjct  480   GVVSAVDNLAITARFK  495



>ref|XP_007015678.1| Aluminum activated malate transporter family protein, putative 
[Theobroma cacao]
 gb|EOY33297.1| Aluminum activated malate transporter family protein, putative 
[Theobroma cacao]
Length=484

 Score =   332 bits (850),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 197/438 (45%), Positives = 276/438 (63%), Gaps = 43/438 (10%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             +I+ F  K  +L + +PR+V+H +KVGLAL+LVSL YY +PLY+  G +A+WAVMTVVVV
Sbjct  31    KIFEFYSKVKKLAQDDPRRVVHSLKVGLALNLVSLLYYYQPLYNGFGVSAIWAVMTVVVV  90

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE++VGATL K +NR +AT   G+L +G + +AN SG+  +PI+L   VFL AA +TF+R
Sbjct  91    FEFSVGATLGKGLNRGLATLSGGALAVGAYHLANLSGRIGEPILLGFFVFLQAAVSTFAR  150

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P IKAR+DYG  IFILTF+ +SVSG+R D++ ++A +RLST+ +G S C+ I++LL P
Sbjct  151   FYPKIKARYDYGLLIFILTFAFISVSGFRDDEIFEMAHKRLSTVLIGGSTCVMISILLFP  210

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNT  960
             VWAG+DLH LI +NLEKL   LEG   +Y    GDG+         +K  L  YK VLN+
Sbjct  211   VWAGEDLHNLIASNLEKLGCFLEGFGDEYFKMPGDGESK------DDKSFLRSYKSVLNS  264

Query  959   KASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAE  780
             K++ED +ANFA WEPGHGRF FRHPWKQYLKI A  R CAY IE+LHG +N+  Q  +  
Sbjct  265   KSNEDTLANFARWEPGHGRFQFRHPWKQYLKIAALTRQCAYRIESLHGHLNADIQ--AKP  322

Query  779   YILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIP  600
              I   +   C ++ S  GK L++                           L  A K ++ 
Sbjct  323   EIRSKIQGTCTKMSSESGKALKE---------------------------LASAIKRMVK  355

Query  599   PSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAART  420
             P S  +     E  K ++ +L    KS   DD+    + L+E+  ++TVASLL+E+ +  
Sbjct  356   PISADIHI---ENSKSAAKNLNSLLKSGPWDDE----MDLLEVVPVATVASLLIEVVSCM  408

Query  419   EGVVKEVNQLANLAQFRG  366
             E + + V++LA++A F G
Sbjct  409   EEIAESVHELASMANFEG  426



>ref|XP_011042190.1| PREDICTED: aluminum-activated malate transporter 2-like, partial 
[Populus euphratica]
 ref|XP_011015564.1| PREDICTED: aluminum-activated malate transporter 2-like, partial 
[Populus euphratica]
Length=449

 Score =   330 bits (846),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 197/462 (43%), Positives = 289/462 (63%), Gaps = 57/462 (12%)
 Frame = -3

Query  1661  IDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytv  1482
             + +  +LG+++PR+V+H +KVGLAL+LVS  +Y  P+Y + G +A+WAVMTVV+VFE++V
Sbjct  2     VKEGRKLGQEDPRRVVHSLKVGLALTLVSTLFYFYPIYINFGFDAIWAVMTVVLVFEFSV  61

Query  1481  gaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSI  1302
             GATL K +NR +AT LAG LGIG H++AN SG   +PI+L   VFL A  +TF RF P I
Sbjct  62    GATLGKGLNRGMATLLAGGLGIGAHYLANLSGHTGEPILLVFLVFLQATISTFLRFFPKI  121

Query  1301  KARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGD  1122
             KAR+DYG  IFI+TFS+++VSG+R D++L+LA +RLST+++G + C+ +++++ PVWAG+
Sbjct  122   KARYDYGMLIFIMTFSMITVSGFREDQILELAHKRLSTVSIGAAACVIVSIVVFPVWAGE  181

Query  1121  DLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNTKASED  945
             DLH LI  N+EKL +SLEG   +Y             +   +KK L GY+ VLN++ SE+
Sbjct  182   DLHNLIVLNIEKLGNSLEGFGDEYF------KRTWGEESKDDKKFLEGYESVLNSENSEE  235

Query  944   AMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSIN----SSAQVGSAEY  777
             ++ANFA WEPGHGRF FRHPWK YLK+G   R CAY IE L+G +N    +S++VGS   
Sbjct  236   SLANFAAWEPGHGRFPFRHPWKLYLKVGTLARECAYRIEALNGCLNADIQASSEVGSI--  293

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
                 + E C  +    GK L++                           L LA K ++PP
Sbjct  294   ----IQEACTNLSIESGKALKE---------------------------LALAIKIMVPP  322

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
             SS    + +E A K ++  +K   KS + +D D     L+++    TVAS+L+++   TE
Sbjct  323   SSAD--SHIENA-KSAAKKIKSLLKSGIWEDID-----LLKVIPGVTVASILIDVVTCTE  374

Query  416   GVVKEVNQLANLAQFRG----QSDKKM-AKQSQSQHKEQNVQ  306
              + + + +LA+ AQF+      S KK+ + Q+QS    Q V 
Sbjct  375   KISESIYELASNAQFKSVEPTLSPKKLHSGQNQSIKSAQLVN  416



>ref|XP_002279322.1| PREDICTED: aluminum-activated malate transporter 2 [Vitis vinifera]
 emb|CBI24426.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   331 bits (849),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 196/454 (43%), Positives = 283/454 (62%), Gaps = 44/454 (10%)
 Frame = -3

Query  1691  GGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvm  1512
             G  V ++     K  +LG+ +PR+VIH +KVGLAL+L+SLFYY R LY   G +AMWAVM
Sbjct  26    GKLVSKVAEVARKIKKLGQDDPRRVIHSLKVGLALTLISLFYYSRALYKGFGDSAMWAVM  85

Query  1511  tvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAA  1332
             TVVVV E++VGATL K +NR +AT LAG+LG+GVH +A+ SG   +P++L   VFL AAA
Sbjct  86    TVVVVLEFSVGATLGKGLNRGLATLLAGALGVGVHHLASLSGGIGEPMLLGFFVFLQAAA  145

Query  1331  ATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIA  1152
             +TF+RF P IKAR+DYGC IFILTF LVSV+GYR  ++L+LA +R+STI +G + C+ I 
Sbjct  146   STFARFFPGIKARYDYGCLIFILTFCLVSVAGYRDREILELAHKRISTILIGGATCVIIT  205

Query  1151  MLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYK  975
             +++CPVWAG+DL  L+  NLEK+ + LEG   +Y          +D +   +K  L GY 
Sbjct  206   IVVCPVWAGEDLQNLVALNLEKIGNYLEGFGGEYF------RTSEDEECKDDKSFLQGYI  259

Query  974   CVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQ  795
              VLN+K SE+++ NFA WEPGHGRF FRHPWKQYLKIG   R CAY IE L+G +NS  Q
Sbjct  260   SVLNSKGSEESLENFARWEPGHGRFRFRHPWKQYLKIGTLTRQCAYRIEALNGYLNSGFQ  319

Query  794   VGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAF  615
               +       +  + + VC+                       ++  +   A+  L LA 
Sbjct  320   APTE------IRSKIKDVCT-----------------------MMSLESGMALNELALAV  350

Query  614   KTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVE  435
             K +  P+S      +E+++  ++  LK   KS + +D D      +E+ +++TVASLL++
Sbjct  351   KKMTRPTSAD--PHIEKSET-AAKTLKTLLKSGIWEDTD-----FLEVIKVATVASLLID  402

Query  434   IAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQ  333
             +   T+ + + V++LA++A F+        ++SQ
Sbjct  403   VTNCTQKIAESVHELASIAHFKSVDPTVSPEKSQ  436



>ref|XP_006339326.1| PREDICTED: aluminum-activated malate transporter 8-like [Solanum 
tuberosum]
Length=478

 Score =   331 bits (848),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 196/460 (43%), Positives = 279/460 (61%), Gaps = 36/460 (8%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             +I   + K  ++GK +PRK+ H  KVGL+L+L+SLFYY RPLYD  G +A+WAV+TVVVV
Sbjct  10    KIVEIMKKTMKIGKDDPRKIWHAFKVGLSLTLISLFYYYRPLYDGFGQSAIWAVLTVVVV  69

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE+T GATLSKC+NR  AT  AG+LG+G  + A+  G++ +PI+L   VF L A  TF+R
Sbjct  70    FEFTAGATLSKCLNRGFATLTAGALGVGAKYFADLFGKEGEPIVLGILVFTLGALGTFTR  129

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P +K R+DYG  IF+LTFS+V+VSGYRVDK+L+LA QRLSTI +G + C+ +++++CP
Sbjct  130   FFPHMKRRYDYGILIFVLTFSMVTVSGYRVDKILELAHQRLSTILIGAATCMIVSLIVCP  189

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLG-YKCVLNT  960
             VWAG+DLH+LI  +LEKLA+ LEG  S+Y        ++ +  KAS +  LG YK VLN+
Sbjct  190   VWAGEDLHKLIYTHLEKLANFLEGFGSEYF----IFSENDEIVKASNEGFLGSYKTVLNS  245

Query  959   KASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAE  780
             KA+E+A+ANFA WEPGHG F  RHPWKQYLKIG   R CA  ++ L G  NS  QV S  
Sbjct  246   KANEEALANFAWWEPGHGSFRLRHPWKQYLKIGVLARECACHLQALSGYFNSKPQVPSE-  304

Query  779   YILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIP  600
                K + E C ++C    KVL++                           L  + KT+  
Sbjct  305   -FQKKIEEACTKMCIESSKVLKE---------------------------LAFSIKTMTQ  336

Query  599   PSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAART  420
             PSS +    +  ++    D   +   +A       + + L+EI    TVAS+L+++    
Sbjct  337   PSSSAAEIHLRHSKAAVDDF--KSILAATETLLLSNKLDLLEIFPAITVASVLIDVINCI  394

Query  419   EGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHKEQNVQTH  300
             + + + V  L+  A F+   +K+ +  S  +   Q+   H
Sbjct  395   DKISESVEDLSVQAHFKKAKNKEFSSSSPEKPPPQHQLLH  434



>gb|KHN33155.1| Aluminum-activated malate transporter 8 [Glycine soja]
Length=486

 Score =   330 bits (847),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 199/455 (44%), Positives = 282/455 (62%), Gaps = 45/455 (10%)
 Frame = -3

Query  1700  DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMW  1521
             D+   F  ++ +      ++GK +PR+VIH +KV +AL+ VSL YY RPLYD  G   MW
Sbjct  24    DLPWNFKSKVINITRSITKIGKDDPRRVIHSLKVAVALTSVSLVYYSRPLYDGFGVAGMW  83

Query  1520  AvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLL  1341
             AV+TVVVVFE++VGATLSK +NR  AT LAG+LG+G   +A   G + +PI+L   VF+L
Sbjct  84    AVLTVVVVFEFSVGATLSKGLNRGFATLLAGALGVGGQHLATAFGGRAEPIVLGILVFIL  143

Query  1340  AAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICI  1161
             AA ATF RF P IK R+DYG  +FILTF LV+VSGYRV++L +LA QRLSTI LG + C+
Sbjct  144   AAGATFFRFFPKIKQRYDYGIVVFILTFCLVAVSGYRVEELFELAHQRLSTILLGAAACM  203

Query  1160  FIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-  984
              I++ +CPVWAG+D H+L+ +N+EKLA+ L+G  ++Y           ++ K  EK +L 
Sbjct  204   VISIFICPVWAGEDFHKLVASNIEKLANYLQGFETEYF-------HCSEDTKKCEKSVLE  256

Query  983   GYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINS  804
             GYK VLN+KASE+++AN A WEPGHGRF  RHPW+QYLKIGA  R CAY IET++  +N 
Sbjct  257   GYKSVLNSKASEESLANLARWEPGHGRFRLRHPWEQYLKIGALTRECAYKIETINNYLNP  316

Query  803   SAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQ  624
               QV S E+  K V E C ++ S   K L+ +S  +K  T  S   + + +  +AVE L+
Sbjct  317   EIQV-SLEFKCK-VQEPCTKMTSESNKALKAISSSIKKMTHPSTAKVHIENSKTAVEDLK  374

Query  623   LAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASL  444
             +A + +                             +L D D      L+ I  ++TVAS+
Sbjct  375   VALEIV-----------------------------SLEDTD------LLSIIPVATVASI  399

Query  443   LVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQ  339
             L EI    E + + V++L++LA F+   +  ++ +
Sbjct  400   LEEITKSVEKIYESVSELSHLAHFKSVVEPNVSPE  434



>ref|XP_004494917.1| PREDICTED: aluminum-activated malate transporter 8-like [Cicer 
arietinum]
Length=480

 Score =   330 bits (846),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 195/426 (46%), Positives = 269/426 (63%), Gaps = 44/426 (10%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             ++G+ +PR+VIH +KVG+AL++VSLFYY RPLY+  G   MWAV+TVVVVFE+TVGATLS
Sbjct  42    KIGQDDPRRVIHSLKVGVALTIVSLFYYSRPLYNGFGVAGMWAVLTVVVVFEFTVGATLS  101

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR  AT LAG+LG+G H +A   G++ + I+L   VF+LAA +TF RF P IKAR+D
Sbjct  102   KSLNRGCATLLAGALGVGGHHLATAVGERGEAIVLGILVFILAAVSTFIRFFPKIKARYD  161

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTF LV+VSGYRV++L DLA QRLSTI +G + C+ I++ +CPVWAG +LH L
Sbjct  162   YGVVIFILTFCLVTVSGYRVEELFDLAHQRLSTIIIGAATCMLISIFVCPVWAGQELHNL  221

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFA  927
             + +N++KLA+ LEG    Y           ++ + S+  L GYK VLN+KASE++MANFA
Sbjct  222   VASNIQKLANYLEGFEGKYF-------HSLEDKEESKSLLEGYKNVLNSKASEESMANFA  274

Query  926   VWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECR  747
              WEPGHG F+ RHPWKQYLKIG   R CAY IETL+  +N   Q  S E+  K + E C 
Sbjct  275   RWEPGHGGFSLRHPWKQYLKIGTLARECAYKIETLNTYLNPKIQ-ASLEFKCK-IQEPCT  332

Query  746   RVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVE  567
             ++ S   K L+                           A+  + K +  PS+  +  +  
Sbjct  333   KMSSESHKALK---------------------------AISTSMKKMTQPSTAKIHIE--  363

Query  566   EAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLA  387
                  +S +  +E K AL      D V L+ I  ++TVA++L EI    E + + V++L+
Sbjct  364   -----NSKYAIEELKVALEVISLED-VELLTIIPVATVAAILEEITISVEKIYESVSELS  417

Query  386   NLAQFR  369
             +LA F+
Sbjct  418   HLAHFK  423



>ref|NP_001237989.1| aluminum-activated malate transporter [Glycine max]
 gb|ACC60273.1| aluminum-activated malate transporter [Glycine max]
Length=486

 Score =   330 bits (847),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 198/454 (44%), Positives = 280/454 (62%), Gaps = 43/454 (9%)
 Frame = -3

Query  1700  DIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMW  1521
             D+   F  ++ +      ++GK +PR+VIH +KV +AL+ VSL YY RPLYD  G   MW
Sbjct  24    DLPWNFKSKVINITRSITKIGKDDPRRVIHSLKVAVALTSVSLVYYSRPLYDGFGVAGMW  83

Query  1520  AvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLL  1341
             AV+TVVVVFE++VGATLSK +NR  AT LAG+LG+G   +A   G + +PI+L   VF+L
Sbjct  84    AVLTVVVVFEFSVGATLSKGLNRGFATLLAGALGVGGQHLATAFGGRAEPIVLGILVFIL  143

Query  1340  AAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICI  1161
             AA ATF RF P IK R+DYG  +FILTF LV+VSGYRV++L +LA QRLSTI LG + C+
Sbjct  144   AAGATFFRFFPKIKQRYDYGIVVFILTFCLVAVSGYRVEELFELAHQRLSTILLGAAACM  203

Query  1160  FIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLG  981
              I++ +CPVWAG+D H+L+ +N+EKLA+ L+G  ++Y          +D  K  +  L G
Sbjct  204   VISIFICPVWAGEDFHKLVASNIEKLANYLQGFETEYF------HCSEDTKKCEKSALEG  257

Query  980   YKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSS  801
             YK VLN+KASE+++AN A WEPGHGRF  RHPW+QYLKIGA  R CAY IET++  +N  
Sbjct  258   YKSVLNSKASEESLANLARWEPGHGRFRLRHPWEQYLKIGALTRECAYKIETINNYLNPG  317

Query  800   AQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQL  621
              QV S E+  K V E C ++ S   K L+ +S  +K  T  S   + + +  +AVE L++
Sbjct  318   IQV-SLEFKCK-VQEPCTKMTSESNKALKAISSSIKKMTHPSTAKVHIENSKTAVEDLKV  375

Query  620   AFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLL  441
             A + +                             +L D D      L+ I  ++TVAS+L
Sbjct  376   ALEIV-----------------------------SLEDTD------LLSIIPVATVASIL  400

Query  440   VEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQ  339
              EI    E + + V++L++LA F+   +  ++ +
Sbjct  401   EEITKSVEKIYESVSELSHLAHFKSVVEPNVSPE  434



>ref|XP_008345100.1| PREDICTED: aluminum-activated malate transporter 8-like [Malus 
domestica]
Length=493

 Score =   330 bits (847),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 200/436 (46%), Positives = 269/436 (62%), Gaps = 38/436 (9%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++   I    +LG+ +PR+V H +KV LAL+LVS+ YY + L+D +G   +WAV+TVVVV
Sbjct  34    KVVKVIKSIIKLGQDDPRRVTHSLKVALALTLVSILYYWQALFDGIGVAGIWAVLTVVVV  93

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE+TVGATLSK +NR  ATFLAG+LG+G + +A+  G K +PI+L   VFLLA A+TFSR
Sbjct  94    FEFTVGATLSKGLNRGFATFLAGALGLGANHIASLFGVKGEPIVLGIFVFLLATASTFSR  153

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P IKAR+DYG  IFILTFS+V+VSGYRV  +L++A +RL TI +G   C+ I+  +CP
Sbjct  154   FFPRIKARYDYGVLIFILTFSMVTVSGYRVQGILEMAHERLLTIGIGGGTCMIISXFVCP  213

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG+DL +LI +N+EKLA+ LE    +Y              K  E  L GYK VLN+K
Sbjct  214   VWAGEDLQKLIASNIEKLANYLEDFGGEYF-PLPKNGKSGMVSKNKESFLQGYKSVLNSK  272

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             +SE+++ NFA WEPGHG F FRHPWKQYLKIGA  R CAY IETL+G INS  QV   E+
Sbjct  273   SSEESLXNFARWEPGHGSFKFRHPWKQYLKIGALARQCAYQIETLNGHINSDVQV-PPEF  331

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
              L+ + + CR +    GK L+                           AL +A KT+  P
Sbjct  332   -LQIIQDSCRTMSIEPGKALK---------------------------ALAIAIKTMKEP  363

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
                    +  E  K + + LK   K+A  +  D     ++ I   +TVAS+LVEI    E
Sbjct  364   KD---ACEHLENSKTAVEDLKIALKAASLETAD-----ILAIVPAATVASILVEIVKGVE  415

Query  416   GVVKEVNQLANLAQFR  369
              + K V++L+ LA F+
Sbjct  416   NISKSVHELSELAHFK  431



>ref|XP_004249775.1| PREDICTED: aluminum-activated malate transporter 8 [Solanum lycopersicum]
Length=478

 Score =   330 bits (846),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 192/446 (43%), Positives = 274/446 (61%), Gaps = 40/446 (9%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             +I   + K  ++GK +PRK+ H  KVGLAL+L+SLFYY RPLYD  G +A+WAV+TVVVV
Sbjct  10    KIVEIVKKTMKIGKDDPRKIWHAFKVGLALTLISLFYYYRPLYDGFGQSAIWAVLTVVVV  69

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE+T GATL KC+NR  AT  AG+LG+G  + A+  G++ +PI+L   VF L A  TF+R
Sbjct  70    FEFTAGATLCKCLNRGFATLTAGALGVGAKYFADLFGKEGEPIVLGILVFTLGALGTFTR  129

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P +K R+DYG  IF+LTFS+V+VSGYRVDK+L+LA QRLSTI +G + C+ +++++CP
Sbjct  130   FFPHMKRRYDYGILIFVLTFSMVTVSGYRVDKILELAHQRLSTILIGAATCMIVSLIVCP  189

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG+DLH+LI  +LEKLA+ LEG  ++Y     + ++D+    ++E  L  YK VLN+K
Sbjct  190   VWAGEDLHKLIYTHLEKLANFLEGFGNEYF---INSENDEIVKPSNEGFLGAYKTVLNSK  246

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             A+E+A+ANFA WEPGHG F  RHPWKQYLKIG   R CA  ++ L G  NS  QV S   
Sbjct  247   ATEEALANFAWWEPGHGSFRLRHPWKQYLKIGVLARECACHLQALSGYFNSKPQVPSE--  304

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
               K + E C ++C    KVL++                           L  + KT+  P
Sbjct  305   FQKEIEEACTKMCIESSKVLKE---------------------------LAFSIKTMTQP  337

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDD---HDLVYLMEIAQLSTVASLLVEIAA  426
             SS +    +  ++    D      KS L+  +     + + L+EI    TVAS+L+++  
Sbjct  338   SSSAAEIHLCHSKTAVDDF-----KSILTTTETLLISNKLDLLEIFPAITVASVLIDVIN  392

Query  425   RTEGVVKEVNQLANLAQFRGQSDKKM  348
               E + + V  L+  A F+   +++ 
Sbjct  393   CVEKMSESVEDLSVQAHFKKAKNEEF  418



>ref|XP_011088959.1| PREDICTED: aluminum-activated malate transporter 2-like [Sesamum 
indicum]
Length=456

 Score =   329 bits (843),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 206/483 (43%), Positives = 288/483 (60%), Gaps = 57/483 (12%)
 Frame = -3

Query  1712  GKVYDIVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGG  1533
             GK+ ++V G           A +LG+++PR+V+H  KVGLA++LVSLFYY    Y+  G 
Sbjct  24    GKIVNVVTGVA-------KDAKKLGEEDPRRVVHSFKVGLAITLVSLFYYFDFFYEGFGV  76

Query  1532  NAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQAS  1353
             NAMWAVMTVVVVFE++VGATL K VNR +AT L G+LG+G H +A+ +G+K++ IIL  S
Sbjct  77    NAMWAVMTVVVVFEFSVGATLGKGVNRAIATLLGGALGVGAHRLASFTGEKIECIILGMS  136

Query  1352  VFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGT  1173
             VFL+AA ATF RF P +KAR+DYG  IFILTFSL+SVSGYR D++LD+A +RLSTI +G 
Sbjct  137   VFLIAAVATFVRFFPKLKARYDYGLLIFILTFSLISVSGYRDDEVLDMAHRRLSTILIGG  196

Query  1172  SICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEK  993
             S  +FI++ +CP+WAG+DLH++   N+EKL   LEG   +Y         + D ++ +  
Sbjct  197   SATVFISIFICPIWAGEDLHKITAANIEKLGTFLEGFGREYF------RVENDKNQENRT  250

Query  992   KLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGS  813
              L  YK VLN+K SED++ NFA WEP HG+F +R PW QYLKIG+  R CAY I+ L+G 
Sbjct  251   SLDEYKSVLNSKGSEDSLVNFAKWEPRHGKFRYRQPWDQYLKIGSLTRECAYKIDALNGY  310

Query  812   INSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVE  633
             + S  Q  +   I   + E C ++ S C   LR+                          
Sbjct  311   LTSDVQ--TPIEIRSKIQESCTKMSSECSVALRE--------------------------  342

Query  632   ALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTV  453
              L +  KT+    S S    +  A K ++  LK   K+ L  D D     L+EI    TV
Sbjct  343   -LAVGIKTM--TCSLSADPHLLNA-KTAAKRLKSSLKTNLWADTD-----LLEIVPAVTV  393

Query  452   ASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHKEQNVQTH**GLHPTLN  273
             ASLL+EI + T  +   V++LA+L++F+   D +M KQ   +   +  +T      P++ 
Sbjct  394   ASLLIEIVSCTVKIADAVHELASLSKFK-IPDPQMIKQISLEKTPKTPRT------PSIE  446

Query  272   ASQ  264
             AS 
Sbjct  447   ASH  449



>gb|ACJ12886.1| ALMT2 [Hordeum vulgare]
Length=369

 Score =   326 bits (835),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 190/406 (47%), Positives = 258/406 (64%), Gaps = 38/406 (9%)
 Frame = -3

Query  1538  GGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQ  1359
             GG+AMWA+MTVVVVFEYTVG  + K  NR  AT  AG++ +GVHW+A  +G +L P I  
Sbjct  1     GGSAMWAIMTVVVVFEYTVGGCVYKGFNRAAATVSAGAIALGVHWIAANAGHELGPFIRS  60

Query  1358  ASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIAL  1179
              SVFLLA+ ATFSRFIP++KARFDYG TIFILT+SLV+VSGYRV+ LL LAQQR+ TI +
Sbjct  61    GSVFLLASMATFSRFIPTVKARFDYGVTIFILTYSLVAVSGYRVESLLALAQQRVCTIGI  120

Query  1178  GTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkAS  999
             G  +C+ + +L+CPVWAG +LH L   N++KLA ++E C+ DY     DG     +  A 
Sbjct  121   GIFMCLCVCVLICPVWAGQELHGLTARNMDKLAGAVEACVEDYFADQADGKQQPPSAAAE  180

Query  998   EKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLH  819
                  GYKCVLN+KASED+ AN A WEPGHGRF FRHP++QY K+GA+MR CAYC+E L 
Sbjct  181   -----GYKCVLNSKASEDSQANLARWEPGHGRFGFRHPYEQYKKVGAAMRHCAYCVEALS  235

Query  818   GSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSA  639
             G + S  Q  + E++ + +++ C  V + C +VL + +  + + T S   D  V DMN+A
Sbjct  236   GCVRSEIQ--APEHVKRHLADGCTTVAARCARVLGEAASSVSAMTTSWSLDFAVADMNTA  293

Query  638   VEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLS  459
             V+ LQ   + L  PS                  L +E+ +            +++  QL 
Sbjct  294   VQELQSDLREL--PSK-----------------LAEESPA-----------LVIDAVQLF  323

Query  458   TVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHK  321
             TV SLL+E++ R EGVV  V+ LA+LA F    D K  + S+++ K
Sbjct  324   TVTSLLIEVSTRVEGVVDAVDTLASLAGFTSADDTK-PEASETETK  368



>ref|XP_008462623.1| PREDICTED: aluminum-activated malate transporter 8 [Cucumis melo]
Length=495

 Score =   330 bits (845),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 203/458 (44%), Positives = 281/458 (61%), Gaps = 41/458 (9%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++ S +++  +LG+ +PR++IH +KVGLAL+ VSL YY RPLYD  G  A+WAV+TVVVV
Sbjct  18    KLISVMERIKKLGRDDPRRIIHSLKVGLALTFVSLLYYWRPLYDGFGIAAIWAVLTVVVV  77

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE+TVGATLSK +NR + T LAG+LG+G    A+  GQ  +PI+L   VFLLAAA+TFSR
Sbjct  78    FEFTVGATLSKGLNRGLGTLLAGALGVGAQHFASLFGQTGEPIVLGIFVFLLAAASTFSR  137

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P IKAR+DYG  IFILTFSLVSVSGYRV+K+L+LA QRLSTI +G + C+FI++ +CP
Sbjct  138   FFPRIKARYDYGVLIFILTFSLVSVSGYRVEKILELAHQRLSTILIGGATCVFISLFICP  197

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKK-----LLGYKC  972
             VWAG+ LH  I +N+EKLA+ LEG   +Y   +   ++    D  S+       L  YK 
Sbjct  198   VWAGETLHNTIASNIEKLANYLEGFGGEYFQYEDGEENIIVEDHHSKSHNKLSCLQAYKS  257

Query  971   VLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQV  792
             VL +++SE+++AN A WEP HG+F+F HPWKQYLKIG+  R CAY IE+L+G +   A +
Sbjct  258   VLTSQSSEESLANLASWEPRHGKFSFGHPWKQYLKIGSLTRQCAYQIESLNGYV-IPADI  316

Query  791   GSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFK  612
               A    + + E C+ + S  GK LR                            L  + K
Sbjct  317   QVAIQFRRRIEESCKAISSESGKALR---------------------------ILASSIK  349

Query  611   TLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEI  432
             T+  PSS S  T +E A K + D LK   KS   +  D     L+ I   +TV  +L++I
Sbjct  350   TMKSPSSSS-KTHIENA-KAAIDDLKHTLKSGYLESSD-----LLGIIPDATVCCILIDI  402

Query  431   AARTEGVVKEVNQLANLAQFRG-QSDKKMAKQSQSQHK  321
                 E + +  ++L   A+F+  ++     K SQ  H+
Sbjct  403   VKSVEKISEATDELGRSARFKSVEATVSPEKTSQLLHR  440



>ref|XP_009804534.1| PREDICTED: aluminum-activated malate transporter 8 [Nicotiana 
sylvestris]
Length=491

 Score =   329 bits (844),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 193/457 (42%), Positives = 274/457 (60%), Gaps = 38/457 (8%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++   I K  ++GK +PRK+ H  KVGLAL+LVSLFYY RPLYD  G +A+WAV+TVVVV
Sbjct  20    KVMEIIKKTMKIGKDDPRKIWHAAKVGLALTLVSLFYYFRPLYDGFGQSAIWAVLTVVVV  79

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE+T GATLSKC+NR  AT LAG+LG+G  + A+  G K +PI+L   VF L A  TF+R
Sbjct  80    FEFTAGATLSKCLNRGFATLLAGALGVGAKYFADLFG-KGEPIVLGFLVFTLGAVGTFTR  138

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P +K ++DYG  IF+LTFSLV+VSGYRVD++L+LA QRL+TI +G + C+ I++++CP
Sbjct  139   FFPHMKRKYDYGILIFVLTFSLVTVSGYRVDEILELAHQRLTTILVGAATCMIISLVVCP  198

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG+DLH+L+  NL+KLA  LEG  S+Y +     ++ +      +  L  YK VLN+K
Sbjct  199   VWAGEDLHKLVCGNLDKLASFLEGFGSEYFSFSEMDEESEKASIKDKGFLQAYKTVLNSK  258

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             A E+++ANFA WEPGHG F  RHPWKQYLKIG   R CA   + L    NS+ Q  +  +
Sbjct  259   AIEESLANFAWWEPGHGSFRLRHPWKQYLKIGVLARECACHFQALTSYFNSNPQAPTEFH  318

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
               K + E C R+     K L++                           L  + KT+  P
Sbjct  319   --KRIEEACTRMSLESSKALKE---------------------------LASSIKTITQP  349

Query  596   SSQSLTTQVEEAQKPSSDH---LKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAA  426
             SS +  T ++ ++    D    L     S LS+  D     L+EI    TVAS+L+++  
Sbjct  350   SSSAAETHLQNSRIAIDDFKAILATTKTSLLSNKLD-----LLEIFPAITVASILIDVIN  404

Query  425   RTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHKEQ  315
               + +   V +L+  A F+   +K+ +   + Q ++Q
Sbjct  405   CVDKISAAVEELSVKAHFKKVKNKESSPSPEKQPQQQ  441



>ref|XP_002314249.1| hypothetical protein POPTR_0009s02310g [Populus trichocarpa]
 gb|EEE88204.1| hypothetical protein POPTR_0009s02310g [Populus trichocarpa]
Length=466

 Score =   328 bits (841),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 197/459 (43%), Positives = 273/459 (59%), Gaps = 56/459 (12%)
 Frame = -3

Query  1655  KAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvga  1476
             K  +LG+ +PR+V H VKVGLA++LVSLFYY  PLYD  G +AMWAVMTVVVVFE++VGA
Sbjct  32    KIKKLGQDDPRRVNHSVKVGLAITLVSLFYYFEPLYDGFGDSAMWAVMTVVVVFEFSVGA  91

Query  1475  TLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKA  1296
             TL + +NR +ATFLAG+LG G H +A  SG+K +P++L   VFLLA   TF RF P +KA
Sbjct  92    TLGRGLNRGLATFLAGALGFGAHRLATLSGEKGEPMLLGLFVFLLATTVTFVRFFPRMKA  151

Query  1295  RFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDL  1116
             R+DYG  IFILTF L+SVSGYR D++LD+A +R+STI +G+   +F+ + +CPVWAGDDL
Sbjct  152   RYDYGLLIFILTFCLISVSGYRDDEMLDMAHKRVSTILIGSLTAVFVCICICPVWAGDDL  211

Query  1115  HRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMA  936
             H L   N+EKL   LE    ++           + +  ++  L GYK VLN+K  E+++ 
Sbjct  212   HNLAATNIEKLGIFLEHFGVEFF------RKPGEGESINKASLQGYKSVLNSKNMEESLV  265

Query  935   NFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSE  756
             NFA WEPGHG+F FRHPWK YLK G+  R CAY +E L+G +NS   + +   I   + +
Sbjct  266   NFARWEPGHGQFKFRHPWKHYLKFGSLTRQCAYRVEALNGYLNS--DIKTPPEIQGMIQD  323

Query  755   ECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTT  576
              C ++ S  GK L++                           L LA K + PPSS     
Sbjct  324   SCTKMSSELGKALKE---------------------------LALAIKRMTPPSS-----  351

Query  575   QVEEAQKPSSDHLKQETKSA-----LSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGV  411
                     +S HL +   +A     L   D    + L+E+    TV SLL E+ + TE +
Sbjct  352   --------ASSHLVKSKNAAKNLKFLLYSDLCSGINLLEVVPAVTVTSLLFEVISCTEKI  403

Query  410   VKEVNQLANLAQFRG--QSDKKMAKQSQSQHKEQNVQTH  300
              + +++LA+LAQF    Q   K+ +Q + Q +  N+  H
Sbjct  404   AEAIHELASLAQFENVEQEKPKLPEQGEMQ-QGANMDVH  441



>ref|XP_004305584.1| PREDICTED: aluminum-activated malate transporter 8-like [Fragaria 
vesca subsp. vesca]
Length=495

 Score =   329 bits (843),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 206/442 (47%), Positives = 269/442 (61%), Gaps = 44/442 (10%)
 Frame = -3

Query  1691  GGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvm  1512
             G F  ++        +LGK +PR+VIH +KV +AL+LVSL YY R LYD +G   MWAV+
Sbjct  31    GNFKNKVTKVAKNTIKLGKDDPRRVIHSLKVAMALTLVSLLYYWRALYDGLGVAGMWAVL  90

Query  1511  tvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAA  1332
             TVVVVFE+TVGATLSK +NR+ AT LAG+LGIG + +A+  G++ +PIIL   VFLLAAA
Sbjct  91    TVVVVFEFTVGATLSKGLNRSFATLLAGALGIGANHLASLFGEQGEPIILGVLVFLLAAA  150

Query  1331  ATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIA  1152
             +TFSRF P IK R+DYG  IFILTFS+V+VSGYRV+ LL +A QRL TI +G   CI ++
Sbjct  151   STFSRFFPRIKERYDYGVLIFILTFSMVTVSGYRVEGLLQMAYQRLITILIGGGTCIILS  210

Query  1151  MLLCPVWAGDDLHRLITNNLEKLADSLEGC-ISDYLnadgdgdddkdndkASEKKLLGYK  975
             + LCPVWAG+DLH LI +N++K+A+ LEG    +Y     DG   K           GYK
Sbjct  211   IFLCPVWAGEDLHSLIASNIDKIANYLEGIGGGEYFQLPKDGKSTKVTQNN------GYK  264

Query  974   CVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQ  795
              VLN+K +E++ ANFA WEPGHGRF FRHPWKQYLK GA +R CAY IETL+  INS  Q
Sbjct  265   SVLNSKNTEESWANFARWEPGHGRFKFRHPWKQYLKTGALVRQCAYQIETLNSHINSDVQ  324

Query  794   VGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAF  615
             V   +  L+ +   C  + +  GK L+                           AL  A 
Sbjct  325   V--PQEFLQIIQASCITMSTESGKALK---------------------------ALGTAI  355

Query  614   KTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVE  435
             KT+  P S     Q  E  K + + L    K+A  +D D     ++ I   +T+AS+LVE
Sbjct  356   KTMKDPKS---ACQHLENSKNAVEELHIALKAASLEDAD-----ILAIIPAATIASILVE  407

Query  434   IAARTEGVVKEVNQLANLAQFR  369
             I    E +   V +L+ LA F+
Sbjct  408   IVTCVEKISMSVYELSQLADFK  429



>ref|XP_002298269.1| hypothetical protein POPTR_0001s22470g [Populus trichocarpa]
 gb|EEE83074.1| hypothetical protein POPTR_0001s22470g [Populus trichocarpa]
Length=476

 Score =   328 bits (840),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 194/440 (44%), Positives = 276/440 (63%), Gaps = 45/440 (10%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             +LG+ +PR+VIH +KVGLAL+LVS+FYY +PLY +    A+WA+MTVVVVFE++VGATL 
Sbjct  41    KLGQDDPRRVIHSLKVGLALTLVSMFYYCQPLYSNFDETAIWAIMTVVVVFEFSVGATLG  100

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR +AT +AG LG G H +AN SG   +PI+L   VFL A  +TF RF+P IK+R+D
Sbjct  101   KGLNRGMATLMAGGLGAGAHHLANLSGHIGEPILLGFFVFLQATISTFLRFLPKIKSRYD  160

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFS++SVSGYR D++L+LA +RLSTI +G + C+ I++++ PVWAG+DLH L
Sbjct  161   YGMLIFILTFSMISVSGYRDDEILELAHRRLSTICIGGATCVIISIVIFPVWAGEDLHNL  220

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNTKASEDAMANF  930
             I  N+EKL + LEG   +Y             +   +KK+L GYK  LN+  SE ++ANF
Sbjct  221   IALNIEKLGNFLEGFGDEYF------KRTGGEECNEDKKILEGYKSFLNSNYSEGSLANF  274

Query  929   AVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEEC  750
             A WEPGHGRF FRHPWK YLK+G   R CAY IE L+G +N+  QV S   +   + E C
Sbjct  275   AAWEPGHGRFPFRHPWKLYLKVGTLARECAYRIEALNGYLNADTQVSSE--VSTIIQEAC  332

Query  749   RRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQV  570
               +    GK L++                           L LA K ++ PSS    + +
Sbjct  333   TTMSLESGKALKE---------------------------LALAIKIMVQPSSAD--SHI  363

Query  569   EEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQL  390
             E A K ++ ++K   KS + +D D     L+++    TV S+LV++   TE +   +++L
Sbjct  364   ENA-KSAAKNIKSLLKSGIWEDID-----LLKVIPGVTVCSILVDVVTCTETIAASIHEL  417

Query  389   ANLAQFRGQSDKKMAKQSQS  330
             A+ AQF+  ++  +++Q QS
Sbjct  418   ASKAQFK-SAESPLSEQIQS  436



>ref|XP_009628093.1| PREDICTED: aluminum-activated malate transporter 8-like [Nicotiana 
tomentosiformis]
Length=492

 Score =   328 bits (841),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 191/458 (42%), Positives = 273/458 (60%), Gaps = 40/458 (9%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++   + K  ++GK +PRK+ H  KVGLAL+LVSLFYY RPLYD  G +A+WAV+TVVVV
Sbjct  20    KVMEIVKKTMKIGKDDPRKIWHAAKVGLALTLVSLFYYFRPLYDGFGQSAIWAVLTVVVV  79

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE+T GATLSKC+NR  AT LAG+LGIG  + A+  G++ +PI+L   +F L A  TF+R
Sbjct  80    FEFTAGATLSKCLNRGFATLLAGALGIGAKYFADLFGKEGEPIVLGFLIFTLGAVGTFTR  139

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P +K ++DYG  IF+LTFSLV+VSGYRVD++L+LA QRL+TI +G + C+ I++++CP
Sbjct  140   FFPHMKRKYDYGILIFVLTFSLVTVSGYRVDEILELAHQRLTTILVGAATCMIISLVVCP  199

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNT  960
             VWAG+DLH+L+  NL+KLA  LEG  S+Y        ++       +K  L  YK VLN+
Sbjct  200   VWAGEDLHKLVCGNLDKLATFLEGFGSEYF--SFSEIEESGKASKEDKGFLQAYKIVLNS  257

Query  959   KASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAE  780
             KA+E+ +ANFA WEPGHG F  RHPWKQYLKIG   R CA  ++ L    NS+ Q  +  
Sbjct  258   KATEETLANFAWWEPGHGSFRLRHPWKQYLKIGVLARECACHLQALTSYFNSNPQAPTEF  317

Query  779   YILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIP  600
             +  K + E C R+     K L+                            L  + KT+  
Sbjct  318   H--KRIEEACTRMSMESSKALKQ---------------------------LASSIKTMTQ  348

Query  599   PSSQSLTTQVEEAQKPSSDH---LKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIA  429
             P S +  T ++ ++    D    L       LS+  D     L+EI    TVAS+L+++ 
Sbjct  349   PPSSAAETHLKNSKTAIDDFKAILATTKTPLLSNKLD-----LLEIFPAITVASILIDVI  403

Query  428   ARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHKEQ  315
                E + + V +L+  A F+   +K+ +   + Q ++Q
Sbjct  404   NCVERISEAVEELSVKAHFKKVKNKESSPSPEKQPQQQ  441



>ref|XP_006648930.1| PREDICTED: aluminum-activated malate transporter 10-like [Oryza 
brachyantha]
Length=649

 Score =   333 bits (853),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 196/450 (44%), Positives = 275/450 (61%), Gaps = 36/450 (8%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++  F  + W++G  +PRK  +GVKV  AL+LVSL YY+RPLYD VGG A+WA+MTVV+V
Sbjct  219   KVSGFAKQVWKIGADDPRKPAYGVKVATALTLVSLLYYVRPLYDGVGGTAVWAIMTVVLV  278

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FEYTVG  + K +NR   T     L +G HW+A++SG++L+P +   SV +LAAAATFSR
Sbjct  279   FEYTVGGVMYKVLNRLAGTTSGAVLALGTHWIASKSGERLEPFVTGGSVIMLAAAATFSR  338

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             FIP++KARFDYG T+F++T+S V+VSGYRV  L  L   R+ TIA+G  IC+ +  L+CP
Sbjct  339   FIPTVKARFDYGVTVFVMTYSFVAVSGYRVGDLAALVLDRIVTIAIGIIICLAVCGLICP  398

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG +LH L   N+EKLA S+E C+ D          +      SE    GYK VL  K
Sbjct  399   VWAGQELHLLTARNMEKLASSVEACVEDCFADPAAKRAEAAAAAKSE----GYKSVLGAK  454

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             ASED+ AN A WEP HGRF FRHP+ QY ++GA+MR CAYC+  L G   +S++   A  
Sbjct  455   ASEDSQANLARWEPPHGRFGFRHPYHQYTEVGAAMRQCAYCVGALGGCAGASSRRERAPV  514

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
             +   +++ C +V + C +VL++ S  + + T S      V  +N+AV+ LQ   + L  P
Sbjct  515   L---IADACAKVGARCARVLKEASTCVATMTTSRRLAFAVASLNTAVQELQSDLRAL--P  569

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
             SS +                ++  +++L++D            QL TVA LL+EIAAR E
Sbjct  570   SSPA----------------EETAETSLAED-----------MQLFTVALLLIEIAARIE  602

Query  416   GVVKEVNQLANLAQFRGQSDKKMAKQSQSQ  327
              VV  V  LA LA+F+   D   A + +++
Sbjct  603   PVVHAVGTLATLARFKPADDVDGADKLEAE  632



>ref|XP_009760052.1| PREDICTED: aluminum-activated malate transporter 2-like [Nicotiana 
sylvestris]
Length=476

 Score =   327 bits (838),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 188/449 (42%), Positives = 279/449 (62%), Gaps = 42/449 (9%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             ++GK +PR+VIH +KVGLAL+LVSLFYY +PLY+  G +AMWA+MTVVVVFE++VGATL 
Sbjct  41    KIGKDDPRRVIHSLKVGLALTLVSLFYYFQPLYNSFGVSAMWAIMTVVVVFEFSVGATLG  100

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR +AT LAG+LG+G H++A+ +G+  +PI+L   VFL A  +TF RF P +KAR+D
Sbjct  101   KGLNRGMATLLAGALGVGAHYLASATGKVAEPILLALFVFLQAFTSTFIRFFPQVKARYD  160

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTF LVS+SG+RV +++D+A +RLSTI +G S+C+ +++ +CPVWAG+DLH+L
Sbjct  161   YGMLIFILTFCLVSISGFRVGEIVDMAHKRLSTILIGASVCVIVSIFVCPVWAGEDLHKL  220

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFA  927
             +  N+EKL   LEG        +     +    K ++  L+ YK VLN+K +E+ +ANFA
Sbjct  221   VAQNMEKLGKFLEG-----FGEEISKSSEGVESKDAKTTLIEYKSVLNSKNAEEILANFA  275

Query  926   VWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECR  747
              WEPGHG+F +RHPWKQYLKIG+  R CA  ++ L+G INS  ++ + E I   + E   
Sbjct  276   RWEPGHGQFKYRHPWKQYLKIGSLTRQCACRVDALNGYINS--EIKAPEEIKNIIKETTT  333

Query  746   RVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVE  567
             ++    GK L++                           L  + KT+  P S +    V 
Sbjct  334   KMSIESGKALKE---------------------------LARSIKTMTCPLSAN--KHVS  364

Query  566   EAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLA  387
              A K ++ +LK    S   +D     + L+E+  ++ VAS+L +I    E + + VN+LA
Sbjct  365   NA-KTAAKNLKSLLISGFWED-----INLLEVIPVAAVASILTDIVICVEEIAESVNELA  418

Query  386   NLAQFRGQSDKKMAKQSQSQHKEQNVQTH  300
             +LA F  +  K  + +  +    Q+ + H
Sbjct  419   SLAHFSSKETKVDSSKESNIEATQSRKIH  447



>ref|XP_003553620.1| PREDICTED: aluminum-activated malate transporter 8-like [Glycine 
max]
 gb|KHN08603.1| Aluminum-activated malate transporter 8 [Glycine soja]
Length=483

 Score =   327 bits (839),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 197/451 (44%), Positives = 278/451 (62%), Gaps = 45/451 (10%)
 Frame = -3

Query  1688  GFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmt  1509
              F  ++ +F     ++GK +PR+VIH +KV +AL+ VSL YY RPLYD  G   MWAV+T
Sbjct  28    NFKTKVINFARSITKIGKDDPRRVIHSLKVAIALTFVSLVYYSRPLYDGFGVAGMWAVLT  87

Query  1508  vvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAA  1329
             VVVVFE++VGATLSK +NR  AT LAG+LG+G   +A   G++ +PI+L   VF LAA A
Sbjct  88    VVVVFEFSVGATLSKGLNRGFATLLAGALGVGGQHLATAFGERAEPIVLGILVFSLAAGA  147

Query  1328  TFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAM  1149
             TF RF P IK R+DYG  +FILTF LV+VSGYRV++L +LA QRLSTI +G + C+ I++
Sbjct  148   TFFRFFPKIKQRYDYGIVVFILTFCLVAVSGYRVEELFELAHQRLSTILIGAAACMVISI  207

Query  1148  LLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKC  972
              +CPVWAG+DLH L+ +N+EKLA+ LE   ++Y           ++ K  EK +L GYK 
Sbjct  208   FICPVWAGEDLHMLVASNIEKLANYLEVFETEYF-------HCSEDTKKCEKSVLEGYKS  260

Query  971   VLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQV  792
             VLN+KASE+++AN A WEPGHGRF  RHPWKQYLKIGA  R CAY IETL+  +N   QV
Sbjct  261   VLNSKASEESLANLARWEPGHGRFPLRHPWKQYLKIGALTRECAYKIETLNNYLNPEIQV  320

Query  791   GSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFK  612
              S E+  K V   C ++ S   K L+ +S  +K  T  S   + + +  +A+E L++A +
Sbjct  321   -SLEFKCK-VQAPCTKMTSESNKALKAISSSIKKMTHPSAAKVHIENSKTAIENLKVALE  378

Query  611   TLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEI  432
              +                             +L + D      L+ I  ++TVAS+L EI
Sbjct  379   IV-----------------------------SLKNTD------LLTIIPVATVASILEEI  403

Query  431   AARTEGVVKEVNQLANLAQFRGQSDKKMAKQ  339
                 E + + V++ ++LA F+   +  ++ +
Sbjct  404   TKSVEKIYESVSEFSHLAHFKSVVEPNVSPE  434



>ref|XP_006481861.1| PREDICTED: aluminum-activated malate transporter 8-like [Citrus 
sinensis]
Length=492

 Score =   327 bits (839),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 200/441 (45%), Positives = 268/441 (61%), Gaps = 39/441 (9%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             +LG+ +PR+V H +KVGLAL+LVSL YY RPLYD  G + MWAV+TVVVVFE+TVGATLS
Sbjct  42    KLGQDDPRRVTHSLKVGLALTLVSLLYYARPLYDSFGVSGMWAVLTVVVVFEFTVGATLS  101

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR  AT +AG+LG+G    A   G K +PI+L   VF+LAAA+TF+RF P +KAR+D
Sbjct  102   KGLNRGFATLIAGALGVGAQHTAILCGDKGEPIVLGILVFILAAASTFTRFFPRMKARYD  161

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFS+V+VSGYRVD+LL LA QRLSTI +G + C  I++ +CPVWAG+DLH+L
Sbjct  162   YGILIFILTFSMVAVSGYRVDELLVLAHQRLSTILVGGAACTVISIFVCPVWAGEDLHKL  221

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFA  927
             I +NLE LA  LEG   +Y       ++  D  K  +  L  YK VLN+K  ED +ANFA
Sbjct  222   IASNLENLACYLEGFGDEYF-QVNKSEEVGDVTKKDKSFLQKYKSVLNSKTQEDNLANFA  280

Query  926   VWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECR  747
              WEPGHG+F  RHPW+QYLKIGA  R CAY IE L+G I+S  QV   + I   + E C 
Sbjct  281   RWEPGHGKFRLRHPWQQYLKIGAFARQCAYQIEALNGCIDSRIQV--PQEIQSKIQESCE  338

Query  746   RVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVE  567
              + S   K L+                           AL  + K +  PS  +  + +E
Sbjct  339   NISSESSKALK---------------------------ALASSIKKMTDPSPAN--SHIE  369

Query  566   EAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLA  387
              ++K   D      +++L+  D         I   +TVAS L+EI    E +   V  L+
Sbjct  370   ASKKAVKDLENALKEASLNTLD------FQAIVPAATVASTLIEIVKCIEKISGSVTDLS  423

Query  386   NLAQFRGQSDKKMAKQSQSQH  324
             NLA F+ + +  ++ + ++ H
Sbjct  424   NLAHFK-EVEPNVSPEGKASH  443



>ref|XP_007015679.1| Aluminum activated malate transporter family protein [Theobroma 
cacao]
 gb|EOY33298.1| Aluminum activated malate transporter family protein [Theobroma 
cacao]
Length=462

 Score =   326 bits (835),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 195/462 (42%), Positives = 278/462 (60%), Gaps = 58/462 (13%)
 Frame = -3

Query  1664  FIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeyt  1485
             F  K  +LG+ +PR+++H  KVGLA++LVSLFYY  PLY   G +A+WAV+TVVVVFE++
Sbjct  38    FPGKIKKLGQGDPRRIVHSFKVGLAITLVSLFYYFDPLYVGFGSSAIWAVLTVVVVFEFS  97

Query  1484  vgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPS  1305
             VGATL K +NR +ATFLAG+LG G H +A   G+K+QPI+L   VF LA   +F RF P 
Sbjct  98    VGATLGKGLNRGLATFLAGTLGFGAHHLATLPGEKVQPILLGLFVFFLATTVSFIRFFPR  157

Query  1304  IKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGT----SICIFIAMLLCP  1137
             +KAR+DYG  IFILTF L+SVSGYR +++L++A +R+STI +G     S+CIFI    CP
Sbjct  158   MKARYDYGLVIFILTFCLISVSGYRDEEVLEMAHKRVSTILIGGFTALSVCIFI----CP  213

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG+DLH L  NN+EKLA+ LEG   +Y    GD +        ++  L GYK +LN+K
Sbjct  214   VWAGEDLHNLAANNIEKLANFLEGFGDEYFKKSGDRES-------NKASLQGYKSILNSK  266

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
              +E+++ANFA WEP HG+F FRHPWKQYLKIG+  R CAY +E L+G +NS  Q  +   
Sbjct  267   QTEESLANFARWEPRHGQFKFRHPWKQYLKIGSLTRQCAYRVEALNGYLNSDVQ--APPE  324

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
             I   + E C ++ S  GK L++                           +  A + + PP
Sbjct  325   IHGKIQEACIKMSSESGKALQE---------------------------IASAIRKMTPP  357

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
             SS     +     K +++ LK   K+    D D     L+E   ++T+ASLL+++ +  E
Sbjct  358   SSDCPYIR---KSKNTANSLKSLLKTGWCKDID-----LLETVAVATIASLLLDVLSSIE  409

Query  416   GVVKEVNQLANLAQFR------GQSDKKMAKQSQSQHKEQNV  309
              + + +++LA+LA F            ++ +Q Q Q    +V
Sbjct  410   KISESIHELASLAHFNSVEPDVANGKPRLNQQGQVQSSSNSV  451



>ref|XP_011042595.1| PREDICTED: aluminum-activated malate transporter 8-like [Populus 
euphratica]
Length=487

 Score =   325 bits (834),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 202/443 (46%), Positives = 276/443 (62%), Gaps = 40/443 (9%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             +LG+ +PR+VIH +KVGLAL+ VS FYY RPLYD  G + MWAV+TV V+FE+TVG TLS
Sbjct  42    KLGEDDPRRVIHSLKVGLALTFVSSFYYSRPLYDGFGVSGMWAVLTVAVIFEFTVGGTLS  101

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K + R +AT LA +LG G   +A+  G+K QP +L+  VF+LAAA+TF+RF P IKAR+D
Sbjct  102   KGLFRGLATLLACALGFGASNLASLFGRKGQPFVLRILVFVLAAASTFTRFFPRIKARYD  161

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFIL FSLVSVSGYRV+KLL L  QRLST+ +G + CI ++ +  PVWAG+DLH+L
Sbjct  162   YGFVIFILAFSLVSVSGYRVEKLLVLTHQRLSTVLIGGATCILLSFIF-PVWAGEDLHKL  220

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNTKASEDAMANF  930
             + +N+EKLA  LEG   ++       D        S+K  L GYK VLN+K++E+++AN 
Sbjct  221   VASNVEKLAKYLEGFEGEFF--QPLEDGRNVKVSNSDKSFLQGYKKVLNSKSTEESVANL  278

Query  929   AVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEEC  750
             A WEPGHGRF FRHPWKQYLKIGA  R CAY IE L   INS  Q         P++  C
Sbjct  279   ARWEPGHGRFGFRHPWKQYLKIGALSRQCAYQIEALDAYINSHNQA--------PLNFRC  330

Query  749   RRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQV  570
              ++   C ++                      + + A+E+L  A KT+  PSS ++   V
Sbjct  331   -KIQGPCTRMFI--------------------ECSMALESLASAIKTMTLPSSANV--HV  367

Query  569   EEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQL  390
             E ++    D LK   K+ +S D D D   L+ I   +TVAS+++EI    E + + V++L
Sbjct  368   ENSKTAIKD-LKIAIKT-VSLDQDQD---LLAIVPAATVASIIIEIVKCVENLSESVHEL  422

Query  389   ANLAQFRGQSDKKMAKQSQSQHK  321
             +NLA F+        ++ Q  H+
Sbjct  423   SNLAHFKSVESTVSLEKPQFLHR  445



>ref|XP_006430062.1| hypothetical protein CICLE_v10013861mg [Citrus clementina]
 gb|ESR43302.1| hypothetical protein CICLE_v10013861mg [Citrus clementina]
Length=492

 Score =   326 bits (835),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 200/441 (45%), Positives = 268/441 (61%), Gaps = 39/441 (9%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             +LG+ +PR+V H +KVGLAL+LVSL YY RPLYD  G + MWAV+TVVVVFE+TVGATLS
Sbjct  42    KLGQDDPRRVTHSLKVGLALTLVSLLYYARPLYDSFGVSGMWAVLTVVVVFEFTVGATLS  101

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR  AT +AG+LG+G    A   G K +PI+L   VF+LAAA+TF+RF P +KAR+D
Sbjct  102   KGLNRGFATLIAGALGVGAQHTAILCGDKGEPIVLGILVFILAAASTFTRFFPRMKARYD  161

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFS+V+VSGYRVD+LL LA QRLSTI +G + C  I++ +CPVWAG+DLH+L
Sbjct  162   YGILIFILTFSMVAVSGYRVDELLVLAHQRLSTILVGGAACTVISIFVCPVWAGEDLHKL  221

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFA  927
             I +NLE LA  LEG   +Y       ++  D  K  +  L  YK VLN+K  ED +ANFA
Sbjct  222   IASNLENLACYLEGFGDEYF-QVNKSEEGGDVTKKDKSFLQKYKSVLNSKTQEDNLANFA  280

Query  926   VWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECR  747
              WEPGHG+F  RHPW+QYLKIGA    CAY IE L+G I+S  QV   + I   + E C 
Sbjct  281   RWEPGHGKFRLRHPWQQYLKIGAFAHQCAYQIEALNGCIDSRIQV--PQEIQSKIQESCE  338

Query  746   RVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVE  567
              + S   K L+                           AL  + K +  PS  +  + +E
Sbjct  339   NISSESSKALK---------------------------ALASSIKKMTDPSPAN--SHIE  369

Query  566   EAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLA  387
              ++K   D      +++L+  D      L  I   +TVAS L+EI    E +   V  L+
Sbjct  370   ASKKAVKDLENALKEASLNTLD------LQAIVPAATVASTLMEIVKCIEKISGSVTDLS  423

Query  386   NLAQFRGQSDKKMAKQSQSQH  324
             NLA F+ + +  ++ + ++ H
Sbjct  424   NLAHFK-EVEPNVSPEGKASH  443



>gb|KHN19922.1| Aluminum-activated malate transporter 2 [Glycine soja]
Length=483

 Score =   325 bits (833),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 208/457 (46%), Positives = 283/457 (62%), Gaps = 42/457 (9%)
 Frame = -3

Query  1697  IVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWA  1518
             +V G VL I        ++ + +PRKVIH +KVGLA+SLVSLFYY +PLY++ G +AMWA
Sbjct  23    VVKGKVLSICRLTK---EIAQDDPRKVIHSLKVGLAISLVSLFYYYQPLYENFGLSAMWA  79

Query  1517  vmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLA  1338
             VMTVVVVFEYTVGATL K +NRT+AT  AG+LG+G H++A+ SG   +PI++ A VF+ A
Sbjct  80    VMTVVVVFEYTVGATLGKGLNRTIATLAAGALGVGAHYLASLSGATGEPILIGAFVFVQA  139

Query  1337  AAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIF  1158
             A A+F RF P +KAR+DYG  IFILTFSL+SVSG+R  ++L++A +RLSTI +G S C+ 
Sbjct  140   AIASFIRFFPKVKARYDYGMLIFILTFSLISVSGFREVEVLEMAHKRLSTIFIGGSACVM  199

Query  1157  IAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-G  981
             I++ +CPVWAG++ H  I + LE L D LE  +  Y     +G+ + +   + +K  L G
Sbjct  200   ISIFVCPVWAGEEFHYSIAHKLEILGDFLEAFVRVYFKISKEGESEDNKGDSKDKSFLEG  259

Query  980   YKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSS  801
             YK VLN+K+ +D++ANFA WEPGHG+F FRHPW  YLK+GA  R CAY +E L  +INS 
Sbjct  260   YKKVLNSKSVDDSLANFAKWEPGHGKFRFRHPWDLYLKVGALSRQCAYRMEALDANINSD  319

Query  800   AQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQL  621
              Q GS E I   + E+C  +C    K  ++L   +++ T SS  D  V +  +AV++L  
Sbjct  320   IQ-GSQE-IRITIQEQCSEMCLEASKAFKELGSSIRTMTMSSSSDTHVANAKAAVKSL--  375

Query  620   AFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLL  441
               KTL+  SS   T                            DL+ L+  A   TVASLL
Sbjct  376   --KTLLQSSSWKET----------------------------DLLSLIPAA---TVASLL  402

Query  440   VEIAARTEGVVKEVNQLANLAQFR-GQSDKKMAKQSQ  333
             ++I   TE +   VN LA L  F    +DK   K  Q
Sbjct  403   IDIIEFTEKIADSVNNLATLTHFEVVDTDKSTTKAQQ  439



>ref|XP_010521628.1| PREDICTED: aluminum-activated malate transporter 2 [Tarenaya 
hassleriana]
Length=499

 Score =   325 bits (834),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 189/447 (42%), Positives = 276/447 (62%), Gaps = 39/447 (9%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++   + +  ++G+++PR+V+H  KVGLAL+LVS FYY +PLYD+ G NAMWAVMTVVVV
Sbjct  7     KVMEIVRETKRVGREDPRRVVHSFKVGLALALVSSFYYYQPLYDNFGVNAMWAVMTVVVV  66

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE++VGATL K +NR VAT LAGSLG+G H +A+ SG  L+PI+L   VFL A+ +TF R
Sbjct  67    FEFSVGATLGKGLNRGVATLLAGSLGVGAHHLASMSGPTLEPILLAIFVFLQASISTFIR  126

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P +KAR+DYG  IFILTF+L+SVSG+R D++LDLA +RLST+ +G + C+ +++ +CP
Sbjct  127   FFPKVKARYDYGLLIFILTFALISVSGFREDEILDLAHKRLSTVFMGGAACVLVSIFVCP  186

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG DLH LI NNL KL + LE    +Y      GD    + K     L GYK VLN+K
Sbjct  187   VWAGQDLHDLIANNLAKLGNFLEEFGDEYFQGAESGDTKDVDMKRG--NLEGYKSVLNSK  244

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             ++E+ + NFA WEP HGRF FRHPWKQYL +GA +R C+Y I+ L+  + +  QV     
Sbjct  245   SNEECLTNFARWEPHHGRFRFRHPWKQYLVLGAQIRHCSYRIDALNSYLKADVQVSMD--  302

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
             + K + E  RR+    G+ +++                           L LA K +   
Sbjct  303   VKKRLEEPLRRMSYESGEAMKE---------------------------LSLAIKKMTKA  335

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
             SS  L  Q   ++  S  +L    +S    +     +  +++ ++ T+ASLL++I   TE
Sbjct  336   SSSDLHIQKANSEAKSLTNL---LESVFVKE-----IEPVDVTRVVTIASLLIDIVNLTE  387

Query  416   GVVKEVNQLANLAQFRGQSDKKMAKQS  336
              + + V++LA+ A+F+      ++ +S
Sbjct  388   KISESVHKLASDARFKNNIKPTVSPES  414



>ref|XP_011003849.1| PREDICTED: aluminum-activated malate transporter 2-like [Populus 
euphratica]
Length=472

 Score =   324 bits (831),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 194/454 (43%), Positives = 269/454 (59%), Gaps = 46/454 (10%)
 Frame = -3

Query  1655  KAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvga  1476
             K  +LG+ +PR+V H VKVGLA++LVSLFYY  PLYD  G +AMWAV+TVVVVFE++VGA
Sbjct  38    KIKKLGQDDPRRVNHAVKVGLAITLVSLFYYSEPLYDGFGDSAMWAVLTVVVVFEFSVGA  97

Query  1475  TLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKA  1296
             TL + +NR + TFLAG+LG G H +A  SG+K +PI+L   VFLLA   TF RF P +KA
Sbjct  98    TLGRGLNRGLETFLAGTLGFGAHHLAILSGEKGEPILLGLFVFLLATTVTFVRFFPRMKA  157

Query  1295  RFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDL  1116
             R+DYG  IFILTF L+SVSGYR D++LD+A +R+STI +G    +F+ + +CPVWAGDDL
Sbjct  158   RYDYGLLIFILTFCLISVSGYRDDEVLDMAHKRVSTILIGGLTAVFVCICICPVWAGDDL  217

Query  1115  HRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMA  936
             H L   N+EKL   LE    ++           + +   +  L GYK VLN+K  E+++ 
Sbjct  218   HNLAATNIEKLGIFLEHFGVEFF------RQPGEGESIHKASLQGYKSVLNSKNMEESLV  271

Query  935   NFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSE  756
             NFA WEPGHG+F FRHPWK YLK G+  R CAY +E L+G +NS   + +   I   + +
Sbjct  272   NFARWEPGHGQFKFRHPWKHYLKFGSLTRQCAYRVEALNGYLNS--DIKTPPEIQGMIQD  329

Query  755   ECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTT  576
              C ++ S  GK L++                           L LA K++ PPSS S   
Sbjct  330   SCTKMSSELGKALKE---------------------------LALAIKSMTPPSSAS---  359

Query  575   QVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVN  396
                 +    S    +  K  LS D     + L+E+    TV SLL E+ +  E + + ++
Sbjct  360   ----SHLVKSKFFAKNLKFLLSSDLCRG-INLLEVVPAVTVTSLLFEVISYAEKIAEAIH  414

Query  395   QLANLAQFRG--QSDKKMAKQSQSQHKEQNVQTH  300
             +LA+LAQ+    Q   K+ +Q +  H+  N+  H
Sbjct  415   ELASLAQYENVEQEKPKLPEQGE-MHQGANMDVH  447



>ref|XP_004980109.1| PREDICTED: aluminum-activated malate transporter 10-like [Setaria 
italica]
Length=427

 Score =   322 bits (824),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 200/427 (47%), Positives = 268/427 (63%), Gaps = 53/427 (12%)
 Frame = -3

Query  1649  WQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTL  1470
             W +G  +PRK +H +KVGL+L+LVS+FYY R LYD VG   M ++MTVV VFEYTVG ++
Sbjct  50    WIIGVDDPRKAVHVLKVGLSLALVSIFYYTRLLYDGVGEAPMSSIMTVVAVFEYTVGGSV  109

Query  1469  SKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARF  1290
              K  NR VAT  AG L +GVHWVA+++G+  +P IL  S+FLLAAAATFSRFIP+++ARF
Sbjct  110   YKSFNRAVATASAGVLALGVHWVADKTGE-FEPYILTGSLFLLAAAATFSRFIPTVEARF  168

Query  1289  DYGC-TIFILTFS-LVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDL  1116
             DYG  TIFI+T+S LV+VSGYR D+L  L +QR+ST+A+G  +C+ +A+ +CPVWAG +L
Sbjct  169   DYGVVTIFIMTYSQLVAVSGYRDDELQALVKQRISTVAIGILMCLVVAVFVCPVWAGQEL  228

Query  1115  HRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMA  936
             H L T N+EKLA +LEGC+ DY                 + +  GY+CV + K+SED  A
Sbjct  229   HLLTTRNMEKLAAALEGCVEDYFAEGPAAQ--------PQARSEGYRCV-DCKSSEDEQA  279

Query  935   NFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSE  756
             N   WEP HGRF FRHP++QY K+G +MRACA C+E L  S  +SA+  ++E++ + V +
Sbjct  280   NLVRWEPAHGRFGFRHPYEQYGKVGDAMRACACCVEAL--SSCASAEARASEHVKRLVRD  337

Query  755   ECRRVCSTCGKVLRDlsklmksttksS-IQDILVHDMNSAVEALQLAFKTLIPPSSQSLT  579
              C R  + C  VLR+ S+ + + T SS    + V DMN+AV  LQ   ++L         
Sbjct  338   ACTRAGARCAHVLREASRSVATMTTSSRALSLAVADMNTAVHELQGDMRSL---------  388

Query  578   TQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEV  399
                     PS           L DD             + TV  LLVEIA R +GVV  V
Sbjct  389   --------PS-----------LVDD----------TMPVFTVGFLLVEIAVRVQGVVDAV  419

Query  398   NQLANLA  378
             N+LA LA
Sbjct  420   NELATLA  426



>ref|XP_004143397.1| PREDICTED: aluminum-activated malate transporter 8-like [Cucumis 
sativus]
 gb|KGN48330.1| hypothetical protein Csa_6G476700 [Cucumis sativus]
Length=496

 Score =   324 bits (830),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 199/457 (44%), Positives = 278/457 (61%), Gaps = 40/457 (9%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++ S + +  +LG+ +PR++IH +KVGLAL+ VSL YY RPLYD  G  ++WAV+TVVVV
Sbjct  18    KLISVVGRIKKLGRDDPRRIIHSLKVGLALTFVSLLYYWRPLYDGFGIASIWAVLTVVVV  77

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE+TVGATLSK +NR + T LAG+LG+G    A+  GQ  +PI+L   VFLLAAA+TFSR
Sbjct  78    FEFTVGATLSKGLNRGLGTLLAGALGVGAQHFASLFGQTGEPIVLGIFVFLLAAASTFSR  137

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P IKAR+DYG  IFILTFSLVSVSGYRV+K+L+LA QRLSTI +G + C+FI++ +CP
Sbjct  138   FFPRIKARYDYGVLIFILTFSLVSVSGYRVEKILELAHQRLSTILIGGATCVFISLFICP  197

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKK----LLGYKCV  969
             VWAG+ LH  I +N+EKLA+ LEG   +Y   + + +     D +        L  YK V
Sbjct  198   VWAGETLHNTIASNIEKLANYLEGFGGEYFQYEDNEESIIVEDHSKLHNKLSSLQAYKSV  257

Query  968   LNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVG  789
             L +++SE+++AN A WEP HG+F+F HPWKQYLKIG+  R CAY IE+L+G +   A + 
Sbjct  258   LTSQSSEESLANLASWEPKHGKFSFGHPWKQYLKIGSLTRQCAYQIESLNGYV-IPADIQ  316

Query  788   SAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKT  609
              A    + + E C+ + +  GK LR                            L  + K 
Sbjct  317   VAIQFRRRIEESCKAISTESGKALR---------------------------ILASSIKA  349

Query  608   LIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIA  429
             +  PSS S  T +E A K + D LK   KS   +  D     L+ I   +TV  +L++I 
Sbjct  350   MTNPSSSS-KTHIENA-KAAIDDLKHTLKSGYLESSD-----LLGIIPDATVCCILIDIV  402

Query  428   ARTEGVVKEVNQLANLAQFRG-QSDKKMAKQSQSQHK  321
                E + +  ++L   A+F+  ++     K SQ  H+
Sbjct  403   KSVEKISEATDELGRSARFKSVEATVSPEKSSQLLHR  439



>ref|XP_011077806.1| PREDICTED: aluminum-activated malate transporter 8-like [Sesamum 
indicum]
Length=500

 Score =   324 bits (830),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 198/451 (44%), Positives = 277/451 (61%), Gaps = 44/451 (10%)
 Frame = -3

Query  1661  IDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytv  1482
             + K  ++G+ +PR+++H +KVGLAL+LVSLFYY RPLYD  G   MWAV+TVVVVFE+TV
Sbjct  38    VKKTKKIGEDDPRRIVHSMKVGLALTLVSLFYYFRPLYDGFGQAGMWAVLTVVVVFEFTV  97

Query  1481  gaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSI  1302
             G TLSK +NR  AT LAG+LG+G  ++A+  G+K +P++L   VF LAAA+TF+RF P++
Sbjct  98    GGTLSKSINRGCATLLAGALGVGAEYLASLCGEKGEPVVLGLMVFFLAAASTFTRFFPNV  157

Query  1301  KARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGD  1122
             K ++DYG  IFILTFSLV+VSG+RV ++L LA QRLSTI +G + C+ I++ +CPVWAG 
Sbjct  158   KRKYDYGVLIFILTFSLVAVSGFRVTQILQLAHQRLSTILIGGATCMLISIFVCPVWAGQ  217

Query  1121  DLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKK--LLGYKCVLNTKASE  948
             DLH L+  N+EKLA  LEG   ++            + K   K   L  YK VLN+KA+E
Sbjct  218   DLHNLVAANIEKLASFLEGFGHEFYGPSAVDGSGAISSKNECKPSFLEAYKSVLNSKATE  277

Query  947   DAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILK  768
             +++ANFA WEPGHGRF F HPWKQYLK+GA  R CA  IETL+  +NS  QV S E+ +K
Sbjct  278   ESLANFAWWEPGHGRFRFHHPWKQYLKVGAMARECACLIETLNRYVNSKHQVAS-EFQIK  336

Query  767   PVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQ  588
              + E C ++ +   K L++++                            A K++  PSS 
Sbjct  337   -IQEACIKMSTESSKALKEVAS---------------------------AIKSMTFPSSG  368

Query  587   SLTTQVEEAQKPSSDHLKQ--ETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEG  414
               T    +  K ++D LK   ET S  ++ D      L EI     VAS+L++I    + 
Sbjct  369   VETHT--QNYKAAADDLKTILETCSLPTEAD------LQEIMPALVVASVLLDIIKCIDK  420

Query  413   VVKEVNQLANLAQFRGQSDKKMA---KQSQS  330
             +   V++L+ +A F+       A   KQ Q+
Sbjct  421   ISLSVHELSRMAGFKKPKSTATALPEKQQQT  451



>ref|XP_006424111.1| hypothetical protein CICLE_v10028411mg [Citrus clementina]
 gb|ESR37351.1| hypothetical protein CICLE_v10028411mg [Citrus clementina]
 gb|KDO58241.1| hypothetical protein CISIN_1g042529mg [Citrus sinensis]
Length=456

 Score =   323 bits (827),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 203/450 (45%), Positives = 280/450 (62%), Gaps = 52/450 (12%)
 Frame = -3

Query  1655  KAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvga  1476
             K  +LG+ +PR++IH +KVGLA++LVSLFYY  PLYD  G +AMWAV+TVVVVFE++VG 
Sbjct  40    KTKKLGQDDPRRIIHSLKVGLAITLVSLFYYFEPLYDGFGVSAMWAVLTVVVVFEFSVGG  99

Query  1475  TLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKA  1296
             TLS+ +NR +ATFLA  LG G H +AN SG+  +PI+L   VFLLA+  TF RF P +KA
Sbjct  100   TLSRGLNRGLATFLAAGLGFGAHHLANLSGKLGEPILLGLFVFLLASTVTFVRFFPRMKA  159

Query  1295  RFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDL  1116
             R+DYG  IFILTF L+SVSGYR D++  +A  R+STI +G    + + +L+ PVWAG DL
Sbjct  160   RYDYGLLIFILTFCLISVSGYRDDEVWHMAHMRVSTILIGGFTAVCVCILIFPVWAGTDL  219

Query  1115  HRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMA  936
             H L+ NN++KLA+ LEG    Y     DG+ D          L GYKCVLN+K +E+++A
Sbjct  220   HNLVANNIDKLANFLEGFGPLYFQIPQDGEMDMTF-------LEGYKCVLNSKQTEESLA  272

Query  935   NFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSE  756
             NFA WEPGHG F FRHPWKQYLKIG+  R CAY IE L+G +N+  +          + E
Sbjct  273   NFAGWEPGHGEFRFRHPWKQYLKIGSLTRNCAYRIEALNGYLNTETK----------IPE  322

Query  755   ECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEAL-QLAF--KTLIPP-SSQ  588
             E R      GK                +QD  ++    AV+AL +LAF  +T+  P S+ 
Sbjct  323   EIR------GK----------------MQDACINMSYEAVKALKELAFSIQTMTKPCSAN  360

Query  587   SLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVV  408
             S  T+ + A K    +LK    ++L  + +     ++++    TVASLLV+  A TE + 
Sbjct  361   SHITKSKIAAK----NLKSLLSTSLCKETE-----ILDLIPAVTVASLLVDAVACTEKIA  411

Query  407   KEVNQLANLAQFRGQSDKKMAKQSQSQHKE  318
             + V +LA++A+F+    KK   +S S+  E
Sbjct  412   ESVQELASIAKFKSVKPKKAPSRSSSKISE  441



>emb|CDP21018.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   323 bits (829),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 185/428 (43%), Positives = 270/428 (63%), Gaps = 46/428 (11%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             ++G+ +PR+VIH +K+GLAL+LVSLFYY +PLY + G +AMWAVMTVVVVFE++VGAT+ 
Sbjct  41    KIGQDDPRRVIHSLKLGLALTLVSLFYYFQPLYKNFGVSAMWAVMTVVVVFEFSVGATIG  100

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR +ATF+AG+LG+G H++A+ +G+  +PI +   VFL AA  TF RF P +KAR+D
Sbjct  101   KGLNRGLATFIAGALGVGAHYLASMTGKVGEPIFIGLFVFLQAAVTTFIRFFPKVKARYD  160

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFSLVS+SG+R D++LDLA +RLSTI +G S C+ +++ +CPVWAG+DLH L
Sbjct  161   YGLVIFILTFSLVSISGFRTDEILDLAHKRLSTILVGASTCVIVSIFVCPVWAGEDLHNL  220

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFA  927
             + ++LEKL + LEG   +Y          +   K ++  L+GY+ VLN+K +E+  AN A
Sbjct  221   VADHLEKLGNFLEGFGEEYF-----AGSVEAEFKDNKSFLVGYRSVLNSKTTEENQANLA  275

Query  926   VWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECR  747
              WEPGHG+F + HPW+QYLKIGA  R CA  IE L+  +NS  ++ + E + + V E C 
Sbjct  276   RWEPGHGKFMYLHPWEQYLKIGALTRKCACRIEALNSYLNS--EIKAPEEVFQKVQEICT  333

Query  746   RVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSS--QSLTTQ  573
              +    G+ L++                           L LA  T+  PSS  + +   
Sbjct  334   IMSKESGQALKE---------------------------LSLAIGTMTKPSSPNRHIVNS  366

Query  572   VEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQ  393
                AQ     +L+   KS   +D     + L ++  ++ VASLL++I    E + + V +
Sbjct  367   TTAAQ-----NLESLLKSGSWED-----INLRQLISVAAVASLLIDIVISVEDIAESVTE  416

Query  392   LANLAQFR  369
             LA LA+F+
Sbjct  417   LATLAKFQ  424



>gb|EYU18115.1| hypothetical protein MIMGU_mgv1a021852mg [Erythranthe guttata]
Length=466

 Score =   322 bits (826),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 195/437 (45%), Positives = 267/437 (61%), Gaps = 56/437 (13%)
 Frame = -3

Query  1661  IDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytv  1482
             + K  ++G+ +PR+++H +KVGLAL+LVSLFYY RPLYD  G   MWA++TVVVVFE+T+
Sbjct  39    VKKTKKIGEDDPRRIVHSIKVGLALTLVSLFYYFRPLYDGFGQAGMWAILTVVVVFEFTI  98

Query  1481  gaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSI  1302
             G TLSK +NR VAT LAG+LG+G  ++A   G K +PI+L   VFLLAA +TF+RFIP +
Sbjct  99    GGTLSKSINRGVATLLAGALGVGAEYLAGLCGDKGEPIVLGLLVFLLAATSTFTRFIPHV  158

Query  1301  KARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGD  1122
             K ++DYG  IFILTFSLV+VSGYRV+ +L LA QRL+TI LG + CI I++ +CPVWAG 
Sbjct  159   KKKYDYGVLIFILTFSLVAVSGYRVNLILQLAHQRLATILLGGATCIIISIFVCPVWAGQ  218

Query  1121  DLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDA  942
             DLH L++ N+EKLA  LEG   D              D   +  L GYK VLN+KA+E++
Sbjct  219   DLHNLVSGNIEKLATFLEGFGGD--------------DDKDKSYLEGYKNVLNSKATEES  264

Query  941   MANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHG-SINS----SAQVGSAEY  777
             +ANFA WEP HG F + HPWK YLKIG   R CA  IETL G S+NS    + +  S+E 
Sbjct  265   LANFAWWEPAHGGFRYNHPWKHYLKIGGLSRECASHIETLAGYSVNSKHTQAKEASSSEL  324

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
              LK +   C+++ +  G+ LR+                           L  A K    P
Sbjct  325   HLK-IQPSCKKLSTESGEALRE---------------------------LATALKNKTFP  356

Query  596   SSQSLTTQVEEAQKPSSDHLKQ--ETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAAR  423
             S+ +  T ++ + K +++ LK+  E  S L    D     L EI  L   +S+L+++ A 
Sbjct  357   SAAA-ETHIKNS-KSAAEELKRVLENSSLLPTKLD-----LQEIMPLLVTSSVLIDVVAC  409

Query  422   TEGVVKEVNQLANLAQF  372
              E +   VN+L+  A F
Sbjct  410   VERIAVSVNELSEKAGF  426



>ref|XP_006481849.1| PREDICTED: aluminum-activated malate transporter 2-like [Citrus 
sinensis]
Length=426

 Score =   321 bits (822),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 201/450 (45%), Positives = 281/450 (62%), Gaps = 52/450 (12%)
 Frame = -3

Query  1655  KAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvga  1476
             K  ++G+ +PR++IH +KVGLA++LVSLFYY  PLYD  G +AMWAV+TVVVVFE++VG 
Sbjct  10    KTEKVGQDDPRRIIHSLKVGLAITLVSLFYYFEPLYDGFGVSAMWAVLTVVVVFEFSVGG  69

Query  1475  TLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKA  1296
             TLS+ +NR +ATFLA  LG G H +AN SG+  +PI+L   VFLLA+  TF RF P +KA
Sbjct  70    TLSRGLNRGLATFLAAGLGFGAHHLANLSGKLGEPILLGLFVFLLASTVTFVRFFPRMKA  129

Query  1295  RFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDL  1116
             R+DYG  IFILTF L+SVSGYR D++  +A  R+STI +G    + + +L+ PVWAG DL
Sbjct  130   RYDYGLLIFILTFCLISVSGYRDDEVWHMAHMRVSTILIGGFTAVCVCILIFPVWAGTDL  189

Query  1115  HRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMA  936
             H L+ NN++KLA+ LEG    Y     DG+ D          L GYKCVLN+K +E+++A
Sbjct  190   HNLVANNIDKLANFLEGFGPLYFQIPQDGEMDMTF-------LEGYKCVLNSKQTEESLA  242

Query  935   NFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSE  756
             NFA WEPGHG+F FRHPWKQYLKIG+  R CAY IE L+G +N+  +          + E
Sbjct  243   NFAGWEPGHGQFRFRHPWKQYLKIGSLTRNCAYRIEALNGYLNTETK----------IPE  292

Query  755   ECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEAL-QLAF--KTLIPP-SSQ  588
             E R      GK                +QD  ++  + AV+AL +LAF  +T+  P S+ 
Sbjct  293   EIR------GK----------------MQDACINMSSEAVKALKELAFSIQTMTKPCSAN  330

Query  587   SLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVV  408
             S  T+ + A K    +LK    ++L  + +     ++++     VASLLV++ A TE + 
Sbjct  331   SHITKSKIAAK----NLKSLLSASLCKETE-----ILDLIPAVAVASLLVDVVACTEKIE  381

Query  407   KEVNQLANLAQFRGQSDKKMAKQSQSQHKE  318
             + V +LA++A+F     KK   +S S+  E
Sbjct  382   ESVQELASIAKFNSVKPKKAPSRSSSKISE  411



>ref|XP_008442919.1| PREDICTED: aluminum-activated malate transporter 8-like [Cucumis 
melo]
Length=462

 Score =   322 bits (824),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 202/437 (46%), Positives = 275/437 (63%), Gaps = 38/437 (9%)
 Frame = -3

Query  1655  KAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvga  1476
             K  +LG+ +PR++IH +KVG+AL+LVSLFYY +PLYD  G + +WAV+TVVV+FE+TVGA
Sbjct  15    KIKKLGQDDPRRIIHSIKVGVALTLVSLFYYWKPLYDGFGASGIWAVITVVVIFEFTVGA  74

Query  1475  TLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKA  1296
             TLSK +NR + T LAG+LG+GV ++AN SGQK +P +L   VFL+AA+ATFSRF P IKA
Sbjct  75    TLSKGLNRGLGTMLAGALGVGVDYLANLSGQKGEPFVLGIFVFLIAASATFSRFFPGIKA  134

Query  1295  RFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDL  1116
             R+DYG  IFILTFS+VSVSGYRVD+ L +A QRL+TI +G +ICI I++++CPVWAG+ L
Sbjct  135   RYDYGVLIFILTFSMVSVSGYRVDEFLTMAHQRLTTILVGGAICIIISIVVCPVWAGETL  194

Query  1115  HRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLG-YKCVLNTKASEDAM  939
             H  I +N+ KLA+ LEG   +Y        D+       +K  L  YK VLN+K++ED+M
Sbjct  195   HNSIISNINKLANYLEGFGGEYF----HSSDEHVTVPEKDKSFLQEYKVVLNSKSTEDSM  250

Query  938   ANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVS  759
             ANFA WEP HG F FRHPWK YLKIG+  R CAY IE L+  + S  Q+       + + 
Sbjct  251   ANFARWEPRHGNFGFRHPWKHYLKIGSFARQCAYHIEALNFHL-SPHQLQEPSQFRRMME  309

Query  758   EECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLT  579
               C+ + S  GK L+                           AL  A KT+  PS  S  
Sbjct  310   VPCKTISSESGKALK---------------------------ALATAMKTMTDPSPSS--  340

Query  578   TQVE-EAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKE  402
              Q+   A K + + LK   KS  +   D D+  L+ I   +TVAS+L++I    E + + 
Sbjct  341   -QLHLNAAKSAVNDLKNTLKSGTAQISD-DISNLLAIIPDATVASILIDIVKSVEDLSEA  398

Query  401   VNQLANLAQFRGQSDKK  351
             V +L+  A+F+  S +K
Sbjct  399   VAELSLKAKFKSVSPEK  415



>emb|CDX95060.1| BnaC05g06110D [Brassica napus]
Length=508

 Score =   323 bits (827),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 196/438 (45%), Positives = 279/438 (64%), Gaps = 39/438 (9%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++   + +  ++GK++PR+V+H  KVGLAL+LVS FYY +PLYD+ G NAMWAVMTVVVV
Sbjct  3     KVREIVREGRRVGKEDPRRVVHAFKVGLALALVSSFYYYQPLYDNFGVNAMWAVMTVVVV  62

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE++VGATL K +NR VAT +AG LGIG H +A+ SG  ++PI+L   VF+ AA +TF R
Sbjct  63    FEFSVGATLGKGINRAVATLVAGGLGIGAHHLASLSGPTIEPILLAIFVFVQAALSTFVR  122

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P +KAR+DYG  IFILTFSL+SVSG+R D++LDLA +RLST+ +G   C+ I++ +CP
Sbjct  123   FFPRVKARYDYGILIFILTFSLISVSGFREDEILDLAHKRLSTVIMGGVSCVLISIFVCP  182

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG DLH LI +NL+ L+  L+  + +Y  A  DGD  +   +   K L  YK VLN+K
Sbjct  183   VWAGQDLHSLIASNLDTLSHFLQEFVEEYFEATDDGDIKEVEKR--RKNLERYKSVLNSK  240

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             ++E+ +ANFA WEP HG+F FRHPW+QYL + A +R CAY I+ L+  + S  Q+   + 
Sbjct  241   SNEETLANFARWEPRHGQFRFRHPWQQYLAVAALLRQCAYRIDALNSYLKSDFQI--PKD  298

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
             I K + E  RR+ S  GK L+++S  +K  TKSS  DI V +  SA + L    K+ I  
Sbjct  299   IKKKLEESLRRMSSESGKSLKEMSISLKKMTKSSSADIHVLNSQSACKTLSTLLKSGI--  356

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
                                        L+D      V  +++  L+T  SLL++I   TE
Sbjct  357   ---------------------------LND------VEPLQLISLTTTVSLLIDIVNLTE  383

Query  416   GVVKEVNQLANLAQFRGQ  363
              + + V++LA+ A+F+ +
Sbjct  384   KISESVHELASAARFKNK  401



>gb|KHG22050.1| Aluminum-activated malate transporter 2 -like protein [Gossypium 
arboreum]
Length=458

 Score =   321 bits (823),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 190/454 (42%), Positives = 273/454 (60%), Gaps = 45/454 (10%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++  F  K  ++ + +PR+++H  KVGLA++LVSLFYY   LY   G +AMWAV+TV+VV
Sbjct  29    KVAEFPGKMKKVAEDDPRRIVHSFKVGLAITLVSLFYYFDHLYVGFGSSAMWAVLTVIVV  88

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
              E++VGATL K +NR +ATFLAG+LG G H +AN  G++LQPI+L   VF+LAA  +F R
Sbjct  89    IEFSVGATLGKGLNRGLATFLAGTLGFGAHHLANLPGRELQPILLGIFVFILAATVSFIR  148

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P +K R+DYG  IF+LTF L+SVSGYR +++L++A +R+STI +G    IF+ + +CP
Sbjct  149   FFPRMKVRYDYGLLIFMLTFCLISVSGYRDEEVLEMAHKRVSTILIGGFTAIFVCIFICP  208

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG+DLH L  NNLEKLA  LEG   +Y              ++++  L  YK +LN+K
Sbjct  209   VWAGEDLHNLAANNLEKLASFLEGFGDEYF-------RKSSEPESNKASLQAYKSILNSK  261

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
              SE+++ NFA WEP HG F FRHPWKQYLKIG+  R CAY IE L+G +NS  Q      
Sbjct  262   QSEESLVNFARWEPPHGPFRFRHPWKQYLKIGSLTRQCAYRIEALNGCLNSDVQAS----  317

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
                   E CR          R+      S            +   AV+ L  A + +  P
Sbjct  318   -----PETCRN--------FREAFIKASS------------ETGKAVKGLASAMRKMTLP  352

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
             +     T      K ++D+LK   ++ L +  D     ++EI +++TVASLL++I A TE
Sbjct  353   TGDCPQTA---KSKNAADNLKSLLRTGLCEGID-----IVEILEVATVASLLLDILACTE  404

Query  416   GVVKEVNQLANLAQF-RGQSDKKMAKQSQSQHKE  318
              + + +++LA+LA F R + D+K       + K+
Sbjct  405   KISESIHELASLAHFKRLEPDEKDGNPDLDKQKQ  438



>ref|XP_006303723.1| hypothetical protein CARUB_v10011859mg [Capsella rubella]
 gb|EOA36621.1| hypothetical protein CARUB_v10011859mg [Capsella rubella]
Length=512

 Score =   323 bits (827),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 192/438 (44%), Positives = 273/438 (62%), Gaps = 39/438 (9%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++   + +  ++G ++PR+V+H  KVGLAL+ VS FYY +PLYD+ G NAMWAVMTVVVV
Sbjct  3     KVREIVREGRRVGNEDPRRVVHAFKVGLALAFVSSFYYYQPLYDNFGVNAMWAVMTVVVV  62

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE++VGATL K +NR VAT +AG LGIG H +A+ SG  ++PI+L   VF+LAA +TF R
Sbjct  63    FEFSVGATLGKGINRAVATLVAGGLGIGAHHLASLSGATVEPILLAIFVFILAALSTFVR  122

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P +KAR+DYG  IFILTF+L+SVSG+R D++LDLA +RLST+ +G   C+ I++ +CP
Sbjct  123   FFPRVKARYDYGVLIFILTFALISVSGFREDEILDLAHKRLSTVMMGGVSCVLISIFVCP  182

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG DLH L+ +N + LA  L+    +Y   +   D D    +   + L  YK VLN+K
Sbjct  183   VWAGQDLHSLLASNFDTLAHFLQEFGEEYF--EATEDRDMKEVEKRRRNLERYKSVLNSK  240

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             ++E+A+ANFA WEP HG F FRHPWKQYL +GA +R CAY I+ L+ SINS  Q+     
Sbjct  241   SNEEALANFAKWEPRHGVFRFRHPWKQYLSVGALLRQCAYRIDALNSSINSDMQIPMD--  298

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
             + K + E  RR+ S  GK ++++S  +K  TKSS  DI V +  SA + L    K+    
Sbjct  299   VKKKLEEPLRRMSSESGKAMKEMSNSLKKMTKSSSSDIHVVNSQSACKTLSTLLKS----  354

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
                                        L+D +   ++ LM      T  SLL++I   TE
Sbjct  355   -------------------------GVLNDVEPLQMISLM------TTVSLLIDIVNFTE  383

Query  416   GVVKEVNQLANLAQFRGQ  363
              + + +++LA+ A+F+  
Sbjct  384   KISESLHELASAAKFKNN  401



>ref|XP_004306386.1| PREDICTED: aluminum-activated malate transporter 2-like [Fragaria 
vesca subsp. vesca]
Length=479

 Score =   321 bits (823),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 194/454 (43%), Positives = 276/454 (61%), Gaps = 45/454 (10%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++  F  K  +LG+ +PR+++H +KVGLA+ LVS+ YY  PLYD +G +AMWAV+TVVVV
Sbjct  31    KVVEFPMKLKKLGQDDPRRIVHSLKVGLAVLLVSMLYYCDPLYDGLGASAMWAVLTVVVV  90

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE++VGATL + +NR +ATFLAGSLG G+H +AN SG+K  PI++   VFLLAA+ TF R
Sbjct  91    FEFSVGATLGRGLNRILATFLAGSLGFGIHHLANLSGEKGHPILVSLFVFLLAASVTFLR  150

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P IKAR+DYG  IFILTF ++SVSGYR +++L++A +R STI +G    + + + +CP
Sbjct  151   FFPRIKARYDYGLLIFILTFCMISVSGYRDEEILEMAHKRASTILIGAFTAVSVCVFICP  210

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNT  960
             VWAGDDLH  +  N+EKL   LEG  ++                 S + LL GY  VLN+
Sbjct  211   VWAGDDLHNSVATNIEKLGSFLEGFGNECF-------KKSFKGGESNRALLKGYCSVLNS  263

Query  959   KASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAE  780
             K SE++  NFA WEP HGRF FRHPWK YLKIG+  R CAY I+TL+G INS  Q     
Sbjct  264   KQSEESQVNFARWEPRHGRFRFRHPWKHYLKIGSLTRQCAYRIDTLNGYINSEIQT----  319

Query  779   YILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIP  600
                 P++ + R+V   C K+  +                     + A++ L LA K +  
Sbjct  320   ----PLNIQSRKVQELCMKMSTES--------------------SEALKELALAMKAMTR  355

Query  599   PSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAART  420
             P+S S    + +++  ++  LK   KS    +D    + L++I    TVASLL ++ A  
Sbjct  356   PTSAS--AHIIKSRTEATT-LKSFLKSPGLGED----ILLLDIIPAVTVASLLTDVVAYV  408

Query  419   EGVVKEVNQLANLA--QFRGQSDKKMAKQSQSQH  324
             E + K + +LA+L+  QF+    K   +Q++  H
Sbjct  409   EQIEKSIQELASLSHVQFKSAEPKTEQEQTKLHH  442



>ref|XP_009337710.1| PREDICTED: aluminum-activated malate transporter 2-like [Pyrus 
x bretschneideri]
Length=485

 Score =   322 bits (824),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 195/468 (42%), Positives = 275/468 (59%), Gaps = 41/468 (9%)
 Frame = -3

Query  1691  GGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvm  1512
             G  + ++  F  K  +LG+ +PR+++H +KVGLA+ LVSL YY +P Y+ +G  AMWA++
Sbjct  24    GKVMNKVVEFPRKLKKLGQDDPRRIVHSLKVGLAVLLVSLLYYFQPFYNGLGDTAMWAIL  83

Query  1511  tvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAA  1332
             TVVVVFE++VGATL + +NR +ATFLAG+LG GVH +AN SG    PI++   VFLLAA+
Sbjct  84    TVVVVFEFSVGATLGRGLNRILATFLAGALGFGVHHLANLSGDIAHPILIGIFVFLLAAS  143

Query  1331  ATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIA  1152
              TF RF P +KAR+DYG  IFILTF L+SVSGYR +++L++A +R STI +G  I +F+ 
Sbjct  144   VTFIRFFPRMKARYDYGLLIFILTFCLISVSGYRDEEILEMAHKRASTILIGAFIAVFVC  203

Query  1151  MLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKC  972
             + +CPVWAGDDLH  +  N+EKL   LEG   +Y    G G+ +          L GY  
Sbjct  204   VFICPVWAGDDLHNSVAKNIEKLGSFLEGFGDEYFKVAGSGESNMA-------HLQGYIS  256

Query  971   VLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQV  792
             VLN+K SE+  ANFA WEP HG+F +RHPW+ YLKIG   R CAY I+TL G +NS  Q 
Sbjct  257   VLNSKQSEETQANFARWEPRHGKFRYRHPWRYYLKIGNLTRQCAYRIDTLSGYLNSEVQT  316

Query  791   GSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFK  612
                      V E C ++ S  GK L++                           L  A K
Sbjct  317   -PLNIQNNQVQELCMKMSSESGKALKE---------------------------LAWALK  348

Query  611   TLIPPSSQSLTTQVEEAQKPSSDHLKQ--ETKSALSDDDDHDLVYLMEIAQLSTVASLLV  438
             T+  P S + ++ + ++ + ++++LK    T +A       D V L++I    TVASLL 
Sbjct  349   TMTEPCSAA-SSHITKS-RAAANNLKSMLRTNAAAVAGVGGDQVRLLDIVPAVTVASLLS  406

Query  437   EIAARTEGVVKEVNQLANL--AQFRGQSDKKMAKQSQSQHKEQNVQTH  300
             ++ A  E + K + +LA+    QF+    KK    + S+    NV  H
Sbjct  407   DVVAYAEQIEKSIQKLASFQHVQFKSAERKKPTALTSSKTSSSNVGPH  454



>emb|CDX93562.1| BnaA06g04860D [Brassica napus]
Length=508

 Score =   322 bits (825),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 197/438 (45%), Positives = 279/438 (64%), Gaps = 39/438 (9%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++   + +  ++GK++PR+V+H  KVGLAL+LVS FYY +PLYD+ G NAMWAVMTVVVV
Sbjct  3     KVREIVREGRRVGKEDPRRVVHAFKVGLALALVSSFYYYQPLYDNFGVNAMWAVMTVVVV  62

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE++VGATL K +NR VAT +AG LGIG H +A+ SG  ++PI+L   VF+ AA +TF R
Sbjct  63    FEFSVGATLGKGINRAVATLVAGGLGIGAHHLASLSGPTIEPILLAIFVFVQAALSTFVR  122

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P +KAR+DYG  IFILTFSL+SVSG+R D++LDLA +RLST+ +G   C+ I++ +CP
Sbjct  123   FFPRVKARYDYGILIFILTFSLISVSGFREDEILDLAHKRLSTVIMGGVSCVLISIFVCP  182

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG DLH LI +NL+ L+  L+    +Y  A  DGD  +   +   K L  YK VLN+K
Sbjct  183   VWAGQDLHSLIASNLDTLSHFLQEFREEYFEATDDGDIKEVEKR--RKNLERYKSVLNSK  240

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             ++E+A+ANFA WEP HG+F FRHPW+QYL + A +R CAY I+ L+  +NS  Q+     
Sbjct  241   SNEEALANFARWEPRHGQFRFRHPWQQYLAVAALLRQCAYRIDALNSYLNSDFQIPMD--  298

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
             I K + E  RR+ S  GK L+++S  +K  TKSS  DI V +  SA + L    K+ I  
Sbjct  299   IKKKLEEPLRRMSSEAGKSLKEMSISLKKMTKSSSSDIHVLNSQSACKDLSTLLKSGI--  356

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
                                        L+D      V  +++  L+T  SLL++I   TE
Sbjct  357   ---------------------------LND------VEPLQLISLTTTVSLLIDIVNLTE  383

Query  416   GVVKEVNQLANLAQFRGQ  363
              + + +++LA+ A+F+ +
Sbjct  384   KISESLHELASAARFKNK  401



>gb|KFK43164.1| hypothetical protein AALP_AA1G088100 [Arabis alpina]
Length=505

 Score =   321 bits (823),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 195/434 (45%), Positives = 274/434 (63%), Gaps = 39/434 (9%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             ++GK++PR+V+H +KVGLAL+LVS FYY +PLYD+ G NAMWAVMTVVVVFE++VGATL 
Sbjct  6     RVGKEDPRRVVHALKVGLALALVSSFYYYQPLYDNFGVNAMWAVMTVVVVFEFSVGATLG  65

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR VAT +AG LG+G H +A+ SG  ++PI+L   VF+ AA +TF RF P +KAR+D
Sbjct  66    KGINRAVATLVAGGLGLGAHHLASFSGPTIEPILLAIFVFVQAALSTFVRFFPRVKARYD  125

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFSL+SVSG+R D++LDLA +RLST+ +G   C+ I++ +CPVWAG DLH L
Sbjct  126   YGILIFILTFSLISVSGFREDEILDLAHKRLSTVIMGGVSCVLISIFVCPVWAGQDLHSL  185

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFA  927
             + +N +KL+  L+    +Y   +   D D    +   K L  YK +LN+K++E+A+ANFA
Sbjct  186   LASNFDKLSHFLQEFGDEYF--EATKDGDIKEVEKKRKNLERYKSILNSKSNEEALANFA  243

Query  926   VWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECR  747
              WEP HG+F FRHPWKQYL + A +R CAY I+TL+   NS  QV     I K + E  R
Sbjct  244   KWEPRHGQFRFRHPWKQYLDVAALLRQCAYRIDTLNSYFNSDVQVPMD--IKKKLEEPLR  301

Query  746   RVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVE  567
             R+    GK ++++S  +K  TKSS  DI V +  SA + L    K+ I            
Sbjct  302   RMSLESGKSMQEMSNSLKKMTKSSSSDIHVLNSQSACKDLSTLIKSGI------------  349

Query  566   EAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLA  387
                              L+D +   ++ L+      T  SLL++I   TE + K V++LA
Sbjct  350   -----------------LNDVEPQQMISLL------TTVSLLIDIVNLTEEISKSVHELA  386

Query  386   NLAQFRGQSDKKMA  345
             + A+F  +   K++
Sbjct  387   SAARFTNKKKSKVS  400



>gb|AFK43844.1| unknown [Lotus japonicus]
Length=473

 Score =   320 bits (820),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 198/454 (44%), Positives = 285/454 (63%), Gaps = 43/454 (9%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++W     + ++ + +PR+VIH +KVGLA+SLVSLFYY +PLY++ G +AMWAVMTVVVV
Sbjct  31    KVWGICKMSKEVAQDDPRRVIHSLKVGLAISLVSLFYYYQPLYENFGLSAMWAVMTVVVV  90

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FEYTVGATL K +NRT+AT  AG+LG+G H++A+ SG+  +PI++   VF+ AA A+F R
Sbjct  91    FEYTVGATLGKGLNRTMATLAAGALGVGAHYLASLSGETGEPILIGFFVFVQAAIASFIR  150

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P +K R+DYG  +FILTFSL+SVSG+R D++L++A +RLSTI +G S C+ I++ +CP
Sbjct  151   FFPKVKTRYDYGILVFILTFSLISVSGFRDDEVLEMAHKRLSTIFIGGSACVMISIFVCP  210

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG++ H  I   LE L D LE  + +Y          + + K ++  L G+K +LN+K
Sbjct  211   VWAGEEFHYSIAEKLEILGDFLEAFVDEYF-----TTSKEGDSKDNKSFLEGHKSILNSK  265

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             +SE+A+ANFA WEPGHG+F FRHPW QYLKIGA  R CAY +E L   +NS+ Q GS E 
Sbjct  266   SSEEALANFARWEPGHGKFKFRHPWSQYLKIGALSRQCAYRMEALKELLNSNTQ-GSPE-  323

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
             I   + E C  +     K L+ L   +++ T +S  DI + +  +A+++L    K+L+  
Sbjct  324   IHCTIQELCSEMSLESSKALKKLVVSIRTMTMASSADIHIANSKAALKSL----KSLL--  377

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
                               +L +ET              L  + Q  TVASLL++I   TE
Sbjct  378   ----------------QSNLWKETD-------------LFSLVQPVTVASLLIDIVECTE  408

Query  416   GVVKEVNQLANLAQFRGQ-SDKKMAKQSQSQHKE  318
              +   VN LA++  F  + +D+K  K SQS + E
Sbjct  409   EIADSVNVLASIVDFDVEDADEKSPKTSQSPNSE  442



>ref|XP_003539851.1| PREDICTED: aluminum-activated malate transporter 2-like isoform 
1 [Glycine max]
Length=481

 Score =   320 bits (820),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 205/461 (44%), Positives = 282/461 (61%), Gaps = 45/461 (10%)
 Frame = -3

Query  1697  IVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWA  1518
             +V G VL I        ++ + +PRKVIH +KVGLA+SLVSLFYY +PLY++ G +AMWA
Sbjct  23    VVKGKVLSICRLTK---EIAQDDPRKVIHSLKVGLAISLVSLFYYYQPLYENFGLSAMWA  79

Query  1517  vmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLA  1338
             VMTVVVVFEYTVGATL K +NRT+AT  AG+LG+G H++A+ SG   +PI++ A VF+ A
Sbjct  80    VMTVVVVFEYTVGATLGKGLNRTIATLAAGALGVGAHYLASLSGATGEPILIGAFVFVQA  139

Query  1337  AAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIF  1158
             A A+F RF P +KAR+DYG  IFILTFSL+SVSG+R  ++L++A +RLSTI +G S C+ 
Sbjct  140   AIASFIRFFPKVKARYDYGMLIFILTFSLISVSGFREVEVLEMAHKRLSTIFIGGSACVM  199

Query  1157  IAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-G  981
             I++ +CPVWAG++ H  I + LE L   LE  +  Y     +G+ + +   + +K  L G
Sbjct  200   ISIFVCPVWAGEEFHYSIAHKLEILGYFLEAFVRVYFTMSKEGESEDNKGDSKDKSFLEG  259

Query  980   YKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSS  801
             YK VLN+K+ +D++ANFA WEPGHG+F FRHPW  YLK+GA  R CAY +E L   INS 
Sbjct  260   YKTVLNSKSVDDSLANFAKWEPGHGKFRFRHPWDLYLKVGALSRQCAYRMEALDAHINSD  319

Query  800   AQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQL  621
              Q GS E +   + E+C  +C    +  ++L   +++ T  S  D  V +  +AV++L  
Sbjct  320   IQ-GSQE-MRSTIQEQCSEMCLEASQAFKELGSSIRTMTMPSSSDTHVANAKAAVKSL--  375

Query  620   AFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLL  441
               KTL+  SS   T                            DL+ L+  A   TVASLL
Sbjct  376   --KTLLQSSSWKET----------------------------DLLSLIPAA---TVASLL  402

Query  440   VEIAARTEGVVKEVNQLANLAQFR----GQSDKKMAKQSQS  330
             ++I   TE +   VN LA L  F      +S  K  + SQS
Sbjct  403   IDIVEFTEKIADSVNNLATLTHFEVVDTDKSSTKAQQPSQS  443



>ref|XP_010488872.1| PREDICTED: aluminum-activated malate transporter 2-like isoform 
X2 [Camelina sativa]
Length=505

 Score =   321 bits (822),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 196/449 (44%), Positives = 278/449 (62%), Gaps = 43/449 (10%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++   + +  ++G ++PR+V+H  KVGLAL+ VS FYY +PLYD+ G NAMWAVMTVVVV
Sbjct  3     KVREIVREGRRVGNEDPRRVVHAFKVGLALAFVSSFYYYQPLYDNFGVNAMWAVMTVVVV  62

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE++VGATL K +NR VAT +AG LGIG H +A+ SG  ++PI+L   VF+ AA +TF R
Sbjct  63    FEFSVGATLGKGINRAVATLVAGGLGIGAHHLASLSGPTIEPILLAIFVFIQAALSTFVR  122

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P +KAR+DYG  IFILTF+L+SVSG+R D++LDLA +RLST+ +G   C+ I++ +CP
Sbjct  123   FFPRVKARYDYGVLIFILTFALISVSGFREDEILDLAHKRLSTVMMGGVSCVLISIFVCP  182

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG DLH L+ +N + LA  L+    +Y  A  DGD  +   +   + L  YK VLN+K
Sbjct  183   VWAGQDLHSLLASNFDTLAHFLQEFGDEYFEATEDGDIKEVEKR--RRNLERYKSVLNSK  240

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             ++E+A+ANFA WEP HG F FRHPWKQYL +GA +R CAY ++ L+  INS  Q+     
Sbjct  241   SNEEALANFAKWEPRHGVFRFRHPWKQYLAVGALLRQCAYPVDALNSYINSDMQIPMD--  298

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
             + K + E  RR+ S  GK ++++S  +K  TKSS  D+ V +  SA + L    K+ I  
Sbjct  299   VKKKLEEPLRRMSSESGKSMKEMSNSLKKMTKSSTSDVHVVNSQSACKTLSTLLKSGI--  356

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
                                        L+D      V  +++  L T  SLL++I   TE
Sbjct  357   ---------------------------LND------VEPLQMISLMTTVSLLIDIVNLTE  383

Query  416   GVVKEVNQLANLAQFRGQSDKKMAKQSQS  330
              + + V++LA+ A+F+     KM   S S
Sbjct  384   KISESVHELASAAKFKN----KMKSSSNS  408



>ref|XP_006656938.1| PREDICTED: aluminum-activated malate transporter 10-like [Oryza 
brachyantha]
Length=585

 Score =   323 bits (828),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 196/456 (43%), Positives = 276/456 (61%), Gaps = 34/456 (7%)
 Frame = -3

Query  1652  AWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaT  1473
             AW++G  +PR+V+HG KV LAL+L S FYY+RPLY   G  AMWAV+TVVVVFEYTVG  
Sbjct  64    AWKVGADDPRRVVHGFKVALALTLCSAFYYVRPLYVFTGQTAMWAVLTVVVVFEYTVGGC  123

Query  1472  LSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPI--ILQASVFLLAAAATFSRFIPSIK  1299
             L K +NR VAT   G+L +G HW+A++ G  L+P   +L AS+F+LAAAA+FSRFIP++K
Sbjct  124   LYKGLNRAVATVTGGALALGAHWLADKCGDDLEPFPFVLTASLFVLAAAASFSRFIPTLK  183

Query  1298  ARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDD  1119
             ARFDYG TIFILT+SLV+VSGYRVD L  +A QRL+TIA+G  IC  +  L+ PVWAG +
Sbjct  184   ARFDYGVTIFILTYSLVAVSGYRVDTLGTMAHQRLTTIAIGAFICFAVCTLIFPVWAGQE  243

Query  1118  LHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAM  939
             LH L+  N++KLA ++E C+ DY ++               +K+  Y  VLN KASED++
Sbjct  244   LHVLVARNMDKLAAAVEACVDDYFSSGEHPTKL-------SEKVRRYMAVLNAKASEDSL  296

Query  938   ANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVS  759
             AN A WEPGHG+F FRHP+ QY K+GA+MR CAYC++ L   + ++ Q  +  ++   ++
Sbjct  297   ANLARWEPGHGKFGFRHPYGQYQKVGAAMRCCAYCVDALAACVGAAGQ--APPHVKNHLA  354

Query  758   EECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLT  579
               C  +   C  VLR+ S  + + T+S    ++V DMN+A + L+   + L      +  
Sbjct  355   AVCTALSQHCSAVLREASGSITTMTRSGRLALVVGDMNTAAQDLRDELRCL------AEI  408

Query  578   TQVEEAQKPSSDHLKQETKS--------ALSDDDDHDLVYLMEIA--QLSTVASLLVE--  435
                EEA    ++H    T           L    D +   LM IA  +  T+A+   +  
Sbjct  409   LDEEEAAPSETEHEHNTTTPPPPLVEALPLFPPADPEGAMLMPIAADEARTMATATEQDK  468

Query  434   ---IAARTEGVVKEVNQLANLAQF--RGQSDKKMAK  342
                 AA T G  +  +Q+  L +   R +S KK  +
Sbjct  469   KETAAAATSGQQEARDQVRQLVKLLMRRRSTKKWGR  504



>ref|XP_010475643.1| PREDICTED: aluminum-activated malate transporter 2-like [Camelina 
sativa]
Length=501

 Score =   320 bits (820),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 198/459 (43%), Positives = 281/459 (61%), Gaps = 43/459 (9%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++   + +  ++G ++PR+V+H  KVGLAL+ VS FYY +PLYD+ G NAMWAVMTVVVV
Sbjct  3     KVREIVREGRRVGNEDPRRVVHAFKVGLALAFVSSFYYYQPLYDNFGVNAMWAVMTVVVV  62

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE++VGATL K +NR VAT +AG LGIG H +A+ SG  ++PI+L   VF+ AA +TF R
Sbjct  63    FEFSVGATLGKGINRAVATLIAGGLGIGAHHLASLSGPTVEPILLAIFVFIQAALSTFVR  122

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P +KAR+DYG  IFILTF+L+SVSG+R D++LDLA +RLST+ +G   C+ I++ +CP
Sbjct  123   FFPRVKARYDYGVLIFILTFALISVSGFREDEILDLAHKRLSTVMMGGVSCVLISIFVCP  182

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG DLH L+ +N + LA  L+    +Y  A  DGD  +   +   + L  YK VLN+K
Sbjct  183   VWAGQDLHSLLASNFDTLAHFLQEFGEEYFEATEDGDIKEVEKR--RRNLERYKSVLNSK  240

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             ++E+A+ANFA WEP HG F FRHPWKQYL +GA +R CAY I+ L+  INS  Q+     
Sbjct  241   SNEEALANFAKWEPRHGVFRFRHPWKQYLAVGALLRQCAYRIDALNSYINSDMQIPMD--  298

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
             + K + E  RR+ S  GK ++++S  +K  TKSS  DI V +  SA + L    K+ I  
Sbjct  299   VKKKLEEPLRRMSSESGKSMKEMSNSLKKMTKSSTSDIHVVNSQSACKTLSTLLKSGI--  356

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
                                        L+D      V  +++    T  SLL++I   TE
Sbjct  357   ---------------------------LND------VEPLQMISFMTTVSLLIDIVNLTE  383

Query  416   GVVKEVNQLANLAQFRGQSDKKMAKQSQSQHKEQNVQTH  300
              + + V++LA+ A+F+     KM   S S      +++H
Sbjct  384   KISESVHELASAAKFKN----KMKSDSVSTSSAVPIKSH  418



>ref|XP_009148099.1| PREDICTED: aluminum-activated malate transporter 2 [Brassica 
rapa]
Length=508

 Score =   320 bits (820),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 197/438 (45%), Positives = 278/438 (63%), Gaps = 39/438 (9%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++   + +  ++GK++PR+V+H  KVGLAL+LVS FYY +PLYD+ G NAMWAVMTVVVV
Sbjct  3     KVREIVREGRRVGKEDPRRVVHAFKVGLALALVSSFYYYQPLYDNFGVNAMWAVMTVVVV  62

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE++VGATL K +NR VAT +AG LGIG H +A+ SG  ++PI+L   VF+ AA +TF R
Sbjct  63    FEFSVGATLGKGINRAVATLVAGGLGIGAHHLASLSGPTIEPILLAIFVFVQAALSTFVR  122

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P +KAR+DYG  IFILTFSL+SVSG+R D++LD A +RLST+ +G   C+ I++ +CP
Sbjct  123   FFPRVKARYDYGILIFILTFSLISVSGFREDEILDWAHKRLSTVIMGGVSCVLISIFVCP  182

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG DLH LI +NL+ L+  L+    +Y  A  DGD  +   +   K L  YK VLN+K
Sbjct  183   VWAGQDLHSLIASNLDTLSHFLQEFREEYFEATDDGDIKEVEKR--RKNLERYKSVLNSK  240

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             ++E+A+ANFA WEP HG+F FRHPW+QYL + A +R CAY I+ L+  +NS  Q+     
Sbjct  241   SNEEALANFARWEPRHGQFRFRHPWQQYLAVAALLRQCAYRIDALNSYLNSDFQIPMD--  298

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
             I K + E  RR+ S  GK L+++S  +K  TKSS  DI V +  SA + L    K+ I  
Sbjct  299   IKKKLEEPLRRMSSEAGKSLKEMSISLKKMTKSSSSDIHVLNSQSACKDLSTLLKSGI--  356

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
                                        L+D      V  +++  L+T  SLL++I   TE
Sbjct  357   ---------------------------LND------VEPLQLISLTTTVSLLIDIVNLTE  383

Query  416   GVVKEVNQLANLAQFRGQ  363
              + + V++LA+ A+F+ +
Sbjct  384   KISESVHELASAARFKNK  401



>gb|KDO70616.1| hypothetical protein CISIN_1g037603mg [Citrus sinensis]
Length=490

 Score =   319 bits (818),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 198/441 (45%), Positives = 266/441 (60%), Gaps = 41/441 (9%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             +LG+ +PR+V H +KVGLAL+LVSL YY RPLYD  G + MWAV+TVVVVFE+TVGATLS
Sbjct  42    KLGQDDPRRVTHSLKVGLALTLVSLLYYARPLYDSFGVSGMWAVLTVVVVFEFTVGATLS  101

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR  AT +AG+LG+G    A   G K +PI+L   VF+LA+  TF+RF P +KAR+D
Sbjct  102   KGLNRGFATLIAGALGVGAQHTAILCGDKGEPIVLGILVFILAS--TFTRFFPRMKARYD  159

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFS+V+VSGYRVD+LL LA QRLSTI +G + C  I++ +CPVWAG+DLH+L
Sbjct  160   YGILIFILTFSMVAVSGYRVDELLVLAHQRLSTILVGGAACTVISIFVCPVWAGEDLHKL  219

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFA  927
             I +NLE LA  LEG   +Y       ++  D  K  +  L  YK VLN+K  ED +ANFA
Sbjct  220   IASNLENLACYLEGFGDEYF-QVNKSEEGGDVTKKDKSFLQKYKSVLNSKTQEDNLANFA  278

Query  926   VWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECR  747
              WEPGHG+F  RHPW+QYLKIGA  R CAY IE L+G I+S  QV   + I   + E C 
Sbjct  279   RWEPGHGKFRLRHPWQQYLKIGAFARQCAYQIEALNGCIDSRIQV--PQEIQSKIQESCE  336

Query  746   RVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVE  567
              + S   K L+                           AL  + K +  PS  +  + +E
Sbjct  337   NISSESSKALK---------------------------ALASSIKKMTDPSPAN--SHIE  367

Query  566   EAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLA  387
              ++K   D      +++L+  D         I   +TVAS L+EI    E +   V  L+
Sbjct  368   ASKKAVKDLENALKEASLNTLD------FQAIVPAATVASTLIEIVKCIEKISGSVTDLS  421

Query  386   NLAQFRGQSDKKMAKQSQSQH  324
             NLA F+ + +  ++ + ++ H
Sbjct  422   NLAHFK-EVEHNVSPEGKASH  441



>ref|XP_010931063.1| PREDICTED: aluminum-activated malate transporter 1-like [Elaeis 
guineensis]
Length=451

 Score =   318 bits (814),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 196/439 (45%), Positives = 264/439 (60%), Gaps = 48/439 (11%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             R+  F++K  ++   +PR++ H  KVGLAL+LVS+FYY+ PL+D  G +A+WAV+TVVVV
Sbjct  30    RVTGFLNKLKKIANDDPRRISHSCKVGLALTLVSIFYYVTPLFDGFGVSAIWAVLTVVVV  89

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
              E+TVGATLSK +NR  AT LAG L +G H +A   G+K +PI+L   VFLLAA+ATFSR
Sbjct  90    MEFTVGATLSKGLNRAFATLLAGFLAVGAHQIAILFGEKGEPILLGLFVFLLAASATFSR  149

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             FIP IKAR+DYG TIFILTFSLV+VS YR D+L+ LA QRLSTI +G   C+F  + + P
Sbjct  150   FIPEIKARYDYGVTIFILTFSLVAVSSYRADELIQLAHQRLSTIVIGVVTCLFTTIFVIP  209

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG+DLH+L   NL+KLA  LEG  S+ L     G+         +  L  +K VLN+K
Sbjct  210   VWAGEDLHKLAAGNLDKLASFLEGLGSECL-----GEKMGGESLEGKSFLQVHKSVLNSK  264

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGS---  786
              +ED++ NFA WEPGHGRF FRHPW+QYLKIGAS R CA  +E L   I ++ +  S   
Sbjct  265   PTEDSLCNFARWEPGHGRFRFRHPWRQYLKIGASSRRCASYMEALTTYITTTPKTESNKE  324

Query  785   AEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTL  606
              E  LK +   C  + S   K LR                            L  A + +
Sbjct  325   PELRLK-IRTACVEMSSESAKALR---------------------------VLSSAIRNM  356

Query  605   IPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAA  426
               P+S        ++   ++     E  +ALS D D     L ++  ++T+A+LL E+  
Sbjct  357   TAPTSA-------QSHVAAAVAASGELGAALSKDAD-----LADVLHVATIATLLAELVV  404

Query  425   RTEGVVKEVNQLANLAQFR  369
             RT+ +   V +LA LA+FR
Sbjct  405   RTQEIAGSVEELARLARFR  423



>ref|XP_010034243.1| PREDICTED: aluminum-activated malate transporter 2-like [Eucalyptus 
grandis]
Length=471

 Score =   318 bits (814),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 194/435 (45%), Positives = 267/435 (61%), Gaps = 41/435 (9%)
 Frame = -3

Query  1655  KAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvga  1476
             K  +LG+ +PR+V+H +KVG ALSLVSL YYL+PLY+  G NAMWAVMTVVVVFE+ VGA
Sbjct  42    KVMKLGQDDPRRVVHSLKVGFALSLVSLIYYLQPLYNSFGINAMWAVMTVVVVFEFYVGA  101

Query  1475  TLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKA  1296
             TL K +NR +AT LAG+LG+G   +A+ +G+  +PI+L   VFL AA  TF RF P IKA
Sbjct  102   TLGKGLNRGLATLLAGALGVGATHLASLTGKTGEPIMLGFFVFLQAAGTTFVRFFPRIKA  161

Query  1295  RFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDL  1116
             ++DYG  IFILTF+LVSVSG+R DK+++ A +RLST+ +G S C+ I++++CPVWAG+DL
Sbjct  162   KYDYGMLIFILTFALVSVSGFREDKIVEFAHKRLSTVVIGGSACLIISIIVCPVWAGEDL  221

Query  1115  HRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMA  936
             H LI +N+EKLA+ LEG   +YL    DGD ++D     E     YK VL TK+ E+++A
Sbjct  222   HLLIASNMEKLANFLEGFEVEYLGESEDGDSNRDKSLFQE-----YKSVLGTKSKEESLA  276

Query  935   NFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSE  756
             NFA WEP HG F FRHPWKQYLK+GAS+R CAY IE L G + +  Q  +   +   + E
Sbjct  277   NFASWEPCHGPFGFRHPWKQYLKVGASIRQCAYRIEALEGYLTTKFQ--APPQVQTRLKE  334

Query  755   ECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTT  576
              C  +     + LR                            L  + KT+  PSS     
Sbjct  335   FCAEMAMEAAEALRQ---------------------------LSSSLKTMATPSSA--IP  365

Query  575   QVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVN  396
              +E+++  +     +  KS L      D   L+ +   +TV SLL++I   T+ + + VN
Sbjct  366   HLEKSRTAA-----KALKSLLKTTSWKDATDLLAVVHATTVTSLLIDITDCTDKIAESVN  420

Query  395   QLANLAQFRGQSDKK  351
             +LA+L  F+     K
Sbjct  421   ELASLTGFKTAEKAK  435



>ref|XP_008230202.1| PREDICTED: aluminum-activated malate transporter 2-like [Prunus 
mume]
Length=479

 Score =   318 bits (814),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 192/478 (40%), Positives = 281/478 (59%), Gaps = 48/478 (10%)
 Frame = -3

Query  1724  SRRRGKVYD--IVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPL  1551
             +R  G+  D    G  + ++  F  K  +LG+ +PR+++H +KVG A+ LVSL YY +PL
Sbjct  11    NRNEGENGDRGFCGKLMNKVVEFPRKLKKLGQDDPRRIVHSIKVGFAVLLVSLLYYFKPL  70

Query  1550  YDDVGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQP  1371
             YD +G  AMWAV+TVVVVFE++VGATL + +NR +ATFLAG+LG G H +AN SG+   P
Sbjct  71    YDGLGATAMWAVLTVVVVFEFSVGATLGRGLNRILATFLAGALGFGAHHLANLSGETAHP  130

Query  1370  IILQASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLS  1191
             I++   VFLLAA+ TF RF P +KAR+DYG  IFILTF L+SVSGYR +++L++A +R+S
Sbjct  131   ILIGVFVFLLAASVTFLRFFPRLKARYDYGLLIFILTFCLISVSGYRDEEILEMAHKRVS  190

Query  1190  TIALGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdn  1011
             TI +G    + + + +CPVWAGDDLH  + NN+EKL   LEG   +Y             
Sbjct  191   TILIGAFTAVSVCVFICPVWAGDDLHNSVANNIEKLGSFLEGFGDEYF--------KVAG  242

Query  1010  dkASEKKLL-GYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYC  834
             +  S K LL GY  VLN+K SE++ ANFA WEP HG+F +RHPW+ YLKIG   R CAY 
Sbjct  243   NTESNKALLQGYSSVLNSKQSEESQANFARWEPRHGKFRYRHPWRHYLKIGTLTRQCAYR  302

Query  833   IETLHGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVH  654
             I+TL+G +NS  Q          V E C ++ S  GK L++                   
Sbjct  303   IDTLNGYLNSEIQT-PLNIQSNKVQELCMKMSSESGKALKE-------------------  342

Query  653   DMNSAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQ--ETKSALSDDDDHDLVYL  480
                     L  A KT+  P S + +  + ++ + ++++LK   +T +AL   +    ++L
Sbjct  343   --------LAWALKTMTKPCSAA-SCHITKS-RAAANNLKSLLKTSAALLGSEG---IHL  389

Query  479   MEIAQLSTVASLLVEIAARTEGVVKEVNQLANLA--QFRGQSDKKMAKQSQSQHKEQN  312
             +++    TVASLL ++ +  E + K + +L++ +  QF+     K  +   S     N
Sbjct  390   LDVVPAVTVASLLSDVVSYAEQIEKSIQELSSFSHVQFKSAEPTKALQPCNSSASSTN  447



>gb|KCW50918.1| hypothetical protein EUGRSUZ_J00567 [Eucalyptus grandis]
Length=458

 Score =   317 bits (812),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 194/435 (45%), Positives = 267/435 (61%), Gaps = 41/435 (9%)
 Frame = -3

Query  1655  KAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvga  1476
             K  +LG+ +PR+V+H +KVG ALSLVSL YYL+PLY+  G NAMWAVMTVVVVFE+ VGA
Sbjct  37    KVMKLGQDDPRRVVHSLKVGFALSLVSLIYYLQPLYNSFGINAMWAVMTVVVVFEFYVGA  96

Query  1475  TLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKA  1296
             TL K +NR +AT LAG+LG+G   +A+ +G+  +PI+L   VFL AA  TF RF P IKA
Sbjct  97    TLGKGLNRGLATLLAGALGVGATHLASLTGKTGEPIMLGFFVFLQAAGTTFVRFFPRIKA  156

Query  1295  RFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDL  1116
             ++DYG  IFILTF+LVSVSG+R DK+++ A +RLST+ +G S C+ I++++CPVWAG+DL
Sbjct  157   KYDYGMLIFILTFALVSVSGFREDKIVEFAHKRLSTVVIGGSACLIISIIVCPVWAGEDL  216

Query  1115  HRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMA  936
             H LI +N+EKLA+ LEG   +YL    DGD ++D     E     YK VL TK+ E+++A
Sbjct  217   HLLIASNMEKLANFLEGFEVEYLGESEDGDSNRDKSLFQE-----YKSVLGTKSKEESLA  271

Query  935   NFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSE  756
             NFA WEP HG F FRHPWKQYLK+GAS+R CAY IE L G + +  Q  +   +   + E
Sbjct  272   NFASWEPCHGPFGFRHPWKQYLKVGASIRQCAYRIEALEGYLTTKFQ--APPQVQTRLKE  329

Query  755   ECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTT  576
              C  +     + LR                            L  + KT+  PSS     
Sbjct  330   FCAEMAMEAAEALRQ---------------------------LSSSLKTMATPSSA--IP  360

Query  575   QVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVN  396
              +E+++  +     +  KS L      D   L+ +   +TV SLL++I   T+ + + VN
Sbjct  361   HLEKSRTAA-----KALKSLLKTTSWKDATDLLAVVHATTVTSLLIDITDCTDKIAESVN  415

Query  395   QLANLAQFRGQSDKK  351
             +LA+L  F+     K
Sbjct  416   ELASLTGFKTAEKAK  430



>emb|CDX97489.1| BnaC08g13540D [Brassica napus]
Length=507

 Score =   318 bits (816),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 199/449 (44%), Positives = 281/449 (63%), Gaps = 43/449 (10%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             ++GK++PR+++H  KVGLAL+ VS FYY +PLYD+ G NAMWAVMTVVVVFE++VGATL 
Sbjct  13    RVGKEDPRRIVHAFKVGLALAFVSSFYYYQPLYDNFGVNAMWAVMTVVVVFEFSVGATLG  72

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR VAT +AG LG+G H +A+ SG  ++PI+L   VF+ AA +TF RF P +KAR+D
Sbjct  73    KGINRAVATLVAGGLGVGAHHLASLSGPTIEPILLAIFVFVQAALSTFVRFFPRVKARYD  132

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFSL+SVSG+R D++LDLA +RLST+ +G   C+ I++ +CPVWAG DLH L
Sbjct  133   YGILIFILTFSLISVSGFREDEILDLAHKRLSTVIMGGVSCVLISIFICPVWAGQDLHSL  192

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFA  927
             +  N + L+  L+    +Y  A  DGD  +   +   + L  YK VLN+K++E+A+ANFA
Sbjct  193   LAFNFDTLSHFLQEFGEEYFEATDDGDVKEVEKR--RRNLQRYKIVLNSKSNEEALANFA  250

Query  926   VWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECR  747
              WEP HG+F FRHPWKQYL + A +R CAY I+ L+  INS  Q+ +   + K + E  R
Sbjct  251   KWEPRHGQFRFRHPWKQYLAVAALLRQCAYRIDALNSYINSDFQIPTD--VKKKLEEPLR  308

Query  746   RVCSTCGKVLRDlsklmksttksSIQDILV-HDMNSAVEALQLAFKTLIPPSSQSLTTQV  570
             R+ S  GK +++ S  +K   KSS  DI V H +NS               + + LTT +
Sbjct  309   RMSSESGKSMKEASISLKKMRKSSSYDIHVDHVLNSQ-------------SACKDLTTLL  355

Query  569   EEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQL  390
                            KS + +D     V  + +  L+T  SLL++I   TE V + V++L
Sbjct  356   ---------------KSGILND-----VEPLHMIALTTTVSLLIDIVNLTEKVSESVHEL  395

Query  389   ANLAQFRGQSDKKMAKQSQSQHKEQNVQT  303
             A+ A+F+ +      K + S  K  +V T
Sbjct  396   ASAARFKNKK-----KSTVSSEKSDSVST  419



>gb|EYU38689.1| hypothetical protein MIMGU_mgv1a024010mg [Erythranthe guttata]
Length=475

 Score =   317 bits (812),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 193/450 (43%), Positives = 271/450 (60%), Gaps = 38/450 (8%)
 Frame = -3

Query  1661  IDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytv  1482
             + +  ++G+++PR++IH +KVG AL+LVSLFYY RPLY+  G   MWA++TVVVVFE+TV
Sbjct  16    VKETKRVGEEDPRRIIHAMKVGFALTLVSLFYYFRPLYNGFGQAGMWAILTVVVVFEFTV  75

Query  1481  gaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSI  1302
             G TLSK +NR  AT +AG+LG+G  ++A   G K +P++L   VF LA  +TF+RF P++
Sbjct  76    GGTLSKSLNRGCATLVAGALGVGAEYLAALCGDKGEPVVLGLMVFFLATTSTFTRFFPNV  135

Query  1301  KARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGD  1122
             K ++DYG  IFILTFSLV+VSG+RVD++L LA +RLSTI +G + CI I++ +CPVWAG 
Sbjct  136   KRKYDYGVLIFILTFSLVAVSGFRVDQILHLAHRRLSTILIGGASCIVISIFVCPVWAGQ  195

Query  1121  DLHRLITNNLEKLADSLEGCISDYLnad--gdgdddkdndkASEKKLL-GYKCVLNTKAS  951
             DLH LI  N+EKL   LEG  +++L       G  +       +K  L GYK VLN+KA+
Sbjct  196   DLHNLIAANIEKLGAFLEGFGTEFLIFHGDESGKINSSCKHGDQKSFLEGYKSVLNSKAT  255

Query  950   EDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYIL  771
             E+++ANFA WEP HGRF F HPWKQYLKIGA  R CA  I++L+G INS +Q      + 
Sbjct  256   EESLANFAWWEPPHGRFRFNHPWKQYLKIGALARDCACLIQSLNGYINSKSQSLVESEVK  315

Query  770   KPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSS  591
               + E C ++    GK L+                    ++ SAV+    AF  L+   +
Sbjct  316   MKIKESCMKMSMESGKALK--------------------ELASAVKT--TAFHPLLAAGA  353

Query  590   QSLTTQVEEAQKPSSDHLK--QETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
                     +  K ++D LK   E  S LS   D     L EI  L  VAS+L++I    +
Sbjct  354   HL------QNSKSAADDLKIALENSSLLSAKAD-----LQEIMPLLVVASVLIDINDGVD  402

Query  416   GVVKEVNQLANLAQFRGQSDKKMAKQSQSQ  327
              + + VN+L+  A F+       A +   Q
Sbjct  403   KIYESVNELSLKACFKNNPKSSKACELHQQ  432



>ref|XP_006417690.1| hypothetical protein EUTSA_v10009830mg [Eutrema salsugineum]
 gb|ESQ36043.1| hypothetical protein EUTSA_v10009830mg [Eutrema salsugineum]
Length=473

 Score =   316 bits (810),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 193/438 (44%), Positives = 274/438 (63%), Gaps = 39/438 (9%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++   + +  ++GK++PR+V+H  KVGLAL+LVS FYY +PLYD+ G NAMWAVMTVVVV
Sbjct  3     KVREIVREGRRVGKEDPRRVVHAFKVGLALALVSSFYYYQPLYDNFGVNAMWAVMTVVVV  62

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE++VGATL K +NR VAT +AG LGIG H +A+ SG  ++PI+L   VF+ AA +TF R
Sbjct  63    FEFSVGATLGKGINRAVATLVAGGLGIGAHHLASFSGPTIEPILLAIFVFVQAALSTFVR  122

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P +KAR+DYG  IFILTFSL+SVSG+R D++L+LA +RLST+ +G   C+ I++ +CP
Sbjct  123   FFPRVKARYDYGILIFILTFSLISVSGFREDEILELAHKRLSTVIMGGVSCVLISIFVCP  182

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG DLH L+ +N + L+  L     +Y   +   D D    +   + L  YK VLN+K
Sbjct  183   VWAGQDLHSLLVSNFDTLSHFLLEFGDEYF--EATEDGDIKEVEKRRRNLERYKVVLNSK  240

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             ++E+A+ANFA WEP HG+F FRHPWKQYL + A +R CAY I+ L+  INS  Q+     
Sbjct  241   SNEEALANFAKWEPRHGQFRFRHPWKQYLAVAALLRQCAYRIDALNSYINSDFQIPMD--  298

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
             I K + E  RR+ +  GK +++ S  +K  TKSS  DI V +  SA +AL    K+ I  
Sbjct  299   IKKKLEEPLRRMSTESGKSMKEASIGLKKMTKSSSSDIHVLNSQSACKALSTLLKSGI--  356

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
                                        L+D +   ++ LM      T  SLL++I   TE
Sbjct  357   ---------------------------LNDVEPLQMISLM------TTISLLIDIVNLTE  383

Query  416   GVVKEVNQLANLAQFRGQ  363
              + + V++LA+ A+F+ +
Sbjct  384   KISESVHELASAARFKNK  401



>emb|CDY31146.1| BnaA08g26960D [Brassica napus]
Length=498

 Score =   317 bits (813),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 194/437 (44%), Positives = 272/437 (62%), Gaps = 42/437 (10%)
 Frame = -3

Query  1682  VLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvv  1503
             V  IW    +  ++GK++PR+++H  KVGLAL+LVS FYY +PLYD+ G NAMWAVMTVV
Sbjct  4     VREIWK---EGRRVGKEDPRRIVHSFKVGLALALVSSFYYYQPLYDNFGVNAMWAVMTVV  60

Query  1502  vvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATF  1323
             VVFE++VGATL K +NR VAT +AG LG+G H +A+ SG  ++PI+L   VF  AA +TF
Sbjct  61    VVFEFSVGATLGKGINRAVATLVAGGLGVGAHHLASLSGPTVEPILLAIFVFAQAALSTF  120

Query  1322  SRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLL  1143
              RF P +KAR+DYG  IFILTFSL+SVSG+R D++LDLA +RLST+ +G   C+ I++ +
Sbjct  121   VRFFPRVKARYDYGILIFILTFSLISVSGFREDEILDLAHKRLSTVIMGGVSCVLISIFI  180

Query  1142  CPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLN  963
             CPVWAG DLH L+ +N + L+  L+    +Y   +   D D    +   + L  YKCVLN
Sbjct  181   CPVWAGQDLHSLLASNFDTLSRFLQEFGDEYF--EETDDGDVKEVEKRRRNLEKYKCVLN  238

Query  962   TKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSA  783
             +K++E+A+ANFA WEP HG+F FRHPWKQYL + A +R CAY ++ L+  INS  Q+   
Sbjct  239   SKSNEEALANFAKWEPRHGQFRFRHPWKQYLAVAALLRQCAYRMDALNSYINSDFQIPMD  298

Query  782   EYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLI  603
               I K + E  R++ S  GK +++ S  +K   KSS  DI V +  SA + L    K+ I
Sbjct  299   --IKKKLEEPLRKMSSESGKSMKEASISLKKMRKSSSSDIHVLNSQSACKDLSTLLKSGI  356

Query  602   PPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAAR  423
                                          L+D      V  +++  L+T  SLL++I   
Sbjct  357   -----------------------------LND------VEPLQMIALTTTVSLLIDIVNL  381

Query  422   TEGVVKEVNQLANLAQF  372
             TE V + V++LA+ A+F
Sbjct  382   TEKVSQSVHELASAARF  398



>ref|XP_006407423.1| hypothetical protein EUTSA_v10022400mg [Eutrema salsugineum]
 gb|ESQ48876.1| hypothetical protein EUTSA_v10022400mg [Eutrema salsugineum]
Length=491

 Score =   317 bits (812),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 184/470 (39%), Positives = 272/470 (58%), Gaps = 54/470 (11%)
 Frame = -3

Query  1688  GFVLRIWSFIDK-----------AWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDD  1542
             GF+ R+ +F+ K             + GK +PR++IH +KVG +L+LVS+ YY+RPLY+ 
Sbjct  11    GFLQRVKAFLSKLKDGVTKRIRNIQKFGKDDPRRIIHSIKVGFSLTLVSMLYYVRPLYNS  70

Query  1541  VGGNAMWAvmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIIL  1362
              G + MWA++TVVVV E+TVG TLSK +NR  AT +AG+LG+G   +A   G K +PI+L
Sbjct  71    FGVSGMWAILTVVVVSEFTVGGTLSKGLNRGFATLIAGALGVGAVHLARFCGHKGEPIVL  130

Query  1361  QASVFLLAAAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIA  1182
                VF L AAATFSRF P IK R+DYG  IFILTF++V+VSGYR D++L +A QR+STI 
Sbjct  131   GILVFSLGAAATFSRFFPRIKQRYDYGALIFILTFTMVAVSGYRTDEILVMAYQRISTIL  190

Query  1181  LGTSICIFIAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkA  1002
             +G +ICI +++ +CPVWAG+DLH++I NN+ KLA+ LEG   +Y         + ++   
Sbjct  191   IGGTICILVSIFVCPVWAGEDLHKMIANNINKLANYLEGFEGEYFALPEKISKETNSCVR  250

Query  1001  SEKKLLGYKCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETL  822
                    YK +L +K++ED +AN A WEPGHGRF  RHPWK Y+KI   +R CA+  E L
Sbjct  251   E------YKSILTSKSTEDTLANLARWEPGHGRFRLRHPWKNYMKIAGLVRQCAFHFEIL  304

Query  821   HGSINSSAQVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSI-QDILVHDMN  645
             +G I S   V + E  +  + E C  +    G+ L+ ++  +K+    S+  +  + +  
Sbjct  305   NGYILS--DVKAPEDFISKIQEPCSIMSREAGEALKAIANSIKTMNNDSVCVNAHIENSK  362

Query  644   SAVEALQLAFKTLIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQ  465
              A+E ++ AFK        S +T+ E+                           L+E   
Sbjct  363   KAIENVKFAFK--------SSSTETEKD--------------------------LLEFIP  388

Query  464   LSTVASLLVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHKEQ  315
               T+AS+LVEI    E + + V +   LA F+   D K++ + + QH   
Sbjct  389   GVTMASILVEIVNSVEKISEAVEEFFGLAHFKETLDPKLSPELEQQHHHH  438



>ref|XP_010543839.1| PREDICTED: aluminum-activated malate transporter 8 [Tarenaya 
hassleriana]
Length=495

 Score =   317 bits (812),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 191/446 (43%), Positives = 261/446 (59%), Gaps = 39/446 (9%)
 Frame = -3

Query  1661  IDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytv  1482
             ++ A +LGK +PR+VIH +KVGLAL+LVSL YY+RPLY+  G + MWAV+TVVVVFE+TV
Sbjct  33    VNNAKKLGKDDPRRVIHSMKVGLALTLVSLLYYVRPLYNSFGVSGMWAVLTVVVVFEFTV  92

Query  1481  gaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSI  1302
             G TLSK +NR  AT  AG+LG+G   +A+  G K +PI+L      L AAATFSRF P I
Sbjct  93    GGTLSKGINRGFATLSAGALGVGSVHLASLFGHKGEPIVLGIXXXXLGAAATFSRFFPRI  152

Query  1301  KARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGD  1122
             K R+DYGC IFILTFS+V+VSGYR D++L +A QRLSTI +G +IC+ + + +CPVWAG+
Sbjct  153   KQRYDYGCLIFILTFSMVAVSGYRTDEILVMAYQRLSTILIGGTICMLVCIFICPVWAGE  212

Query  1121  DLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDA  942
             DLH L+ NN++KL   LEG   +Y          + + K ++  L GYK VL +++ E+ 
Sbjct  213   DLHELVANNIDKLGTFLEGFSGEYF------QTIEKSSKEAKSSLQGYKSVLTSRSIEET  266

Query  941   MANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPV  762
             +AN A WEPGHGRF  RHPWKQYLKIGA +R CA+ IE L+G + S   V + +     +
Sbjct  267   LANLARWEPGHGRFRLRHPWKQYLKIGALVRQCAFHIEILNGYVPS--DVKAPQEFQSRI  324

Query  761   SEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSL  582
              E C  +    G+ LR                 ++ +    +  L    KT I       
Sbjct  325   QEPCTALTREIGEALR-----------------VLSESVKTMRKLDDPAKTHI-------  360

Query  581   TTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKE  402
                  E  K S   L+   KS  S  D      L+EI   +TV S+L ++    E +   
Sbjct  361   -----ENSKESVRKLRSALKSTSSPPDSAR--ELLEIIPGATVVSILTDVVKCIESISAA  413

Query  401   VNQLANLAQFRGQSDKKMAKQSQSQH  324
             V +LA  A F    +  ++ +   QH
Sbjct  414   VEELAVQAHFTAGVEPTVSPEKLGQH  439



>ref|XP_007132493.1| hypothetical protein PHAVU_011G098800g [Phaseolus vulgaris]
 gb|ESW04487.1| hypothetical protein PHAVU_011G098800g [Phaseolus vulgaris]
Length=477

 Score =   316 bits (810),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 196/445 (44%), Positives = 269/445 (60%), Gaps = 39/445 (9%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             ++ + +PRKVIH +KVGLA+SLVSLFYY +PLY++ G +AMWAVMTVVVVFEYTVGATL 
Sbjct  37    EIAQDDPRKVIHSLKVGLAISLVSLFYYYQPLYENFGLSAMWAVMTVVVVFEYTVGATLG  96

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NRT+AT  AG+LG+G H++A+ SG   +PI++ A VF+ AA A+F RF P +KAR+D
Sbjct  97    KGLNRTIATLAAGALGVGAHYLASLSGATGEPILIGAFVFVQAAIASFIRFFPKVKARYD  156

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFSL+SVSG+R  ++L++A +RLSTI +G S C+ I++ +CPVWAG++ H  
Sbjct  157   YGMLIFILTFSLISVSGFREVEVLEMAHKRLSTIFIGGSACVMISIFVCPVWAGEEFHYS  216

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNTKASEDAMANF  930
             I + LE L D +E  + +Y +   +G+ +     + +K  L GYK VLN+K+ +D++ANF
Sbjct  217   IAHKLEILGDFMEAFVHEYFDQPEEGESEDSKGDSKDKSFLEGYKKVLNSKSLDDSLANF  276

Query  929   AVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEEC  750
             A WEPGHG+F FRHPW  YLKIGA  R CAY +E L   INS  + GS E+    + E C
Sbjct  277   AKWEPGHGKFRFRHPWDLYLKIGALSRQCAYRMEALDAHINSDIK-GSHEF-RSTIQELC  334

Query  749   RRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQV  570
               +     K  ++                           L  + +T+  PSS    T V
Sbjct  335   SEMSLESSKAFKE---------------------------LGSSIRTMTRPSSSD--THV  365

Query  569   EEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQL  390
               A+            S+    D      L+ +   +TVASLL++I   TE +   VN L
Sbjct  366   ANAKAAVKSLKSLLQSSSRKQTD------LLSLIPAATVASLLIDILEITEKIADSVNDL  419

Query  389   ANLAQFR-GQSDKKMAKQSQSQHKE  318
             A LA F    +DK     SQS H E
Sbjct  420   ATLANFEVVDTDKSPKVPSQSSHCE  444



>ref|XP_007205300.1| hypothetical protein PRUPE_ppa006760mg [Prunus persica]
 gb|EMJ06499.1| hypothetical protein PRUPE_ppa006760mg [Prunus persica]
Length=396

 Score =   313 bits (801),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 167/323 (52%), Positives = 222/323 (69%), Gaps = 10/323 (3%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++  F  K  +LG+ +PR+++H +KVGLA+ LVSL YY +PLYD +G  AMWAV+TVVVV
Sbjct  3     KVVEFPRKLKKLGQDDPRRIVHSLKVGLAVLLVSLLYYFQPLYDGLGATAMWAVLTVVVV  62

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE++VGATL + +NR +ATFLAG+LG GVH +AN SG+   PI++   VFLLAA+ TF R
Sbjct  63    FEFSVGATLGRGLNRILATFLAGALGFGVHHLANLSGKTAHPILIGVFVFLLAASVTFLR  122

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P +KAR+DYG  IFILTF L+SVSGYR +++L++A +R+STI +G    +F+ +L+CP
Sbjct  123   FFPRLKARYDYGLLIFILTFCLISVSGYRDEEILEMAHKRVSTILIGAFTAVFVCVLICP  182

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNT  960
             VWAGDDLH  + NN+EKL   LEG   +Y             +  S K LL GY  VLN+
Sbjct  183   VWAGDDLHNSVANNIEKLGSFLEGFGDEYF--------KVAGNAESNKALLQGYSSVLNS  234

Query  959   KASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAE  780
             K SE++ ANFA WEP HG+F +RHPWK YLKIG   R CAY I+TL+G +NS  Q     
Sbjct  235   KQSEESQANFARWEPRHGKFRYRHPWKHYLKIGTLTRQCAYRIDTLNGYLNSEIQT-PLN  293

Query  779   YILKPVSEECRRVCSTCGKVLRD  711
                  V E C ++ S  GK L++
Sbjct  294   IQSNKVQELCMKMSSESGKALKE  316



>ref|XP_009110894.1| PREDICTED: aluminum-activated malate transporter 2-like [Brassica 
rapa]
Length=510

 Score =   316 bits (810),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 194/437 (44%), Positives = 272/437 (62%), Gaps = 42/437 (10%)
 Frame = -3

Query  1682  VLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvv  1503
             V  IW    +  ++GK++PR+++H  KVGLAL+LVS FYY +PLYD+ G NAMWAVMTVV
Sbjct  8     VREIWK---EGRRVGKEDPRRIVHSFKVGLALALVSSFYYYQPLYDNFGVNAMWAVMTVV  64

Query  1502  vvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATF  1323
             VVFE++VGATL K +NR VAT +AG LG+G H +A+ SG  ++PI+L   VF  AA +TF
Sbjct  65    VVFEFSVGATLGKGINRAVATLVAGGLGVGAHHLASLSGPTVEPILLAIFVFAQAALSTF  124

Query  1322  SRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLL  1143
              RF P +KAR+DYG  IFILTFSL+SVSG+R D++LDLA +RLST+ +G   C+ I++ +
Sbjct  125   VRFFPRVKARYDYGILIFILTFSLISVSGFREDEILDLAHKRLSTVIMGGVSCVLISIFI  184

Query  1142  CPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLN  963
             CPVWAG DLH L+ +N + L+  L+    +Y   +   D D    +   + L  YKCVLN
Sbjct  185   CPVWAGQDLHSLLASNFDTLSRFLQEFGDEYF--EETDDGDVKEVEKRRRNLEKYKCVLN  242

Query  962   TKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSA  783
             +K++E+A+ANFA WEP HG+F FRHPWKQYL + A +R CAY ++ L+  INS  Q+   
Sbjct  243   SKSNEEALANFAKWEPRHGQFRFRHPWKQYLAVAALLRQCAYRMDALNSYINSDFQIPMD  302

Query  782   EYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLI  603
               I K + E  R++ S  GK +++ S  +K   KSS  DI V +  SA + L    K+ I
Sbjct  303   --IKKKLEEPLRKMSSESGKSMKEASISLKKMRKSSSSDIHVLNSQSACKDLSTLLKSGI  360

Query  602   PPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAAR  423
                                          L+D      V  +++  L+T  SLL++I   
Sbjct  361   -----------------------------LND------VEPLQMIALTTTVSLLIDIVNL  385

Query  422   TEGVVKEVNQLANLAQF  372
             TE V + V++LA+ A+F
Sbjct  386   TEKVSQSVHELASAARF  402



>ref|XP_002889694.1| hypothetical protein ARALYDRAFT_334132 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65953.1| hypothetical protein ARALYDRAFT_334132 [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score =   316 bits (810),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 198/468 (42%), Positives = 281/468 (60%), Gaps = 49/468 (10%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++   + +  ++GK++PR+V+H  KVGLAL+LVS FYY +PLYD+ G NAMWAVMTVVVV
Sbjct  3     KVREIVREGRRVGKEDPRRVVHAFKVGLALALVSSFYYCQPLYDNFGVNAMWAVMTVVVV  62

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE++VGATL K +NR VAT +AG LGIG H +A+ SG  ++PI+L   VF+ AA +TF R
Sbjct  63    FEFSVGATLGKGLNRAVATLVAGGLGIGAHHLASLSGPTVEPILLAIFVFVQAALSTFVR  122

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P +KAR+DYG  IFILTF+L+SVSG+R D++LDLA +RLST+ +G   C+ I++ +CP
Sbjct  123   FFPRVKARYDYGVLIFILTFALISVSGFREDEILDLAHKRLSTVIMGGVSCVLISIFVCP  182

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG DLH L+ +N + LA  L+    +Y   +   D D    +   + L  YK VLN+K
Sbjct  183   VWAGQDLHSLLASNFDTLAHFLQEFGDEYF--EATEDGDIKEVEKRRRNLERYKSVLNSK  240

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             ++E+A+ANFA WEP HG+F FRHPWKQY+ +GA +R CA  I+ L+ +INS  Q+     
Sbjct  241   SNEEALANFAKWEPRHGQFRFRHPWKQYIAVGALLRQCACRIDALNSNINSDMQIPMD--  298

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
             I K + E  RR+ S  GK ++++S  +K  TKSS  DI V +  SA + L    K+ I  
Sbjct  299   IKKKLEEPLRRMSSESGKSMKEVSISLKKMTKSSSFDIHVVNSQSACKTLSTLLKSGI--  356

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
                                        L D      V  +++  L T  SL ++I   TE
Sbjct  357   ---------------------------LKD------VEPLQMISLMTTVSLFIDIVNLTE  383

Query  416   GVVKEVNQLANLAQFR----------GQSDKKMAKQSQSQHKEQNVQT  303
              + + V++LA+ A+F+          G+    M  +S   H    V T
Sbjct  384   KISESVHELASAAKFKNKTKPSRSDSGRIGHDMPNKSHDDHHRHRVVT  431



>ref|XP_002298271.2| hypothetical protein POPTR_0001s22510g [Populus trichocarpa]
 gb|EEE83076.2| hypothetical protein POPTR_0001s22510g [Populus trichocarpa]
Length=450

 Score =   314 bits (805),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 195/458 (43%), Positives = 281/458 (61%), Gaps = 53/458 (12%)
 Frame = -3

Query  1652  AW---QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytv  1482
             AW   +LG+++PR+V+H +KVGLAL+LVS  YYL  L    G +A+WAVMTVV+VFE++V
Sbjct  2     AWNIKKLGQEDPRRVVHSLKVGLALTLVSTLYYLS-LSKTFGVDAIWAVMTVVLVFEFSV  60

Query  1481  gaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSI  1302
             GATL K +NR +AT LAG L IG H +A  +G   QPI++   VFL A  +TF RF P I
Sbjct  61    GATLGKGLNRGMATLLAGGLSIGAHHLAKLTGHTGQPILILFLVFLQATISTFLRFFPKI  120

Query  1301  KARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGD  1122
             KAR+DYG  IFILTFS+++VSG+R D++L+LA +RLST+++G + C+ +++++ PVWAG+
Sbjct  121   KARYDYGMLIFILTFSMITVSGFRQDQILELAHKRLSTVSIGAAACVIVSIVVFPVWAGE  180

Query  1121  DLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNTKASED  945
             DLH LI  N+EKL +SLEG   +Y             +   +KK L GYK VLN+K SE+
Sbjct  181   DLHNLIALNIEKLGNSLEGFGDEYF------KRTGGEESKDDKKFLEGYKSVLNSKNSEE  234

Query  944   AMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKP  765
             ++ANFA WEP HGRF FRHPWK YLK+G   R CAY I+ L+G +N+  Q  S   +   
Sbjct  235   SLANFAAWEPCHGRFPFRHPWKLYLKVGTLARECAYRIQALNGCLNADIQASSE--VSNI  292

Query  764   VSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQS  585
             + E C ++    GK L++                           L LA K ++ PSS  
Sbjct  293   IQEACTKMSRESGKSLKE---------------------------LALAIKIMVQPSSAD  325

Query  584   LTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVK  405
               + +E A K ++ ++K   KS + +D D     L+++    TVAS+L+++   TE + +
Sbjct  326   --SHIENA-KSAAKNIKSLLKSGIWEDID-----LLKVIPGVTVASILIDVVTYTEKISE  377

Query  404   EVNQLANLAQFRG----QSDKKM-AKQSQSQHKEQNVQ  306
              + +LA+ AQF+      S KK+ + Q+QS    Q V 
Sbjct  378   SIYELASKAQFKSVEPTLSPKKLHSGQNQSVKSAQIVN  415



>ref|XP_008799710.1| PREDICTED: aluminum-activated malate transporter 1-like [Phoenix 
dactylifera]
Length=451

 Score =   314 bits (804),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 189/438 (43%), Positives = 263/438 (60%), Gaps = 46/438 (11%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             R+  F++K  ++ K +PR++ H  KVGLAL+LVS  YY+ PL+D  G +A+WAV+TVVVV
Sbjct  30    RVTGFLNKLKKIAKDDPRRIAHSCKVGLALTLVSFSYYVTPLFDGFGVSAIWAVLTVVVV  89

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
              EYTVGATLSK +NR  AT LA  LG+G H +A   G+K +PI+L   VF+LAAAATFSR
Sbjct  90    MEYTVGATLSKGLNRAFATLLAAFLGVGAHQIAILFGEKGEPILLGLFVFILAAAATFSR  149

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             FIP IKAR+DYG +IFILTFSLV+VS YR ++L+ LA QRLSTI +G   C+   + + P
Sbjct  150   FIPEIKARYDYGVSIFILTFSLVAVSSYRAEELIQLAHQRLSTIVIGVVTCLCTTIFVIP  209

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG+DLH+L   NL+KLA  LEG  S+ L      +  +      +  L  +K VLN+K
Sbjct  210   VWAGEDLHKLAAVNLDKLASFLEGLGSECLGEKVGSESLE-----GKPFLQVHKSVLNSK  264

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
              +ED++ NFA WEPGHGRF FRHPWKQYLKIGA  R CA  +E L   I +SA+  + + 
Sbjct  265   PTEDSLCNFARWEPGHGRFRFRHPWKQYLKIGALNRRCASSMEALTTYITTSAETQATKE  324

Query  776   --ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLI  603
               + + +   C  + S   K LR+                           L  A +T+ 
Sbjct  325   PELRQKIRTACLEMSSESAKALRE---------------------------LSKAIRTMT  357

Query  602   PPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAAR  423
              P+S +           ++     E +S LS D D     + ++  ++T+A+L+ E+  R
Sbjct  358   APASAN-------PHMAAAIAATGELRSTLSKDAD-----IADVLHVATIATLVAELVVR  405

Query  422   TEGVVKEVNQLANLAQFR  369
             T+ +   V +LA LA+F+
Sbjct  406   TQEIFGSVEELARLARFK  423



>ref|NP_172320.1| aluminum-activated malate transporter 2 [Arabidopsis thaliana]
 sp|Q9SJE8.2|ALMT2_ARATH RecName: Full=Aluminum-activated malate transporter 2; Short=AtALMT2 
[Arabidopsis thaliana]
 gb|AEE28290.1| aluminum-activated malate transporter 2 [Arabidopsis thaliana]
Length=501

 Score =   315 bits (807),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 191/433 (44%), Positives = 273/433 (63%), Gaps = 39/433 (9%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++   + +  ++GK++PR+V+H  KVGLAL+LVS FYY +PLYD+ G NAMWAVMTVVVV
Sbjct  3     KVREIVREGRRVGKEDPRRVVHAFKVGLALALVSSFYYYQPLYDNFGVNAMWAVMTVVVV  62

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE++VGATL K +NR VAT +AG LGIG H +A+ SG  ++PI+L   VF+LAA +TF R
Sbjct  63    FEFSVGATLGKGLNRAVATLVAGGLGIGAHHLASLSGPTVEPILLAIFVFVLAALSTFVR  122

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P +KAR+DYG  IFILTF+L+SVSG+R D++LDLA +RLST+ +G   C+ I++ +CP
Sbjct  123   FFPRVKARYDYGVLIFILTFALISVSGFREDEILDLAHKRLSTVIMGGVSCVLISIFVCP  182

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG DLH L+ +N + L+  L+    +Y   +   D D    +   + L  YK VLN+K
Sbjct  183   VWAGQDLHSLLASNFDTLSHFLQEFGDEYF--EATEDGDIKEVEKRRRNLERYKSVLNSK  240

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             ++E+A+ANFA WEP HG+F FRHPW+QYL +GA +R  AY I+ L+ +INS  Q+     
Sbjct  241   SNEEALANFAKWEPRHGQFRFRHPWRQYLAVGALLRQSAYRIDALNSNINSDMQIPMD--  298

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
             I K + E  RR+ S  GK ++++S  +K+ T SS  DI V +  SA + L    K+ I  
Sbjct  299   IKKKIEEPLRRMSSESGKSMKEVSISLKNMTISSSFDIHVVNSQSACKTLSTLLKSGI--  356

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
                                        L+D      V  +++  L T  SLL++I   TE
Sbjct  357   ---------------------------LND------VEPLQMISLMTTVSLLIDIVNLTE  383

Query  416   GVVKEVNQLANLA  378
              + + V++LA+ A
Sbjct  384   KISESVHELASAA  396



>ref|XP_011003846.1| PREDICTED: aluminum-activated malate transporter 2-like isoform 
X3 [Populus euphratica]
Length=386

 Score =   311 bits (797),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 176/355 (50%), Positives = 236/355 (66%), Gaps = 16/355 (5%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             ++G+ +PR+VIH +KVGLAL+LVS+FYY +PLY + G  AMWA+MTVVVVFE++VGATL 
Sbjct  41    KVGQDDPRRVIHSLKVGLALALVSIFYYYQPLYSNFGVTAMWAIMTVVVVFEFSVGATLG  100

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR +AT LA +LG+G H +AN SG   +PI+L + VFL AA +TF RF P IKAR+D
Sbjct  101   KGLNRGMATLLASALGVGAHHLANLSGHVGEPILLGSLVFLQAAISTFLRFFPKIKARYD  160

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFSL+S+SG+R D++L+LA +R+ TI +G   C+ I++++ PVWAG+DLH L
Sbjct  161   YGLLIFILTFSLISISGFRDDEILELAHKRVLTIFVGGCACVIISIVVFPVWAGEDLHNL  220

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFA  927
             I  N+EKL + LEG   +Y              K  +K L GYK VLN+K  E+++ANFA
Sbjct  221   IALNIEKLGNFLEGFGDEYF-----KRTGDAGSKDDKKYLEGYKSVLNSKTGEESLANFA  275

Query  926   VWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECR  747
              WEPGHGRF FRHPWKQYLK+G   R CAY IE L+G +N+  Q  S   +   + E C 
Sbjct  276   AWEPGHGRFQFRHPWKQYLKVGTLARECAYRIEALNGYLNADIQASSE--VRSRIQEACT  333

Query  746   RVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSL  582
              +    GK L++LS  +K      +Q ++             A KTL+ PS  SL
Sbjct  334   NMSIESGKALKELSLTIKKMGLQWLQSLM---------KWSNALKTLLNPSMNSL  379



>gb|KCW44681.1| hypothetical protein EUGRSUZ_L01785, partial [Eucalyptus grandis]
Length=430

 Score =   312 bits (800),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 188/426 (44%), Positives = 263/426 (62%), Gaps = 43/426 (10%)
 Frame = -3

Query  1643  LGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSK  1464
             LG+ +PR+V H +KVGLALSLVSLFYYL+PLY+  G NAMWAVMTVV++FE+ VGAT S+
Sbjct  41    LGQDDPRRVTHSLKVGLALSLVSLFYYLQPLYEGFGVNAMWAVMTVVLIFEFHVGATFSR  100

Query  1463  CVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDY  1284
              +NR +AT + G++G+G H +A+ SG+  QPI+L   VFL AA  TF RF P IKA++DY
Sbjct  101   GLNRLLATVIGGAIGLGAHHLASLSGKTGQPIMLSFFVFLQAAGITFMRFFPRIKAKYDY  160

Query  1283  GCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLI  1104
             G  I ILTF+LVSVSG+R DK+ + A +RLST+ +G+S C+ +++++CPVWAG+DLHRLI
Sbjct  161   GMMILILTFALVSVSGFREDKIFEFAHKRLSTVVIGSSACLIVSVIVCPVWAGEDLHRLI  220

Query  1103  TNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAV  924
               N+EKLA+ LEG   +YL    D D ++D     E     YK VL TK+ E+++A F+ 
Sbjct  221   VLNVEKLANFLEGFGDEYLRKLEDSDLNQDKSLFRE-----YKSVLETKSEEESLAIFSS  275

Query  923   WEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKP-VSEECR  747
             WEP HGRF FRHPWKQYLKIGA +R CAY IE L   + +       ++   P V     
Sbjct  276   WEPRHGRFGFRHPWKQYLKIGALIRQCAYRIEALDSYLTT-------KFHAPPQVQTRLE  328

Query  746   RVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVE  567
              +C+  G                        +   A + L  + KT+  PSS   T  +E
Sbjct  329   ELCAEMGI-----------------------EAARASKQLSSSLKTMTTPSSA--TPHLE  363

Query  566   EAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLA  387
             +A+  +     +  KS L     +    L+ +    TV SLL+++   T+ + + VN+LA
Sbjct  364   KARNAA-----KALKSLLKTTSWNHATDLLAVVHAITVTSLLIDVIDCTDKIAESVNELA  418

Query  386   NLAQFR  369
             +LA F+
Sbjct  419   SLAGFK  424



>ref|XP_010034240.1| PREDICTED: aluminum-activated malate transporter 2-like [Eucalyptus 
grandis]
 gb|KCW50915.1| hypothetical protein EUGRSUZ_J00563 [Eucalyptus grandis]
Length=439

 Score =   313 bits (801),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 190/430 (44%), Positives = 270/430 (63%), Gaps = 43/430 (10%)
 Frame = -3

Query  1655  KAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvga  1476
             K  +LGK + R++ H +KVG ALSLVSL YY +PLY+  G +AMWAVMTVVVVFE  VGA
Sbjct  10    KKMKLGKDDKRRITHSLKVGFALSLVSLIYYCQPLYNSFGVSAMWAVMTVVVVFELHVGA  69

Query  1475  TLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKA  1296
             TLSK +NR +ATF AG+LG+G H +A+ SG+  +PI+L   VFL A ++TF RF P +KA
Sbjct  70    TLSKGLNRGLATFFAGALGVGAHHLASLSGKTGEPIMLGFFVFLQATSSTFIRFFPRVKA  129

Query  1295  RFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDL  1116
             ++DYG  IFILTF+LVSVSG+R D++L  A +RLSTI +G S C+ I++++CPVWAG+DL
Sbjct  130   KYDYGMLIFILTFALVSVSGFREDEILVFAHKRLSTIVIGGSACLIISVIVCPVWAGEDL  189

Query  1115  HRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNTKASEDAM  939
             H LI  N+EKLA+ LEG  + YL       + +D+D    K LL GYK VL TK++E+++
Sbjct  190   HLLIALNMEKLANFLEGFGNGYL------RESEDSDSNKNKSLLQGYKSVLGTKSNEESL  243

Query  938   ANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVS  759
             ANFA WEP HG F FRHPWKQYLKIGA +R CAY IETL   + +  +  +   +   + 
Sbjct  244   ANFASWEPRHGWFGFRHPWKQYLKIGALIRQCAYRIETLDSYLTT--KFHAPPQVQTRLE  301

Query  758   EECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLT  579
             E C  +     + L+                            L  + KT+  PSS   T
Sbjct  302   ELCLEMSREAARALKQ---------------------------LASSHKTMTVPSSA--T  332

Query  578   TQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEV  399
               +E+++  ++        ++  D++DH     + +   +TV SLL+++   T+ + + V
Sbjct  333   PHLEKSRTAATALKSVLKTTSWKDENDH-----LTVIHAATVTSLLLDVIDCTDKIAESV  387

Query  398   NQLANLAQFR  369
             N+LA+LA+F+
Sbjct  388   NELASLARFK  397



>ref|XP_010034242.1| PREDICTED: aluminum-activated malate transporter 2-like [Eucalyptus 
grandis]
Length=436

 Score =   312 bits (799),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 191/432 (44%), Positives = 268/432 (62%), Gaps = 47/432 (11%)
 Frame = -3

Query  1655  KAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvga  1476
             +A +LG+ +PR+V H +KVGLALSLVSLFYYL+PLY+  G NAMWAVMTVVV+FE+ VGA
Sbjct  10    RAVKLGQDDPRRVTHSLKVGLALSLVSLFYYLQPLYEGFGVNAMWAVMTVVVIFEFHVGA  69

Query  1475  TLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKA  1296
             T S+ +NR +AT L G++G+G H +A+ SG+  QPI+L   VFL AA  TF RF P IKA
Sbjct  70    TFSRGLNRLLATVLGGAIGLGAHHLASLSGKTGQPIMLSFFVFLQAAGITFMRFFPRIKA  129

Query  1295  RFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDL  1116
             ++DYG  I ILTF+LVSVSG+R DK+ + A +RLST+ +G+S C+ +++++CPVWAG+DL
Sbjct  130   KYDYGMLILILTFALVSVSGFREDKIFEFAHKRLSTVVIGSSACLIVSVIVCPVWAGEDL  189

Query  1115  HRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMA  936
             HRLI  N+EKLA+ LEG   +YL    D D ++D     E     YK VL TK+ E+++A
Sbjct  190   HRLIALNVEKLANFLEGFGDEYLRKLEDSDLNQDKSLFRE-----YKSVLETKSKEESLA  244

Query  935   NFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKP-VS  759
              FA WEP HGRF +RHPWKQYLKIGA +R CAY IE +   +       + ++   P V 
Sbjct  245   IFASWEPSHGRFGYRHPWKQYLKIGALIRQCAYRIEAIDSYL-------TIKFHAPPQVQ  297

Query  758   EECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQL--AFKTLIPPSSQS  585
                  +C+  G                         M +A  + QL  + KT+  PSS  
Sbjct  298   TRLEELCAEMG-------------------------MEAARASKQLSSSLKTMTTPSSA-  331

Query  584   LTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVK  405
              T  +E+A+  +     +  KS L     +    ++ +    TV SLL+++   T+ + +
Sbjct  332   -TPHLEKARTAA-----KALKSLLKTTSWNHATDILAVIPTITVTSLLIDVIDCTDKIAE  385

Query  404   EVNQLANLAQFR  369
              VN+LA+LA F+
Sbjct  386   SVNELASLAGFK  397



>ref|XP_010041054.1| PREDICTED: aluminum-activated malate transporter 2-like [Eucalyptus 
grandis]
Length=436

 Score =   312 bits (799),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 187/425 (44%), Positives = 260/425 (61%), Gaps = 41/425 (10%)
 Frame = -3

Query  1643  LGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSK  1464
             LG+ +PR+V H +KVGLALSLVSLFYYL+PLY+  G NAMWAVMTVV++FE+ VGAT S+
Sbjct  14    LGQDDPRRVTHSLKVGLALSLVSLFYYLQPLYEGFGVNAMWAVMTVVLIFEFHVGATFSR  73

Query  1463  CVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDY  1284
              +NR +AT + G++G+G H +A+ SG+  QPI+L   VFL AA  TF RF P IKA++DY
Sbjct  74    GLNRLLATVIGGAIGLGAHHLASLSGKTGQPIMLSFFVFLQAAGITFMRFFPRIKAKYDY  133

Query  1283  GCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLI  1104
             G  I ILTF+LVSVSG+R DK+ + A +RLST+ +G+S C+ +++++CPVWAG+DLHRLI
Sbjct  134   GMMILILTFALVSVSGFREDKIFEFAHKRLSTVVIGSSACLIVSVIVCPVWAGEDLHRLI  193

Query  1103  TNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAV  924
               N+EKLA+ LEG   +YL    D D ++D     E     YK VL TK+ E+++A F+ 
Sbjct  194   VLNVEKLANFLEGFGDEYLRKLEDSDLNQDKSLFRE-----YKSVLETKSEEESLAIFSS  248

Query  923   WEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRR  744
             WEP HGRF FRHPWKQYLKIGA +R CAY IE L   + +             V      
Sbjct  249   WEPRHGRFGFRHPWKQYLKIGALIRQCAYRIEALDSYLTTKFHAPPQ------VQTRLEE  302

Query  743   VCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEE  564
             +C+  G                        +   A + L  + KT+  PSS   T  +E+
Sbjct  303   LCAEMGI-----------------------EAARASKQLSSSLKTMTTPSSA--TPHLEK  337

Query  563   AQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLAN  384
             A+  +     +  KS L     +    L+ +    TV SLL+++   T+ + + VN+LA+
Sbjct  338   ARNAA-----KALKSLLKTTSWNHATDLLAVVHAITVTSLLIDVIDCTDKIAESVNELAS  392

Query  383   LAQFR  369
             LA F+
Sbjct  393   LAGFK  397



>emb|CDY08504.1| BnaA05g27400D [Brassica napus]
Length=489

 Score =   313 bits (803),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 182/447 (41%), Positives = 270/447 (60%), Gaps = 43/447 (10%)
 Frame = -3

Query  1661  IDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytv  1482
             I    + GK +PR++IH +KVGL+L+LVS+ YY+RPLY+  G + MWA++TVVVV E+TV
Sbjct  31    IKHVQKFGKDDPRRIIHSIKVGLSLTLVSMLYYVRPLYNSFGVSGMWAILTVVVVSEFTV  90

Query  1481  gaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSI  1302
             G TLSK +NR  AT +AG+LG+G   +A   G K +PI+L   VF L AAATFSRF P I
Sbjct  91    GGTLSKGLNRAFATLIAGALGVGAVHLARLCGHKGEPIVLGILVFSLGAAATFSRFFPRI  150

Query  1301  KARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGD  1122
             K R+DYG  IFILTFS+V+VSGYR D++L +A QRLSTI +G +ICI +++ + PVWAG+
Sbjct  151   KQRYDYGALIFILTFSMVAVSGYRTDEILVIAYQRLSTILIGGTICILVSIFVFPVWAGE  210

Query  1121  DLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDA  942
             DLH+++ NN+ KLA+SLEG   +Y          +   K +   +  YK +L +K++ED 
Sbjct  211   DLHKMVANNIIKLANSLEGFEGEYF------PSSEKTSKGTNSSVREYKSILTSKSTEDT  264

Query  941   MANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPV  762
             +AN A WEPGHGRF  RHPW +YLKI   +R CA   E L+G + S A+    ++I K +
Sbjct  265   LANLARWEPGHGRFRLRHPWTKYLKIAGLVRQCAIHFEVLNGCVLSDAK-APQDFISK-I  322

Query  761   SEECRRVCSTCGKVLRDlsklmksttksSI-QDILVHDMNSAVEALQLAFKTLIPPSSQS  585
              E C  +    G+ L+ ++K +K+ ++  +  +  + +  +A+E L+LA K   P     
Sbjct  323   QEPCSIISREAGEALKAIAKSIKTMSRYHVCVNTHIKNSKNAIENLRLALKVSFP-----  377

Query  584   LTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVK  405
                                       + D D   L+EI  + T+AS L++I +  E + +
Sbjct  378   --------------------------ETDKD---LLEIIPVVTMASTLIDIVSYVEKISE  408

Query  404   EVNQLANLAQFRGQSDKKMAKQSQSQH  324
              V++ + LA F+   D K++ +    H
Sbjct  409   SVDEFSVLAHFKENLDPKLSPELGQHH  435



>ref|XP_007015680.1| Aluminum activated malate transporter family protein, putative 
[Theobroma cacao]
 gb|EOY33299.1| Aluminum activated malate transporter family protein, putative 
[Theobroma cacao]
Length=460

 Score =   311 bits (797),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 185/456 (41%), Positives = 270/456 (59%), Gaps = 44/456 (10%)
 Frame = -3

Query  1685  FVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtv  1506
             F  ++      A +LG+ +PR++IH +KVGLAL+LVSLFYY +PLYD    +A+WAV+TV
Sbjct  28    FCAKVMGIAKMAKKLGQDDPRRIIHSLKVGLALTLVSLFYYFKPLYDGFEDSALWAVLTV  87

Query  1505  vvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAAT  1326
             VVVFE++VGATL K +NR +ATF+AG+LGIG H +A  SG+  +PI++   VF++AA  T
Sbjct  88    VVVFEFSVGATLGKGLNRMLATFVAGALGIGAHCLATLSGRTAEPILIAIFVFVIAAIVT  147

Query  1325  FSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAML  1146
             F RF P +KAR+DYG  IFILTFSLVSVSGYR D++L +A QRLSTI +G+ I + + + 
Sbjct  148   FMRFFPRLKARYDYGLLIFILTFSLVSVSGYRDDQVLKMAHQRLSTIIVGSCISVIVCIC  207

Query  1145  LCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVL  966
             +CPVW G+DLH  +  N+EKL + LE    +Y         ++     ++  L GY+ VL
Sbjct  208   ICPVWIGEDLHNFVAANMEKLGNFLEAFGDEYF-----KVSEEPQSNVNKSFLQGYRSVL  262

Query  965   NTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGS  786
              +K+ E+ MAN A WEPGHG F FRHPWK YLK+G   R CAY +E L+  +NS  Q  +
Sbjct  263   TSKSGEETMANLARWEPGHGPFGFRHPWKMYLKLGNLTRECAYKVEALNSYLNSKIQTPA  322

Query  785   AEYILKPVSEECR-RVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKT  609
                       E R ++   C K  R+                     + A++ L  AF+ 
Sbjct  323   ----------EIRGKIQGPCEKASRES--------------------SKALKELASAFRK  352

Query  608   LIPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIA  429
             ++   S  L      + K +++ LK   K ++  + D     ++EI   ++VASLL+EI 
Sbjct  353   MVRTRSAILHIA---SSKTTAEELKNLLKQSVWGEAD-----VLEIIPAASVASLLLEII  404

Query  428   ARTEGVVKEVNQLANLAQFRGQSDKKMAKQSQSQHK  321
                E + + V +LA +A FR +    + ++    H+
Sbjct  405   ECIEKIAEAVYELAKVASFRNRDATVLPERPDLLHQ  440



>ref|XP_008338598.1| PREDICTED: aluminum-activated malate transporter 2-like [Malus 
domestica]
Length=485

 Score =   311 bits (798),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 194/468 (41%), Positives = 272/468 (58%), Gaps = 41/468 (9%)
 Frame = -3

Query  1691  GGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvm  1512
             G  + ++  F  K  +LG+ + R+++H +KVGLA+ LVSL YY +P Y+ +G  AMWA++
Sbjct  24    GKVMNKVVEFPRKLKKLGQDDRRRIVHSLKVGLAVLLVSLLYYFQPFYNGLGDTAMWAIL  83

Query  1511  tvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAA  1332
             TVVVVFE++VGATL + +NR +ATFLA +LG GVH +AN SG    PI++   VFLLAA+
Sbjct  84    TVVVVFEFSVGATLGRGLNRILATFLAXALGFGVHHLANLSGDIAHPILIGIFVFLLAAS  143

Query  1331  ATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIA  1152
              TF RF P +KAR+DYG  IFILTF L+SVSGYR +++L++A +R STI  G  I +F+ 
Sbjct  144   VTFIRFFPRMKARYDYGLLIFILTFCLISVSGYRDEEILEMAHKRASTILXGAFIAVFVC  203

Query  1151  MLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKC  972
             + +CPVWAG+DLH  ++ N+EKL   LEG   +Y    G G+ +          L GY  
Sbjct  204   VFICPVWAGEDLHNSVSKNIEKLGSFLEGFGXEYFKVVGSGESNMA-------HLQGYFS  256

Query  971   VLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQV  792
             VLN+K SE+  ANFA WEP HGRF +RHPW+ YLKIG   R CAY I+TL G +NS  Q 
Sbjct  257   VLNSKQSEETQANFARWEPRHGRFRYRHPWRYYLKIGNLTRQCAYRIDTLSGYLNSEVQT  316

Query  791   GSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFK  612
                      V E C ++ S  GK L++                           L  A K
Sbjct  317   -LLNIQNNQVQELCMKMSSESGKALKE---------------------------LAWALK  348

Query  611   TLIPPSSQSLTTQVEEAQKPSSDHLKQ--ETKSALSDDDDHDLVYLMEIAQLSTVASLLV  438
             T+  P S + ++ + ++ + ++++LK    T +A       D V L++I    TVASLL 
Sbjct  349   TMTEPCSAA-SSHITKS-RAAANNLKSMLRTNAAAVAGVGGDQVRLLDIVPAVTVASLLS  406

Query  437   EIAARTEGVVKEVNQLANL--AQFRGQSDKKMAKQSQSQHKEQNVQTH  300
             EI A  E + K + +LA+    QF+    KK    +  +    NV  H
Sbjct  407   EIVAYAEXIEKSIQKLASXQHVQFKSAERKKPTALTSCKTSSSNVGPH  454



>gb|EEE65634.1| hypothetical protein OsJ_21203 [Oryza sativa Japonica Group]
Length=645

 Score =   316 bits (810),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 181/434 (42%), Positives = 258/434 (59%), Gaps = 39/434 (9%)
 Frame = -3

Query  1664  FIDKAWQLGKKEPRKVIHGVKVGL--ALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfe  1491
             F   AW++G  +PR+V+HG K  +   L++V +F Y       VGG              
Sbjct  66    FGRTAWKVGADDPRRVVHGFKTAMWAVLTVVVVFEYT------VGG--------------  105

Query  1490  ytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFI  1311
                   + K +NR +AT   G+L +GVHWVA++SG   +P +L AS+F+LAAAA+FSRFI
Sbjct  106   -----CMYKGLNRAMATVAGGALALGVHWVADKSGDDAEPFVLTASLFVLAAAASFSRFI  160

Query  1310  PSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVW  1131
             P++KARFDYG TIFILT+SLV+VSGYRVD L+ +AQQRL TIA+G  IC  +  L+ PVW
Sbjct  161   PTLKARFDYGVTIFILTYSLVAVSGYRVDTLVTMAQQRLITIAIGAFICFAVCTLVFPVW  220

Query  1130  AGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKAS  951
             AG +LH L+  N++KLA ++E C+ DY ++        D   A  +K  GY+ VLN KAS
Sbjct  221   AGQELHVLVARNMDKLAAAIEACVDDYFSSAEHAGGCGDAATALSEKARGYRAVLNAKAS  280

Query  950   EDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYIL  771
             ED++AN A WEPGHG+F FRHP+ QY  +GA+MR CAYCI+ L   + +  Q  +  ++ 
Sbjct  281   EDSLANLARWEPGHGKFGFRHPYGQYQNVGAAMRCCAYCIDALAACVGAGGQ--APAHVK  338

Query  770   KPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSS  591
             + ++  C  +   C  VLR+ S  + S T+S    ++V DMN+A + L+   + L     
Sbjct  339   RHLAGACVALSQHCAAVLREASGSVTSMTRSGRLALVVGDMNAAAQDLRNELRCL-----  393

Query  590   QSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGV  411
               +    EE +  SS+  + E  +A           L+E   L T ASLL+EI+ R EGV
Sbjct  394   AEILDDDEEEEAASSEAEQHEHNTAPP-----PPPPLIEALPLFTAASLLLEISTRAEGV  448

Query  410   VKEVNQLANLAQFR  369
             V  V+ L   A+F+
Sbjct  449   VAAVDALGTTAKFK  462



>ref|XP_010458081.1| PREDICTED: aluminum-activated malate transporter 2 [Camelina 
sativa]
Length=508

 Score =   312 bits (799),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 190/433 (44%), Positives = 268/433 (62%), Gaps = 39/433 (9%)
 Frame = -3

Query  1676  RIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvv  1497
             ++   + +  ++G ++PR+V+H  KVGLAL+ VS FYY +PLYD+ G NAMWAVMTVVVV
Sbjct  3     KVREIVREGRRVGNEDPRRVVHAFKVGLALAFVSSFYYYQPLYDNFGVNAMWAVMTVVVV  62

Query  1496  feytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSR  1317
             FE++VGATL K +NR VAT +AG LGIG H +A+ SG  ++PI+L   VF+ AA +TF R
Sbjct  63    FEFSVGATLGKGINRAVATLVAGGLGIGAHHLASLSGPTVEPILLAIFVFIQAALSTFVR  122

Query  1316  FIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCP  1137
             F P +KAR+DYG  IFILTF+L+SVSG+R D++LDLA +RLST+ +G   C+ I++ +CP
Sbjct  123   FFPRVKARYDYGVLIFILTFALISVSGFREDEILDLAHKRLSTVMMGGVSCVLISIFVCP  182

Query  1136  VWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTK  957
             VWAG DLH L+ +N + LA  L+    +Y  A  DGD  +   +   + L  YK VLN+K
Sbjct  183   VWAGQDLHSLLASNFDTLAHFLQEFGDEYFEATEDGDIKEVEKR--RRNLERYKSVLNSK  240

Query  956   ASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEY  777
             ++E+A+ANFA WEP H  F FRHPWKQYL +GA +R CAY I+ L+  INS  Q+     
Sbjct  241   SNEEALANFAKWEPRHSVFRFRHPWKQYLAVGALLRQCAYRIDALNSYINSDMQIPMD--  298

Query  776   ILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPP  597
             + K + E  RR+ S  GK ++++S  +K  T S   DI V +  SA + L    K+ I  
Sbjct  299   VKKKLEEPLRRMSSESGKSMKEMSISLKKMTNSYTSDIHVVNSQSACKTLSTLLKSGI--  356

Query  596   SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTE  417
                                        L+D      V  +++  L T  SLL++I   TE
Sbjct  357   ---------------------------LND------VEPLQMISLMTTVSLLIDIVNLTE  383

Query  416   GVVKEVNQLANLA  378
              + + V++LA+ A
Sbjct  384   KISESVHELASAA  396



>gb|EYU20649.1| hypothetical protein MIMGU_mgv1a026850mg, partial [Erythranthe 
guttata]
Length=426

 Score =   309 bits (792),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 188/439 (43%), Positives = 264/439 (60%), Gaps = 43/439 (10%)
 Frame = -3

Query  1652  AWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaT  1473
             A +LG+++PR+VIH  KVGLA++LVSLFYY    Y   G NAMWAVMTVVVVFE++VGAT
Sbjct  30    AKKLGEEDPRRVIHSFKVGLAITLVSLFYYFDFSYQGFGVNAMWAVMTVVVVFEFSVGAT  89

Query  1472  LSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKAR  1293
             L K VNR +AT L G LG+  H +A+ +G+K++ +IL  SVF +A+A TF RF P +KAR
Sbjct  90    LGKGVNRAIATLLGGGLGVAAHRLASFAGEKIECVILGMSVFFIASAVTFCRFFPKMKAR  149

Query  1292  FDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLH  1113
             FDYG  IFILTF L++VSGYR D+++D+AQ+RLSTI +G    +FI ML+CPVWAG+DLH
Sbjct  150   FDYGLLIFILTFCLITVSGYRDDEVIDMAQRRLSTILIGGCATVFICMLICPVWAGEDLH  209

Query  1112  RLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMAN  933
             +   +++EKL+  LEG    Y     + + + +     +     YK VLN+K  ED++ N
Sbjct  210   KYTASSIEKLSIFLEGFGRAYFQVSNEKNQENNVASLDQ-----YKTVLNSKGIEDSLVN  264

Query  932   FAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEE  753
             FA WEP HG+F +R PW QYLKIG+  R CAY I+ ++  +NS AQ  +   I K + E 
Sbjct  265   FAKWEPRHGKFRYRQPWDQYLKIGSLSRECAYKIDAINSYLNSDAQ--TPVEIQKKIQEP  322

Query  752   CRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQ  573
             C ++ + C   LR+                           L +  KT+    S S    
Sbjct  323   CTKMSTECSYALRE---------------------------LAMGIKTM--TCSLSADIH  353

Query  572   VEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQ  393
             +  A K S+  LK   K+   + D      L+EI    TVASLL+E+ + T  +   V++
Sbjct  354   IVNA-KASAKKLKSMLKNGRPEID------LLEIIPTFTVASLLIEVVSCTVKIADCVHE  406

Query  392   LANLAQFRGQSDKKMAKQS  336
             L + ++F+     KM KQ+
Sbjct  407   LGSKSKFKSPDPVKMKKQT  425



>emb|CDY01048.1| BnaC05g41520D [Brassica napus]
Length=488

 Score =   311 bits (797),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 180/447 (40%), Positives = 268/447 (60%), Gaps = 43/447 (10%)
 Frame = -3

Query  1661  IDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytv  1482
             I    + GK +PR++IH +KVGL+L+LVS+ YY+RPLY+  G + MWA++TVVVV E+TV
Sbjct  31    IKHVQKFGKDDPRRIIHSIKVGLSLTLVSMLYYVRPLYNSFGVSGMWAILTVVVVSEFTV  90

Query  1481  gaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSI  1302
             G TLSK +NR  AT +AG+LG+G   +A   G K +PI+L   VF L AAATFSRF P I
Sbjct  91    GGTLSKGLNRAFATLIAGALGVGAVHLARLCGHKGEPIVLGILVFSLGAAATFSRFFPRI  150

Query  1301  KARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGD  1122
             K R+DYG  IFILTFS+V+VSGYR D++L +A QRLSTI +G +ICI +++ + PVWAG+
Sbjct  151   KQRYDYGALIFILTFSMVAVSGYRTDEILVIAYQRLSTILIGGTICILVSIFVFPVWAGE  210

Query  1121  DLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDA  942
             DLH+++ NN+ KLA+SLEG   +Y          +   K +   +  YK +L +K++ED 
Sbjct  211   DLHKMVANNIIKLANSLEGFDGEYF------PSSEKTSKETNSSVREYKSILTSKSTEDT  264

Query  941   MANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPV  762
             +AN A WEPGHGRF  RHPW +YLKI   +R CA   E L+G + S A+    ++I K +
Sbjct  265   LANLARWEPGHGRFRLRHPWTKYLKIAGLVRQCAIHFEVLNGYVLSDAK-APQDFISK-I  322

Query  761   SEECRRVCSTCGKVLRDlsklmksttksSI-QDILVHDMNSAVEALQLAFKTLIPPSSQS  585
              E C  +    G+ L+ ++K +K+ ++  +  +  + +  +A+E L+LA K   P + + 
Sbjct  323   QEPCSIMSREAGEALKSIAKSIKTMSRYHVCVNTHIKNSKNAIENLRLALKLSFPETEKD  382

Query  584   LTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVK  405
                                               L+EI    T+AS L++I +  E + +
Sbjct  383   ----------------------------------LLEIIPGVTMASTLIDIVSYVEKISE  408

Query  404   EVNQLANLAQFRGQSDKKMAKQSQSQH  324
              V++ + LA F+   D K++ +    H
Sbjct  409   AVDEFSVLAHFKENLDPKLSPELGQHH  435



>ref|XP_007206655.1| hypothetical protein PRUPE_ppa022263mg [Prunus persica]
 gb|EMJ07854.1| hypothetical protein PRUPE_ppa022263mg [Prunus persica]
Length=474

 Score =   310 bits (795),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 199/445 (45%), Positives = 272/445 (61%), Gaps = 50/445 (11%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             +LG+ +PR+V H +KVG AL+LVSLFYY +PLYD+ G +AMWAVMTVVVVFE++VGATL 
Sbjct  39    KLGQDDPRRVFHSLKVGFALTLVSLFYYYQPLYDNFGVSAMWAVMTVVVVFEFSVGATLG  98

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR +AT LAG+LGIG H +A+ SGQ  +PI++   VFL AA +TF RF P IKAR+D
Sbjct  99    KGLNRALATLLAGALGIGAHHLASLSGQIGEPIVIGFFVFLQAATSTFIRFFPQIKARYD  158

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFSL+SVSG+R D++L+LA +RL+TI +G S C+ I++++CPVWAG+DLH L
Sbjct  159   YGLLIFILTFSLISVSGFRDDEILELAHKRLATIFIGGSACVIISIVVCPVWAGEDLHNL  218

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNTKASEDAMANF  930
             I  N+E L   LEG   +Y          +D +   +K  L  YK  LN+K+SE+++ANF
Sbjct  219   IAANIENLGSFLEGFGDEYF------KTLEDAESKEDKAFLQAYKSALNSKSSEESLANF  272

Query  929   AVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEEC  750
             A WEPGHGRF+F HPWKQYLK+    R CAY IE LH  + +  +V     IL  + E C
Sbjct  273   ARWEPGHGRFHFCHPWKQYLKVATLTRQCAYRIEALHSRLTADNKVSPE--ILNIIQESC  330

Query  749   RRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQV  570
              ++    GK L++                           L  AFK +    S       
Sbjct  331   TKLSLETGKALKE---------------------------LAAAFKEMTKSPSPETHMAK  363

Query  569   EEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQL  390
              +A   S   L+   KS L +D +     L+E+   +TV SLL+++   +E +++ VN+L
Sbjct  364   AKAAAKS---LRSLLKSGLWEDTE-----LLEVMPAATVGSLLLDVVNCSEKIIESVNEL  415

Query  389   ANLAQFRGQSDKKMAKQSQSQHKEQ  315
             A LA F      K  + + SQ K Q
Sbjct  416   AFLANF------KTVEATVSQEKSQ  434



>ref|XP_008361562.1| PREDICTED: aluminum-activated malate transporter 2-like [Malus 
domestica]
Length=484

 Score =   310 bits (795),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 189/456 (41%), Positives = 270/456 (59%), Gaps = 39/456 (9%)
 Frame = -3

Query  1697  IVGGFVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWA  1518
             + G  + ++  F  K  +LG+ +PR+V+H +KVGLA+ LVSL YY++P+Y+ +G   MWA
Sbjct  24    LCGKVMNKVVEFPIKLKKLGQDDPRRVVHSLKVGLAVLLVSLLYYVQPVYNGLGDTTMWA  83

Query  1517  vmtvvvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLA  1338
             V+TVVVVFE++VGATL + +NR +ATFLAG+LG GVH +A+ SG+   PI++   VFLLA
Sbjct  84    VITVVVVFEFSVGATLGRGLNRILATFLAGALGFGVHHLASISGEIGHPILIGIFVFLLA  143

Query  1337  AAATFSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIF  1158
             A+ TF RF P +KARFDYG  IFILTF L+SVSGYR +++L++A +R+STI +G    +F
Sbjct  144   ASVTFIRFFPRMKARFDYGLLIFILTFCLISVSGYREEEILEMAHKRVSTILIGAFTAVF  203

Query  1157  IAMLLCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGY  978
             + + +CPVWAGDDLH L+ NN+EKL   LEG   +Y            N +++   L GY
Sbjct  204   VCIFICPVWAGDDLHNLVANNIEKLGSFLEGFGDEYF-------KVAGNGESNRAHLQGY  256

Query  977   KCVLNTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSA  798
               VLN+K SE+  ANFA WEP HG+F +RHPW+ YLKIG   + CAY IETL+G +NS  
Sbjct  257   TSVLNSKQSEETQANFARWEPRHGKFRYRHPWRHYLKIGNLNQQCAYRIETLNGYLNSEI  316

Query  797   QVGSAEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLA  618
             Q          V E C ++ S  GK L++                           L  A
Sbjct  317   QT-PLNIQSNKVQELCMKMSSESGKALKE---------------------------LAWA  348

Query  617   FKTLIPP--SSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASL  444
              KT+  P  ++ S  T+   A    +   +  T +A +  +    V L ++    TVASL
Sbjct  349   LKTMTEPCAAASSHITKSRAAANNLTSMFR--TSAAAAAGEGGYQVRLQDMVPAVTVASL  406

Query  443   LVEIAARTEGVVKEVNQLANLAQFRGQSDKKMAKQS  336
             L ++ A  E + K + +LA+    + +S +    QS
Sbjct  407   LSDVVAYAEQIEKSIQELASFPHVQFKSAEPKTLQS  442



>ref|XP_010544467.1| PREDICTED: aluminum-activated malate transporter 2-like [Tarenaya 
hassleriana]
Length=340

 Score =   305 bits (781),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 169/355 (48%), Positives = 232/355 (65%), Gaps = 31/355 (9%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             ++ +++PR+V+H +KVGLAL+LVS FYY +PLYD+ G NAMWAVMTVVVVFE++VGATL 
Sbjct  17    RVAREDPRRVVHSLKVGLALALVSSFYYYQPLYDNFGVNAMWAVMTVVVVFEFSVGATLG  76

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR VAT  A +LG+G H +A+ SG  L+PI+L   VFL AA +TF RF P +KAR+D
Sbjct  77    KGLNRGVATLFASALGVGAHHIASISGPTLEPILLAVFVFLHAAISTFIRFFPKVKARYD  136

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTF+LVSVSG+R D++++LA +RLST+ +G + C+ +++ +CPVWAG DLH L
Sbjct  137   YGLLIFILTFALVSVSGFRDDEVIELAHKRLSTVGVGGAACVLVSIFICPVWAGQDLHNL  196

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFA  927
             I NNL K+ + LE    +Y    G  + D  + +   + L GYK VL+TK++E+++ANFA
Sbjct  197   IANNLAKVGNFLEEFGDEYF--QGAANGDTIHVEKKRENLEGYKSVLSTKSNEESLANFA  254

Query  926   VWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECR  747
              WEPGHG F FRHPWKQYL IG  +R C Y ++ L+  + +  QV       K + E  R
Sbjct  255   RWEPGHGDFRFRHPWKQYLAIGTLIRQCGYRVDALNSYLKADIQVSMDAK--KRLEEPLR  312

Query  746   RVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSL  582
             R+ S  GK L++                           L LAFK +  PSS  +
Sbjct  313   RMSSESGKALKE---------------------------LSLAFKKMKKPSSSGI  340



>ref|XP_008230212.1| PREDICTED: aluminum-activated malate transporter 2 [Prunus mume]
Length=475

 Score =   310 bits (793),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 201/452 (44%), Positives = 274/452 (61%), Gaps = 47/452 (10%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             +LG+ +PR+V H +KVG AL+LVSLFYY +PLYD+ G +AMWAVMTVVVVFE++VGATL 
Sbjct  40    KLGQDDPRRVFHSLKVGFALTLVSLFYYYQPLYDNFGVSAMWAVMTVVVVFEFSVGATLG  99

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR +AT LAG+LGIG H +A+ SGQ  +PI++   VFL AA +TF RF P IKAR+D
Sbjct  100   KGLNRALATLLAGALGIGAHHLASLSGQIGEPIVIGFFVFLQAATSTFIRFFPQIKARYD  159

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             YG  IFILTFSL+SVSG R D++L+LA +RL+TI +G S C+ I++++CPVWAG+DLH L
Sbjct  160   YGLLIFILTFSLISVSGLRDDEILELAHKRLATIFIGGSACVIISIVVCPVWAGEDLHNL  219

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNTKASEDAMANF  930
             I  N+E L   LEG   +Y          +D +   +K  L  YK  LN+K+SE+++ANF
Sbjct  220   IAANIENLGSFLEGFGDEYF------KMLEDAESKDDKAFLQAYKSALNSKSSEESLANF  273

Query  929   AVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEEC  750
             A WEPGHGRF+F HPWKQYLK+    R CAY IE LH  + +  +V     IL  + E C
Sbjct  274   ARWEPGHGRFHFCHPWKQYLKVATLTRQCAYRIEALHSRLTAENKVSPE--ILNIIQESC  331

Query  749   RRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQV  570
              ++    GK L++                           L  AFK +    S       
Sbjct  332   TKLSLETGKALKE---------------------------LAAAFKEMTKSPSPETHMAK  364

Query  569   EEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQL  390
              +A   S   L+   KS L +D +     L+E+   +TV SLL++    +E +++ VN+L
Sbjct  365   AKAAAKS---LRSLLKSGLWEDTE-----LLEVMPAATVGSLLLDAVNCSEKIIESVNEL  416

Query  389   ANLAQFRGQSDKKMAKQSQS---QHKEQNVQT  303
             A LA F+        ++SQS     KE+N  T
Sbjct  417   AFLANFKTVEATVSLEKSQSGKLDTKEKNPNT  448



>ref|XP_007015684.1| Aluminum activated malate transporter family protein, putative 
[Theobroma cacao]
 gb|EOY33303.1| Aluminum activated malate transporter family protein, putative 
[Theobroma cacao]
Length=456

 Score =   308 bits (789),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 183/439 (42%), Positives = 263/439 (60%), Gaps = 41/439 (9%)
 Frame = -3

Query  1685  FVLRIWSFIDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtv  1506
             F  R+     K  Q+G+++PR+V H +K+GLAL+LVS+FYY +P+YD  G NAMWAV+TV
Sbjct  30    FNARVTEIARKTKQIGQQDPRRVYHSLKMGLALTLVSVFYYFQPVYDGFGDNAMWAVLTV  89

Query  1505  vvvfeytvgaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAAT  1326
             VVVFE++VGATL K +NR +AT  AG+L +G H +A  SG+  +PI++   VF+  +  T
Sbjct  90    VVVFEFSVGATLGKGLNRMLATLTAGALALGAHRIATLSGRTGEPILISTFVFITGSIVT  149

Query  1325  FSRFIPSIKARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAML  1146
             F +FIP +KARFDYG TIFILTF LVSVSGYR D++L++A +R++TI +G+ I IF+ + 
Sbjct  150   FMKFIPKLKARFDYGMTIFILTFCLVSVSGYRDDQVLEMAHERVTTIIIGSCISIFVCVC  209

Query  1145  LCPVWAGDDLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVL  966
             + PVW G+DLH+L+ NN+EKL + LEG   +Y        +++     SE  L  YK VL
Sbjct  210   IYPVWIGEDLHKLVANNMEKLGNYLEGFGDEYF----KVSEEETQTNDSEPFLQAYKSVL  265

Query  965   NTKASEDAMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGS  786
              +K+SE+ MAN A WEPGHGRF F HPWK YLKIG   R CAY ++ L+  +NS  Q  +
Sbjct  266   TSKSSEETMANLARWEPGHGRFRFHHPWKNYLKIGNLTRECAYKVQALNSYLNSEIQ--T  323

Query  785   AEYILKPVSEECRRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTL  606
                I   + E   ++     K L++L+  ++  T++   D  + +  +A E L+   K  
Sbjct  324   PIEIRSKIQESSTKISLESSKALKELASTIRKMTRTRSADPHIANSKTAAEELKTLLK--  381

Query  605   IPPSSQSLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAA  426
                     TT  EE +                         L++I    +VASLL+EI  
Sbjct  382   --------TTFWEEKE-------------------------LLQILPAVSVASLLLEIVE  408

Query  425   RTEGVVKEVNQLANLAQFR  369
               E + + V +LA  A F+
Sbjct  409   CAEKIAEAVYELAKEASFK  427



>ref|XP_009146692.1| PREDICTED: aluminum-activated malate transporter 8-like [Brassica 
rapa]
Length=492

 Score =   309 bits (792),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 182/448 (41%), Positives = 270/448 (60%), Gaps = 44/448 (10%)
 Frame = -3

Query  1661  IDKAWQLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytv  1482
             I    + GK +PR++IH +KVGL+L+LVS+ YY+RPLY+  G + MWA++TVVVV E+TV
Sbjct  33    IKHVQKFGKDDPRRIIHSIKVGLSLTLVSMLYYVRPLYNSFGVSGMWAILTVVVVSEFTV  92

Query  1481  gaTLSKCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSI  1302
             G TLSK +NR  AT +AG+LG+G   +A   G K +PI+L   VF L AAATFSRF P I
Sbjct  93    GGTLSKGLNRAFATLIAGALGVGAVHLARLCGHKGEPIVLGILVFSLGAAATFSRFFPRI  152

Query  1301  KARFDYGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGD  1122
             K R+DYG  IFILTFS+V+VSGYR D++L +A QRLSTI +G +ICI +++ + PVWAG+
Sbjct  153   KQRYDYGALIFILTFSMVAVSGYRTDEILVIAYQRLSTILIGGTICILVSIFVFPVWAGE  212

Query  1121  DLHRLITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCV-LNTKASED  945
             DLH+++ NN+ KLA+SLEG   +Y          +   K +   +  YK + L +K++ED
Sbjct  213   DLHKMVANNIIKLANSLEGFEGEYF------PSSEKTSKGTNSSVREYKSINLTSKSTED  266

Query  944   AMANFAVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKP  765
              +AN A WEPGHGRF  RHPW +YLKI   +R CA   E L+G + S A+    ++I K 
Sbjct  267   TLANLARWEPGHGRFRLRHPWTKYLKIAGLVRQCAIHFEVLNGCVLSDAK-APQDFISK-  324

Query  764   VSEECRRVCSTCGKVLRDlsklmksttksSI-QDILVHDMNSAVEALQLAFKTLIPPSSQ  588
             + E C  +    G+ L+ ++K +K+ ++  +  +  + +  +A+E L+LA K   P    
Sbjct  325   IQEPCSIISREAGEALKAIAKSIKTMSRYHVCVNTHIKNSKNAIENLRLALKVSFP----  380

Query  587   SLTTQVEEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVV  408
                                        + D D   L+EI  + T+AS L++I +  E + 
Sbjct  381   ---------------------------ETDKD---LLEIIPVVTMASTLIDIVSYVEKIS  410

Query  407   KEVNQLANLAQFRGQSDKKMAKQSQSQH  324
             + V++ + LA F+   D K++ +    H
Sbjct  411   ESVDEFSVLAHFKENLDPKLSPELGQHH  438



>ref|XP_006369382.1| hypothetical protein POPTR_0001s22500g, partial [Populus trichocarpa]
 gb|ERP65951.1| hypothetical protein POPTR_0001s22500g, partial [Populus trichocarpa]
Length=383

 Score =   305 bits (780),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 182/427 (43%), Positives = 268/427 (63%), Gaps = 51/427 (12%)
 Frame = -3

Query  1646  QLGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLS  1467
             +LG+++PR+V+H +KVGLAL+LVS  YYLR  Y +   +A+WAVMTVV+VFE++VGATL 
Sbjct  7     KLGQEDPRRVVHSLKVGLALTLVSTLYYLRLFYKNYRLDAIWAVMTVVLVFEFSVGATLG  66

Query  1466  KCVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFD  1287
             K +NR +AT LAG+LGIG H++A        PI++   VFL A  +TF RF+P IKAR+D
Sbjct  67    KGLNRGMATLLAGALGIGAHYLAGG------PILILFLVFLQATISTFLRFLPKIKARYD  120

Query  1286  YGCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRL  1107
             Y   IFILTFS+++VSG++ + +L+ AQ RLST+++G ++C+ +++++ PVWAG+DLH L
Sbjct  121   YAMLIFILTFSMITVSGFQ-ENILESAQSRLSTVSIGAAVCVIVSIVIFPVWAGEDLHNL  179

Query  1106  ITNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLL-GYKCVLNTKASEDAMANF  930
             I  N+EKL +SLEG   +Y    G  +         +KK L GYK VLN+K SE+++ANF
Sbjct  180   IALNIEKLGNSLEGFGDEYFKRTGGEESK------DDKKFLEGYKSVLNSKKSEESLANF  233

Query  929   AVWEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEEC  750
             A WEP HGRF F HPWK YLK+G   R CAY IE L+G +N+  Q  S   +   + E C
Sbjct  234   AAWEPCHGRFPFGHPWKLYLKVGTLARECAYRIEALNGYLNADIQASSE--VSNIIQEAC  291

Query  749   RRVCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQV  570
              ++    GK L++                           L LA K ++ PSS    + +
Sbjct  292   TKMSRESGKSLKE---------------------------LALAIKIMVQPSSAD--SHI  322

Query  569   EEAQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQL  390
             E A K ++ ++K   KS + +D D     L+++    TVAS+L+++   TE + + + +L
Sbjct  323   ENA-KSAAKNIKSLLKSGMWEDID-----LLKVIPGVTVASILIDVVTYTEKISESIYEL  376

Query  389   ANLAQFR  369
             A+ AQF+
Sbjct  377   ASKAQFK  383



>ref|XP_006362899.1| PREDICTED: aluminum-activated malate transporter 2-like [Solanum 
tuberosum]
Length=467

 Score =   307 bits (787),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 184/431 (43%), Positives = 276/431 (64%), Gaps = 39/431 (9%)
 Frame = -3

Query  1643  LGKKEPRKVIHGVKVGLALSLVSLFYYLRPLYDDVGGNAMWAvmtvvvvfeytvgaTLSK  1464
             + K +PR+VIH +KVGL+L+LVSLFYY +PLY+  G + MWA+MTVVVVFE++VGATL K
Sbjct  44    IAKDDPRRVIHSLKVGLSLTLVSLFYYFQPLYNGFGVSTMWAIMTVVVVFEFSVGATLGK  103

Query  1463  CVNRTVATFLAGSLGIGVHWVANQSGQKLQPIILQASVFLLAAAATFSRFIPSIKARFDY  1284
              +NR +AT +AG+LG+G H++A+ +G+ ++PI+L   VFL A A TF RF P +KAR+DY
Sbjct  104   GLNRGMATLIAGALGVGAHYLASATGKVVEPILLGLFVFLQAFALTFIRFFPQVKARYDY  163

Query  1283  GCTIFILTFSLVSVSGYRVDKLLDLAQQRLSTIALGTSICIFIAMLLCPVWAGDDLHRLI  1104
             G  I ILTF LVS+SG+RVD+++D+A +R+STI +G S+C+ +++++CPVWAG+DLH+L+
Sbjct  164   GMLILILTFCLVSISGFRVDEIVDMAHKRISTIFMGASVCVIVSIVVCPVWAGEDLHKLV  223

Query  1103  TNNLEKLADSLEGCISDYLnadgdgdddkdndkASEKKLLGYKCVLNTKASEDAMANFAV  924
               N+EKL   LEG   +         +D    K ++  L+ YK VLN+K +E+ +ANFA 
Sbjct  224   AQNMEKLGKFLEGFGDEIF----KSSEDITESKVTKTSLIEYKSVLNSKNTEETLANFAK  279

Query  923   WEPGHGRFNFRHPWKQYLKIGASMRACAYCIETLHGSINSSAQVGSAEYILKPVSEECRR  744
             WEPGHG+F +RHPWKQYLKIG  +R CA  I+ L+  INS  ++ + E I + + E   +
Sbjct  280   WEPGHGQFKYRHPWKQYLKIGGLIRQCACRIDALNAYINS--EIKAPEEIREMIKETSMK  337

Query  743   VCSTCGKVLRDlsklmksttksSIQDILVHDMNSAVEALQLAFKTLIPPSSQSLTTQVEE  564
             +   CGK L++LSK              +  MN             +P S+    T  + 
Sbjct  338   MSIECGKALKELSKS-------------MRKMN-------------LPISADEHVTNAKN  371

Query  563   AQKPSSDHLKQETKSALSDDDDHDLVYLMEIAQLSTVASLLVEIAARTEGVVKEVNQLAN  384
             + K  +  LK       S  ++ + + L+++  L+T+AS+L +I    E + + VN+LA+
Sbjct  372   SAKKLNSLLK-------SRINNWEEINLLQVIPLATIASILTDIVICVEEIGQGVNELAS  424

Query  383   LAQFRGQSDKK  351
             LA F+     K
Sbjct  425   LANFKTTKSSK  435



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5121296209290