BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18333_g3_i1 len=538 path=[2243:0-537]

Length=538
                                                                      Score     E

ref|XP_010675511.1|  PREDICTED: protein RALF-like 19                  94.7    3e-21   
emb|CDO99525.1|  unnamed protein product                              92.4    2e-20   
ref|XP_009387647.1|  PREDICTED: protein RALF-like 19                  92.0    2e-20   
ref|XP_010043059.1|  PREDICTED: rapid alkalinization factor           89.0    4e-19   
ref|XP_002528254.1|  RALFL33, putative                                88.6    5e-19   Ricinus communis
ref|XP_002280202.1|  PREDICTED: protein RALF-like 19                  89.0    5e-19   Vitis vinifera
ref|XP_006849879.1|  hypothetical protein AMTR_s00022p00078480        88.2    7e-19   
ref|XP_004505070.1|  PREDICTED: protein RALF-like 19-like             88.2    7e-19   
ref|XP_010434917.1|  PREDICTED: protein RALF-like 33                  87.8    9e-19   
ref|XP_003542740.1|  PREDICTED: protein RALF-like 19-like             87.8    1e-18   
ref|XP_007025592.1|  Ralf-like 4, putative                            87.8    1e-18   
ref|XP_010644182.1|  PREDICTED: protein RALF-like 19                  87.8    1e-18   
ref|NP_001237097.1|  uncharacterized protein LOC100306584 precursor   87.4    1e-18   
gb|KHN16254.1|  hypothetical protein glysoja_046571                   87.4    1e-18   
gb|ABK25798.1|  unknown                                               87.4    2e-18   Picea sitchensis
ref|XP_006285957.1|  hypothetical protein CARUB_v10007476mg           86.7    2e-18   
gb|ACN40381.1|  unknown                                               86.7    3e-18   Picea sitchensis
emb|CDX99974.1|  BnaC09g03270D                                        86.3    3e-18   
ref|XP_010313004.1|  PREDICTED: rapid alkalinization factor           86.3    4e-18   
gb|AAR00326.1|  rapid alkalinization factor 2                         85.9    5e-18   Solanum chacoense
emb|CDY19732.1|  BnaA09g03850D                                        85.9    5e-18   
gb|ABK22709.1|  unknown                                               85.9    6e-18   Picea sitchensis
gb|ABS72341.1|  rapid alkalinization factor precursor                 85.9    6e-18   Litchi chinensis [litchi]
ref|XP_007043620.1|  Uncharacterized protein TCM_008135               85.9    7e-18   
ref|XP_004504245.1|  PREDICTED: protein RALF-like 19-like             85.5    7e-18   
ref|XP_004290774.1|  PREDICTED: protein RALF-like 33-like isoform 1   85.5    7e-18   
ref|XP_002321018.2|  hypothetical protein POPTR_0014s12630g           85.1    8e-18   Populus trichocarpa [western balsam poplar]
ref|XP_009111745.1|  PREDICTED: protein RALF-like 22                  85.1    9e-18   
ref|XP_010105661.1|  hypothetical protein L484_010825                 85.1    1e-17   
ref|XP_008791840.1|  PREDICTED: rapid alkalinization factor-like      85.1    1e-17   
gb|AAO27366.1|  rapid alkalinization factor 1 precursor               84.7    1e-17   Populus trichocarpa x Populus deltoides
ref|XP_006382486.1|  RALF-LIKE 23 family protein                      84.7    2e-17   
ref|XP_006444286.1|  hypothetical protein CICLE_v10023750mg           84.3    2e-17   
ref|XP_004485791.1|  PREDICTED: protein RALF-like 19-like             84.3    2e-17   
ref|XP_004495709.1|  PREDICTED: rapid alkalinization factor-like      84.0    3e-17   
ref|XP_008370433.1|  PREDICTED: rapid alkalinization factor-like      84.0    3e-17   
ref|XP_011027816.1|  PREDICTED: protein RALF-like 19                  83.6    3e-17   
ref|XP_006344656.1|  PREDICTED: rapid alkalinization factor-like      83.6    3e-17   
ref|XP_011033568.1|  PREDICTED: protein RALF-like 1                   83.6    4e-17   
ref|NP_567476.1|  protein ralf-like 33                                83.2    5e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KHN24772.1|  hypothetical protein glysoja_045891                   83.2    5e-17   
ref|XP_007212761.1|  hypothetical protein PRUPE_ppa026481mg           83.2    6e-17   
ref|XP_010526512.1|  PREDICTED: protein RALF-like 4                   82.4    7e-17   
gb|EMS45535.1|  hypothetical protein TRIUR3_16964                     83.2    7e-17   
gb|AFK46281.1|  unknown                                               82.4    8e-17   
emb|CDY09740.1|  BnaC07g33210D                                        82.4    8e-17   
ref|XP_007159334.1|  hypothetical protein PHAVU_002G229400g           82.4    9e-17   
ref|XP_011036862.1|  PREDICTED: protein RALF-like 33                  82.8    9e-17   
ref|XP_010259629.1|  PREDICTED: rapid alkalinization factor           82.4    1e-16   
ref|XP_010097623.1|  hypothetical protein L484_001106                 83.6    1e-16   
ref|XP_008246129.1|  PREDICTED: rapid alkalinization factor-like      82.4    1e-16   
ref|XP_003626248.1|  hypothetical protein MTR_7g113080                82.4    1e-16   
ref|XP_007227502.1|  hypothetical protein PRUPE_ppa013419mg           82.4    1e-16   
gb|AAS13437.1|  rapid alkalinization factor preproprotein             82.0    1e-16   Nicotiana attenuata
ref|XP_010108173.1|  hypothetical protein L484_014498                 82.0    1e-16   
ref|XP_009409606.1|  PREDICTED: protein RALF-like 22                  82.0    2e-16   
ref|XP_002305130.2|  hypothetical protein POPTR_0004s04470g           81.6    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_010549330.1|  PREDICTED: protein RALF-like 19                  81.3    2e-16   
ref|XP_008386646.1|  PREDICTED: rapid alkalinization factor-like      81.3    3e-16   
ref|XP_008225111.1|  PREDICTED: protein RALF-like 22                  81.3    3e-16   
ref|XP_010915431.1|  PREDICTED: protein RALF-like 22                  81.3    3e-16   
ref|XP_009342123.1|  PREDICTED: protein RALF-like 33                  80.9    3e-16   
ref|NP_001235167.1|  uncharacterized protein LOC100306190 precursor   81.3    3e-16   
ref|XP_002263387.1|  PREDICTED: rapid alkalinization factor           80.9    3e-16   Vitis vinifera
ref|XP_007147024.1|  hypothetical protein PHAVU_006G089900g           80.5    4e-16   
ref|XP_009136714.1|  PREDICTED: protein RALF-like 33                  80.9    4e-16   
ref|XP_004494597.1|  PREDICTED: protein RALF-like 33-like             81.3    4e-16   
ref|XP_002283709.1|  PREDICTED: protein RALF-like 33                  80.9    4e-16   Vitis vinifera
ref|XP_002870208.1|  hypothetical protein ARALYDRAFT_493304           80.9    4e-16   
ref|XP_010469431.1|  PREDICTED: protein RALF-like 19                  80.5    4e-16   
gb|KFK44989.1|  hypothetical protein AALP_AA1G329500                  80.5    5e-16   
ref|XP_003637105.1|  RALF                                             80.5    5e-16   
ref|XP_010314082.1|  PREDICTED: protein RALF-like 22                  80.5    5e-16   
ref|XP_010538170.1|  PREDICTED: protein RALF-like 19                  80.5    5e-16   
ref|XP_009381195.1|  PREDICTED: protein RALF-like 22                  80.9    5e-16   
ref|XP_006414444.1|  hypothetical protein EUTSA_v10026579mg           80.5    6e-16   
gb|EYU42176.1|  hypothetical protein MIMGU_mgv1a016421mg              80.5    7e-16   
ref|XP_009111178.1|  PREDICTED: protein RALF-like 1                   80.1    8e-16   
gb|KHN03976.1|  hypothetical protein glysoja_022662                   79.0    8e-16   
ref|XP_002512426.1|  RALFL33, putative                                80.1    8e-16   Ricinus communis
emb|CDX89932.1|  BnaA10g01500D                                        80.1    9e-16   
emb|CDY18130.1|  BnaC05g01530D                                        80.1    9e-16   
ref|XP_002531878.1|  RALFL33, putative                                79.7    9e-16   Ricinus communis
ref|NP_850219.1|  protein RALF-like 19                                79.7    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009623267.1|  PREDICTED: protein RALF-like 22                  80.1    1e-15   
ref|XP_007035581.1|  Rapid alkalinization factor 1, putative          80.1    1e-15   
ref|XP_002879470.1|  hypothetical protein ARALYDRAFT_902453           79.3    1e-15   
ref|XP_007199089.1|  hypothetical protein PRUPE_ppa020353mg           79.3    1e-15   
ref|XP_004295624.1|  PREDICTED: rapid alkalinization factor-like      79.7    1e-15   
ref|XP_010269500.1|  PREDICTED: rapid alkalinization factor-like      80.1    1e-15   
ref|XP_010509833.1|  PREDICTED: protein RALF-like 19                  79.3    1e-15   
ref|XP_003554646.1|  PREDICTED: protein RALF-like 1-like              79.7    1e-15   
ref|XP_010038196.1|  PREDICTED: rapid alkalinization factor-like      79.7    1e-15   
gb|KGN44918.1|  hypothetical protein Csa_7G396340                     79.3    1e-15   
ref|XP_006295275.1|  hypothetical protein CARUB_v10024364mg           79.0    2e-15   
ref|XP_006419584.1|  hypothetical protein CICLE_v10006201mg           79.7    2e-15   
gb|AFB73770.1|  rapid alkalinization factor                           79.3    2e-15   
ref|XP_009376626.1|  PREDICTED: protein RALF-like 33                  79.3    2e-15   
emb|CDX86697.1|  BnaC08g00060D                                        79.3    2e-15   
ref|XP_009119598.1|  PREDICTED: protein RALF-like 1                   79.7    2e-15   
ref|XP_006840509.1|  hypothetical protein AMTR_s00045p00202280        79.0    2e-15   
ref|XP_010413812.1|  PREDICTED: protein RALF-like 19                  78.6    2e-15   
ref|XP_006279280.1|  hypothetical protein CARUB_v10016532mg           78.2    2e-15   
ref|XP_011023680.1|  PREDICTED: rapid alkalinization factor-like      79.0    2e-15   
ref|XP_006304742.1|  hypothetical protein CARUB_v10012118mg           79.0    2e-15   
ref|XP_003521695.2|  PREDICTED: protein RALF-like 1-like isoform 1    80.1    2e-15   
ref|XP_010098288.1|  hypothetical protein L484_023536                 79.0    2e-15   
emb|CBI39521.3|  unnamed protein product                              79.3    2e-15   
ref|XP_008246447.1|  PREDICTED: rapid alkalinization factor           78.6    3e-15   
ref|XP_010925571.1|  PREDICTED: protein RALF-like 22                  78.6    3e-15   
ref|XP_006410523.1|  hypothetical protein EUTSA_v10017458mg           78.2    3e-15   
gb|EYU28258.1|  hypothetical protein MIMGU_mgv1a016453mg              78.2    4e-15   
ref|NP_001241351.1|  uncharacterized protein LOC100801740 precursor   77.8    5e-15   
ref|XP_006389381.1|  hypothetical protein POPTR_0026s00240g           77.8    5e-15   
gb|ABK96369.1|  unknown                                               77.8    5e-15   Populus trichocarpa x Populus deltoides
emb|CDY15442.1|  BnaA08g27260D                                        77.8    5e-15   
ref|XP_008451660.1|  PREDICTED: rapid alkalinization factor-like      77.4    6e-15   
ref|XP_010691694.1|  PREDICTED: protein RALF-like 33                  77.8    6e-15   
ref|XP_009352252.1|  PREDICTED: protein RALF-like 33                  77.8    6e-15   
ref|XP_008235043.1|  PREDICTED: protein RALF-like 33                  77.4    6e-15   
ref|XP_007206150.1|  hypothetical protein PRUPE_ppa013461mg           77.4    7e-15   
ref|NP_001152442.1|  RALF precursor                                   77.8    7e-15   Zea mays [maize]
ref|XP_003619621.1|  Rapid alkalinization factor                      77.0    8e-15   
ref|XP_009784377.1|  PREDICTED: protein RALF-like 19                  77.4    8e-15   
ref|XP_009143830.1|  PREDICTED: protein RALF-like 19                  77.0    8e-15   
emb|CDY27943.1|  BnaCnng05280D                                        77.0    9e-15   
emb|CAN83593.1|  hypothetical protein VITISV_037723                   77.0    9e-15   Vitis vinifera
ref|XP_011087422.1|  PREDICTED: rapid alkalinization factor           77.0    9e-15   
ref|XP_002319521.1|  RALF-LIKE 23 family protein                      77.4    1e-14   Populus trichocarpa [western balsam poplar]
ref|XP_011082482.1|  PREDICTED: rapid alkalinization factor-like      77.0    1e-14   
ref|XP_010326583.1|  PREDICTED: rapid alkalinization factor           77.0    1e-14   
ref|XP_002273386.1|  PREDICTED: protein RALF-like 33                  77.0    1e-14   Vitis vinifera
ref|XP_004302395.1|  PREDICTED: protein RALF-like 33-like isoform 1   76.6    1e-14   
ref|XP_006306243.1|  hypothetical protein CARUB_v10012072mg           76.6    1e-14   
dbj|BAD94374.1|  hypothetical protein                                 76.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009352900.1|  PREDICTED: protein RALF-like 19                  77.0    1e-14   
gb|AAO27367.1|  rapid alkalinization factor 2 precursor               77.0    1e-14   Populus trichocarpa x Populus deltoides
gb|EPS72954.1|  rapid alkalinization factor                           76.3    1e-14   
emb|CBI26076.3|  unnamed protein product                              77.4    1e-14   
ref|XP_007050868.1|  Ralf-like 33, putative                           76.3    2e-14   
ref|NP_566253.1|  protein RALF-like 22                                76.6    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867453.1|  hypothetical protein ARALYDRAFT_913686           76.3    2e-14   
gb|KDP23480.1|  hypothetical protein JCGZ_23313                       76.6    2e-14   
gb|KFK39006.1|  hypothetical protein AALP_AA3G188700                  76.6    2e-14   
ref|XP_002882418.1|  hypothetical protein ARALYDRAFT_477838           76.3    2e-14   
ref|NP_171789.1|  rapid alkalinization factor 1                       76.6    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009400663.1|  PREDICTED: rapid alkalinization factor-like      76.6    2e-14   
ref|XP_008368985.1|  PREDICTED: rapid alkalinization factor-like      76.3    2e-14   
ref|XP_002892134.1|  hypothetical protein ARALYDRAFT_470261           76.3    2e-14   
gb|KFK32572.1|  hypothetical protein AALP_AA6G260700                  76.3    2e-14   
ref|XP_008229078.1|  PREDICTED: rapid alkalinization factor-like      76.6    2e-14   
ref|XP_008360280.1|  PREDICTED: protein RALF-like 33                  76.3    2e-14   
ref|XP_006288916.1|  hypothetical protein CARUB_v10002279mg           75.9    2e-14   
ref|XP_002516916.1|  RALFL33, putative                                75.9    2e-14   Ricinus communis
ref|XP_009124021.1|  PREDICTED: protein RALF-like 22                  75.9    2e-14   
emb|CDY40711.1|  BnaC03g34270D                                        75.9    3e-14   
ref|XP_004244368.1|  PREDICTED: protein RALF-like 22                  76.3    3e-14   
ref|XP_006424193.1|  hypothetical protein CICLE_v10030160mg           75.9    3e-14   
ref|XP_009113682.1|  PREDICTED: protein RALF-like 4                   75.9    3e-14   
ref|XP_004229189.1|  PREDICTED: rapid alkalinization factor-like      76.3    3e-14   
ref|XP_006415678.1|  hypothetical protein EUTSA_v10009158mg           75.5    3e-14   
gb|KFK42648.1|  rapid alkalinization factor 1                         75.9    3e-14   
ref|XP_009102923.1|  PREDICTED: protein RALF-like 4                   75.5    3e-14   
ref|XP_003632038.1|  PREDICTED: protein RALF-like 24                  75.9    3e-14   
ref|XP_003550267.1|  PREDICTED: rapid alkalinization factor 23-like   75.9    3e-14   
emb|CDY18799.1|  BnaAnng02640D                                        75.5    3e-14   
gb|KFK31007.1|  hypothetical protein AALP_AA6G056400                  75.5    3e-14   
ref|XP_010481344.1|  PREDICTED: protein RALF-like 1                   75.9    3e-14   
ref|XP_009134826.1|  PREDICTED: protein RALF-like 22                  75.5    3e-14   
ref|XP_003625906.1|  RALF                                             75.5    3e-14   
ref|XP_010474880.1|  PREDICTED: protein RALF-like 1                   75.5    4e-14   
ref|XP_006408069.1|  hypothetical protein EUTSA_v10021783mg           75.5    4e-14   
ref|XP_010457289.1|  PREDICTED: protein RALF-like 1                   75.5    4e-14   
ref|XP_010485998.1|  PREDICTED: protein RALF-like 22                  75.5    4e-14   
ref|XP_003601688.1|  Rapid alkalinization factor preproprotein        75.9    4e-14   
ref|XP_007154282.1|  hypothetical protein PHAVU_003G105300g           75.5    4e-14   
ref|XP_006298819.1|  hypothetical protein CARUB_v10014925mg           75.5    4e-14   
ref|XP_010464074.1|  PREDICTED: protein RALF-like 22                  75.5    4e-14   
emb|CDY18779.1|  BnaAnng02440D                                        75.5    4e-14   
ref|XP_004508218.1|  PREDICTED: rapid alkalinization factor 23-like   75.5    4e-14   
ref|XP_010428004.1|  PREDICTED: protein RALF-like 22                  75.5    4e-14   
gb|EMS65783.1|  hypothetical protein TRIUR3_31877                     75.1    4e-14   
ref|XP_004494362.1|  PREDICTED: rapid alkalinization factor-like      75.5    4e-14   
gb|KFK44698.1|  hypothetical protein AALP_AA1G291600                  75.1    4e-14   
ref|XP_010522782.1|  PREDICTED: protein RALF-like 1                   75.1    4e-14   
gb|AFK33323.1|  unknown                                               75.5    4e-14   
emb|CDY35727.1|  BnaC03g58480D                                        75.1    5e-14   
ref|XP_009418953.1|  PREDICTED: protein RALF-like 33                  75.1    5e-14   
ref|XP_010487517.1|  PREDICTED: rapid alkalinization factor 23-like   75.5    5e-14   
ref|NP_001152377.1|  RALF precursor                                   75.5    5e-14   Zea mays [maize]
gb|KFK37938.1|  hypothetical protein AALP_AA3G049600                  75.1    5e-14   
ref|XP_009109739.1|  PREDICTED: protein RALF-like 4                   75.1    5e-14   
emb|CDX94598.1|  BnaC07g10600D                                        75.1    5e-14   
ref|XP_007198968.1|  hypothetical protein PRUPE_ppa015429mg           74.3    5e-14   
ref|XP_006406825.1|  hypothetical protein EUTSA_v10021739mg           75.5    6e-14   
ref|XP_010493984.1|  PREDICTED: protein RALF-like 22                  75.1    6e-14   
ref|XP_006356972.1|  PREDICTED: rapid alkalinization factor-like      75.5    6e-14   
ref|XP_002454987.1|  hypothetical protein SORBIDRAFT_03g002560        75.5    6e-14   Sorghum bicolor [broomcorn]
ref|XP_010656981.1|  PREDICTED: protein RALF-like 19                  75.1    6e-14   
ref|XP_008390661.1|  PREDICTED: rapid alkalinization factor-like      75.1    7e-14   
ref|XP_008359858.1|  PREDICTED: rapid alkalinization factor-like      74.7    7e-14   
emb|CDY15684.1|  BnaA07g08550D                                        75.5    8e-14   
dbj|BAK08263.1|  predicted protein                                    74.7    8e-14   
gb|AES91867.2|  RALF                                                  74.7    8e-14   
ref|XP_010038087.1|  PREDICTED: rapid alkalinization factor-like      74.7    8e-14   
ref|XP_010465683.1|  PREDICTED: rapid alkalinization factor 23-like   74.7    9e-14   
ref|XP_010499341.1|  PREDICTED: protein RALF-like 4                   74.3    9e-14   
ref|NP_174148.1|  protein ralf-like 4                                 74.3    9e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006359396.1|  PREDICTED: rapid alkalinization factor-like      74.3    9e-14   
ref|XP_010524867.1|  PREDICTED: protein RALF-like 22                  74.3    9e-14   
ref|XP_010449887.1|  PREDICTED: protein RALF-like 33                  74.3    1e-13   
ref|XP_003529566.1|  PREDICTED: rapid alkalinization factor 23-like   74.3    1e-13   
gb|EMT22699.1|  hypothetical protein F775_09967                       74.3    1e-13   
ref|XP_009778264.1|  PREDICTED: rapid alkalinization factor           74.3    1e-13   
ref|XP_010546717.1|  PREDICTED: protein RALF-like 22                  74.3    1e-13   
ref|XP_009615222.1|  PREDICTED: rapid alkalinization factor-like      74.3    1e-13   
ref|NP_001149391.1|  LOC100283017 precursor                           74.3    1e-13   Zea mays [maize]
ref|XP_009781864.1|  PREDICTED: rapid alkalinization factor-like      74.3    1e-13   
ref|XP_009415108.1|  PREDICTED: protein RALF-like 19                  74.3    1e-13   
ref|XP_008458453.1|  PREDICTED: protein RALF-like 33                  73.9    1e-13   
ref|XP_004302396.1|  PREDICTED: protein RALF-like 33-like isoform 2   73.6    1e-13   
ref|XP_010504445.1|  PREDICTED: rapid alkalinization factor 23-like   74.3    1e-13   
ref|XP_006299574.1|  hypothetical protein CARUB_v10015749mg           74.3    1e-13   
ref|XP_006412966.1|  hypothetical protein EUTSA_v10026612mg           73.6    1e-13   
emb|CDX92081.1|  BnaA05g23260D                                        73.9    2e-13   
ref|XP_009629090.1|  PREDICTED: rapid alkalinization factor           73.6    2e-13   
ref|XP_010440247.1|  PREDICTED: protein RALF-like 33                  73.9    2e-13   
ref|XP_002883013.1|  hypothetical protein ARALYDRAFT_897975           73.9    2e-13   
gb|KDP28133.1|  hypothetical protein JCGZ_13904                       73.9    2e-13   
ref|XP_004502245.1|  PREDICTED: protein RALF-like 24-like             73.6    2e-13   
emb|CDM82107.1|  unnamed protein product                              73.6    2e-13   
ref|XP_009775621.1|  PREDICTED: rapid alkalinization factor-like      73.2    2e-13   
ref|XP_003609670.1|  Rapid alkalinization factor                      73.6    2e-13   
ref|XP_009373554.1|  PREDICTED: LOW QUALITY PROTEIN: protein RALF...  73.9    2e-13   
gb|KHN20242.1|  hypothetical protein glysoja_023805                   72.4    2e-13   
emb|CAN78122.1|  hypothetical protein VITISV_041547                   72.0    2e-13   Vitis vinifera
ref|XP_004143090.1|  PREDICTED: protein RALF-like 33-like             73.2    2e-13   
gb|EPS59172.1|  rapid alkalinization factor 2                         72.8    3e-13   
gb|KDP27792.1|  hypothetical protein JCGZ_18872                       73.2    3e-13   
ref|XP_007030995.1|  Rapid alkalinization factor 1, putative          73.2    3e-13   
ref|XP_010550987.1|  PREDICTED: protein RALF-like 22                  73.2    3e-13   
ref|XP_009604381.1|  PREDICTED: rapid alkalinization factor-like      73.2    3e-13   
ref|XP_003536069.1|  PREDICTED: protein RALF-like 1-like              72.8    3e-13   
gb|KHN31786.1|  hypothetical protein glysoja_050399                   72.0    3e-13   
ref|XP_006433408.1|  hypothetical protein CICLE_v10002897mg           72.8    3e-13   
ref|XP_008454184.1|  PREDICTED: protein RALF-like 33                  72.8    3e-13   
ref|XP_008775576.1|  PREDICTED: protein RALF-like 33                  72.8    3e-13   
ref|XP_010921813.1|  PREDICTED: protein RALF-like 33                  72.8    3e-13   
ref|XP_008789920.1|  PREDICTED: protein RALF-like 33                  72.8    4e-13   
gb|KDP38641.1|  hypothetical protein JCGZ_03994                       72.8    4e-13   
ref|XP_009135493.1|  PREDICTED: rapid alkalinization factor 23-like   73.2    4e-13   
ref|XP_008340810.1|  PREDICTED: protein RALF-like 33                  71.2    4e-13   
ref|XP_010938417.1|  PREDICTED: protein RALF-like 33                  72.8    4e-13   
ref|XP_007144948.1|  hypothetical protein PHAVU_007G197000g           72.4    4e-13   
ref|XP_009147231.1|  PREDICTED: LOW QUALITY PROTEIN: protein RALF...  72.4    4e-13   
emb|CDX75886.1|  BnaC03g39690D                                        72.8    4e-13   
ref|XP_004172589.1|  PREDICTED: protein RALF-like 33-like             72.4    5e-13   
ref|XP_010241287.1|  PREDICTED: protein RALF-like 19                  72.4    5e-13   
ref|XP_003575694.1|  PREDICTED: rapid alkalinization factor-like      72.4    5e-13   
ref|XP_010090810.1|  hypothetical protein L484_009088                 72.4    5e-13   
ref|XP_008349249.1|  PREDICTED: protein RALF-like 4                   72.0    6e-13   
emb|CDY43109.1|  BnaC05g36680D                                        72.4    6e-13   
emb|CDP05933.1|  unnamed protein product                              72.0    7e-13   
ref|XP_008349218.1|  PREDICTED: protein RALF-like 19                  72.0    7e-13   
ref|XP_006855698.1|  hypothetical protein AMTR_s00044p00139580        72.0    7e-13   
ref|XP_010052296.1|  PREDICTED: protein RALF-like 19                  71.6    7e-13   
ref|XP_006421017.1|  hypothetical protein CICLE_v10006214mg           72.0    8e-13   
ref|NP_001042630.1|  Os01g0257100                                     72.0    8e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EAY73360.1|  hypothetical protein OsI_01239                        72.0    9e-13   Oryza sativa Indica Group [Indian rice]
ref|NP_001043013.1|  Os01g0358100                                     71.6    9e-13   Oryza sativa Japonica Group [Japonica rice]
gb|KDO50663.1|  hypothetical protein CISIN_1g033245mg                 71.6    9e-13   
ref|XP_004152366.1|  PREDICTED: protein RALF-like 33-like             71.6    9e-13   
ref|XP_006489845.1|  PREDICTED: protein RALF-like 31-like             71.6    9e-13   
ref|XP_006468214.1|  PREDICTED: rapid alkalinization factor-like      71.6    1e-12   
ref|XP_010931638.1|  PREDICTED: rapid alkalinization factor-like      71.6    1e-12   
ref|XP_007163812.1|  hypothetical protein PHAVU_001G266400g           71.6    1e-12   
emb|CDP03512.1|  unnamed protein product                              71.6    1e-12   
ref|XP_011092082.1|  PREDICTED: rapid alkalinization factor-like      71.2    1e-12   
gb|EMT10153.1|  hypothetical protein F775_10210                       71.2    1e-12   
ref|XP_010247579.1|  PREDICTED: protein RALF-like 24                  71.6    1e-12   
emb|CDM86027.1|  unnamed protein product                              71.2    1e-12   
ref|XP_009402519.1|  PREDICTED: rapid alkalinization factor-like      71.2    1e-12   
dbj|BAK00812.1|  predicted protein                                    71.2    1e-12   
ref|XP_006606531.1|  PREDICTED: protein RALF-like 1-like              70.9    1e-12   
ref|XP_002874355.1|  hypothetical protein ARALYDRAFT_910810           70.9    2e-12   
ref|XP_009349368.1|  PREDICTED: protein RALF-like 33                  70.5    2e-12   
ref|XP_002457819.1|  hypothetical protein SORBIDRAFT_03g014360        70.9    2e-12   
gb|KHN16104.1|  hypothetical protein glysoja_012080                   70.5    2e-12   
ref|XP_009146075.1|  PREDICTED: rapid alkalinization factor 23-like   70.9    2e-12   
ref|XP_009349509.1|  PREDICTED: protein RALF-like 33                  70.9    2e-12   
ref|XP_008794136.1|  PREDICTED: protein RALF-like 22                  70.9    2e-12   
ref|NP_566555.1|  rapid alkalinization factor 23                      71.2    2e-12   
ref|XP_006285333.1|  hypothetical protein CARUB_v10006723mg           70.5    2e-12   
ref|XP_008786719.1|  PREDICTED: protein RALF-like 33                  70.9    2e-12   
gb|EYU42214.1|  hypothetical protein MIMGU_mgv1a016660mg              70.5    2e-12   
ref|NP_001150599.1|  LOC100284232 precursor                           70.5    2e-12   
ref|XP_010931639.1|  PREDICTED: protein RALF-like 33                  70.5    2e-12   
ref|XP_008813275.1|  PREDICTED: protein RALF-like 33                  70.5    2e-12   
gb|KDO77604.1|  hypothetical protein CISIN_1g044503mg                 70.5    2e-12   
ref|NP_001235444.1|  uncharacterized protein LOC100500513 precursor   70.5    2e-12   
ref|XP_006418288.1|  hypothetical protein EUTSA_v10009124mg           70.5    3e-12   
ref|XP_009393214.1|  PREDICTED: rapid alkalinization factor-like      70.5    3e-12   
ref|NP_001278545.1|  Rapid alkalinization factor 1 precursor          70.1    3e-12   
ref|XP_010524533.1|  PREDICTED: rapid alkalinization factor 23-like   70.5    3e-12   
ref|XP_004971750.1|  PREDICTED: protein RALF-like 33-like             70.5    3e-12   
ref|NP_001150887.1|  LOC100284520 precursor                           70.5    3e-12   
emb|CAN79219.1|  hypothetical protein VITISV_012796                   72.0    3e-12   
gb|KHN02967.1|  hypothetical protein glysoja_009833                   68.6    3e-12   
ref|XP_009384171.1|  PREDICTED: protein RALF-like 33                  70.1    3e-12   
ref|XP_008338587.1|  PREDICTED: protein RALF-like 24                  70.9    4e-12   
ref|XP_010069952.1|  PREDICTED: rapid alkalinization factor-like      70.1    4e-12   
ref|XP_003566439.1|  PREDICTED: rapid alkalinization factor-like      70.1    4e-12   
ref|XP_010059255.1|  PREDICTED: protein RALF-like 19                  69.7    4e-12   
ref|XP_007034215.1|  RALFL33, putative                                69.7    4e-12   
gb|AGT16955.1|  hypothetical protein SHCRBa_149_L20_R_90              69.7    5e-12   
ref|XP_009349507.1|  PREDICTED: rapid alkalinization factor-like      69.3    5e-12   
ref|XP_010548947.1|  PREDICTED: rapid alkalinization factor 23-like   69.7    5e-12   
gb|EMT00251.1|  hypothetical protein F775_01891                       68.2    5e-12   
gb|EPS64652.1|  rapid alkalinization factor                           68.2    6e-12   
ref|XP_009381039.1|  PREDICTED: rapid alkalinization factor-like      69.3    6e-12   
ref|NP_001241215.1|  uncharacterized protein LOC100793523 precursor   69.3    6e-12   
ref|XP_007140560.1|  hypothetical protein PHAVU_008G122900g           69.3    6e-12   
gb|EYU46690.1|  hypothetical protein MIMGU_mgv1a016538mg              69.3    6e-12   
gb|EYU44954.1|  hypothetical protein MIMGU_mgv1a023845mg              69.3    6e-12   
gb|EAY96898.1|  hypothetical protein OsI_18820                        69.7    6e-12   
ref|XP_009351497.1|  PREDICTED: rapid alkalinization factor-like      69.3    7e-12   
ref|XP_003538529.1|  PREDICTED: protein RALF-like 24-like             69.3    7e-12   
ref|XP_008342967.1|  PREDICTED: rapid alkalinization factor-like      69.3    7e-12   
ref|XP_010914425.1|  PREDICTED: protein RALF-like 33                  69.3    8e-12   
ref|XP_003521558.1|  PREDICTED: rapid alkalinization factor-like      68.9    8e-12   
ref|XP_002442268.1|  hypothetical protein SORBIDRAFT_08g017280        68.9    9e-12   
emb|CAN69272.1|  hypothetical protein VITISV_001680                   67.4    1e-11   
ref|XP_008358766.1|  PREDICTED: rapid alkalinization factor-like      68.6    1e-11   
ref|XP_006655080.1|  PREDICTED: rapid alkalinization factor-like      68.6    1e-11   
gb|EMS54687.1|  hypothetical protein TRIUR3_08197                     68.6    1e-11   
gb|ACG39263.1|  hypothetical protein                                  69.7    1e-11   
ref|XP_009766091.1|  PREDICTED: protein RALF-like 24                  68.9    2e-11   
gb|KHN20413.1|  hypothetical protein glysoja_039711                   67.0    2e-11   
ref|XP_007223934.1|  hypothetical protein PRUPE_ppa013295mg           68.6    2e-11   
ref|XP_010023649.1|  PREDICTED: protein RALF-like 24                  68.6    2e-11   
ref|XP_002459040.1|  hypothetical protein SORBIDRAFT_03g044930        68.2    2e-11   
ref|XP_003567435.1|  PREDICTED: protein RALF-like 33                  68.2    2e-11   
ref|XP_009412092.1|  PREDICTED: protein RALF-like 33                  67.8    2e-11   
emb|CDY53781.1|  BnaC04g44150D                                        67.8    2e-11   
ref|XP_002522804.1|  RALFL33, putative                                67.8    2e-11   
ref|XP_006373091.1|  hypothetical protein POPTR_0017s08620g           68.2    2e-11   
ref|XP_002459740.1|  hypothetical protein SORBIDRAFT_02g009700        68.2    2e-11   
gb|KHN15225.1|  hypothetical protein glysoja_042499                   67.8    2e-11   
ref|XP_010025230.1|  PREDICTED: rapid alkalinization factor-like      67.8    2e-11   
ref|XP_008339535.1|  PREDICTED: rapid alkalinization factor-like      67.4    2e-11   
ref|XP_008353053.1|  PREDICTED: LOW QUALITY PROTEIN: protein RALF...  68.6    3e-11   
ref|XP_006394946.1|  hypothetical protein EUTSA_v10005147mg           67.8    3e-11   
ref|NP_001042323.1|  Os01g0201400                                     68.2    3e-11   
gb|EAY72922.1|  hypothetical protein OsI_00794                        68.2    3e-11   
ref|XP_009340925.1|  PREDICTED: protein RALF-like 19                  67.4    3e-11   
ref|XP_002457590.1|  hypothetical protein SORBIDRAFT_03g009900        67.8    3e-11   
ref|XP_004963460.1|  PREDICTED: rapid alkalinization factor-like      67.8    3e-11   
gb|AGT16104.1|  hypothetical protein SHCRBa_134_J05_F_340             67.8    3e-11   
gb|EAZ10927.1|  hypothetical protein OsJ_00768                        67.8    3e-11   
ref|XP_008222806.1|  PREDICTED: protein RALF-like 24                  68.2    3e-11   
ref|XP_002440772.1|  hypothetical protein SORBIDRAFT_09g006350        67.8    3e-11   
ref|XP_011069491.1|  PREDICTED: protein RALF-like 24                  67.4    3e-11   
ref|XP_008800838.1|  PREDICTED: rapid alkalinization factor-like      67.4    4e-11   
ref|XP_009351500.1|  PREDICTED: protein RALF-like 33                  67.0    4e-11   
ref|NP_001149446.1|  rapid alkalinization factor 1 precursor          67.0    4e-11   
ref|XP_008338729.1|  PREDICTED: protein RALF-like 19                  67.0    4e-11   
ref|XP_008345894.1|  PREDICTED: protein RALF-like 19                  67.0    4e-11   
gb|EAY83408.1|  hypothetical protein OsI_38624                        67.0    5e-11   
gb|EPS64947.1|  rapid alkalinization factor 2                         66.2    6e-11   
ref|XP_009612980.1|  PREDICTED: protein RALF-like 24                  67.0    6e-11   
ref|NP_001066957.1|  Os12g0541700                                     66.6    6e-11   
ref|XP_010314746.1|  PREDICTED: uncharacterized protein LOC101258931  67.8    6e-11   
gb|EMT28519.1|  hypothetical protein F775_11053                       65.5    6e-11   
ref|XP_010272745.1|  PREDICTED: LOW QUALITY PROTEIN: protein RALF...  65.1    7e-11   
gb|ACU19560.1|  unknown                                               66.6    7e-11   
emb|CDP03492.1|  unnamed protein product                              65.1    8e-11   
ref|XP_010037445.1|  PREDICTED: rapid alkalinization factor           66.2    1e-10   
ref|XP_009392644.1|  PREDICTED: rapid alkalinization factor-like      65.9    1e-10   
ref|XP_006645884.1|  PREDICTED: rapid alkalinization factor-like      65.9    1e-10   
gb|KDP39325.1|  hypothetical protein JCGZ_01082                       65.5    1e-10   
ref|NP_001150875.1|  RALF precursor                                   65.9    1e-10   
ref|XP_003566535.1|  PREDICTED: rapid alkalinization factor-like      65.9    1e-10   
ref|XP_009802961.1|  PREDICTED: rapid alkalinization factor-like      65.5    1e-10   
ref|XP_004972328.1|  PREDICTED: rapid alkalinization factor-like      65.5    1e-10   
ref|XP_004971175.1|  PREDICTED: rapid alkalinization factor-like      65.1    2e-10   
ref|XP_004148669.1|  PREDICTED: protein RALF-like 4-like              65.1    2e-10   
ref|XP_010230590.1|  PREDICTED: rapid alkalinization factor-like      65.5    2e-10   
ref|XP_003524928.1|  PREDICTED: protein RALF-like 24-like             65.5    2e-10   
gb|KDP39326.1|  hypothetical protein JCGZ_01083                       65.1    2e-10   
ref|XP_006349913.1|  PREDICTED: protein RALF-like 33-like             65.9    2e-10   
gb|AAR00325.2|  rapid alkalinization factor 1                         65.9    2e-10   
ref|XP_004968724.1|  PREDICTED: rapid alkalinization factor-like      65.1    2e-10   
ref|XP_011012491.1|  PREDICTED: protein RALF-like 31                  65.1    2e-10   
ref|XP_003567676.1|  PREDICTED: rapid alkalinization factor 23-like   64.7    2e-10   
ref|XP_004295623.1|  PREDICTED: protein RALF-like 19-like             64.7    3e-10   
dbj|BAK04479.1|  predicted protein                                    65.1    3e-10   
ref|XP_009385018.1|  PREDICTED: protein RALF-like 33                  64.7    3e-10   
ref|NP_001150840.1|  rapid alkalinization factor 1 precursor          64.7    3e-10   
ref|NP_001151898.1|  LOC100285535 precursor                           64.7    3e-10   
ref|NP_001043012.1|  Os01g0357900                                     64.3    3e-10   
gb|KFK36285.1|  hypothetical protein AALP_AA4G102800                  63.9    4e-10   
ref|XP_004308256.1|  PREDICTED: protein RALF-like 19-like             64.3    4e-10   
ref|XP_008381617.1|  PREDICTED: protein RALF-like 33                  63.9    4e-10   
ref|XP_011003629.1|  PREDICTED: protein RALF-like 24                  64.3    5e-10   
ref|XP_010097951.1|  hypothetical protein L484_026842                 63.2    5e-10   
gb|KFK39677.1|  protein ralf-like 24                                  63.2    8e-10   
ref|XP_004298210.1|  PREDICTED: protein RALF-like 24-like             63.2    9e-10   
ref|XP_008655401.1|  PREDICTED: RALFL33 isoform X1                    63.2    9e-10   
emb|CDO98876.1|  unnamed protein product                              63.5    9e-10   
gb|AFW79661.1|  rapid alkalinization factor 1                         63.2    1e-09   
gb|EAY87021.1|  hypothetical protein OsI_08418                        63.2    1e-09   
ref|NP_001047696.2|  Os02g0670500                                     63.2    1e-09   
ref|XP_008653461.1|  PREDICTED: protein RALF-like 1                   63.2    1e-09   
ref|XP_004967815.1|  PREDICTED: protein RALF-like 22-like             63.2    1e-09   
emb|CDY58804.1|  BnaC08g46770D                                        62.4    1e-09   
ref|XP_009107494.1|  PREDICTED: protein RALF-like 31                  62.4    1e-09   
ref|XP_002868326.1|  hypothetical protein ARALYDRAFT_493518           62.4    2e-09   
ref|NP_001266447.1|  RALFL33                                          62.8    2e-09   
ref|XP_010241351.1|  PREDICTED: rapid alkalinization factor-like      62.8    2e-09   
ref|XP_002306471.1|  hypothetical protein POPTR_0005s18220g           62.8    2e-09   
ref|XP_004962821.1|  PREDICTED: rapid alkalinization factor-like      62.4    2e-09   
gb|EAY78048.1|  hypothetical protein OsI_33090                        62.0    2e-09   
ref|XP_002523599.1|  RALFL33, putative                                62.4    2e-09   
ref|XP_002459039.1|  hypothetical protein SORBIDRAFT_03g044920        62.4    2e-09   
gb|AAL31098.1|AC091749_27  hypothetical protein                       62.0    2e-09   
gb|AEW09180.1|  hypothetical protein CL4545Contig1_04                 60.5    2e-09   
ref|NP_001152007.1|  RALFL33 precursor                                62.0    2e-09   
ref|XP_008441015.1|  PREDICTED: protein RALF-like 19                  61.6    3e-09   
ref|XP_003559814.1|  PREDICTED: rapid alkalinization factor 23-like   61.6    3e-09   
gb|KDO71638.1|  hypothetical protein CISIN_1g032876mg                 62.0    3e-09   
gb|AGT16384.1|  hypothetical protein SHCRBa_052_I12_R_250             62.8    3e-09   
emb|CDJ26443.1|  unnamed protein product                              61.6    3e-09   
ref|XP_003561647.1|  PREDICTED: protein RALF-like 22                  61.2    4e-09   
gb|AFK34833.1|  unknown                                               61.6    4e-09   
ref|NP_567413.1|  protein ralf-like 31                                61.2    4e-09   
ref|XP_009383793.1|  PREDICTED: rapid alkalinization factor-like      61.2    4e-09   
gb|AAM62990.1|  unknown                                               61.2    4e-09   
gb|EMS58328.1|  hypothetical protein TRIUR3_13285                     60.8    5e-09   
ref|XP_006414843.1|  hypothetical protein EUTSA_v10026600mg           60.8    5e-09   
ref|XP_010450145.1|  PREDICTED: protein RALF-like 31                  60.5    6e-09   
ref|XP_010532737.1|  PREDICTED: protein RALF-like 24                  60.5    7e-09   
gb|EYU32711.1|  hypothetical protein MIMGU_mgv1a016289mg              60.8    8e-09   
ref|XP_011005857.1|  PREDICTED: protein RALF-like 34                  60.8    8e-09   
ref|XP_011029660.1|  PREDICTED: protein RALF-like 34                  60.5    8e-09   
gb|EAZ26888.1|  hypothetical protein OsJ_10813                        60.5    1e-08   
gb|ABF95894.1|  Rapid ALkalinization Factor family protein            60.5    1e-08   
ref|XP_011083276.1|  PREDICTED: protein RALF-like 19                  60.1    1e-08   
ref|XP_009799028.1|  PREDICTED: protein RALF-like 34                  60.1    1e-08   
ref|XP_010908035.1|  PREDICTED: protein RALF-like 33                  59.7    1e-08   
gb|EPS62454.1|  hypothetical protein M569_12337                       59.7    2e-08   
gb|EAZ11859.1|  hypothetical protein OsJ_01733                        59.3    2e-08   
ref|XP_009406337.1|  PREDICTED: protein RALF-like 33                  59.3    2e-08   
ref|XP_002310722.1|  hypothetical protein POPTR_0007s10940g           59.3    2e-08   
ref|XP_004958630.1|  PREDICTED: protein RALF-like 33-like             59.3    2e-08   
ref|XP_008655554.1|  PREDICTED: LOW QUALITY PROTEIN: rapid alkali...  59.7    2e-08   
ref|NP_001150677.1|  RALFL33 precursor                                58.9    2e-08   
ref|XP_004979239.1|  PREDICTED: rapid alkalinization factor 23-like   58.9    3e-08   
ref|XP_009403123.1|  PREDICTED: protein RALF-like 33                  58.9    3e-08   
ref|XP_010558588.1|  PREDICTED: protein RALF-like 34                  58.9    3e-08   
ref|XP_010667406.1|  PREDICTED: protein RALF-like 34                  58.9    3e-08   
ref|XP_009102578.1|  PREDICTED: protein RALF-like 24                  58.9    3e-08   
emb|CDX85126.1|  BnaC07g07800D                                        58.9    3e-08   
emb|CDX77484.1|  BnaA07g06220D                                        58.5    3e-08   
gb|AGT16335.1|  hypothetical protein SHCRBa_256_D11_F_160             60.8    3e-08   
ref|XP_009106333.1|  PREDICTED: protein RALF-like 24                  58.9    4e-08   
ref|XP_008241468.1|  PREDICTED: protein RALF-like 34                  58.5    4e-08   
gb|AGT16640.1|  rapid alkalinization factor 1                         58.2    4e-08   
ref|XP_004150814.1|  PREDICTED: protein RALF-like 4-like              58.2    4e-08   
gb|AGT15906.1|  RALFL33 precursor                                     58.2    4e-08   
ref|XP_006374915.1|  hypothetical protein POPTR_0014s02670g           58.2    4e-08   
gb|KGN56707.1|  hypothetical protein Csa_3G129640                     58.5    5e-08   
ref|XP_008438316.1|  PREDICTED: protein RALF-like 24                  58.5    5e-08   
emb|CDY50107.1|  BnaC01g43550D                                        58.2    5e-08   
gb|AGT16909.1|  ralf-like protein                                     58.2    5e-08   
ref|XP_004511922.1|  PREDICTED: protein RALF-like 34-like             58.2    5e-08   
ref|NP_001149642.1|  rapid ALkalinization Factor family protein p...  58.5    5e-08   
ref|XP_004984414.1|  PREDICTED: rapid alkalinization factor-like      58.2    6e-08   
gb|KHN36234.1|  hypothetical protein glysoja_003357                   58.2    6e-08   
dbj|BAB67949.1|  hypothetical protein                                 57.4    1e-07   
ref|XP_006848521.1|  hypothetical protein AMTR_s00013p00262240        57.0    1e-07   
ref|XP_002885594.1|  hypothetical protein ARALYDRAFT_898918           57.0    1e-07   
ref|XP_010466739.1|  PREDICTED: protein RALF-like 24                  57.0    1e-07   
ref|XP_006284794.1|  hypothetical protein CARUB_v10006063mg           57.0    1e-07   
ref|XP_002461186.1|  hypothetical protein SORBIDRAFT_02g042530        57.4    1e-07   
ref|NP_001067847.1|  Os11g0456000                                     56.6    1e-07   
ref|XP_011043533.1|  PREDICTED: protein RALF-like 34                  57.0    1e-07   
gb|EKG20916.1|  Rapid ALkalinization Factor                           58.2    1e-07   
ref|XP_010435211.1|  PREDICTED: protein RALF-like 31                  56.6    1e-07   
ref|XP_002298677.2|  hypothetical protein POPTR_0001s32790g           57.0    2e-07   
ref|XP_010512928.1|  PREDICTED: protein RALF-like 24                  56.6    2e-07   
gb|ABK25477.1|  unknown                                               56.2    2e-07   
ref|XP_010488459.1|  PREDICTED: protein RALF-like 24                  56.6    2e-07   
gb|EPS62616.1|  hypothetical protein M569_12176                       56.6    2e-07   
ref|XP_003611725.1|  hypothetical protein MTR_5g017160                56.6    2e-07   
ref|XP_006296636.1|  hypothetical protein CARUB_v10014939mg           56.6    2e-07   
ref|XP_010450123.1|  PREDICTED: protein RALF-like 31                  56.6    2e-07   
gb|KDO37447.1|  hypothetical protein CISIN_1g047734mg                 55.5    2e-07   
ref|NP_566740.1|  protein ralf-like 24                                56.6    2e-07   
ref|XP_007017197.1|  Ralf-like 34, putative                           56.6    2e-07   
gb|KHN42086.1|  hypothetical protein glysoja_003826                   56.2    2e-07   



>ref|XP_010675511.1| PREDICTED: protein RALF-like 19 [Beta vulgaris subsp. vulgaris]
 ref|XP_010696047.1| PREDICTED: protein RALF-like 19 [Beta vulgaris subsp. vulgaris]
Length=128

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (74%), Gaps = 3/80 (4%)
 Frame = -2

Query  267  RKCTGNVIGDDCVFEDEEMAMELGMSRRVL-GQTKYISYAALAANSIPCNARGRSYYNCH  91
            R C G +   DC+ ++EE AM++  +RR L G+ +YISY AL  N++PCN RG+SYYNC 
Sbjct  48   RTCNGRI--GDCIGDEEEEAMDVDDARRQLAGRRRYISYDALKKNNVPCNRRGQSYYNCR  105

Query  90   THQKVNPYNRGCSMITHCAR  31
            ++ + NPYNRGCS ITHCAR
Sbjct  106  SNARANPYNRGCSYITHCAR  125



>emb|CDO99525.1| unnamed protein product [Coffea canephora]
Length=124

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            C G V   DC+ E EEM ++   SRRVL QT+YISY AL   +IPC+ RG SYYNC +HQ
Sbjct  47   CNGRV--GDCIDEAEEMMLDSEASRRVLAQTRYISYDALRRGNIPCSRRGSSYYNCGSHQ  104

Query  81   KVNPYNRGCSMITHCAR  31
            K+NPY+ GC+ IT+C R
Sbjct  105  KINPYSGGCTRITNCVR  121



>ref|XP_009387647.1| PREDICTED: protein RALF-like 19 [Musa acuminata subsp. malaccensis]
Length=121

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = -2

Query  237  DCVFEDEEMAMELGMSRRVLG-QTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNR  61
            +CV ++EEM ME   +RR L  +TK++SY AL  N +PCN RG+SYYNCH  +KVNPY R
Sbjct  49   ECVGDEEEMTMESVSARRSLASRTKFVSYGALTKNRVPCNRRGQSYYNCHRQKKVNPYRR  108

Query  60   GCSMITHCAR  31
            GCS IT CAR
Sbjct  109  GCSSITKCAR  118



>ref|XP_010043059.1| PREDICTED: rapid alkalinization factor [Eucalyptus grandis]
 gb|KCW85083.1| hypothetical protein EUGRSUZ_B01916 [Eucalyptus grandis]
Length=117

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 54/77 (70%), Gaps = 2/77 (3%)
 Frame = -2

Query  267  RKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHT  88
            R+CTG++   +C+ E+EE AM+   +RR+L  +KYISY AL  NS+PC+ RG SYYNC  
Sbjct  41   RQCTGSLA--ECMSEEEEFAMDSESNRRILASSKYISYGALQRNSVPCSRRGASYYNCKP  98

Query  87   HQKVNPYNRGCSMITHC  37
                NPYNRGCS I+ C
Sbjct  99   GASSNPYNRGCSSISRC  115



>ref|XP_002528254.1| RALFL33, putative [Ricinus communis]
 gb|EEF34139.1| RALFL33, putative [Ricinus communis]
Length=112

 Score = 88.6 bits (218),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 62/101 (61%), Gaps = 6/101 (6%)
 Frame = -2

Query  324  FHQPQLLMVHGNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTK-YISYAA  148
            F    L MV  +HAT T PR  TG ++GD+    +EE+ ++   SRRVL   K Y+SYAA
Sbjct  9    FLLVALAMV-AHHATATAPRNSTGRLVGDE--VGEEEVMLDSEASRRVLASGKRYLSYAA  65

Query  147  LAANSIPCNARGRSYYNCH--THQKVNPYNRGCSMITHCAR  31
            L AN  PC  RGRSYY C     +KVNPY R C++IT C R
Sbjct  66   LKANMTPCMKRGRSYYYCKQLARKKVNPYKRACTVITKCYR  106



>ref|XP_002280202.1| PREDICTED: protein RALF-like 19 [Vitis vinifera]
Length=128

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 58/100 (58%), Gaps = 4/100 (4%)
 Frame = -2

Query  324  FHQPQLLMVHGNHATPTRPRK-CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTK-YISYA  151
            +   Q+ +V G     T     C G V   DC+ ED+EM M+   +RR L Q + YISY 
Sbjct  28   WDDSQIQLVDGTQVNATDGFAPCDGAV--GDCINEDDEMMMDSETNRRSLAQRRRYISYG  85

Query  150  ALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            AL  N +PCN RGRSYYNC    + NPY RGCS+IT C R
Sbjct  86   ALRRNQVPCNRRGRSYYNCRRGGRANPYRRGCSVITKCHR  125



>ref|XP_006849879.1| hypothetical protein AMTR_s00022p00078480 [Amborella trichopoda]
 gb|ERN11460.1| hypothetical protein AMTR_s00022p00078480 [Amborella trichopoda]
Length=123

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = -2

Query  255  GNVIGDDCVFEDEEMAMELGMSRRVLGQTK-YISYAALAANSIPCNARGRSYYNCHTHQK  79
            G+ +  D + EDEEM+M+   SRRVLG  + Y+SY AL  N +PCN RG SYYNC    +
Sbjct  45   GDGLVGDLIEEDEEMSMQSETSRRVLGAARQYLSYRALLKNRVPCNHRGNSYYNCKPRAR  104

Query  78   VNPYNRGCSMITHCAR  31
             NPY RGCS+IT CAR
Sbjct  105  ANPYRRGCSIITRCAR  120



>ref|XP_004505070.1| PREDICTED: protein RALF-like 19-like [Cicer arietinum]
Length=112

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = -2

Query  237  DCVFEDEEMAMELGMSRRVL-GQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNR  61
            D + E+ EM ME   +RR L GQ +YISY +L AN +PC  RG+SYYNC    + NPYNR
Sbjct  40   DLIGEENEMLMESETNRRTLEGQQRYISYGSLQANQVPCGRRGQSYYNCQQRGQANPYNR  99

Query  60   GCSMITHCAR  31
            GCS  THCAR
Sbjct  100  GCSQATHCAR  109



>ref|XP_010434917.1| PREDICTED: protein RALF-like 33 [Camelina sativa]
Length=119

 Score = 87.8 bits (216),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = -2

Query  279  PTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYY  100
            P    +CTG++   +C    EE  M+  ++RR+L  TKYISY AL  N++PC+ RG SYY
Sbjct  39   PIIESRCTGSI--AECSLSSEEFEMDSEINRRILATTKYISYGALKRNTVPCSRRGASYY  96

Query  99   NCHTHQKVNPYNRGCSMITHCAR  31
            NC    + NPY+RGCS IT C R
Sbjct  97   NCRRGAQANPYSRGCSAITRCRR  119



>ref|XP_003542740.1| PREDICTED: protein RALF-like 19-like [Glycine max]
 gb|KHN09995.1| hypothetical protein glysoja_026895 [Glycine soja]
Length=111

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = -2

Query  252  NVIGDDCVFEDEEMAMELGMSRRVL-GQTKYISYAALAANSIPCNARGRSYYNCHTHQKV  76
            N +  D + +D EM ++   +RR L G+ +YISY AL AN++PC  RGRSYYNC    + 
Sbjct  34   NAVVHDLIGDDNEMLLDSESNRRTLTGRQRYISYGALNANNVPCGNRGRSYYNCQQRGRA  93

Query  75   NPYNRGCSMITHCAR  31
            NPYNRGC+ ITHCAR
Sbjct  94   NPYNRGCTKITHCAR  108



>ref|XP_007025592.1| Ralf-like 4, putative [Theobroma cacao]
 gb|EOY28214.1| Ralf-like 4, putative [Theobroma cacao]
Length=117

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 57/100 (57%), Gaps = 10/100 (10%)
 Frame = -2

Query  324  FHQPQLLMVH-GNHATPTRPRKCTGNVIGDDCVFED-EEMAMELGMSRRVLGQTKYISYA  151
            FH+    + H GN    +         I   C  ED  +  M+  ++RR L Q +YISY 
Sbjct  23   FHEASWGLTHFGNDELSS--------CIDGQCDVEDVSQTLMDSEINRRQLAQKRYISYG  74

Query  150  ALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            AL ANS+PCN RG SYYNC   ++ NPYNRGCS ITHC R
Sbjct  75   ALKANSVPCNRRGNSYYNCQNRKRANPYNRGCSAITHCYR  114



>ref|XP_010644182.1| PREDICTED: protein RALF-like 19 [Vitis vinifera]
Length=126

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 56/99 (57%), Gaps = 3/99 (3%)
 Frame = -2

Query  324  FHQPQLLMVHGNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQT-KYISYAA  148
            F +    + H   A     R C G V   DC+    E  M+  +SRR L Q  K+ISY A
Sbjct  27   FSEANWGLTHFAGADLGGRRACNGLV--GDCIDPYAETMMDSEVSRRTLAQGGKFISYGA  84

Query  147  LAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            L  N++PCN RGRSYYNC    + NPY RGCS ITHCAR
Sbjct  85   LKKNNVPCNRRGRSYYNCRKGGRANPYQRGCSTITHCAR  123



>ref|NP_001237097.1| uncharacterized protein LOC100306584 precursor [Glycine max]
 gb|ACU14827.1| unknown [Glycine max]
Length=111

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = -2

Query  255  GNVIGDDCVFEDEEMAMELGMSRRVL-GQTKYISYAALAANSIPCNARGRSYYNCHTHQK  79
            G  +  D + +D EM ++   +RR L G+ +YISY AL AN++PC  RGRSYYNC    +
Sbjct  33   GAAVVHDLIGDDNEMLLDSKTNRRTLAGRRQYISYGALNANNVPCGNRGRSYYNCQQRGR  92

Query  78   VNPYNRGCSMITHCAR  31
             NPYNRGC+ ITHCAR
Sbjct  93   ANPYNRGCTQITHCAR  108



>gb|KHN16254.1| hypothetical protein glysoja_046571 [Glycine soja]
Length=111

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = -2

Query  255  GNVIGDDCVFEDEEMAMELGMSRRVL-GQTKYISYAALAANSIPCNARGRSYYNCHTHQK  79
            G  +  D + +D EM ++   +RR L G+ +YISY AL AN++PC  RGRSYYNC    +
Sbjct  33   GAAVVHDLIGDDNEMLLDSETNRRTLAGRQQYISYGALNANNVPCGNRGRSYYNCQQRGR  92

Query  78   VNPYNRGCSMITHCAR  31
             NPYNRGC+ ITHCAR
Sbjct  93   ANPYNRGCTQITHCAR  108



>gb|ABK25798.1| unknown [Picea sitchensis]
 gb|ACN41181.1| unknown [Picea sitchensis]
Length=121

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 58/83 (70%), Gaps = 4/83 (5%)
 Frame = -2

Query  276  TRPR-KCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYY  100
            ++PR +C G +IG+   FE++EM M+  ++RR L    YISYAAL ANS+PC+ RG SYY
Sbjct  39   SKPRPRCEG-LIGE--CFEEDEMQMDSEINRRFLAGRTYISYAALRANSVPCSKRGSSYY  95

Query  99   NCHTHQKVNPYNRGCSMITHCAR  31
            NC +  + NPY R C+ IT CAR
Sbjct  96   NCRSTSQANPYQRSCTTITRCAR  118



>ref|XP_006285957.1| hypothetical protein CARUB_v10007476mg [Capsella rubella]
 gb|EOA18855.1| hypothetical protein CARUB_v10007476mg [Capsella rubella]
Length=116

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 51/77 (66%), Gaps = 2/77 (3%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            CTG++   +C    EE  M+  +SRR+L  TKYISY AL  N++PC+ RG SYYNC    
Sbjct  42   CTGSI--AECSLSVEEFEMDSEISRRILATTKYISYGALRRNTVPCSRRGASYYNCRRGA  99

Query  81   KVNPYNRGCSMITHCAR  31
            + NPY+RGCS IT C R
Sbjct  100  QANPYSRGCSAITRCRR  116



>gb|ACN40381.1| unknown [Picea sitchensis]
Length=121

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 58/83 (70%), Gaps = 4/83 (5%)
 Frame = -2

Query  276  TRPR-KCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYY  100
            ++PR +C G +IG+   FE++EM M+  ++RR L    YISYAAL ANS+PC+ RG SYY
Sbjct  39   SKPRPRCEG-LIGE--CFEEDEMQMDSEINRRFLAGRTYISYAALRANSVPCSRRGSSYY  95

Query  99   NCHTHQKVNPYNRGCSMITHCAR  31
            NC +  + NPY R C+ IT CAR
Sbjct  96   NCRSTSQANPYQRSCTTITRCAR  118



>emb|CDX99974.1| BnaC09g03270D [Brassica napus]
Length=116

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 52/77 (68%), Gaps = 2/77 (3%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            C G++   DC+ E+EE  ++  +SRR+L   KY+SY A+  NS+PC+ RG SYYNC    
Sbjct  42   CRGSI--ADCIPEEEEFGLDSEISRRILASKKYVSYGAMRKNSVPCSRRGASYYNCQRGA  99

Query  81   KVNPYNRGCSMITHCAR  31
            + NPY+RGCS IT C R
Sbjct  100  QANPYSRGCSTITRCRR  116



>ref|XP_010313004.1| PREDICTED: rapid alkalinization factor [Solanum lycopersicum]
Length=114

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 54/85 (64%), Gaps = 2/85 (2%)
 Frame = -2

Query  291  NHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARG  112
            +   P R  +C G++   +C+ E++E A++   +RR+L   KYISY AL  NS+PC+ RG
Sbjct  30   DWMVPARSGECKGSIA--ECMAEEDEFALDSESNRRILATKKYISYGALQKNSVPCSRRG  87

Query  111  RSYYNCHTHQKVNPYNRGCSMITHC  37
             SYYNC    + NPY RGCS IT C
Sbjct  88   ASYYNCKPGAQANPYTRGCSAITRC  112



>gb|AAR00326.1| rapid alkalinization factor 2 [Solanum chacoense]
Length=114

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 54/85 (64%), Gaps = 2/85 (2%)
 Frame = -2

Query  291  NHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARG  112
            +   P R  +C G++   +C+ E++E A++   +RR+L   KYISY AL  NS+PC+ RG
Sbjct  30   DWMVPARSGECKGSIA--ECMAEEDEFALDSESNRRILATKKYISYGALQKNSVPCSRRG  87

Query  111  RSYYNCHTHQKVNPYNRGCSMITHC  37
             SYYNC    + NPY RGCS IT C
Sbjct  88   ASYYNCKPGAQANPYTRGCSAITRC  112



>emb|CDY19732.1| BnaA09g03850D [Brassica napus]
Length=116

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 52/77 (68%), Gaps = 2/77 (3%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            C G++   DC+ ++EE  ++  +SRR+L   KY+SY A+  NS+PC+ RG SYYNC    
Sbjct  42   CRGSIA--DCIPQEEEFGLDSEISRRILASKKYVSYGAMRKNSVPCSRRGASYYNCQRGA  99

Query  81   KVNPYNRGCSMITHCAR  31
            + NPY+RGCS IT C R
Sbjct  100  QANPYSRGCSTITRCRR  116



>gb|ABK22709.1| unknown [Picea sitchensis]
Length=122

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 57/83 (69%), Gaps = 4/83 (5%)
 Frame = -2

Query  276  TRPR-KCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYY  100
            ++PR +C G++   +C FEDEEM M+  ++RR L    Y+SY AL +NS+PC+ RG SYY
Sbjct  40   SKPRPRCEGSI--GEC-FEDEEMQMDSEINRRFLAGRTYVSYGALRSNSVPCSRRGSSYY  96

Query  99   NCHTHQKVNPYNRGCSMITHCAR  31
            NC +  + NPY R C+ IT CAR
Sbjct  97   NCGSTSQANPYKRSCTQITRCAR  119



>gb|ABS72341.1| rapid alkalinization factor precursor [Litchi chinensis]
Length=126

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 58/87 (67%), Gaps = 6/87 (7%)
 Frame = -2

Query  279  PTRPRKCTGNVIGDDCVFEDEEMAMELGM----SRRVLGQTKYISYAALAANSIPCNARG  112
            P +P +C+G+ IG+     DEE+ +E  M    +RR+L  ++YISY AL  NS+PC+ RG
Sbjct  42   PMKP-ECSGS-IGECATVGDEELDLEFEMDSESNRRILATSQYISYGALRRNSVPCSRRG  99

Query  111  RSYYNCHTHQKVNPYNRGCSMITHCAR  31
             SYYNC T  + NPY+RGCS IT C R
Sbjct  100  ASYYNCQTGAQANPYSRGCSAITRCRR  126



>ref|XP_007043620.1| Uncharacterized protein TCM_008135 [Theobroma cacao]
 gb|EOX99451.1| Uncharacterized protein TCM_008135 [Theobroma cacao]
Length=126

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = -2

Query  240  DDCVFEDEEMAMELGMSRRVLGQTK-YISYAALAANSIPCNARGRSYYNCHTHQKVNPYN  64
             +C+  +EE  ME  +SRR L + K YISY AL  NS+PCN RG SYYNC    + NPY 
Sbjct  53   SECIGNEEETPMEWDISRRALAEGKRYISYGALKQNSVPCNRRGNSYYNCGAPGRANPYK  112

Query  63   RGCSMITHCAR  31
            RGCS+ITHC R
Sbjct  113  RGCSVITHCYR  123



>ref|XP_004504245.1| PREDICTED: protein RALF-like 19-like [Cicer arietinum]
Length=112

 Score = 85.5 bits (210),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = -2

Query  243  GDDCVFEDE-EMAMELGMSRRVL-GQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNP  70
            GD+ + ED+ E  M    S RVL G+ +YI Y AL AN +PC  RGRSYYNCH   + NP
Sbjct  37   GDNGLIEDDNEFLMSSEASHRVLAGRRRYIGYGALRANQVPCGRRGRSYYNCHRRGRANP  96

Query  69   YNRGCSMITHCAR  31
            Y+RGCS ITHCAR
Sbjct  97   YHRGCSAITHCAR  109



>ref|XP_004290774.1| PREDICTED: protein RALF-like 33-like isoform 1 [Fragaria vesca 
subsp. vesca]
 ref|XP_004290775.1| PREDICTED: protein RALF-like 33-like isoform 2 [Fragaria vesca 
subsp. vesca]
Length=114

 Score = 85.5 bits (210),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 56/87 (64%), Gaps = 4/87 (5%)
 Frame = -2

Query  297  HGNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNA  118
            HG    P + R C G++   +C+ EDE   M+  ++RR+L  TKYISY AL  N++PC+ 
Sbjct  30   HGLSFVPAKSR-CQGSIA--ECMAEDE-FDMDSEINRRILATTKYISYGALQRNTVPCSQ  85

Query  117  RGRSYYNCHTHQKVNPYNRGCSMITHC  37
            RG SYYNC    + NPYNRGCS IT C
Sbjct  86   RGASYYNCKPGAQANPYNRGCSAITRC  112



>ref|XP_002321018.2| hypothetical protein POPTR_0014s12630g [Populus trichocarpa]
 gb|EEE99333.2| hypothetical protein POPTR_0014s12630g [Populus trichocarpa]
Length=115

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = -2

Query  297  HGNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNA  118
            H  +  PTR R C G V   +C+  DE   M+  ++RR+L  + YISY AL  N++PC+ 
Sbjct  30   HNLNWVPTRARGCQGTVA--ECMGNDE-FEMDSEINRRILATSNYISYDALGKNNVPCSQ  86

Query  117  RGRSYYNCHTHQKVNPYNRGCSMITHC  37
            RG SYYNC T  + NPY+RGCS IT C
Sbjct  87   RGASYYNCKTGAEANPYSRGCSAITRC  113



>ref|XP_009111745.1| PREDICTED: protein RALF-like 22 [Brassica rapa]
Length=116

 Score = 85.1 bits (209),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 52/77 (68%), Gaps = 2/77 (3%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            C G++   DC+ ++EE  ++  +SRR+L   KY+SY A+  NS+PC+ RG SYYNC    
Sbjct  42   CRGSI--ADCIPQEEEFGLDSEISRRILASKKYVSYGAMRKNSVPCSRRGASYYNCQRGA  99

Query  81   KVNPYNRGCSMITHCAR  31
            + NPY+RGCS IT C R
Sbjct  100  QANPYSRGCSTITRCRR  116



>ref|XP_010105661.1| hypothetical protein L484_010825 [Morus notabilis]
 gb|EXC05642.1| hypothetical protein L484_010825 [Morus notabilis]
Length=119

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 53/77 (69%), Gaps = 4/77 (5%)
 Frame = -2

Query  267  RKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHT  88
            + C G++   +C+ E+ EM  E+  SRR+L  TKYISY AL  N++PC+ RG SYYNC T
Sbjct  45   KGCDGSI--AECLEEEFEMDSEI--SRRILATTKYISYGALQRNTVPCSRRGASYYNCKT  100

Query  87   HQKVNPYNRGCSMITHC  37
              + NPYNRGCS IT C
Sbjct  101  GAQANPYNRGCSAITRC  117



>ref|XP_008791840.1| PREDICTED: rapid alkalinization factor-like [Phoenix dactylifera]
Length=128

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = -2

Query  234  CVFEDEEMAMELGMSRRVLGQ--TKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNR  61
            C+ ED EM  E G+SRR L +   ++ISY AL+ N +PCN RGRSYYNC   +  NPY R
Sbjct  56   CIDEDTEMETETGISRRGLARAGVRHISYGALSKNRVPCNRRGRSYYNCSRGKSANPYRR  115

Query  60   GCSMITHCAR  31
            GCS+IT C R
Sbjct  116  GCSVITQCQR  125



>gb|AAO27366.1| rapid alkalinization factor 1 precursor [Populus trichocarpa 
x Populus deltoides]
Length=120

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = -2

Query  279  PTRPRKCTGNVIGDDCVFED-EEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSY  103
             TR   C G++   +C+ ED EE  M+  ++RR+L  TKY+SY AL  N++PC+ RG SY
Sbjct  39   ATRSSVCKGSI--AECMAEDGEEFEMDTEINRRILATTKYVSYGALQRNNVPCSRRGASY  96

Query  102  YNCHTHQKVNPYNRGCSMITHC  37
            YNC    + NPY+RGCS IT C
Sbjct  97   YNCQRGAQANPYSRGCSRITRC  118



>ref|XP_006382486.1| RALF-LIKE 23 family protein [Populus trichocarpa]
 gb|ABK94089.1| unknown [Populus trichocarpa]
 gb|ERP60283.1| RALF-LIKE 23 family protein [Populus trichocarpa]
Length=120

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = -2

Query  279  PTRPRKCTGNVIGDDCVFED-EEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSY  103
             TR   C G++   +C+ ED EE  M+  ++RR+L  TKY+SY AL  N++PC+ RG SY
Sbjct  39   ATRSSVCKGSI--AECMAEDGEEFEMDTEINRRILATTKYVSYGALQRNNVPCSRRGASY  96

Query  102  YNCHTHQKVNPYNRGCSMITHC  37
            YNC    + NPY+RGCS IT C
Sbjct  97   YNCQRGAQANPYSRGCSRITRC  118



>ref|XP_006444286.1| hypothetical protein CICLE_v10023750mg [Citrus clementina]
 ref|XP_006479916.1| PREDICTED: protein RALF-like 33-like [Citrus sinensis]
 gb|ESR57526.1| hypothetical protein CICLE_v10023750mg [Citrus clementina]
 gb|KDO87300.1| hypothetical protein CISIN_1g033577mg [Citrus sinensis]
Length=116

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 55/82 (67%), Gaps = 4/82 (5%)
 Frame = -2

Query  282  TPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSY  103
             P + R C G++   +C+  DEE  M+  ++RR+L  TKYISY AL  +S+PC+ RG SY
Sbjct  37   VPAKAR-CQGSMA--ECM-ADEEFGMDSEINRRILATTKYISYGALQRDSVPCSQRGASY  92

Query  102  YNCHTHQKVNPYNRGCSMITHC  37
            YNCH   + NPY+RGCS IT C
Sbjct  93   YNCHAGAQANPYSRGCSAITRC  114



>ref|XP_004485791.1| PREDICTED: protein RALF-like 19-like [Cicer arietinum]
Length=112

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = -2

Query  231  VFEDEEMAMELGMSRRVL-GQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGC  55
            + +D E  M    S R+L G+ +YISY AL AN +PC  RGRSYYNC    K NPY RGC
Sbjct  42   IEDDNEFLMSSEASHRILAGRGRYISYGALRANQVPCGKRGRSYYNCQKRGKANPYRRGC  101

Query  54   SMITHCAR  31
            S+ITHCAR
Sbjct  102  SVITHCAR  109



>ref|XP_004495709.1| PREDICTED: rapid alkalinization factor-like [Cicer arietinum]
Length=120

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 54/86 (63%), Gaps = 3/86 (3%)
 Frame = -2

Query  294  GNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNAR  115
            G    P     C G++   +C+ ED+E  ++  ++RR+L  TKYISY AL  N++PC+ R
Sbjct  36   GMGWLPLTKAVCEGSIA--ECL-EDDEFELDSEINRRILANTKYISYGALQRNTVPCSRR  92

Query  114  GRSYYNCHTHQKVNPYNRGCSMITHC  37
            G SYYNC    K NPYNRGCS IT C
Sbjct  93   GASYYNCRPGAKANPYNRGCSAITRC  118



>ref|XP_008370433.1| PREDICTED: rapid alkalinization factor-like [Malus domestica]
Length=120

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 5/82 (6%)
 Frame = -2

Query  273  RPRKCTGNVIGDDCVF---EDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSY  103
            +   C G++   +C     +DEE  M+  +SRR+L  TKYISY AL  N++PC+ RG SY
Sbjct  39   KSASCKGSIA--ECALAAGDDEEFDMDSEISRRILATTKYISYGALQRNTVPCSRRGASY  96

Query  102  YNCHTHQKVNPYNRGCSMITHC  37
            YNC    + NPYNRGCS IT C
Sbjct  97   YNCKPGAQANPYNRGCSAITRC  118



>ref|XP_011027816.1| PREDICTED: protein RALF-like 19 [Populus euphratica]
Length=115

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 2/72 (3%)
 Frame = -2

Query  240  DDCVFE-DEEMAMELGMSRRVLGQ-TKYISYAALAANSIPCNARGRSYYNCHTHQKVNPY  67
            D+  FE   EM M+  ++ R+L Q T+YISY AL ANS+PCN RGRSYYNC+  Q+ NPY
Sbjct  41   DNNGFEFSTEMMMDSEINHRLLAQKTRYISYGALRANSVPCNRRGRSYYNCNRRQRANPY  100

Query  66   NRGCSMITHCAR  31
             RGCS IT C R
Sbjct  101  RRGCSTITRCRR  112



>ref|XP_006344656.1| PREDICTED: rapid alkalinization factor-like [Solanum tuberosum]
Length=114

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 2/85 (2%)
 Frame = -2

Query  291  NHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARG  112
            +   P R  +C G++   +C+ E++E A++   +RR+L    YISY AL  NS+PC+ RG
Sbjct  30   DWMVPARSGECKGSIA--ECMAEEDEFALDSESNRRILATKNYISYGALQKNSVPCSRRG  87

Query  111  RSYYNCHTHQKVNPYNRGCSMITHC  37
             SYYNC    + NPY RGCS IT C
Sbjct  88   ASYYNCKPGAQANPYTRGCSAITRC  112



>ref|XP_011033568.1| PREDICTED: protein RALF-like 1 [Populus euphratica]
Length=115

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = -2

Query  297  HGNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNA  118
            H  +  PTR R C G V   +C+  DE   M+  ++RR+L  + YISY AL  +++PC+ 
Sbjct  30   HNLNWVPTRARGCQGTVA--ECMGNDE-FEMDSEINRRILATSDYISYDALEKDNVPCSQ  86

Query  117  RGRSYYNCHTHQKVNPYNRGCSMITHC  37
            RG SYYNC T  + NPY+RGCS IT C
Sbjct  87   RGASYYNCKTGAEANPYSRGCSAITRC  113



>ref|NP_567476.1| protein ralf-like 33 [Arabidopsis thaliana]
 sp|Q8L9P8.1|RLF33_ARATH RecName: Full=Protein RALF-like 33; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAM65845.1| RALF precursor [Arabidopsis thaliana]
 gb|ABF59010.1| At4g15800 [Arabidopsis thaliana]
 dbj|BAE99025.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83653.1| protein ralf-like 33 [Arabidopsis thaliana]
Length=116

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  264  KCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            KC G +        +EE  M+  ++RR+L  TKYISY AL  N++PC+ RG SYYNC   
Sbjct  39   KCNGTIAECSLSTAEEEFEMDSEINRRILATTKYISYGALRRNTVPCSRRGASYYNCRRG  98

Query  84   QKVNPYNRGCSMITHCAR  31
             + NPY+RGCS IT C R
Sbjct  99   AQANPYSRGCSAITRCRR  116



>gb|KHN24772.1| hypothetical protein glysoja_045891 [Glycine soja]
Length=124

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 52/85 (61%), Gaps = 12/85 (14%)
 Frame = -2

Query  249  VIGD---DCVFEDEEMAMELGMSRRVL---------GQTKYISYAALAANSIPCNARGRS  106
            +I D   D + +D E  M    +RR L         G+ +YISYAAL +N +PC  RGRS
Sbjct  37   IISDGDADLIVDDNEFLMSSESTRRSLMHGHPGKGRGRARYISYAALRSNQVPCGRRGRS  96

Query  105  YYNCHTHQKVNPYNRGCSMITHCAR  31
            YYNC+   + NPYNRGC+ ITHCAR
Sbjct  97   YYNCNQRGRANPYNRGCTAITHCAR  121



>ref|XP_007212761.1| hypothetical protein PRUPE_ppa026481mg [Prunus persica]
 gb|EMJ13960.1| hypothetical protein PRUPE_ppa026481mg [Prunus persica]
Length=122

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 55/91 (60%), Gaps = 7/91 (8%)
 Frame = -2

Query  297  HGNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVL--GQTKYISYAALAANSIPC  124
            H + +   R     G++IG     E+ EM M+   SRR L   Q +YI+Y AL  N++PC
Sbjct  36   HDDESLIDRANSKVGDMIG-----EENEMMMDSESSRRTLRGAQGRYIAYGALRRNAVPC  90

Query  123  NARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
              RG+SYYNC   Q+ NPY RGC++IT CAR
Sbjct  91   GRRGQSYYNCQNRQRANPYQRGCTIITRCAR  121



>ref|XP_010526512.1| PREDICTED: protein RALF-like 4 [Tarenaya hassleriana]
Length=102

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 5/72 (7%)
 Frame = -2

Query  246  IGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPY  67
            +  DCV E+   A E  MSRR+L  T+YISY AL  N+IPCN RGRSYYNC     VNPY
Sbjct  33   LSGDCVKEE---ATE--MSRRILKGTRYISYDALKRNNIPCNRRGRSYYNCGPGGPVNPY  87

Query  66   NRGCSMITHCAR  31
            +RGCS+ITHC R
Sbjct  88   HRGCSVITHCYR  99



>gb|EMS45535.1| hypothetical protein TRIUR3_16964 [Triticum urartu]
Length=124

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 58/87 (67%), Gaps = 6/87 (7%)
 Frame = -2

Query  276  TRPRKCTGNVIGDDCVFEDEEMAMELGMS-RRVLGQ---TKYISYAALAANSIPCNARGR  109
            +R   C G +IG+  V EDEEMA   G + RR L +    +YISYAAL A+ IPC+ RG 
Sbjct  36   SRAAACDG-IIGECGVDEDEEMAPGAGEALRRSLARKSTARYISYAALRADQIPCDKRGA  94

Query  108  SYY-NCHTHQKVNPYNRGCSMITHCAR  31
            SYY NC + Q+ NPY RGCS ITHCAR
Sbjct  95   SYYINCGSMQQANPYTRGCSAITHCAR  121



>gb|AFK46281.1| unknown [Lotus japonicus]
Length=110

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 48/74 (65%), Gaps = 2/74 (3%)
 Frame = -2

Query  249  VIGDDCVFEDEEMAMELGMSRRVL-GQTKYISYAALAANSIPCNARGRSYYNCHTHQKVN  73
            V+GD  + ED EM ++   SRR L G+  YISY AL A  +PC  RGRSYYNC    + N
Sbjct  34   VVGD-VIGEDNEMLLDSEASRRTLRGRRGYISYGALKAGQVPCGRRGRSYYNCQQRGRAN  92

Query  72   PYNRGCSMITHCAR  31
            PY RGC+  THCAR
Sbjct  93   PYRRGCTAATHCAR  106



>emb|CDY09740.1| BnaC07g33210D [Brassica napus]
Length=111

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = -2

Query  264  KCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            +CTG++   +C     E  M+  +SRR+L  T+YISY AL  N++PC+ RG SYYNC   
Sbjct  36   ECTGSI--AECSTATAEFEMDSEISRRILATTRYISYGALRRNTVPCSRRGASYYNCRRG  93

Query  84   QKVNPYNRGCSMITHCAR  31
             + NPY+RGCS IT C R
Sbjct  94   AQANPYSRGCSAITRCRR  111



>ref|XP_007159334.1| hypothetical protein PHAVU_002G229400g [Phaseolus vulgaris]
 gb|ESW31328.1| hypothetical protein PHAVU_002G229400g [Phaseolus vulgaris]
Length=108

 Score = 82.4 bits (202),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = -2

Query  243  GDDCVFEDEEMAMELGMSRRVL-GQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPY  67
            G D V +D EM ++   +RR L G+ +YISY AL AN  PC  RG SYYNC    + NPY
Sbjct  34   GMDLVGDDNEMQLDSESNRRTLAGREQYISYGALNANQAPCGNRGNSYYNCQDRGRANPY  93

Query  66   NRGCSMITHCAR  31
            +RGCS ITHCAR
Sbjct  94   SRGCSQITHCAR  105



>ref|XP_011036862.1| PREDICTED: protein RALF-like 33 [Populus euphratica]
Length=120

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = -2

Query  279  PTRPRKCTGNVIGDDCVFED-EEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSY  103
             TR   C G++   +C+ ED EE  M+  ++RR+L  +KY+SY AL  N++PC+ RG SY
Sbjct  39   ATRSSICKGSI--AECMAEDGEEFEMDTEINRRILATSKYVSYGALQRNNVPCSRRGASY  96

Query  102  YNCHTHQKVNPYNRGCSMITHC  37
            YNC    + NPY RGCS IT C
Sbjct  97   YNCRRGAQANPYGRGCSRITRC  118



>ref|XP_010259629.1| PREDICTED: rapid alkalinization factor [Nelumbo nucifera]
Length=116

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 51/77 (66%), Gaps = 2/77 (3%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            C G++   +C+  D+E  M+  +SRR+L   +YISY AL  N++PC+ RG SYYNC    
Sbjct  42   CQGSM--GECMDADDEFGMDSEISRRILATNQYISYGALQRNTVPCSRRGASYYNCKPGA  99

Query  81   KVNPYNRGCSMITHCAR  31
            + NPYNRGCS IT C R
Sbjct  100  QANPYNRGCSAITRCRR  116



>ref|XP_010097623.1| hypothetical protein L484_001106 [Morus notabilis]
 gb|EXB69889.1| hypothetical protein L484_001106 [Morus notabilis]
Length=164

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 4/76 (5%)
 Frame = -2

Query  267  RKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHT  88
            + C G++   +C+  +EE  M+  +SRR+L  TKYISY AL  N++PC+ RG SYYNC T
Sbjct  45   KGCDGSIA--ECL--EEEFEMDSEISRRILATTKYISYGALQRNTVPCSRRGASYYNCKT  100

Query  87   HQKVNPYNRGCSMITH  40
              + NPYNRGCS IT 
Sbjct  101  GAQANPYNRGCSAITR  116



>ref|XP_008246129.1| PREDICTED: rapid alkalinization factor-like [Prunus mume]
Length=124

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 3/76 (4%)
 Frame = -2

Query  264  KCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            +  G +I +D   ED E+ ME  +SRR+L   +YISY AL  N++PC+ RG SYYNC   
Sbjct  50   RSAGGLIAED---EDLELPMESEISRRILATNRYISYGALRRNTVPCSRRGASYYNCRPG  106

Query  84   QKVNPYNRGCSMITHC  37
             + NPY+RGCS IT C
Sbjct  107  AQANPYSRGCSAITRC  122



>ref|XP_003626248.1| hypothetical protein MTR_7g113080 [Medicago truncatula]
 gb|ABN08027.1| Rapid ALkalinization Factor [Medicago truncatula]
 gb|AES82466.1| RALF [Medicago truncatula]
 gb|AFK41182.1| unknown [Medicago truncatula]
Length=127

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 61/107 (57%), Gaps = 9/107 (8%)
 Frame = -2

Query  351  SPTYNDNHRFHQPQLLMVHGNHATPTRPRKCTGNVIGDDCVFE--DEEMAMELGMSRRVL  178
            SPT +    F    +  +H      T+   C G++   DC+ +  +EE   +  ++RR+L
Sbjct  26   SPTVDAAGGFELGGMEWIH-----QTKTATCEGSI--ADCMLQQGEEEFQFDNEINRRIL  78

Query  177  GQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHC  37
              TKYISY AL  N++PC+ RG SYYNC    + NPY+RGCS IT C
Sbjct  79   ATTKYISYGALQRNTVPCSRRGASYYNCRPGAQANPYSRGCSAITRC  125



>ref|XP_007227502.1| hypothetical protein PRUPE_ppa013419mg [Prunus persica]
 gb|EMJ28701.1| hypothetical protein PRUPE_ppa013419mg [Prunus persica]
Length=124

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 3/76 (4%)
 Frame = -2

Query  264  KCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            +  G +I +D   ED E+ ME  +SRR+L   +YISY AL  N++PC+ RG SYYNC   
Sbjct  50   RSAGGLIAED---EDLELPMESEISRRILATNRYISYGALRRNTVPCSRRGASYYNCRPG  106

Query  84   QKVNPYNRGCSMITHC  37
             + NPY+RGCS IT C
Sbjct  107  AQANPYSRGCSRITRC  122



>gb|AAS13437.1| rapid alkalinization factor preproprotein [Nicotiana attenuata]
Length=115

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 54/86 (63%), Gaps = 3/86 (3%)
 Frame = -2

Query  291  NHATPTRP-RKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNAR  115
            +   P R  R C G++   +C+ E++E  ++   +RR+L   KYISY AL  NS+PC+ R
Sbjct  30   DWVMPARSGRGCNGSI--GECMAEEDEFELDSESNRRILATKKYISYGALQKNSVPCSRR  87

Query  114  GRSYYNCHTHQKVNPYNRGCSMITHC  37
            G SYYNC    + NPY+RGCS IT C
Sbjct  88   GASYYNCKPGAQANPYSRGCSAITRC  113



>ref|XP_010108173.1| hypothetical protein L484_014498 [Morus notabilis]
 gb|EXC18098.1| hypothetical protein L484_014498 [Morus notabilis]
Length=120

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 52/92 (57%), Gaps = 7/92 (8%)
 Frame = -2

Query  303  MVHGNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTK-YISYAALAANSIP  127
            + H NH          G+ IGDD      EM ++   SRR L + + YI Y AL AN +P
Sbjct  32   LSHFNHVVAGGA-GAIGDFIGDD-----NEMLLDSEASRRSLARGRSYIGYDALKANQVP  85

Query  126  CNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            C  RG SYYNC   Q+ NPY RGCS ITHCAR
Sbjct  86   CGRRGHSYYNCQKRQRANPYKRGCSAITHCAR  117



>ref|XP_009409606.1| PREDICTED: protein RALF-like 22 [Musa acuminata subsp. malaccensis]
Length=133

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 58/100 (58%), Gaps = 4/100 (4%)
 Frame = -2

Query  318  QPQLLMVHGNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVL----GQTKYISYA  151
            Q  L+ V G  A        T + +  +CV ED+E  ME   +RR L    G+ ++ISY 
Sbjct  31   QWGLVRVDGGDAAGLGASAPTCDGLVGECVDEDDEPDMEPEDARRFLYRANGRQRFISYG  90

Query  150  ALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            AL+ + +PCN RG SYYNC    + NPY RGCS+IT CAR
Sbjct  91   ALSRDRVPCNRRGHSYYNCRRSGRANPYRRGCSVITRCAR  130



>ref|XP_002305130.2| hypothetical protein POPTR_0004s04470g [Populus trichocarpa]
 ref|XP_002305131.2| hypothetical protein POPTR_0004s04480g [Populus trichocarpa]
 gb|EEE85641.2| hypothetical protein POPTR_0004s04470g [Populus trichocarpa]
 gb|EEE85642.2| hypothetical protein POPTR_0004s04480g [Populus trichocarpa]
Length=112

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 50/72 (69%), Gaps = 2/72 (3%)
 Frame = -2

Query  240  DDCVFE-DEEMAMELGMSRRVLGQ-TKYISYAALAANSIPCNARGRSYYNCHTHQKVNPY  67
            D+  FE   EM M+  ++ R+L Q T+YISY AL ANS+PCN RG SYYNC+  Q+ NPY
Sbjct  38   DNNGFEFSTEMMMDSEINHRLLAQKTRYISYGALRANSVPCNRRGSSYYNCNKRQRANPY  97

Query  66   NRGCSMITHCAR  31
             RGCS IT C R
Sbjct  98   RRGCSTITRCRR  109



>ref|XP_010549330.1| PREDICTED: protein RALF-like 19 [Tarenaya hassleriana]
Length=110

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 54/76 (71%), Gaps = 3/76 (4%)
 Frame = -2

Query  249  VIGDDCVFEDE--EMAMELGMSRRVLGQ-TKYISYAALAANSIPCNARGRSYYNCHTHQK  79
            V G+ C+ +++  E  M+   +RR L Q  +YISY AL  N++PC+ RGRSYY+C   ++
Sbjct  32   VNGEGCIGDEDGVETLMDSETNRRQLAQGRRYISYGALRKNNVPCSRRGRSYYDCRRRKR  91

Query  78   VNPYNRGCSMITHCAR  31
            VNPY RGCS+ITHCAR
Sbjct  92   VNPYRRGCSVITHCAR  107



>ref|XP_008386646.1| PREDICTED: rapid alkalinization factor-like [Malus domestica]
Length=113

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 55/88 (63%), Gaps = 4/88 (5%)
 Frame = -2

Query  297  HGNHATPTRPRKCTGNVIGDDCVFE-DEEMAMELGMSRRVLGQTKYISYAALAANSIPCN  121
            HG    P RPR C G+V   +C+ + D+   M+  +SRR+L  ++YISY AL  N++PC+
Sbjct  27   HGASWVPVRPR-CEGSVA--ECMDDHDDVFGMDSEISRRILATSQYISYGALQRNTVPCS  83

Query  120  ARGRSYYNCHTHQKVNPYNRGCSMITHC  37
             R  SYYNC    + NPYNRGCS I  C
Sbjct  84   QRXASYYNCKPGXQSNPYNRGCSAIARC  111



>ref|XP_008225111.1| PREDICTED: protein RALF-like 22 [Prunus mume]
Length=122

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 54/91 (59%), Gaps = 7/91 (8%)
 Frame = -2

Query  297  HGNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVL--GQTKYISYAALAANSIPC  124
            H + +   R     G++IG     E+ EM M+   SRR L   Q +YI+Y AL  N++PC
Sbjct  36   HDDESLIDRANGKVGDMIG-----EENEMMMDSESSRRTLRGSQGRYIAYGALRRNAVPC  90

Query  123  NARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
              RG+SYYNC   Q+ NPY RGC+ IT CAR
Sbjct  91   GRRGQSYYNCQNRQRANPYQRGCTTITRCAR  121



>ref|XP_010915431.1| PREDICTED: protein RALF-like 22 [Elaeis guineensis]
Length=124

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -2

Query  234  CVFEDEEMAMELGMSRRVLGQ--TKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNR  61
            C  ED EM  E G+SRR L +   +YISY AL+ N +PCN RG SYY C   ++ NPY R
Sbjct  52   CTDEDAEMETETGISRRGLARAGVRYISYGALSRNRVPCNRRGHSYYRCSRGKRANPYRR  111

Query  60   GCSMITHCAR  31
            GCS+IT C R
Sbjct  112  GCSVITQCQR  121



>ref|XP_009342123.1| PREDICTED: protein RALF-like 33 [Pyrus x bretschneideri]
 ref|XP_009342133.1| PREDICTED: protein RALF-like 33 [Pyrus x bretschneideri]
Length=113

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 55/83 (66%), Gaps = 4/83 (5%)
 Frame = -2

Query  282  TPTRPRKCTGNVIGDDCVFE-DEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRS  106
             P RPR C G+V   +C+ + D+E  M+  +SRR+L  ++YISY AL  N++PC+ RG S
Sbjct  32   VPLRPR-CEGSVA--ECMDDHDDEFGMDSEISRRILATSQYISYGALQRNTVPCSHRGAS  88

Query  105  YYNCHTHQKVNPYNRGCSMITHC  37
            YYNC +  + NPY RGCS I  C
Sbjct  89   YYNCKSGAQSNPYKRGCSSIARC  111



>ref|NP_001235167.1| uncharacterized protein LOC100306190 precursor [Glycine max]
 gb|ACU14252.1| unknown [Glycine max]
Length=124

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 51/85 (60%), Gaps = 12/85 (14%)
 Frame = -2

Query  249  VIGD---DCVFEDEEMAMELGMSRRVL---------GQTKYISYAALAANSIPCNARGRS  106
            +I D   D + +D E       +RR L         G+ +YISYAAL +N +PC  RGRS
Sbjct  37   IISDGDADLIVDDNEFLTSSESTRRSLMHGHPGKGRGRARYISYAALRSNQVPCGRRGRS  96

Query  105  YYNCHTHQKVNPYNRGCSMITHCAR  31
            YYNC+   + NPYNRGC+ ITHCAR
Sbjct  97   YYNCNQRGRANPYNRGCTAITHCAR  121



>ref|XP_002263387.1| PREDICTED: rapid alkalinization factor [Vitis vinifera]
 emb|CAN77387.1| hypothetical protein VITISV_033365 [Vitis vinifera]
 emb|CBI36827.3| unnamed protein product [Vitis vinifera]
Length=118

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            C G++   +C+   +E  M+  ++RR+L  T+YISY AL  N++PC+ RG SYYNC    
Sbjct  44   CQGSIA--ECLAGRDEFEMDTEINRRILATTQYISYGALQRNTVPCSQRGASYYNCKPGA  101

Query  81   KVNPYNRGCSMITHC  37
            + NPYNRGCS IT C
Sbjct  102  EANPYNRGCSTITRC  116



>ref|XP_007147024.1| hypothetical protein PHAVU_006G089900g [Phaseolus vulgaris]
 gb|ESW19018.1| hypothetical protein PHAVU_006G089900g [Phaseolus vulgaris]
Length=104

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  222  DEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMIT  43
            DEE  ++  +SRR+L  TKYISY AL  N++PC+ RG SYYNC    + NPY+RGCS IT
Sbjct  41   DEEFQLDSEISRRILATTKYISYGALQRNTVPCSRRGASYYNCQPGAQANPYSRGCSAIT  100

Query  42   HC  37
             C
Sbjct  101  RC  102



>ref|XP_009136714.1| PREDICTED: protein RALF-like 33 [Brassica rapa]
 emb|CDX90567.1| BnaA03g42140D [Brassica napus]
Length=111

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = -2

Query  264  KCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            +CTG++   +C     E  M+  ++RR+L  T+YISY AL  N++PC+ RG SYYNC   
Sbjct  36   ECTGSI--AECSTATAEFEMDSEINRRILATTRYISYGALRRNTVPCSRRGASYYNCRRG  93

Query  84   QKVNPYNRGCSMITHCAR  31
             + NPY+RGCS IT C R
Sbjct  94   AQANPYSRGCSAITRCRR  111



>ref|XP_004494597.1| PREDICTED: protein RALF-like 33-like [Cicer arietinum]
Length=127

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 58/107 (54%), Gaps = 10/107 (9%)
 Frame = -2

Query  351  SPTYNDNHRFHQPQLLMVHGNHATPTRPRKCTGNVIGDDCVFE--DEEMAMELGMSRRVL  178
            SPT  D     Q  +  +H           C G++   DC+ +  +EE   +  ++RR+L
Sbjct  27   SPTVVDAGGLEQLGMEWIHQTKTI------CEGSI--ADCMLQQGEEEFEFDNEINRRIL  78

Query  177  GQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHC  37
              TKYISY AL  N++PC+ RG SYYNC    + NPY RGCS IT C
Sbjct  79   ATTKYISYGALQRNTVPCSRRGASYYNCRPGAQANPYTRGCSAITRC  125



>ref|XP_002283709.1| PREDICTED: protein RALF-like 33 [Vitis vinifera]
 emb|CAN61144.1| hypothetical protein VITISV_043554 [Vitis vinifera]
Length=124

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 52/88 (59%), Gaps = 8/88 (9%)
 Frame = -2

Query  279  PTRPRKCTGNVI-------GDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCN  121
            PTR   C G V        G+D      E AM+  ++RR+L  +KYISY AL  NS+PC+
Sbjct  36   PTRS-VCKGTVAECLALAGGEDEFGLTSEFAMDSEINRRILATSKYISYGALQRNSVPCS  94

Query  120  ARGRSYYNCHTHQKVNPYNRGCSMITHC  37
             RG SYYNC    + NPYNRGCS IT C
Sbjct  95   RRGASYYNCQPGAQANPYNRGCSTITRC  122



>ref|XP_002870208.1| hypothetical protein ARALYDRAFT_493304 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46467.1| hypothetical protein ARALYDRAFT_493304 [Arabidopsis lyrata subsp. 
lyrata]
Length=118

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = -2

Query  264  KCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            KC G  I +  +   EE  M+  ++RR+L  TKYISY AL  N++PC+ RG SYYNC   
Sbjct  42   KCNGT-IAECSLSTAEEFEMDSEINRRILATTKYISYGALRRNTVPCSRRGASYYNCRRG  100

Query  84   QKVNPYNRGCSMITHCAR  31
             + NPY+RGCS IT C R
Sbjct  101  AQANPYSRGCSAITRCRR  118



>ref|XP_010469431.1| PREDICTED: protein RALF-like 19 [Camelina sativa]
Length=110

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = -2

Query  249  VIGDDCVFEDEEMA--MELGMSRRVLGQTK-YISYAALAANSIPCNARGRSYYNCHTHQK  79
            V G  C+ ED+E+   M+   +RR L   + YISY AL  N++PC+ RGRSYY+C   +K
Sbjct  32   VNGQGCIGEDDELESLMDSETNRRQLAARRSYISYGALKKNNVPCSRRGRSYYDCKKRKK  91

Query  78   VNPYNRGCSMITHCAR  31
             NPY RGCS+ITHC R
Sbjct  92   ANPYRRGCSVITHCYR  107



>gb|KFK44989.1| hypothetical protein AALP_AA1G329500 [Arabis alpina]
Length=105

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = -2

Query  243  GDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYN  64
            G+D   E+ EM  E+  +RR+L  T+YISY AL  N+IPC+ RG SYYNC    + NPY+
Sbjct  37   GEDLFTEEFEMDSEI--NRRILATTRYISYGALRRNTIPCSRRGASYYNCRRGAQANPYS  94

Query  63   RGCSMITHCAR  31
            RGCS IT C R
Sbjct  95   RGCSAITRCRR  105



>ref|XP_003637105.1| RALF [Medicago truncatula]
 gb|KEH31048.1| RALF [Medicago truncatula]
Length=111

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 52/78 (67%), Gaps = 7/78 (9%)
 Frame = -2

Query  258  TGNVIGDDCVFEDEEMAMELGMSRRVLG--QTKYISYAALAANSIPCNARGRSYYNCHTH  85
             G++IGDD      EM M+   +RR L   + +YISY AL AN+IPC  +G+SYY+C+  
Sbjct  37   VGDLIGDD-----NEMLMDSESNRRTLAGRKRRYISYGALKANNIPCGQKGQSYYDCNAR  91

Query  84   QKVNPYNRGCSMITHCAR  31
             + NPY RGC+ ITHCAR
Sbjct  92   GQANPYRRGCTAITHCAR  109



>ref|XP_010314082.1| PREDICTED: protein RALF-like 22 [Solanum lycopersicum]
Length=121

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -2

Query  237  DCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRG  58
            D +FEDEEM M    +RR L +  +I Y AL AN+IPC+ RG SYY C+   K+NPY RG
Sbjct  50   DMLFEDEEMMMPSESARRTLDERDHIGYRALRANNIPCDQRGASYYECNRMSKINPYRRG  109

Query  57   CSMITHCAR  31
            C  IT C R
Sbjct  110  CQRITGCGR  118



>ref|XP_010538170.1| PREDICTED: protein RALF-like 19 [Tarenaya hassleriana]
Length=110

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = -2

Query  246  IGDDCVFEDEEMAMELGMSRRVLGQ-TKYISYAALAANSIPCNARGRSYYNCHTHQKVNP  70
            IGD+   +D E  M+   +RR L Q  +YISY AL  N++PCN RGRSYY+C   ++ NP
Sbjct  38   IGDE---DDLESLMDSETNRRQLAQGRRYISYGALKKNNVPCNRRGRSYYDCTRRKRANP  94

Query  69   YNRGCSMITHCAR  31
            Y RGCS+ITHC R
Sbjct  95   YRRGCSVITHCGR  107



>ref|XP_009381195.1| PREDICTED: protein RALF-like 22 [Musa acuminata subsp. malaccensis]
Length=132

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 51/81 (63%), Gaps = 6/81 (7%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVL----GQTKYISYAALAANSIPCNARGRSYYNC  94
            C G V   +C+ ED E+ ME    RR L    G+ ++ISY AL+ N +PCN RG SYYNC
Sbjct  51   CDGLV--GECLDEDNELDMEAEDPRRFLSPAHGRQRFISYGALSRNRVPCNRRGHSYYNC  108

Query  93   HTHQKVNPYNRGCSMITHCAR  31
                + NPY RGCS+IT CAR
Sbjct  109  RRSGRANPYRRGCSVITRCAR  129



>ref|XP_006414444.1| hypothetical protein EUTSA_v10026579mg [Eutrema salsugineum]
 gb|ESQ55897.1| hypothetical protein EUTSA_v10026579mg [Eutrema salsugineum]
Length=122

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = -2

Query  264  KCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            +CTG+ I +      EE  M+  ++RR+L  T+YISY AL  N++PC+ RG SYYNC   
Sbjct  46   ECTGS-IAECSTAAAEEFEMDSEINRRILATTRYISYGALRRNTVPCSRRGASYYNCRRG  104

Query  84   QKVNPYNRGCSMITHCAR  31
             + NPY+RGCS IT C R
Sbjct  105  AQANPYSRGCSAITRCRR  122



>gb|EYU42176.1| hypothetical protein MIMGU_mgv1a016421mg [Erythranthe guttata]
Length=122

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 52/82 (63%), Gaps = 3/82 (4%)
 Frame = -2

Query  279  PTRPRKCTGNVIGDDCVF-EDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSY  103
            P+    C G V   +C+  EDEE  M+   +RR+L   ++ISY AL ++S+PC+ RG SY
Sbjct  41   PSARSGCKGTVA--ECLGNEDEEFEMDSESNRRILATRRFISYGALESDSVPCSRRGASY  98

Query  102  YNCHTHQKVNPYNRGCSMITHC  37
            YNC    + NPYNRGCS IT C
Sbjct  99   YNCRPGAQANPYNRGCSAITQC  120



>ref|XP_009111178.1| PREDICTED: protein RALF-like 1 [Brassica rapa]
Length=121

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 5/76 (7%)
 Frame = -2

Query  261  CTGNVIGDDCV-FEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            C G++   DC+  E+EEM  E+  SRR+L  TKYISY +L  NS+PC+ RG SYYNC   
Sbjct  48   CRGSIA--DCIGAEEEEMDSEI--SRRILATTKYISYQSLKRNSVPCSRRGASYYNCQNG  103

Query  84   QKVNPYNRGCSMITHC  37
             + NPY+RGCS I  C
Sbjct  104  AQANPYSRGCSSIARC  119



>gb|KHN03976.1| hypothetical protein glysoja_022662 [Glycine soja]
Length=75

 Score = 79.0 bits (193),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  222  DEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMIT  43
            +EE  ++  +SRR+L  TKYISY AL  N++PC+ RG SYYNC    + NPY+RGCS IT
Sbjct  12   EEEFQLDSEISRRILATTKYISYGALQRNTVPCSRRGASYYNCQPGAQANPYSRGCSAIT  71

Query  42   HC  37
             C
Sbjct  72   RC  73



>ref|XP_002512426.1| RALFL33, putative [Ricinus communis]
 gb|EEF49878.1| RALFL33, putative [Ricinus communis]
Length=121

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 50/76 (66%), Gaps = 3/76 (4%)
 Frame = -2

Query  261  CTGNVIGDDCVFED-EEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            C G++   +C+  + EE  M+   SRR+L  TKYISY AL  NS+PC+ RG SYYNC   
Sbjct  46   CKGSI--AECLASNGEEFEMDSETSRRILATTKYISYGALQRNSVPCSRRGASYYNCQPG  103

Query  84   QKVNPYNRGCSMITHC  37
             + NPY+RGCS IT C
Sbjct  104  AQANPYSRGCSTITRC  119



>emb|CDX89932.1| BnaA10g01500D [Brassica napus]
Length=122

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 60/103 (58%), Gaps = 12/103 (12%)
 Frame = -2

Query  342  YNDNHRFHQPQLLMVHGNHATPTRPRKCTGNVIGDDCV-FEDEEMAMELGMSRRVLGQTK  166
            + D+ +  +     VHG+         C G++   DC+  E+EEM  E+  +RR+L  TK
Sbjct  29   FTDDLKGLEWSSTGVHGSSG-------CHGSI--ADCIGTEEEEMDSEI--NRRILATTK  77

Query  165  YISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHC  37
            YISY AL  NS+PC+ RG SYYNC    + NPY+RGCS I  C
Sbjct  78   YISYQALKRNSVPCSRRGASYYNCQNGAQANPYSRGCSAIARC  120



>emb|CDY18130.1| BnaC05g01530D [Brassica napus]
Length=122

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 55/89 (62%), Gaps = 12/89 (13%)
 Frame = -2

Query  300  VHGNHATPTRPRKCTGNVIGDDCV-FEDEEMAMELGMSRRVLGQTKYISYAALAANSIPC  124
            VHG+         C G++   DC+  E+EEM  E+  +RR+L  TKYISY AL  NS+PC
Sbjct  43   VHGSSG-------CYGSI--ADCIGTEEEEMDSEI--NRRILATTKYISYQALKRNSVPC  91

Query  123  NARGRSYYNCHTHQKVNPYNRGCSMITHC  37
            + RG SYYNC    + NPY+RGCS I  C
Sbjct  92   SRRGASYYNCQNGAQANPYSRGCSAIARC  120



>ref|XP_002531878.1| RALFL33, putative [Ricinus communis]
 gb|EEF30515.1| RALFL33, putative [Ricinus communis]
Length=116

 Score = 79.7 bits (195),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 51/79 (65%), Gaps = 3/79 (4%)
 Frame = -2

Query  273  RPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNC  94
            +  +C G +   DC+ EDE   M+  ++RR+L  T YISY AL  N+IPC+ RG SYYNC
Sbjct  39   KTSRCQGTLA--DCMQEDE-FDMDSEINRRILATTNYISYGALQRNTIPCSQRGASYYNC  95

Query  93   HTHQKVNPYNRGCSMITHC  37
                + NPY+RGCS IT C
Sbjct  96   QPGAEANPYSRGCSAITRC  114



>ref|NP_850219.1| protein RALF-like 19 [Arabidopsis thaliana]
 sp|Q6NME6.1|RLF19_ARATH RecName: Full=Protein RALF-like 19; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAS49077.1| At2g33775 [Arabidopsis thaliana]
 gb|AEC08883.1| protein RALF-like 19 [Arabidopsis thaliana]
Length=110

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 6/95 (6%)
 Frame = -2

Query  306  LMVHGNHATPTRPRKCTGNVIGDDCVFEDEEM--AMELGMSRRVLGQTK-YISYAALAAN  136
            ++    +AT T  + C   V G  C+ ED E+   M+   +RR L   + YISY AL  N
Sbjct  16   VVAESANATWTLTKSC---VNGQGCIGEDGELDYLMDSETNRRQLAARRSYISYGALRKN  72

Query  135  SIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            ++PC+ RGRSYY+C   ++ NPY RGCS+ITHC R
Sbjct  73   NVPCSRRGRSYYDCKKRKRANPYRRGCSVITHCYR  107



>ref|XP_009623267.1| PREDICTED: protein RALF-like 22 [Nicotiana tomentosiformis]
Length=131

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = -2

Query  294  GNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQT---KYISYAALAANSIPC  124
              H+T       T   IG+  +FEDEEM M    +RR L  +   +YISY A+  NSIPC
Sbjct  40   ARHSTDGGLDDLTAGHIGES-LFEDEEMMMPSESARRTLWSSYRERYISYQAMRRNSIPC  98

Query  123  NARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            N RG+SYY C   Q++ PY RGC  IT C+R
Sbjct  99   NRRGQSYYQCTRMQRIRPYRRGCLQITRCSR  129



>ref|XP_007035581.1| Rapid alkalinization factor 1, putative [Theobroma cacao]
 gb|EOY06507.1| Rapid alkalinization factor 1, putative [Theobroma cacao]
Length=128

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 59/102 (58%), Gaps = 8/102 (8%)
 Frame = -2

Query  315  PQLLMVHGNHATPTRPRKCTGNVI------GDDCVFE-DEEMAMELGMSRRVLGQTKYIS  157
            P L  V G+   P +  +C G++       GD+   + D E AM   + RR+L  T+YIS
Sbjct  28   PTLDFVGGDQFLPIKS-ECRGSIAECLMLSGDESSSDFDAEFAMGSEIYRRILATTRYIS  86

Query  156  YAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            Y AL  N++PC+ RG SYYNC    + NPY+RGC+ IT C R
Sbjct  87   YGALRRNTVPCSRRGASYYNCQPGAQANPYSRGCNRITRCRR  128



>ref|XP_002879470.1| hypothetical protein ARALYDRAFT_902453 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55729.1| hypothetical protein ARALYDRAFT_902453 [Arabidopsis lyrata subsp. 
lyrata]
Length=110

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 6/95 (6%)
 Frame = -2

Query  306  LMVHGNHATPTRPRKCTGNVIGDDCVFEDEEM--AMELGMSRRVLGQTK-YISYAALAAN  136
            ++    +AT T  + C   V G  C+ ED E+   M+   +RR L   + YISY AL  N
Sbjct  16   VVAESANATWTLTKSC---VNGQGCIGEDGELDYLMDSETNRRQLAARRSYISYGALRKN  72

Query  135  SIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            ++PC+ RGRSYY+C   ++ NPY RGCS+ITHC R
Sbjct  73   NVPCSRRGRSYYDCKKRKRANPYRRGCSVITHCYR  107



>ref|XP_007199089.1| hypothetical protein PRUPE_ppa020353mg [Prunus persica]
 gb|EMJ00288.1| hypothetical protein PRUPE_ppa020353mg [Prunus persica]
Length=103

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 55/87 (63%), Gaps = 4/87 (5%)
 Frame = -2

Query  297  HGNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNA  118
            HG    P R R C G++   +C+  D+E  M+  ++RR+L  ++YISY AL  N++PC+ 
Sbjct  19   HGLSWVPGRTR-CQGSIA--ECM-ADDEFDMDSQINRRILATSQYISYGALQRNTVPCSR  74

Query  117  RGRSYYNCHTHQKVNPYNRGCSMITHC  37
            RG SYYNC    + NPYNRGCS I  C
Sbjct  75   RGASYYNCKPGAESNPYNRGCSAIARC  101



>ref|XP_004295624.1| PREDICTED: rapid alkalinization factor-like [Fragaria vesca subsp. 
vesca]
Length=118

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 51/78 (65%), Gaps = 7/78 (9%)
 Frame = -2

Query  258  TGNVIGDDCVFEDEEMAMELGMSRRVL-GQTKYISYAALAANSIPCNARGRSYYNCHT-H  85
             G+VIG     ED EM ++   SRR L G+T+YISY AL  N IPC  RG SYYNC   +
Sbjct  44   VGDVIG-----EDNEMMLDSESSRRTLAGRTRYISYGALKRNRIPCRRRGASYYNCGRPN  98

Query  84   QKVNPYNRGCSMITHCAR  31
            Q+ N Y RGCS+IT CAR
Sbjct  99   QQANTYRRGCSVITRCAR  116



>ref|XP_010269500.1| PREDICTED: rapid alkalinization factor-like [Nelumbo nucifera]
Length=139

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 53/81 (65%), Gaps = 3/81 (4%)
 Frame = -2

Query  279  PTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYY  100
            PTR   C G++  ++C+    E  M+  ++RR+L  ++YISY AL  N++PC+ RG SYY
Sbjct  60   PTRS-TCQGSM--EECMAGGNEFEMDSEINRRILATSQYISYGALQRNTVPCSRRGASYY  116

Query  99   NCHTHQKVNPYNRGCSMITHC  37
            NC    + NPYNRGCS IT C
Sbjct  117  NCKPGAQANPYNRGCSAITRC  137



>ref|XP_010509833.1| PREDICTED: protein RALF-like 19 [Camelina sativa]
Length=110

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = -2

Query  249  VIGDDCVFEDEEMA--MELGMSRRVLGQTK-YISYAALAANSIPCNARGRSYYNCHTHQK  79
            V G  C+ ED+E+   M+   +RR L   + YISY AL  N++PC+ RGRSYY+C   ++
Sbjct  32   VNGQGCIGEDDELESLMDSEANRRQLAARRSYISYGALKKNNVPCSRRGRSYYDCKKRKR  91

Query  78   VNPYNRGCSMITHCAR  31
             NPY RGCS+ITHC R
Sbjct  92   ANPYRRGCSVITHCYR  107



>ref|XP_003554646.1| PREDICTED: protein RALF-like 1-like [Glycine max]
 gb|KHN43298.1| hypothetical protein glysoja_001881 [Glycine soja]
Length=129

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  222  DEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMIT  43
            +EE  ++  +SRR+L  TKYISY AL  N++PC+ RG SYYNC    + NPY+RGCS IT
Sbjct  66   EEEFQLDSEISRRILATTKYISYGALQRNTVPCSRRGASYYNCQPGAQANPYSRGCSAIT  125

Query  42   HC  37
             C
Sbjct  126  RC  127



>ref|XP_010038196.1| PREDICTED: rapid alkalinization factor-like [Eucalyptus grandis]
 gb|KCW50015.1| hypothetical protein EUGRSUZ_K03464 [Eucalyptus grandis]
Length=127

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 3/84 (4%)
 Frame = -2

Query  285  ATPTRPRKCTGNVIGDDCVFED-EEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGR  109
            A  ++P +C G++   +C+ E   E  M+  +SRRVL  ++YISY AL  N++PC+ RG 
Sbjct  44   AASSKPGRCQGSI--AECMAEQGSEFDMDTEVSRRVLATSQYISYGALQRNTVPCSQRGA  101

Query  108  SYYNCHTHQKVNPYNRGCSMITHC  37
            SYYNC    + NPY+R CS +T C
Sbjct  102  SYYNCQPGAQSNPYSRSCSAVTQC  125



>gb|KGN44918.1| hypothetical protein Csa_7G396340 [Cucumis sativus]
Length=112

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 58/101 (57%), Gaps = 7/101 (7%)
 Frame = -2

Query  324  FHQPQLLMVHGNHATPTRP-----RKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYI  160
            F    +L V     TP+        +C G++   +C+ ED E  M+  ++RR+L    YI
Sbjct  12   FLLVAILTVSSTAKTPSWVLDGAHARCHGSMA--ECMMEDIEFQMDSEINRRILADLNYI  69

Query  159  SYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHC  37
            SY AL ANS+PC+ +G SYYNC    + NPY+RGC+ I+ C
Sbjct  70   SYDALKANSVPCSRKGASYYNCQPGAEANPYDRGCNAISRC  110



>ref|XP_006295275.1| hypothetical protein CARUB_v10024364mg [Capsella rubella]
 gb|EOA28173.1| hypothetical protein CARUB_v10024364mg [Capsella rubella]
Length=110

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 3/76 (4%)
 Frame = -2

Query  249  VIGDDCVFEDEEMA--MELGMSRRVLGQTK-YISYAALAANSIPCNARGRSYYNCHTHQK  79
            V G  C+ ED+E+   M+   +RR L   + YISY AL  N++PC  RGRSYY+C   ++
Sbjct  32   VNGQGCIGEDDELESLMDSEANRRQLAARRSYISYGALKKNNVPCGRRGRSYYDCKKRKR  91

Query  78   VNPYNRGCSMITHCAR  31
             NPY RGCS+ITHC R
Sbjct  92   ANPYRRGCSVITHCYR  107



>ref|XP_006419584.1| hypothetical protein CICLE_v10006201mg [Citrus clementina]
 ref|XP_006489088.1| PREDICTED: rapid alkalinization factor 23-like [Citrus sinensis]
 gb|ESR32824.1| hypothetical protein CICLE_v10006201mg [Citrus clementina]
 gb|KDO71637.1| hypothetical protein CISIN_1g032876mg [Citrus sinensis]
Length=131

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = -2

Query  252  NVIGDDCVFE-DEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKV  76
            +V GDD   E D E AM+  ++RR+L   +YISY AL  NS+PC+ RG SYYNC    + 
Sbjct  57   SVEGDDGDQELDLEFAMDGEINRRILAMRRYISYGALRRNSVPCSRRGASYYNCRAGGQA  116

Query  75   NPYNRGCSMITHCAR  31
            NPY+RGCS IT C R
Sbjct  117  NPYSRGCSAITRCRR  131



>gb|AFB73770.1| rapid alkalinization factor [Chimonanthus praecox]
Length=127

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 4/81 (5%)
 Frame = -2

Query  267  RKCTGNVIGDDCVFEDEEMAMELGMSRRVLG-QTKYISYAALAANSIPCNARGRSYYNCH  91
            R C GN+ G  C++E EEM M+  +SRR+L  Q KYISY AL  + +PC+  G SYYNC 
Sbjct  45   RDCAGNLRGG-CLWE-EEMEMDSEISRRILAAQKKYISYEALKRDEVPCSKPGASYYNCQ  102

Query  90   THQKV-NPYNRGCSMITHCAR  31
               K  NPY+RGC++IT CAR
Sbjct  103  APPKTNNPYSRGCTVITGCAR  123



>ref|XP_009376626.1| PREDICTED: protein RALF-like 33 [Pyrus x bretschneideri]
Length=120

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 50/78 (64%), Gaps = 5/78 (6%)
 Frame = -2

Query  261  CTGNVIGDDCVF---EDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCH  91
            C G++   +C     +D E  M+  +SRR+L  TKYISY AL  N++PC+ RG SYYNC 
Sbjct  43   CKGSIA--ECALAAGDDGEFDMDSEISRRILATTKYISYGALQRNTVPCSRRGASYYNCK  100

Query  90   THQKVNPYNRGCSMITHC  37
               + NPY+RGCS IT C
Sbjct  101  PGAQANPYSRGCSAITRC  118



>emb|CDX86697.1| BnaC08g00060D [Brassica napus]
Length=121

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 5/76 (7%)
 Frame = -2

Query  261  CTGNVIGDDCV-FEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            C G++   DC+  E+EEM  E+  SRR+L  TKYISY +L  NS+PC+ RG SYYNC   
Sbjct  48   CHGSIA--DCIGAEEEEMDSEI--SRRILATTKYISYQSLKRNSVPCSRRGASYYNCQNG  103

Query  84   QKVNPYNRGCSMITHC  37
             + NPY+RGCS I  C
Sbjct  104  AQANPYSRGCSSIARC  119



>ref|XP_009119598.1| PREDICTED: protein RALF-like 1 [Brassica rapa]
Length=146

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 60/103 (58%), Gaps = 12/103 (12%)
 Frame = -2

Query  342  YNDNHRFHQPQLLMVHGNHATPTRPRKCTGNVIGDDCV-FEDEEMAMELGMSRRVLGQTK  166
            + D+ +  +     VHG+         C G++   DC+  E+EEM  E+  +RR+L  TK
Sbjct  53   FTDDLKGLEWSSTGVHGSSG-------CHGSIA--DCIGTEEEEMDSEI--NRRILATTK  101

Query  165  YISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHC  37
            YISY AL  NS+PC+ RG SYYNC    + NPY+RGCS I  C
Sbjct  102  YISYQALKRNSVPCSRRGASYYNCQNGAQANPYSRGCSAIARC  144



>ref|XP_006840509.1| hypothetical protein AMTR_s00045p00202280 [Amborella trichopoda]
 gb|ERN02184.1| hypothetical protein AMTR_s00045p00202280 [Amborella trichopoda]
Length=119

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 3/79 (4%)
 Frame = -2

Query  267  RKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHT  88
            + C G++   +C+   EE AM+  ++RR+L   +YISY AL  N +PC+ +G+SYYNC  
Sbjct  41   QSCEGSI--GECL-SGEEFAMDSEINRRILATDQYISYNALKKNIVPCSKKGQSYYNCRA  97

Query  87   HQKVNPYNRGCSMITHCAR  31
              + NPY+RGCS IT CAR
Sbjct  98   GGQANPYSRGCSAITRCAR  116



>ref|XP_010413812.1| PREDICTED: protein RALF-like 19 [Camelina sativa]
Length=110

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = -2

Query  249  VIGDDCVFEDEEMA--MELGMSRRVLGQTK-YISYAALAANSIPCNARGRSYYNCHTHQK  79
            V G  C+ ED+E+   M+   +RR L   + YISY AL  N++PC+ RGRSYY+C   ++
Sbjct  32   VNGQGCIGEDDELESLMDSETNRRQLAARRSYISYDALKKNNVPCSRRGRSYYDCKKRKR  91

Query  78   VNPYNRGCSMITHCAR  31
             NPY RGCS+ITHC R
Sbjct  92   ANPYRRGCSVITHCYR  107



>ref|XP_006279280.1| hypothetical protein CARUB_v10016532mg, partial [Capsella rubella]
 gb|EOA12178.1| hypothetical protein CARUB_v10016532mg, partial [Capsella rubella]
Length=85

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 5/76 (7%)
 Frame = -2

Query  261  CTGNVIGDDCV-FEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            C G++   +C+  E+EEM  E+  SRRVL  TKYISY +L  NS+PC+ RG SYYNC   
Sbjct  12   CHGSIA--ECIGAEEEEMDSEI--SRRVLATTKYISYQSLKKNSVPCSRRGASYYNCQNG  67

Query  84   QKVNPYNRGCSMITHC  37
             + NPY+RGCS I  C
Sbjct  68   AQANPYSRGCSKIARC  83



>ref|XP_011023680.1| PREDICTED: rapid alkalinization factor-like [Populus euphratica]
Length=126

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 50/83 (60%), Gaps = 1/83 (1%)
 Frame = -2

Query  282  TPTRPRKCTGNVIGDDCVFED-EEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRS  106
            T TR   C    + +    ED EE  M+  ++RR+L  +KY+SY AL  N++PC+ RG S
Sbjct  42   TATRSSICDKGSLAECMAEEDGEEFEMDTEINRRILATSKYVSYGALQKNNVPCSRRGAS  101

Query  105  YYNCHTHQKVNPYNRGCSMITHC  37
            YYNC    + NPY RGCS IT C
Sbjct  102  YYNCKNGAQANPYRRGCSRITRC  124



>ref|XP_006304742.1| hypothetical protein CARUB_v10012118mg [Capsella rubella]
 gb|EOA37640.1| hypothetical protein CARUB_v10012118mg [Capsella rubella]
Length=123

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 50/88 (57%), Gaps = 10/88 (11%)
 Frame = -2

Query  300  VHGNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCN  121
            VHG         +C G         E+EEM  E+  SRRVL  TKYISY +L  NS+PC+
Sbjct  44   VHGGSGCHGSIAECIGA--------EEEEMDSEI--SRRVLATTKYISYQSLKKNSVPCS  93

Query  120  ARGRSYYNCHTHQKVNPYNRGCSMITHC  37
             RG SYYNC    + NPY+RGCS I  C
Sbjct  94   RRGASYYNCQNGAQANPYSRGCSKIARC  121



>ref|XP_003521695.2| PREDICTED: protein RALF-like 1-like isoform 1 [Glycine max]
Length=174

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  222  DEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMIT  43
            +EE  ++  +SRR+L  TKYISY AL  N++PC+ RG SYYNC    + NPY+RGCS IT
Sbjct  111  EEEFQLDSEISRRILATTKYISYGALQRNTVPCSRRGASYYNCQPGAQANPYSRGCSAIT  170

Query  42   HC  37
             C
Sbjct  171  RC  172



>ref|XP_010098288.1| hypothetical protein L484_023536 [Morus notabilis]
 gb|EXB74792.1| hypothetical protein L484_023536 [Morus notabilis]
Length=125

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 55/97 (57%), Gaps = 6/97 (6%)
 Frame = -2

Query  309  LLMVHGNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMS----RRVLGQTKYISYAALA  142
            L+  H       R   C G++   +C+  D +  +E+ M     RR+L Q +YISY AL 
Sbjct  31   LISDHQLSWIAARSDGCRGSI--GECLIADVDSELEMEMDSEGHRRILAQRRYISYGALR  88

Query  141  ANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
             N++PC+ RG SYYNC    + NPY+RGCS IT C R
Sbjct  89   RNTVPCSRRGSSYYNCRPGGQANPYSRGCSAITRCRR  125



>emb|CBI39521.3| unnamed protein product [Vitis vinifera]
Length=147

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -2

Query  216  EMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHC  37
            E AM+  ++RR+L  +KYISY AL  NS+PC+ RG SYYNC    + NPYNRGCS IT C
Sbjct  86   EFAMDSEINRRILATSKYISYGALQRNSVPCSRRGASYYNCQPGAQANPYNRGCSTITRC  145



>ref|XP_008246447.1| PREDICTED: rapid alkalinization factor [Prunus mume]
Length=121

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 58/96 (60%), Gaps = 8/96 (8%)
 Frame = -2

Query  306  LMVHGNH-----ATPTRPRKCTGNVIGDDCVFE-DEEMAMELGMSRRVLGQTKYISYAAL  145
            ++  G+H       PT    C G++   +C+   DEE  ++  ++RR+L  +KYISY A+
Sbjct  26   VLASGDHPQNLSWMPTNKSSCKGSIA--ECLAAGDEEFDLDSEINRRILATSKYISYGAM  83

Query  144  AANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHC  37
              N++PC+ RG SYYNC    + NPY+RGCS IT C
Sbjct  84   QRNTVPCSRRGASYYNCQPGAQSNPYSRGCSAITRC  119



>ref|XP_010925571.1| PREDICTED: protein RALF-like 22 [Elaeis guineensis]
Length=124

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -2

Query  234  CVFEDEEMAMELGMSRRVLGQ--TKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNR  61
            C  ED EM  E G+SRR L +   +YISY AL+ N +PC  RG SYY+C   ++ NPY R
Sbjct  52   CTDEDNEMETETGISRRGLARAGVRYISYGALSRNRVPCRRRGHSYYHCSRGRRANPYRR  111

Query  60   GCSMITHCAR  31
            GCS+IT C R
Sbjct  112  GCSIITQCQR  121



>ref|XP_006410523.1| hypothetical protein EUTSA_v10017458mg [Eutrema salsugineum]
 gb|ESQ51976.1| hypothetical protein EUTSA_v10017458mg [Eutrema salsugineum]
Length=110

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 58/95 (61%), Gaps = 6/95 (6%)
 Frame = -2

Query  306  LMVHGNHATPTRPRKCTGNVIGDDCVFEDE--EMAMELGMSRRVLGQTK-YISYAALAAN  136
            ++    +AT T  + C   V G  C+ +D+  E  M+   +RR L   + YISY AL  N
Sbjct  16   VVAESANATWTLTKSC---VNGQGCIGDDDGLESLMDSETNRRQLAARRSYISYGALKKN  72

Query  135  SIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            ++PC+ RGRSYY+C   ++ NPY RGCS+ITHC R
Sbjct  73   NVPCSRRGRSYYDCKKRKRANPYRRGCSVITHCYR  107



>gb|EYU28258.1| hypothetical protein MIMGU_mgv1a016453mg [Erythranthe guttata]
Length=121

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 4/70 (6%)
 Frame = -2

Query  228  FEDEEMAMELGMSRRVLGQTK----YISYAALAANSIPCNARGRSYYNCHTHQKVNPYNR  61
            ++ E   M+  +SRR+L  +     YISY A++ + +PC+ RGRSYYNC+T Q+ NPY R
Sbjct  49   YDQEAGMMDSDISRRILAGSNNNNHYISYGAISRDWVPCHVRGRSYYNCNTRQRSNPYTR  108

Query  60   GCSMITHCAR  31
            GC+ ITHCAR
Sbjct  109  GCTKITHCAR  118



>ref|NP_001241351.1| uncharacterized protein LOC100801740 precursor [Glycine max]
 gb|ACU23956.1| unknown [Glycine max]
 gb|KHN08513.1| hypothetical protein glysoja_014278 [Glycine soja]
Length=123

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 49/79 (62%), Gaps = 8/79 (10%)
 Frame = -2

Query  243  GD-DCVFEDEEMAMELGMSRRVL-------GQTKYISYAALAANSIPCNARGRSYYNCHT  88
            GD D + +D E  M    + R L       G+ +YISYAAL +N IPC  RGRSYYNC+ 
Sbjct  42   GDADLIVDDNEFLMSSESTPRSLMHGHPGKGRARYISYAALRSNQIPCGRRGRSYYNCNE  101

Query  87   HQKVNPYNRGCSMITHCAR  31
              + NPY+RGC  ITHCAR
Sbjct  102  RGRANPYSRGCIAITHCAR  120



>ref|XP_006389381.1| hypothetical protein POPTR_0026s00240g [Populus trichocarpa]
 gb|ERP48295.1| hypothetical protein POPTR_0026s00240g [Populus trichocarpa]
Length=112

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = -2

Query  264  KCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            +C G++   +C+  DEE  M+   +RR+L  ++Y+SY AL  N++PC+ RG SYYNC   
Sbjct  38   ECRGSIA--ECLM-DEEFGMDTESNRRILATSRYVSYGALRRNTVPCSRRGASYYNCRPG  94

Query  84   QKVNPYNRGCSMITHC  37
             + NPY+RGCS IT C
Sbjct  95   AQANPYSRGCSRITRC  110



>gb|ABK96369.1| unknown [Populus trichocarpa x Populus deltoides]
Length=112

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = -2

Query  264  KCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            +C G++   +C+  DEE  M+   +RR+L  ++Y+SY AL  N++PC+ RG SYYNC   
Sbjct  38   ECRGSI--AECLM-DEEFGMDTESNRRILATSRYVSYGALRRNTVPCSRRGASYYNCRPG  94

Query  84   QKVNPYNRGCSMITHC  37
             + NPY+RGCS IT C
Sbjct  95   AQANPYSRGCSRITRC  110



>emb|CDY15442.1| BnaA08g27260D [Brassica napus]
Length=121

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 5/76 (7%)
 Frame = -2

Query  261  CTGNVIGDDCV-FEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            C G++   DC+  E+EEM  E+  +RR+L  TKYISY +L  NS+PC+ RG SYYNC   
Sbjct  48   CHGSIA--DCIGAEEEEMDSEI--NRRILATTKYISYQSLKRNSVPCSRRGASYYNCQNG  103

Query  84   QKVNPYNRGCSMITHC  37
             + NPY+RGCS I  C
Sbjct  104  AQANPYSRGCSSIARC  119



>ref|XP_008451660.1| PREDICTED: rapid alkalinization factor-like [Cucumis melo]
Length=112

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 58/101 (57%), Gaps = 7/101 (7%)
 Frame = -2

Query  324  FHQPQLLMVHGNHATPTRP-----RKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYI  160
            F    +L V     TP+        +C G++   +C+ ED E  M+  ++RR+L    YI
Sbjct  12   FLLVAILTVSSTATTPSWVLGGAHARCHGSMA--ECMKEDIEFEMDSEINRRILADLNYI  69

Query  159  SYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHC  37
            SY AL ANS+PC+ +G SYYNC    + NPY+RGC+ I+ C
Sbjct  70   SYDALRANSVPCSRKGASYYNCQPGAEANPYDRGCNAISRC  110



>ref|XP_010691694.1| PREDICTED: protein RALF-like 33 [Beta vulgaris subsp. vulgaris]
Length=119

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 51/78 (65%), Gaps = 3/78 (4%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDE-EMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            C G+V   +C+  DE E  M+  ++RR+L  + YISYAAL  N +PC+ RG SYYNC   
Sbjct  43   CKGSV--GECLGVDEDEFEMDSEINRRILATSNYISYAALNRNRVPCSRRGASYYNCRPG  100

Query  84   QKVNPYNRGCSMITHCAR  31
               NPY+RGCS I+ CAR
Sbjct  101  ASANPYSRGCSAISRCAR  118



>ref|XP_009352252.1| PREDICTED: protein RALF-like 33 [Pyrus x bretschneideri]
Length=126

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = -2

Query  267  RKCTGNVIGDDCVFEDEEMAMELGMSRRVLG-QTKYISYAALAANSIPCNARGRSYYNCH  91
            R   G +I D+   ED EM M+  ++RR+L  + +YISY AL  N++PC+ RG SYYNC 
Sbjct  49   RSAAGGLIADE--DEDAEMLMDSEINRRILAWRRRYISYGALRRNTVPCSRRGASYYNCR  106

Query  90   THQKVNPYNRGCSMITHCAR  31
               + NPY RGCS IT C R
Sbjct  107  PGAQANPYRRGCSAITRCRR  126



>ref|XP_008235043.1| PREDICTED: protein RALF-like 33 [Prunus mume]
Length=116

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = -2

Query  297  HGNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNA  118
            HG    P R   C G++   +C+  D+E  M+  ++RR+L  ++YISY AL  N++PC+ 
Sbjct  32   HGLSWVPGRT-SCQGSIA--ECM-ADDEFDMDSEINRRILATSQYISYGALQRNTVPCSR  87

Query  117  RGRSYYNCHTHQKVNPYNRGCSMITHC  37
            RG SYYNC    + NPYNRGCS I  C
Sbjct  88   RGASYYNCKPGAESNPYNRGCSAIARC  114



>ref|XP_007206150.1| hypothetical protein PRUPE_ppa013461mg [Prunus persica]
 gb|EMJ07349.1| hypothetical protein PRUPE_ppa013461mg [Prunus persica]
Length=121

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = -2

Query  279  PTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYY  100
            PT    C G+ I +     DEE  ++  ++RR+L  +KYISY A+  N++PC+ RG SYY
Sbjct  40   PTNNSACKGS-IAECLAAGDEEFDLDSEINRRILATSKYISYGAMQRNTVPCSRRGASYY  98

Query  99   NCHTHQKVNPYNRGCSMITHC  37
            NC    + NPY+RGCS IT C
Sbjct  99   NCQPGAQSNPYSRGCSAITRC  119



>ref|NP_001152442.1| RALF precursor [Zea mays]
 gb|ACG47638.1| RALF precursor [Zea mays]
 gb|ACN27478.1| unknown [Zea mays]
 gb|AFW80344.1| RALF [Zea mays]
Length=142

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 58/104 (56%), Gaps = 14/104 (13%)
 Frame = -2

Query  309  LLMVHGNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMS------RRVLGQTK----YI  160
            LL   G       P+KC+G  +G+  V E EE+ +  G        RR L Q K    YI
Sbjct  39   LLAAKGGSGAG--PQKCSG-AVGECDVDEAEELGLSGGGLGSDDAVRRTLAQRKPTNRYI  95

Query  159  SYAALAANSIPCNARGRSYY-NCHTHQKVNPYNRGCSMITHCAR  31
            SYAAL A+ +PCN RGRSYY NC   +  NPY RGCS IT CAR
Sbjct  96   SYAALRADQVPCNKRGRSYYSNCEAQKAANPYRRGCSAITRCAR  139



>ref|XP_003619621.1| Rapid alkalinization factor [Medicago truncatula]
 gb|AES75839.1| RALF [Medicago truncatula]
Length=105

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 50/73 (68%), Gaps = 5/73 (7%)
 Frame = -2

Query  249  VIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNP  70
            V+  D + E+ EM M+   +RR     +YISY AL A+SIPC  +G+SYY+C+   +VNP
Sbjct  36   VLVGDLIREENEMLMDSESNRR-----RYISYDALLADSIPCGLKGQSYYDCNHRDQVNP  90

Query  69   YNRGCSMITHCAR  31
            Y RGC+ ITHCAR
Sbjct  91   YRRGCTAITHCAR  103



>ref|XP_009784377.1| PREDICTED: protein RALF-like 19 [Nicotiana sylvestris]
Length=131

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = -2

Query  237  DCVFEDEEMAMELGMSRRVLGQT---KYISYAALAANSIPCNARGRSYYNCHTHQKVNPY  67
            D +F DEEM M    +RR L  +   +YISY A+  NSIPCN RG+SYY C   Q++ PY
Sbjct  58   DSLFGDEEMMMPSESARRTLWSSYRERYISYQAMRRNSIPCNRRGQSYYQCTRMQRIRPY  117

Query  66   NRGCSMITHCAR  31
             RGC  IT C+R
Sbjct  118  RRGCLQITRCSR  129



>ref|XP_009143830.1| PREDICTED: protein RALF-like 19 [Brassica rapa]
 emb|CDY17200.1| BnaA05g09880D [Brassica napus]
Length=110

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 58/95 (61%), Gaps = 6/95 (6%)
 Frame = -2

Query  306  LMVHGNHATPTRPRKCTGNVIGDDCVFEDE--EMAMELGMSRRVLG-QTKYISYAALAAN  136
            ++    + T +  R C   V G  C+ +D+  E  M+   +RR L  + +YISY AL  N
Sbjct  16   VVAESANVTWSLTRSC---VNGQGCIGDDDGLESLMDSETNRRQLAARRRYISYGALKKN  72

Query  135  SIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            ++PC+ RGRSYY+C   ++ NPY RGCS+ITHC R
Sbjct  73   NVPCSRRGRSYYDCTKRKRANPYRRGCSIITHCYR  107



>emb|CDY27943.1| BnaCnng05280D [Brassica napus]
Length=110

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = -2

Query  249  VIGDDCVFEDE--EMAMELGMSRRVLG-QTKYISYAALAANSIPCNARGRSYYNCHTHQK  79
            V G  C+ +D+  E  M+   +RR L  + +YISY AL  N++PC+ RGRSYY+C   ++
Sbjct  32   VNGQGCIGDDDGLESLMDSETNRRQLAARRRYISYGALKKNNVPCSRRGRSYYDCTKRKR  91

Query  78   VNPYNRGCSMITHCAR  31
             NPY RGCS+ITHC R
Sbjct  92   ANPYRRGCSIITHCYR  107



>emb|CAN83593.1| hypothetical protein VITISV_037723 [Vitis vinifera]
Length=118

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            C G++   +C+   EE  M+  ++RR+L   +YISY AL+ NS+PC+ RG SYYNC    
Sbjct  45   CQGSI--AECL-AGEEFEMDSEINRRILASKRYISYGALSRNSVPCSRRGASYYNCRPGA  101

Query  81   KVNPYNRGCSMITHCAR  31
            + NPY RGCS IT C R
Sbjct  102  QANPYTRGCSAITRCRR  118



>ref|XP_011087422.1| PREDICTED: rapid alkalinization factor [Sesamum indicum]
Length=117

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = -2

Query  261  CTGNVIGDDCVF-EDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            C G V   +C+  EDEE  ++   +RR+L   +YISY AL  NS+PC+ RG SYYNC   
Sbjct  42   CRGTVA--ECLANEDEEFELDSESNRRILATRRYISYGALQRNSVPCSRRGASYYNCRPG  99

Query  84   QKVNPYNRGCSMITHC  37
             + NPY+RGCS +T C
Sbjct  100  AQANPYSRGCSAVTRC  115



>ref|XP_002319521.1| RALF-LIKE 23 family protein [Populus trichocarpa]
 gb|ABK95616.1| unknown [Populus trichocarpa]
 gb|EEE95444.1| RALF-LIKE 23 family protein [Populus trichocarpa]
Length=128

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = -2

Query  276  TRPRKCTGNVIGDDCVFED-EEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYY  100
            TR   C    + +    ED EE  M+  ++RR+L  ++Y+SY AL  N++PC+ RG SYY
Sbjct  46   TRSSICDKGSLAECMAEEDGEEFGMDTEINRRILATSRYVSYGALQKNNVPCSRRGASYY  105

Query  99   NCHTHQKVNPYNRGCSMITHC  37
            NC    + NPY+RGCS IT C
Sbjct  106  NCKNGAQANPYSRGCSRITRC  126



>ref|XP_011082482.1| PREDICTED: rapid alkalinization factor-like [Sesamum indicum]
Length=115

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = -2

Query  273  RPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNC  94
            +P  C G++   +C+ +  E  M+  ++RR+L  T YISY AL AN++PC+ RG SYYNC
Sbjct  37   KPATCQGSIA--ECMADGGEFDMDSEINRRILATTSYISYGALQANNVPCSQRGASYYNC  94

Query  93   HTHQKVNPYNRGCSMITHC  37
                + NPY R C+  T C
Sbjct  95   QPGAEANPYTRSCTAATQC  113



>ref|XP_010326583.1| PREDICTED: rapid alkalinization factor [Solanum lycopersicum]
Length=118

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  216  EMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHC  37
            E  M+   +RR+L  T YISY AL +NS+PC+ RG SYYNC T  + NPY RGCS IT C
Sbjct  57   EFEMDSESNRRILATTDYISYGALQSNSVPCSRRGASYYNCKTGAEANPYTRGCSAITRC  116



>ref|XP_002273386.1| PREDICTED: protein RALF-like 33 [Vitis vinifera]
Length=118

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            C G++   +C+   EE  M+  ++RR+L   +YISY AL+ NS+PC+ RG SYYNC    
Sbjct  45   CQGSI--AECL-AGEEFEMDSEINRRILASKRYISYGALSRNSVPCSRRGASYYNCRPGA  101

Query  81   KVNPYNRGCSMITHCAR  31
            + NPY RGCS IT C R
Sbjct  102  QANPYTRGCSAITRCRR  118



>ref|XP_004302395.1| PREDICTED: protein RALF-like 33-like isoform 1 [Fragaria vesca 
subsp. vesca]
Length=108

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  231  VFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCS  52
            +  D+E  ++  ++RR+L  + YISY AL  N++PC+ RG SYYNC    + NPYNRGCS
Sbjct  42   LVSDDEFELDSEINRRILATSNYISYGALQRNTVPCSRRGASYYNCKPGAQANPYNRGCS  101

Query  51   MITHC  37
             IT C
Sbjct  102  AITRC  106



>ref|XP_006306243.1| hypothetical protein CARUB_v10012072mg [Capsella rubella]
 gb|EOA39141.1| hypothetical protein CARUB_v10012072mg [Capsella rubella]
Length=110

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 50/76 (66%), Gaps = 3/76 (4%)
 Frame = -2

Query  249  VIGDDCVFEDEEMA--MELGMSRRVLGQ-TKYISYAALAANSIPCNARGRSYYNCHTHQK  79
            V G  C+ ED+E+   M+   +RR L +  +YI Y AL  N++PCN RGRSYY+C   ++
Sbjct  32   VNGQGCIGEDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCNRRGRSYYDCKKRKR  91

Query  78   VNPYNRGCSMITHCAR  31
             NPY RGCS ITHC R
Sbjct  92   NNPYRRGCSAITHCYR  107



>dbj|BAD94374.1| hypothetical protein [Arabidopsis thaliana]
Length=110

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 57/95 (60%), Gaps = 6/95 (6%)
 Frame = -2

Query  306  LMVHGNHATPTRPRKCTGNVIGDDCVFEDEEM--AMELGMSRRVLGQTK-YISYAALAAN  136
            ++    +AT T  + C   V G  C+ ED E+   M+   +RR L   + YISY AL  N
Sbjct  16   VVAESANATWTLTKSC---VNGQGCIGEDGELDYLMDSETNRRQLAARRSYISYGALRKN  72

Query  135  SIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            ++PC+ R RSYY+C   ++ NPY RGCS+ITHC R
Sbjct  73   NVPCSRRDRSYYDCKKRKRANPYRRGCSVITHCYR  107



>ref|XP_009352900.1| PREDICTED: protein RALF-like 19 [Pyrus x bretschneideri]
Length=121

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = -2

Query  258  TGNVIGDDCVFEDEEMAMELGMSRRVL-GQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            T + IGD  V E+ E+ M+    RR L G T+YI Y AL  N++PC  RG+SYYNC   +
Sbjct  46   TNSKIGD--VGEENELLMDSNSGRRTLQGTTRYIGYGALRRNAVPCGRRGQSYYNCQRKE  103

Query  81   KVNPYNRGCSMITHCAR  31
              NPY RGC  IT C+R
Sbjct  104  GANPYKRGCEYITRCSR  120



>gb|AAO27367.1| rapid alkalinization factor 2 precursor [Populus trichocarpa 
x Populus deltoides]
Length=128

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = -2

Query  276  TRPRKCTGNVIGDDCVFED-EEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYY  100
            TR   C    + +    ED EE  M+  ++RR+L  ++Y+SY AL  N++PC+ RG SYY
Sbjct  46   TRSSICDKGSLAECMAEEDGEEFGMDTEINRRILATSRYVSYGALQKNNVPCSRRGASYY  105

Query  99   NCHTHQKVNPYNRGCSMITHC  37
            NC    + NPY+RGCS IT C
Sbjct  106  NCKNGAQANPYSRGCSRITRC  126



>gb|EPS72954.1| rapid alkalinization factor [Genlisea aurea]
Length=100

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = -2

Query  237  DCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRG  58
            D +  DEE+ M+   SRR L    YISY AL  N +PC+ RG SYYNC    + NPY RG
Sbjct  29   DALDLDEELMMDSEASRRQLAAGNYISYGALRRNRVPCSRRGHSYYNCRASGRANPYRRG  88

Query  57   CSMITHCAR  31
            C+ +T CAR
Sbjct  89   CTRVTRCAR  97



>emb|CBI26076.3| unnamed protein product [Vitis vinifera]
Length=152

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            C G++   +C+   EE  M+  ++RR+L   +YISY AL+ NS+PC+ RG SYYNC    
Sbjct  79   CQGSIA--ECL-AGEEFEMDSEINRRILASKRYISYGALSRNSVPCSRRGASYYNCRPGA  135

Query  81   KVNPYNRGCSMITHCAR  31
            + NPY RGCS IT C R
Sbjct  136  QANPYTRGCSAITRCRR  152



>ref|XP_007050868.1| Ralf-like 33, putative [Theobroma cacao]
 gb|EOX95025.1| Ralf-like 33, putative [Theobroma cacao]
Length=116

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 55/87 (63%), Gaps = 4/87 (5%)
 Frame = -2

Query  297  HGNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNA  118
            H  +  PT+   C G++   +C+  DE   M+  ++RR+L  T+YISY AL  N++PC+ 
Sbjct  32   HLINWVPTKA-GCQGSM--AECITNDE-FDMDSEINRRILATTQYISYGALQRNTVPCSL  87

Query  117  RGRSYYNCHTHQKVNPYNRGCSMITHC  37
            RG SYYNC    + NPY+RGCS IT C
Sbjct  88   RGASYYNCQPGAQANPYSRGCSAITRC  114



>ref|NP_566253.1| protein RALF-like 22 [Arabidopsis thaliana]
 sp|Q9MA62.1|RLF22_ARATH RecName: Full=Protein RALF-like 22; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF64534.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67020.1| RALF precursor [Arabidopsis thaliana]
 gb|AAO22595.1| unknown protein [Arabidopsis thaliana]
 gb|ABD38901.1| At3g05490 [Arabidopsis thaliana]
 gb|AEE74248.1| protein RALF-like 22 [Arabidopsis thaliana]
Length=119

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -2

Query  195  MSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            +SRR+L Q KYISY A+  NS+PC+ RG SYYNC    + NPY+RGCS IT C R
Sbjct  65   ISRRILAQKKYISYGAMRRNSVPCSRRGASYYNCQRGAQANPYSRGCSTITRCRR  119



>ref|XP_002867453.1| hypothetical protein ARALYDRAFT_913686 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43712.1| hypothetical protein ARALYDRAFT_913686 [Arabidopsis lyrata subsp. 
lyrata]
Length=107

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  225  EDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMI  46
            E+E       +S R+L   +YISY AL  N++PC  RGRSYY+C   +K NPY RGCS++
Sbjct  40   EEERTIAGFELSGRILKAARYISYGALKRNNVPCKRRGRSYYSCGPGKKANPYKRGCSVV  99

Query  45   THCAR  31
            THC R
Sbjct  100  THCYR  104



>gb|KDP23480.1| hypothetical protein JCGZ_23313 [Jatropha curcas]
Length=125

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 6/84 (7%)
 Frame = -2

Query  279  PTRPRKCTGNVIGDDCVFED---EEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGR  109
            P R   C G++   +C+  D   EE  ++  +SRR+L  + YISY AL  N++PC+ RG 
Sbjct  43   PIRS-SCKGSI--AECLASDDGGEEFELDSEISRRILATSNYISYGALQRNTVPCSRRGA  99

Query  108  SYYNCHTHQKVNPYNRGCSMITHC  37
            SYYNC    + NPY RGCS IT C
Sbjct  100  SYYNCQNGAQANPYTRGCSTITRC  123



>gb|KFK39006.1| hypothetical protein AALP_AA3G188700 [Arabis alpina]
Length=124

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = -2

Query  264  KCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            +C G  I +  V   +E  M+  ++RR+L   +YISY AL  N+IPC+ RG SYYNC   
Sbjct  47   ECRGT-IAECSVSAGDEFEMDSEINRRILATQRYISYGALRRNTIPCSRRGASYYNCRRG  105

Query  84   QKVNPYNRGCSMITHCAR  31
             + NPY+RGCS IT C R
Sbjct  106  AQANPYSRGCSAITRCRR  123



>ref|XP_002882418.1| hypothetical protein ARALYDRAFT_477838 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58677.1| hypothetical protein ARALYDRAFT_477838 [Arabidopsis lyrata subsp. 
lyrata]
Length=118

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -2

Query  195  MSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            +SRR+L Q KYISY A+  NS+PC+ RG SYYNC    + NPY+RGCS IT C R
Sbjct  64   ISRRILAQKKYISYGAMRRNSVPCSRRGASYYNCQRGAQANPYSRGCSTITRCRR  118



>ref|NP_171789.1| rapid alkalinization factor 1 [Arabidopsis thaliana]
 sp|Q9SRY3.1|RLF1_ARATH RecName: Full=Protein RALF-like 1; AltName: Full=Rapid alkalinization 
factor 1; Short=AtRALF1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF02876.1|AC009525_10 Unknown protein [Arabidopsis thaliana]
 gb|AAQ22643.1| At1g02900 [Arabidopsis thaliana]
 gb|AEE27494.1| rapid alkalinization factor 1 [Arabidopsis thaliana]
Length=120

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 2/63 (3%)
 Frame = -2

Query  225  EDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMI  46
            E+EEM  E+  +RR+L  TKYISY +L  NS+PC+ RG SYYNC    + NPY+RGCS I
Sbjct  58   EEEEMDSEI--NRRILATTKYISYQSLKRNSVPCSRRGASYYNCQNGAQANPYSRGCSKI  115

Query  45   THC  37
              C
Sbjct  116  ARC  118



>ref|XP_009400663.1| PREDICTED: rapid alkalinization factor-like [Musa acuminata subsp. 
malaccensis]
Length=130

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 64/112 (57%), Gaps = 8/112 (7%)
 Frame = -2

Query  360  SPPSPTYNDNHRFHQPQLLMVHGNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRV  181
            S    TY  N     P      G  A+P     C G V   DCV E+EEMAME   +RR 
Sbjct  22   SAGEATYGVNEWSVAPFASGDGGLRASPV----CDGRV--GDCVDEEEEMAMESESTRRS  75

Query  180  LGQT--KYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            L ++  ++ISY AL+ N +PCN RG+SYYNC   ++ NPY RGCS IT CAR
Sbjct  76   LARSGARFISYGALSKNRVPCNRRGQSYYNCQRQKRANPYRRGCSTITRCAR  127



>ref|XP_008368985.1| PREDICTED: rapid alkalinization factor-like [Malus domestica]
Length=113

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 4/83 (5%)
 Frame = -2

Query  282  TPTRPRKCTGNVIGDDCVFE-DEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRS  106
             P RP  C G+V   +C+ + D E  M+  +SRR+L  ++YISY AL  N++PC+ RG S
Sbjct  32   VPLRP-GCEGSVA--ECMDDHDVEFGMDSEISRRILATSQYISYGALQRNTVPCSHRGAS  88

Query  105  YYNCHTHQKVNPYNRGCSMITHC  37
            YYNC +  + NPY RGC+ I  C
Sbjct  89   YYNCKSGAQSNPYKRGCTAIARC  111



>ref|XP_002892134.1| hypothetical protein ARALYDRAFT_470261 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68393.1| hypothetical protein ARALYDRAFT_470261 [Arabidopsis lyrata subsp. 
lyrata]
Length=119

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 2/63 (3%)
 Frame = -2

Query  225  EDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMI  46
            E+EEM  E+  +RR+L  TKYISY +L  NS+PC+ RG SYYNC    + NPY+RGCS I
Sbjct  58   EEEEMDSEI--NRRILATTKYISYQSLKRNSVPCSRRGASYYNCRNGAQANPYSRGCSAI  115

Query  45   THC  37
            + C
Sbjct  116  SRC  118



>gb|KFK32572.1| hypothetical protein AALP_AA6G260700 [Arabis alpina]
Length=124

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = -2

Query  264  KCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            +C G  I +  V   +E  M+  ++RR+L   +YISY AL  N+IPC+ RG SYYNC   
Sbjct  47   ECRGT-ISECSVSAGDEFEMDSEINRRILATQRYISYGALRRNTIPCSRRGASYYNCRRG  105

Query  84   QKVNPYNRGCSMITHCAR  31
             + NPY+RGCS IT C R
Sbjct  106  AQANPYSRGCSAITRCRR  123



>ref|XP_008229078.1| PREDICTED: rapid alkalinization factor-like [Prunus mume]
Length=145

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 62/98 (63%), Gaps = 10/98 (10%)
 Frame = -2

Query  294  GNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVL--------GQTKYISYAALAA  139
            G  ATP RPR C  + +G++C+ E+E+   E    +  L        G T+YISY AL  
Sbjct  50   GEGATP-RPRACK-DSLGEECLNEEEDKEEEEEGEQEGLQTVRAQDEGNTRYISYEALKK  107

Query  138  NSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCARGG  25
            +++PCN RG SYYNC T  ++NPY RGC++IT+CAR G
Sbjct  108  DNVPCNRRGSSYYNCGTSGQINPYQRGCTIITNCAREG  145



>ref|XP_008360280.1| PREDICTED: protein RALF-like 33 [Malus domestica]
Length=126

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = -2

Query  267  RKCTGNVIGDDCVFEDEEMAMELGMSRRVLG-QTKYISYAALAANSIPCNARGRSYYNCH  91
            R   G +I D+   E+ EM M+  ++RR+L  + +YISY AL  N++PC+ RG SYYNC 
Sbjct  49   RSAAGGLIADE--DEEAEMLMDSEINRRILAWRRRYISYGALRRNTVPCSRRGASYYNCR  106

Query  90   THQKVNPYNRGCSMITHCAR  31
               + NPY RGCS IT C R
Sbjct  107  PGAQANPYRRGCSAITRCRR  126



>ref|XP_006288916.1| hypothetical protein CARUB_v10002279mg [Capsella rubella]
 gb|EOA21814.1| hypothetical protein CARUB_v10002279mg [Capsella rubella]
Length=117

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 51/77 (66%), Gaps = 2/77 (3%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            C G++   DC+ E+EE  ++  +SRR+L   KY+SY A+  N++PC+ RG SYYNC    
Sbjct  43   CKGSI--ADCIAEEEEFELDSEISRRILASKKYVSYGAMRKNNVPCSRRGASYYNCKRGA  100

Query  81   KVNPYNRGCSMITHCAR  31
            + NPY RGCS IT C R
Sbjct  101  QANPYRRGCSQITRCRR  117



>ref|XP_002516916.1| RALFL33, putative [Ricinus communis]
 gb|EEF45530.1| RALFL33, putative [Ricinus communis]
Length=117

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 52/84 (62%), Gaps = 5/84 (6%)
 Frame = -2

Query  279  PTRPRKCTGNVIGDDCVF---EDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGR  109
            P     C G++   +C+    +D E AM+  ++RR+L   KYISY AL  N++PC+ RG 
Sbjct  34   PMESGGCRGSIA--ECLMSGEDDLEFAMDTEINRRILATNKYISYGALRRNTVPCSRRGA  91

Query  108  SYYNCHTHQKVNPYNRGCSMITHC  37
            SYYNC    + NPY+RGC+ IT C
Sbjct  92   SYYNCRPGAQANPYSRGCNRITRC  115



>ref|XP_009124021.1| PREDICTED: protein RALF-like 22 [Brassica rapa]
Length=119

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -2

Query  195  MSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            +SRR+L Q KY+SY A+  NS+PC+ RG SYYNC    + NPY+RGCS IT C R
Sbjct  65   ISRRILAQKKYVSYGAMRKNSVPCSRRGASYYNCQRGAQANPYSRGCSTITRCRR  119



>emb|CDY40711.1| BnaC03g34270D [Brassica napus]
Length=118

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -2

Query  195  MSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            +SRR+L Q KY+SY A+  NS+PC+ RG SYYNC    + NPY+RGCS IT C R
Sbjct  64   ISRRILAQKKYVSYGAMRKNSVPCSRRGASYYNCQRGAQANPYSRGCSTITRCRR  118



>ref|XP_004244368.1| PREDICTED: protein RALF-like 22 [Solanum lycopersicum]
Length=128

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = -2

Query  237  DCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRG  58
            D +F DEEM M    +RR L    +ISY A++ N+IPC+  G SYY C   QK+ PY RG
Sbjct  59   DTLFADEEMMMPTESARRALNNQDHISYRAMSKNAIPCDRHGASYYQCTRMQKIRPYRRG  118

Query  57   CSMITHCAR  31
            CS IT C R
Sbjct  119  CSKITRCQR  127



>ref|XP_006424193.1| hypothetical protein CICLE_v10030160mg [Citrus clementina]
 gb|ESR37433.1| hypothetical protein CICLE_v10030160mg [Citrus clementina]
 gb|KDO39727.1| hypothetical protein CISIN_1g037899mg [Citrus sinensis]
Length=113

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = -2

Query  252  NVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNC-HTHQKV  76
            N +G    +++ EM M    SRR L    +ISY AL ANS+PCN RG SYYNC H    V
Sbjct  36   NNVGRINEYDENEMLMPTEESRRQLWGGGFISYGALRANSVPCNRRGTSYYNCNHGGGPV  95

Query  75   NPYNRGCSMITHCAR  31
            NPY RGCS IT+C R
Sbjct  96   NPYRRGCSAITNCER  110



>ref|XP_009113682.1| PREDICTED: protein RALF-like 4 [Brassica rapa]
 emb|CDY46613.1| BnaA09g27400D [Brassica napus]
 emb|CDY46282.1| BnaC05g21740D [Brassica napus]
Length=111

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 3/76 (4%)
 Frame = -2

Query  249  VIGDDCVFEDEEMA--MELGMSRRVLGQ-TKYISYAALAANSIPCNARGRSYYNCHTHQK  79
            + G  C+ +D+E+   M+   +RR L +  +YI Y AL  N++PCN RGRSYY+C   ++
Sbjct  33   INGQGCIGDDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCNRRGRSYYDCKKRRR  92

Query  78   VNPYNRGCSMITHCAR  31
             NPY RGCS ITHC R
Sbjct  93   NNPYRRGCSAITHCYR  108



>ref|XP_004229189.1| PREDICTED: rapid alkalinization factor-like [Solanum lycopersicum]
Length=135

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDE-EMAMELGMSRRVLG-QTKYISYAALAANSIPCNARGRSYYNCHT  88
            C G+ IGD    EDE E  ME   SRR+L  + +YISY AL++N +PC+ RG SYYNC  
Sbjct  58   CDGS-IGDCLAEEDENEFGMESESSRRMLAYRRRYISYGALSSNRVPCSRRGASYYNCRP  116

Query  87   HQKVNPYNRGCSMITHC  37
              + NPY RGCS IT C
Sbjct  117  GAQANPYQRGCSAITRC  133



>ref|XP_006415678.1| hypothetical protein EUTSA_v10009158mg [Eutrema salsugineum]
 gb|ESQ34031.1| hypothetical protein EUTSA_v10009158mg [Eutrema salsugineum]
Length=110

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 3/76 (4%)
 Frame = -2

Query  249  VIGDDCVFEDEEMA--MELGMSRRVLGQ-TKYISYAALAANSIPCNARGRSYYNCHTHQK  79
            + G  C+ +D+E+   M+   +RR L +  +YI Y AL  N++PCN RGRSYY+C   ++
Sbjct  32   INGQGCIGDDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCNRRGRSYYDCKKRRR  91

Query  78   VNPYNRGCSMITHCAR  31
             NPY RGCS ITHC R
Sbjct  92   NNPYRRGCSAITHCYR  107



>gb|KFK42648.1| rapid alkalinization factor 1 [Arabis alpina]
Length=123

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 2/63 (3%)
 Frame = -2

Query  225  EDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMI  46
            E+EEM  E+  +RR+L  TKYISY +L  NS+PC+ RG SYYNC    + NPY+RGCS I
Sbjct  61   EEEEMDSEI--NRRILATTKYISYQSLKRNSVPCSRRGASYYNCQNGAQANPYSRGCSSI  118

Query  45   THC  37
              C
Sbjct  119  ARC  121



>ref|XP_009102923.1| PREDICTED: protein RALF-like 4 [Brassica rapa]
Length=111

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 3/76 (4%)
 Frame = -2

Query  249  VIGDDCVFEDEEMA--MELGMSRRVLGQ-TKYISYAALAANSIPCNARGRSYYNCHTHQK  79
            + G  C+ +D+E+   M+   +RR L +  +YI Y AL  N++PCN RGRSYY+C   ++
Sbjct  33   INGQGCIGDDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCNRRGRSYYDCKKRRR  92

Query  78   VNPYNRGCSMITHCAR  31
             NPY RGCS ITHC R
Sbjct  93   NNPYRRGCSAITHCYR  108



>ref|XP_003632038.1| PREDICTED: protein RALF-like 24 [Vitis vinifera]
Length=131

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 48/91 (53%), Gaps = 2/91 (2%)
 Frame = -2

Query  300  VHGNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCN  121
            V  N       R C G V    C+ E+ +   E+   R ++ Q KYISY  L  + IPC 
Sbjct  37   VKNNEIEAIPKRDCGGEV--GQCLGEEMDWEWEISSRRVLVMQKKYISYETLKKDMIPCA  94

Query  120  ARGRSYYNCHTHQKVNPYNRGCSMITHCARG  28
              G SYYNC    + NPYNRGC +IT CARG
Sbjct  95   RPGASYYNCRASGEANPYNRGCEVITGCARG  125



>ref|XP_003550267.1| PREDICTED: rapid alkalinization factor 23-like [Glycine max]
Length=120

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 45/73 (62%), Gaps = 4/73 (5%)
 Frame = -2

Query  249  VIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNP  70
            + GDD    D E  ME   +RR+L    YISY AL  N++PC+ RG SYYNC    + NP
Sbjct  52   LAGDD----DTEFLMESESNRRILAGRSYISYGALRRNTVPCSRRGASYYNCRPGAQANP  107

Query  69   YNRGCSMITHCAR  31
            Y+RGCS IT C R
Sbjct  108  YSRGCSAITRCRR  120



>emb|CDY18799.1| BnaAnng02640D [Brassica napus]
Length=119

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -2

Query  195  MSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            +SRR+L Q KY+SY A+  NS+PC+ RG SYYNC    + NPY RGCS IT C R
Sbjct  65   ISRRILAQKKYVSYGAMRKNSVPCSRRGASYYNCQRGAQANPYRRGCSTITRCRR  119



>gb|KFK31007.1| hypothetical protein AALP_AA6G056400 [Arabis alpina]
Length=110

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 58/96 (60%), Gaps = 6/96 (6%)
 Frame = -2

Query  309  LLMVHGNHATPTRPRKCTGNVIGDDCVFEDE--EMAMELGMSRRVLGQTK-YISYAALAA  139
            +++    +AT    + C   V G  C+ +D+  E  M+   +RR L   + YISY AL  
Sbjct  15   VVVAESANATWGLTKSC---VNGQGCIGDDDGLESLMDSETNRRQLAARRTYISYGALKK  71

Query  138  NSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            N++PC+ RGRSYY+C+  ++ NPY RGCS ITHC R
Sbjct  72   NNVPCSRRGRSYYDCNKRKRANPYRRGCSAITHCYR  107



>ref|XP_010481344.1| PREDICTED: protein RALF-like 1 [Camelina sativa]
Length=122

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 5/76 (7%)
 Frame = -2

Query  261  CTGNVIGDDCV-FEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            C G++   +C+  E+EEM  E+  +RR+L  TKYISY +L  NS+PC+ RG SYYNC   
Sbjct  49   CHGSIA--ECIGAEEEEMDSEI--NRRILATTKYISYQSLRRNSVPCSRRGASYYNCQNG  104

Query  84   QKVNPYNRGCSMITHC  37
             + NPY+RGCS I  C
Sbjct  105  AQANPYSRGCSAIARC  120



>ref|XP_009134826.1| PREDICTED: protein RALF-like 22 [Brassica rapa]
 emb|CDX74145.1| BnaA03g29020D [Brassica napus]
Length=118

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -2

Query  195  MSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            +SRR+L Q KY+SY A+  NS+PC+ RG SYYNC    + NPY RGCS IT C R
Sbjct  64   ISRRILAQKKYVSYGAMRKNSVPCSRRGASYYNCQRGAQANPYRRGCSTITRCRR  118



>ref|XP_003625906.1| RALF [Medicago truncatula]
 gb|AES82124.1| RALF [Medicago truncatula]
Length=118

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 51/87 (59%), Gaps = 3/87 (3%)
 Frame = -2

Query  297  HGNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNA  118
            H     P     C G++  ++C+ E+ E  M     RR+L  T YISY AL  N++PC+ 
Sbjct  32   HLRWVAPMTTPTCQGSI--EECI-EEGEFGMNSESHRRILATTHYISYRALQRNTVPCSH  88

Query  117  RGRSYYNCHTHQKVNPYNRGCSMITHC  37
            +G SYYNC T  + NPY+RGC+ IT C
Sbjct  89   KGASYYNCQTGAEANPYSRGCATITRC  115



>ref|XP_010474880.1| PREDICTED: protein RALF-like 1 [Camelina sativa]
Length=119

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 2/63 (3%)
 Frame = -2

Query  225  EDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMI  46
            E+EEM  E+  +RR+L  TKYISY +L  NS+PC+ RG SYYNC    + NPY+RGCS I
Sbjct  57   EEEEMDSEI--NRRILATTKYISYQSLRRNSVPCSRRGASYYNCQNGAQANPYSRGCSAI  114

Query  45   THC  37
              C
Sbjct  115  ARC  117



>ref|XP_006408069.1| hypothetical protein EUTSA_v10021783mg [Eutrema salsugineum]
 gb|ESQ49522.1| hypothetical protein EUTSA_v10021783mg [Eutrema salsugineum]
Length=119

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -2

Query  195  MSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            +SRR+L Q KY+SY A+  NS+PC+ RG SYYNC    + NPY RGCS IT C R
Sbjct  65   ISRRILAQKKYVSYGAMRKNSVPCSRRGASYYNCRRGAQANPYRRGCSTITRCRR  119



>ref|XP_010457289.1| PREDICTED: protein RALF-like 1 [Camelina sativa]
Length=119

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 2/63 (3%)
 Frame = -2

Query  225  EDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMI  46
            E+EEM  E+  +RR+L  TKYISY +L  NS+PC+ RG SYYNC    + NPY+RGCS I
Sbjct  57   EEEEMDSEI--NRRILATTKYISYQSLRRNSVPCSRRGASYYNCQNGAQANPYSRGCSAI  114

Query  45   THC  37
              C
Sbjct  115  ARC  117



>ref|XP_010485998.1| PREDICTED: protein RALF-like 22 [Camelina sativa]
Length=123

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -2

Query  195  MSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            +SRR+L Q KY+SY A+  NS+PC+ RG SYYNC    + NPY RGCS IT C R
Sbjct  69   ISRRILAQKKYVSYGAMRKNSVPCSRRGASYYNCQRGAQANPYRRGCSTITRCRR  123



>ref|XP_003601688.1| Rapid alkalinization factor preproprotein [Medicago truncatula]
 gb|AES71939.1| RALF [Medicago truncatula]
Length=135

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 52/90 (58%), Gaps = 4/90 (4%)
 Frame = -2

Query  291  NHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLG-QTKYISYAALAANSIPCNAR  115
            N A     R CT  +   +C+ + E M M+   +RRVL  Q KYISY  L  + +PC+  
Sbjct  44   NDAVVITKRVCTKTI--GECLTDPEMMMMDSESNRRVLAMQKKYISYDTLKRDMVPCDRP  101

Query  114  GRSYYNCHTHQKVNPYNRGCSMITHCARGG  25
            G SYYNCH  Q  NPY+RGC +IT C RG 
Sbjct  102  GASYYNCHRRQ-ANPYSRGCEVITACVRGA  130



>ref|XP_007154282.1| hypothetical protein PHAVU_003G105300g [Phaseolus vulgaris]
 gb|ESW26276.1| hypothetical protein PHAVU_003G105300g [Phaseolus vulgaris]
Length=122

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  225  EDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMI  46
            +D E  M+   SRR+L    YISY AL  N++PC+ RG SYYNC    + NPY+RGCS I
Sbjct  58   DDAEFLMDSETSRRILAGKTYISYGALRRNTVPCSRRGASYYNCRPGAQANPYSRGCSAI  117

Query  45   THCAR  31
            T C R
Sbjct  118  TRCRR  122



>ref|XP_006298819.1| hypothetical protein CARUB_v10014925mg [Capsella rubella]
 gb|EOA31717.1| hypothetical protein CARUB_v10014925mg [Capsella rubella]
Length=125

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -2

Query  195  MSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            +SRR+L Q KY+SY A+  NS+PC+ RG SYYNC    + NPY RGCS IT C R
Sbjct  71   ISRRILAQKKYVSYGAMRKNSVPCSRRGASYYNCQRGAQANPYRRGCSTITRCRR  125



>ref|XP_010464074.1| PREDICTED: protein RALF-like 22 [Camelina sativa]
Length=122

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -2

Query  195  MSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            +SRR+L Q KY+SY A+  NS+PC+ RG SYYNC    + NPY RGCS IT C R
Sbjct  68   ISRRILAQKKYVSYGAMRKNSVPCSRRGASYYNCQRGAQANPYRRGCSAITRCRR  122



>emb|CDY18779.1| BnaAnng02440D [Brassica napus]
Length=119

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -2

Query  195  MSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            +SRR+L Q KY+SY A+  NS+PC+ RG SYYNC    + NPY RGCS IT C R
Sbjct  65   ISRRILAQKKYVSYGAMRKNSVPCSRRGASYYNCQRGAQANPYRRGCSTITRCRR  119



>ref|XP_004508218.1| PREDICTED: rapid alkalinization factor 23-like [Cicer arietinum]
Length=127

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -2

Query  249  VIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNP  70
            + GD+   +D E  M+   SRR+L   +YISY AL  N++PC+ RG SYYNC    + NP
Sbjct  58   LAGDE---DDTEFLMDSENSRRILAGRRYISYGALRRNTVPCSRRGASYYNCRPGAQANP  114

Query  69   YNRGCSMITHCAR  31
            Y RGCS IT C R
Sbjct  115  YRRGCSAITRCRR  127



>ref|XP_010428004.1| PREDICTED: protein RALF-like 22 [Camelina sativa]
Length=126

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -2

Query  195  MSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            +SRR+L Q KY+SY A+  NS+PC+ RG SYYNC    + NPY RGCS IT C R
Sbjct  72   ISRRILAQKKYVSYGAMRKNSVPCSRRGASYYNCQRGAQANPYRRGCSAITRCRR  126



>gb|EMS65783.1| hypothetical protein TRIUR3_31877 [Triticum urartu]
Length=111

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 56/90 (62%), Gaps = 9/90 (10%)
 Frame = -2

Query  276  TRPRKCTGNVIGDDCVFEDEEM---AMELGMS-RRVLGQ---TKYISYAALAANSIPCNA  118
            TR   C G  +G+  V EDEEM   A   G + RR L +    +YISYAAL A+ +PCN 
Sbjct  20   TRAATCDG-AVGECGVDEDEEMGTGAYGTGEALRRSLARKPTARYISYAALRADQVPCNK  78

Query  117  RGRSYY-NCHTHQKVNPYNRGCSMITHCAR  31
            R +SYY NC + Q+ NPY RGCS IT CAR
Sbjct  79   RDKSYYTNCGSMQQANPYTRGCSAITRCAR  108



>ref|XP_004494362.1| PREDICTED: rapid alkalinization factor-like [Cicer arietinum]
Length=118

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 53/82 (65%), Gaps = 7/82 (9%)
 Frame = -2

Query  282  TPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSY  103
            TPT    C G++  ++C+ ED E  M+    RR+L  ++YISY AL  N++PC+ +G SY
Sbjct  41   TPT----CQGSI--EECI-EDGEFGMDSESHRRILATSQYISYRALQRNTVPCSHKGASY  93

Query  102  YNCHTHQKVNPYNRGCSMITHC  37
            YNC    + NPY+RGC+ IT C
Sbjct  94   YNCQKGAEANPYSRGCTTITRC  115



>gb|KFK44698.1| hypothetical protein AALP_AA1G291600 [Arabis alpina]
Length=110

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = -2

Query  243  GDDCVFEDEEMA--MELGMSRRVLGQ-TKYISYAALAANSIPCNARGRSYYNCHTHQKVN  73
            G  C+ +D+E+   M+   +RR L +  +YI Y AL  N++PCN RGRSYY+C   ++ N
Sbjct  34   GQGCIGDDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCNRRGRSYYDCKKRRRNN  93

Query  72   PYNRGCSMITHCAR  31
            PY RGCS ITHC R
Sbjct  94   PYRRGCSAITHCYR  107



>ref|XP_010522782.1| PREDICTED: protein RALF-like 1 [Tarenaya hassleriana]
Length=111

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -2

Query  222  DEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMIT  43
            D E  M+  ++RR+L  T YISY AL  NSIPC+ RG SYYNC    + NPY+RGCS I 
Sbjct  48   DGEFEMDSEINRRILATTDYISYQALQRNSIPCSRRGASYYNCRAGAQANPYSRGCSAIA  107

Query  42   HC  37
             C
Sbjct  108  RC  109



>gb|AFK33323.1| unknown [Medicago truncatula]
Length=126

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDE---EMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCH  91
            C G++ G   +  DE   E  M+   +RR+L   +YISY AL  N++PC+ RG SYYNC 
Sbjct  47   CRGSIAGCSLLAGDEDDSEFMMDSESNRRILAARRYISYGALRRNTVPCSRRGASYYNCR  106

Query  90   THQKVNPYNRGCSMITHCAR  31
               + NPY RGCS IT C R
Sbjct  107  PGAQANPYRRGCSAITRCRR  126



>emb|CDY35727.1| BnaC03g58480D [Brassica napus]
Length=111

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = -2

Query  243  GDDCVFEDEEMA--MELGMSRRVLGQ-TKYISYAALAANSIPCNARGRSYYNCHTHQKVN  73
            G  C+ +D+E+   M+   +RR L +  +YI Y AL  N++PCN RGRSYY+C   ++ N
Sbjct  35   GQGCIGDDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCNRRGRSYYDCKKRRRNN  94

Query  72   PYNRGCSMITHCAR  31
            PY RGCS ITHC R
Sbjct  95   PYRRGCSAITHCYR  108



>ref|XP_009418953.1| PREDICTED: protein RALF-like 33 [Musa acuminata subsp. malaccensis]
Length=117

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 7/79 (9%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELG--MSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHT  88
            C+G+V   +CV  +E    ELG  ++RR+L ++ YISYAAL  +S+PC+ RG SYYNC  
Sbjct  44   CSGSVA--ECVAGEE---FELGSEVTRRILARSYYISYAALRRDSVPCSRRGASYYNCRP  98

Query  87   HQKVNPYNRGCSMITHCAR  31
              + NPY+R CS IT C R
Sbjct  99   GARANPYSRSCSAITRCRR  117



>ref|XP_010487517.1| PREDICTED: rapid alkalinization factor 23-like [Camelina sativa]
 ref|XP_010487519.1| PREDICTED: rapid alkalinization factor 23-like [Camelina sativa]
Length=129

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (63%), Gaps = 3/75 (4%)
 Frame = -2

Query  246  IGD---DCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKV  76
            IGD   D  +   E  M+  ++RR+L   +YISY AL  N++PC+ RG SYYNC    + 
Sbjct  55   IGDEDGDLFYGGAEFEMDSEINRRMLAARRYISYGALRRNTVPCSRRGASYYNCRRGAQA  114

Query  75   NPYNRGCSMITHCAR  31
            NPY+RGCS IT C R
Sbjct  115  NPYSRGCSAITRCRR  129



>ref|NP_001152377.1| RALF precursor [Zea mays]
 gb|ACG47312.1| RALF precursor [Zea mays]
Length=137

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 53/89 (60%), Gaps = 12/89 (13%)
 Frame = -2

Query  264  KCTGNVIGDDCVFEDEEMAMELGMS------RRVLGQTK----YISYAALAANSIPCNAR  115
            KC+G  +G+  V E+EE+ +  G        RR L Q K    YISYAAL A+ +PCN R
Sbjct  47   KCSG-AVGECGVDEEEELGLSGGGIGAGDALRRTLAQRKPTNRYISYAALRADQVPCNKR  105

Query  114  GRSYY-NCHTHQKVNPYNRGCSMITHCAR  31
            GRSYY NC      NPY RGCS IT CAR
Sbjct  106  GRSYYTNCAAQTAANPYRRGCSAITRCAR  134



>gb|KFK37938.1| hypothetical protein AALP_AA3G049600 [Arabis alpina]
Length=117

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -2

Query  195  MSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            +SRR+L Q +Y+SY A+  NS+PC+ RG SYYNC    + NPY RGCS IT C R
Sbjct  63   ISRRILAQKRYVSYGAMKKNSVPCSRRGASYYNCQRGAQANPYRRGCSQITRCRR  117



>ref|XP_009109739.1| PREDICTED: protein RALF-like 4 [Brassica rapa]
 emb|CDX90140.1| BnaA08g18440D [Brassica napus]
Length=111

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = -2

Query  243  GDDCVFEDEEMA--MELGMSRRVLGQ-TKYISYAALAANSIPCNARGRSYYNCHTHQKVN  73
            G  C+ +D+E+   M+   +RR L +  +YI Y AL  N++PCN RGRSYY+C   ++ N
Sbjct  35   GQGCIGDDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCNRRGRSYYDCKKRRRNN  94

Query  72   PYNRGCSMITHCAR  31
            PY RGCS ITHC R
Sbjct  95   PYRRGCSAITHCYR  108



>emb|CDX94598.1| BnaC07g10600D [Brassica napus]
Length=111

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = -2

Query  243  GDDCVFEDEEMA--MELGMSRRVLGQ-TKYISYAALAANSIPCNARGRSYYNCHTHQKVN  73
            G  C+ +D+E+   M+   +RR L +  +YI Y AL  N++PCN RGRSYY+C   ++ N
Sbjct  35   GQGCIGDDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCNRRGRSYYDCKKRRRNN  94

Query  72   PYNRGCSMITHCAR  31
            PY RGCS ITHC R
Sbjct  95   PYRRGCSAITHCYR  108



>ref|XP_007198968.1| hypothetical protein PRUPE_ppa015429mg, partial [Prunus persica]
 gb|EMJ00167.1| hypothetical protein PRUPE_ppa015429mg, partial [Prunus persica]
Length=89

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  177  GQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCARGG  25
            G T+YISY AL  +++PCN RG SYYNC T  K+NPY RGC++IT+CAR G
Sbjct  39   GNTRYISYEALKKDNVPCNRRGSSYYNCGTSGKINPYQRGCTIITNCAREG  89



>ref|XP_006406825.1| hypothetical protein EUTSA_v10021739mg [Eutrema salsugineum]
 gb|ESQ48278.1| hypothetical protein EUTSA_v10021739mg [Eutrema salsugineum]
Length=136

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -2

Query  216  EMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHC  37
            E  M+  ++RR+L   +YISY AL  NS+PC+ RG SYYNC    + NPY+RGCS+IT C
Sbjct  75   EFEMDSEINRRILANRRYISYGALRRNSVPCSRRGASYYNCRRGAQANPYSRGCSVITRC  134

Query  36   AR  31
             R
Sbjct  135  RR  136



>ref|XP_010493984.1| PREDICTED: protein RALF-like 22 [Camelina sativa]
Length=116

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 52/78 (67%), Gaps = 2/78 (3%)
 Frame = -2

Query  264  KCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            +C G++   DC+ EDEE   +  +SRR+L   KY+SY A+  N++PC+ RG SYYNC   
Sbjct  41   ECKGSI--ADCIAEDEEFEFDSEISRRILASKKYVSYGAMRKNNVPCSRRGASYYNCKRG  98

Query  84   QKVNPYNRGCSMITHCAR  31
             + NPY+RGCS IT C R
Sbjct  99   AQANPYSRGCSKITRCRR  116



>ref|XP_006356972.1| PREDICTED: rapid alkalinization factor-like [Solanum tuberosum]
Length=134

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDE-EMAMELGMSRRVLG-QTKYISYAALAANSIPCNARGRSYYNCHT  88
            C G+ IGD    EDE E  ME   SRR+L  + +YISY AL++N +PC+ RG SYYNC  
Sbjct  57   CDGS-IGDCLAEEDEDEFGMESESSRRMLAYRRRYISYGALSSNRVPCSRRGASYYNCRP  115

Query  87   HQKVNPYNRGCSMITHC  37
              + NPY RGCS IT C
Sbjct  116  GAQANPYQRGCSAITRC  132



>ref|XP_002454987.1| hypothetical protein SORBIDRAFT_03g002560 [Sorghum bicolor]
 gb|EES00107.1| hypothetical protein SORBIDRAFT_03g002560 [Sorghum bicolor]
Length=135

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 54/95 (57%), Gaps = 12/95 (13%)
 Frame = -2

Query  282  TPTRPRKCTGNVIGDDCVFEDEEMAMELG------MSRRVLGQ----TKYISYAALAANS  133
            T  R  KC+G +   D V E EE+ +  G        RR L       +YISYAAL A+ 
Sbjct  39   TVGRSSKCSGPMSQCD-VDEAEELGLSGGGFPAGDTIRRTLAARQPTNRYISYAALRADQ  97

Query  132  IPCNARGRSYY-NCHTHQKVNPYNRGCSMITHCAR  31
            +PCN RGRSYY NC + Q  NPY RGCS IT CAR
Sbjct  98   VPCNKRGRSYYSNCASQQAANPYRRGCSAITRCAR  132



>ref|XP_010656981.1| PREDICTED: protein RALF-like 19 [Vitis vinifera]
Length=129

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = -2

Query  213  MAMELGMSRRVLGQ-TKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHC  37
            M  E+ + RR L Q +++ISY AL  N++PCN RG SYYNC    K NPY RGCS ITHC
Sbjct  65   MGDEVDIVRRSLAQRSRFISYGALKKNNVPCNRRGNSYYNCARSGKANPYRRGCSAITHC  124

Query  36   AR  31
             R
Sbjct  125  QR  126



>ref|XP_008390661.1| PREDICTED: rapid alkalinization factor-like [Malus domestica]
Length=126

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = -2

Query  267  RKCTGNVIGDDCVFEDE--EMAMELGMSRRVLG-QTKYISYAALAANSIPCNARGRSYYN  97
            R   G +I D    EDE  EM M+  ++RR+L  + +YISY AL  N++PC+ RG SYYN
Sbjct  49   RSAAGGLIAD----EDEXAEMLMDSEINRRILAWRRRYISYGALRRNTVPCSRRGASYYN  104

Query  96   CHTHQKVNPYNRGCSMITHCAR  31
            C    + NPY RGCS IT C R
Sbjct  105  CRPGAQANPYRRGCSAITRCRR  126



>ref|XP_008359858.1| PREDICTED: rapid alkalinization factor-like [Malus domestica]
Length=120

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 49/79 (62%), Gaps = 6/79 (8%)
 Frame = -2

Query  261  CTGNVIGDDCVF----EDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNC  94
            C G++   DC      ++ E  M+  +SRR+L  + YISY AL  N++PC+ RG SYYNC
Sbjct  42   CKGSIA--DCALAAGNDEVEFDMDSEISRRILATSNYISYGALQRNTVPCSRRGASYYNC  99

Query  93   HTHQKVNPYNRGCSMITHC  37
                + NPY+RGCS IT C
Sbjct  100  QPGAQSNPYSRGCSAITRC  118



>emb|CDY15684.1| BnaA07g08550D [Brassica napus]
Length=163

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = -2

Query  243  GDDCVFEDEEMA--MELGMSRRVLGQ-TKYISYAALAANSIPCNARGRSYYNCHTHQKVN  73
            G  C+ +D+E+   M+   +RR L +  +YI Y AL  N++PCN RGRSYY+C   ++ N
Sbjct  35   GQGCIGDDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCNRRGRSYYDCKKRRRNN  94

Query  72   PYNRGCSMITHCAR  31
            PY RGCS ITHC R
Sbjct  95   PYRRGCSAITHCYR  108



>dbj|BAK08263.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=127

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 55/90 (61%), Gaps = 9/90 (10%)
 Frame = -2

Query  276  TRPRKCTGNVIGDDCVFEDEEMAMELGMS----RRVLGQ---TKYISYAALAANSIPCNA  118
            +R   C G  +G+  V EDEEM      +    RR L +    +YISYAAL A+ IPCN 
Sbjct  36   SRTATCDG-AVGECGVDEDEEMGTGAAGTGEALRRSLARKPTARYISYAALRADQIPCNK  94

Query  117  RGRSYY-NCHTHQKVNPYNRGCSMITHCAR  31
            R +SYY NC + Q++NPY RGCS IT CAR
Sbjct  95   RDKSYYTNCGSMQQMNPYTRGCSAITRCAR  124



>gb|AES91867.2| RALF [Medicago truncatula]
Length=126

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -2

Query  249  VIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNP  70
            + GD+   +D E  M+   +RR+L   +YISY AL  N++PC+ RG SYYNC    + NP
Sbjct  57   LAGDE---DDSEFMMDSESNRRILAARRYISYGALRRNTVPCSRRGASYYNCRPGAQANP  113

Query  69   YNRGCSMITHCAR  31
            Y RGCS IT C R
Sbjct  114  YRRGCSAITRCRR  126



>ref|XP_010038087.1| PREDICTED: rapid alkalinization factor-like [Eucalyptus grandis]
 gb|KCW49886.1| hypothetical protein EUGRSUZ_K03354 [Eucalyptus grandis]
Length=117

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 49/80 (61%), Gaps = 6/80 (8%)
 Frame = -2

Query  264  KCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            +C G+ IG+ C    EE   E    RR+L   +YISY AL  NS PC+ RG SYYNC   
Sbjct  44   ECQGDSIGE-CRVLGEETESE----RRILATRQYISYGALRRNSAPCSQRGASYYNCRAG  98

Query  84   QKVNPYNRGCSMITHCARGG  25
             + NPY+RGCS IT C RGG
Sbjct  99   GQSNPYSRGCSQITRC-RGG  117



>ref|XP_010465683.1| PREDICTED: rapid alkalinization factor 23-like [Camelina sativa]
Length=128

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 2/74 (3%)
 Frame = -2

Query  246  IGD--DCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVN  73
            +GD  D  +   E  M+  ++RR+L   +YISY AL  N++PC+ RG SYYNC    + N
Sbjct  55   LGDEGDLFYGGAEFEMDSEINRRMLAARRYISYGALRRNTVPCSRRGASYYNCRRGAQAN  114

Query  72   PYNRGCSMITHCAR  31
            PY+RGCS IT C R
Sbjct  115  PYSRGCSAITRCRR  128



>ref|XP_010499341.1| PREDICTED: protein RALF-like 4 [Camelina sativa]
 ref|XP_010460611.1| PREDICTED: protein RALF-like 4 [Camelina sativa]
Length=110

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = -2

Query  243  GDDCVFEDEEMA--MELGMSRRVLGQ-TKYISYAALAANSIPCNARGRSYYNCHTHQKVN  73
            G  C+ ED+E+   M+   +RR L +  +YI Y AL  N++PC+ RGRSYY+C   ++ N
Sbjct  34   GQGCIGEDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCSRRGRSYYDCKKRRRNN  93

Query  72   PYNRGCSMITHCAR  31
            PY RGCS ITHC R
Sbjct  94   PYRRGCSAITHCYR  107



>ref|NP_174148.1| protein ralf-like 4 [Arabidopsis thaliana]
 ref|XP_002890767.1| hypothetical protein ARALYDRAFT_473036 [Arabidopsis lyrata subsp. 
lyrata]
 sp|Q9FZA0.1|RLF4_ARATH RecName: Full=Protein RALF-like 4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF98428.1|AC021044_7 Hypothetical protein [Arabidopsis thaliana]
 gb|AAO64155.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00491.1| hypothetical protein [Arabidopsis thaliana]
 gb|EFH67026.1| hypothetical protein ARALYDRAFT_473036 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE30939.1| protein ralf-like 4 [Arabidopsis thaliana]
Length=110

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = -2

Query  243  GDDCVFEDEEMA--MELGMSRRVLGQ-TKYISYAALAANSIPCNARGRSYYNCHTHQKVN  73
            G  C+ ED+E+   M+   +RR L +  +YI Y AL  N++PC+ RGRSYY+C   ++ N
Sbjct  34   GQGCIGEDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCSRRGRSYYDCKKRRRNN  93

Query  72   PYNRGCSMITHCAR  31
            PY RGCS ITHC R
Sbjct  94   PYRRGCSAITHCYR  107



>ref|XP_006359396.1| PREDICTED: rapid alkalinization factor-like [Solanum tuberosum]
Length=118

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = -2

Query  216  EMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHC  37
            E  M+   +RR+L  T YISY AL +NS+PC+ RG SYYNC T  + NPY R CS IT C
Sbjct  57   EFEMDSESNRRILATTDYISYGALQSNSVPCSRRGASYYNCKTGAEANPYTRDCSAITRC  116



>ref|XP_010524867.1| PREDICTED: protein RALF-like 22 [Tarenaya hassleriana]
Length=117

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -2

Query  195  MSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            +SRR+L   KYISY AL  NS+PC+ RG SYYNC    + NPY+RGCS IT C R
Sbjct  63   ISRRILATNKYISYGALQRNSVPCSRRGASYYNCRRGAQANPYSRGCSTITRCRR  117



>ref|XP_010449887.1| PREDICTED: protein RALF-like 33 [Camelina sativa]
Length=122

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -2

Query  195  MSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            ++RR+L  TKYISY AL  N++PC+ RG SYYNC    + NPY+RGCS IT C R
Sbjct  68   INRRILATTKYISYGALKRNTVPCSRRGASYYNCRRGAQANPYSRGCSAITRCRR  122



>ref|XP_003529566.1| PREDICTED: rapid alkalinization factor 23-like [Glycine max]
Length=118

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  225  EDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMI  46
            +D E  ME   +RR+L    YISY AL  N++PC+ RG SYYNC    + NPY+RGCS I
Sbjct  54   DDAEFLMESESNRRILAGRSYISYGALRRNTVPCSRRGASYYNCRPGAQANPYSRGCSAI  113

Query  45   THCAR  31
            T C R
Sbjct  114  TRCRR  118



>gb|EMT22699.1| hypothetical protein F775_09967 [Aegilops tauschii]
Length=116

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 55/95 (58%), Gaps = 10/95 (11%)
 Frame = -2

Query  312  QLLMVHGNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANS  133
            QL    G   T T+    T  +  + C  +++E+A          G  +YISYAAL A++
Sbjct  28   QLPRATGGGVTTTQAFDGTAALGLEQCAADEQELAR---------GNPRYISYAALRADA  78

Query  132  IPCNARGRSYY-NCHTHQKVNPYNRGCSMITHCAR  31
            IPC+ RG+SYY NC + Q+ NPY RGCS IT CAR
Sbjct  79   IPCDKRGQSYYTNCGSMQQANPYRRGCSAITRCAR  113



>ref|XP_009778264.1| PREDICTED: rapid alkalinization factor [Nicotiana sylvestris]
Length=115

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            C G++   DC+ E+EE  ++   +RR+L   KYISY AL  NS+PC+ RG SYYNC    
Sbjct  41   CNGSI--GDCMAEEEEFELDSESNRRILATKKYISYGALQKNSVPCSRRGASYYNCKPGA  98

Query  81   KVNPYNRGCSMITHC  37
            + NPY+RGCS IT C
Sbjct  99   QANPYSRGCSAITRC  113



>ref|XP_010546717.1| PREDICTED: protein RALF-like 22 [Tarenaya hassleriana]
Length=117

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -2

Query  195  MSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            +SRR+L   KYISY AL  NS+PC+ RG SYYNC    + NPY+RGCS IT C R
Sbjct  63   ISRRILATNKYISYGALQRNSVPCSRRGASYYNCRRGAQANPYSRGCSTITRCRR  117



>ref|XP_009615222.1| PREDICTED: rapid alkalinization factor-like [Nicotiana tomentosiformis]
Length=128

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = -2

Query  222  DEEMAMELGMSRRVLG-QTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMI  46
            DEE +ME   +RR+L  + +YISY AL+ N +PC+ RG SYYNC    + NPY RGCS I
Sbjct  64   DEEFSMESESTRRILAYRRRYISYGALSRNRVPCSRRGASYYNCRPGAQANPYRRGCSAI  123

Query  45   THCAR  31
            T C R
Sbjct  124  TRCRR  128



>ref|NP_001149391.1| LOC100283017 precursor [Zea mays]
 gb|ACG35284.1| RALF precursor [Zea mays]
 gb|AFW77437.1| RALF [Zea mays]
Length=129

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 48/78 (62%), Gaps = 8/78 (10%)
 Frame = -2

Query  249  VIGDDCVFEDEEMAMELGMSRRVLGQ----TKYISYAALAANSIPCNARGRSYY-NCHTH  85
             +G D   E++E+       RR L Q     +YISYAAL A+ +PCN RGRSYY NC + 
Sbjct  52   AVGSD---EEQEVGGSDAFLRRALAQRQPTNRYISYAALRADQVPCNQRGRSYYSNCASQ  108

Query  84   QKVNPYNRGCSMITHCAR  31
            +  NPY RGCS IT CAR
Sbjct  109  KPANPYRRGCSAITRCAR  126



>ref|XP_009781864.1| PREDICTED: rapid alkalinization factor-like [Nicotiana sylvestris]
Length=128

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = -2

Query  222  DEEMAMELGMSRRVLG-QTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMI  46
            DEE +ME   +RR+L  + +YISY AL+ N +PC+ RG SYYNC    + NPY RGCS I
Sbjct  64   DEEFSMESESTRRILAYRRRYISYGALSRNRVPCSRRGASYYNCRPGAQANPYRRGCSAI  123

Query  45   THCAR  31
            T C R
Sbjct  124  TRCRR  128



>ref|XP_009415108.1| PREDICTED: protein RALF-like 19 [Musa acuminata subsp. malaccensis]
Length=127

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 46/79 (58%), Gaps = 4/79 (5%)
 Frame = -2

Query  261  CTGNVIGDDCVFE-DEEMAMELGMSRRVLG---QTKYISYAALAANSIPCNARGRSYYNC  94
            C+G   G  C+ E   EM M    SRR+L    + KYISY AL  + +PCN  G  YYNC
Sbjct  44   CSGRRRGQGCLLEHGVEMEMSSEESRRLLWAVTEKKYISYEALKGDVVPCNKPGVPYYNC  103

Query  93   HTHQKVNPYNRGCSMITHC  37
            H   K NPYNRGC +I+ C
Sbjct  104  HVFPKANPYNRGCQIISGC  122



>ref|XP_008458453.1| PREDICTED: protein RALF-like 33 [Cucumis melo]
Length=119

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  216  EMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHC  37
            E  M+  ++RR+L  T+YISY AL  N++PC+ RG SYYNC    + NPY+RGCS IT C
Sbjct  58   EFQMDSEINRRILATTRYISYGALRRNNVPCSRRGASYYNCRPGAQANPYSRGCSAITRC  117



>ref|XP_004302396.1| PREDICTED: protein RALF-like 33-like isoform 2 [Fragaria vesca 
subsp. vesca]
Length=106

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  231  VFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCS  52
            +  D+E  ++  ++RR+L  + YISY AL  N++PC+ RG SYYNC    + NPYNRGCS
Sbjct  42   LVSDDEFELDSEINRRILATSNYISYGALQRNTVPCSRRGASYYNCKPGAQANPYNRGCS  101

Query  51   MITH  40
             IT 
Sbjct  102  AITR  105



>ref|XP_010504445.1| PREDICTED: rapid alkalinization factor 23-like [Camelina sativa]
Length=130

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 47/79 (59%), Gaps = 7/79 (9%)
 Frame = -2

Query  246  IGD---DCVFEDEEMAMELGM----SRRVLGQTKYISYAALAANSIPCNARGRSYYNCHT  88
            +GD   D  +   EM  E  M    SRR+L   +YISY AL  N++PC+ RG SYYNC  
Sbjct  52   LGDEDGDLFYGGGEMGAEFEMDSEISRRMLAARRYISYGALRRNTVPCSRRGASYYNCRR  111

Query  87   HQKVNPYNRGCSMITHCAR  31
              + NPY+RGCS IT C R
Sbjct  112  GAQANPYSRGCSAITRCRR  130



>ref|XP_006299574.1| hypothetical protein CARUB_v10015749mg [Capsella rubella]
 gb|EOA32472.1| hypothetical protein CARUB_v10015749mg [Capsella rubella]
Length=131

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -2

Query  216  EMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHC  37
            E  M+  ++RR+L   +YISY AL  N++PC+ RG SYYNC    + NPY RGCS+IT C
Sbjct  70   EFEMDSEINRRILATRRYISYGALRRNTVPCSRRGASYYNCRRGAQANPYRRGCSVITRC  129

Query  36   AR  31
             R
Sbjct  130  RR  131



>ref|XP_006412966.1| hypothetical protein EUTSA_v10026612mg [Eutrema salsugineum]
 gb|ESQ54419.1| hypothetical protein EUTSA_v10026612mg [Eutrema salsugineum]
Length=111

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 44/65 (68%), Gaps = 3/65 (5%)
 Frame = -2

Query  225  EDEEMAMELG--MSRRVLGQTKYISYAALAANS-IPCNARGRSYYNCHTHQKVNPYNRGC  55
            E EEM    G  +SRR+L   +YISY AL  N+ +PC  RGRSYYNC   +K NPY RGC
Sbjct  41   ELEEMRTMTGFDLSRRILKAARYISYNALKKNNNVPCKRRGRSYYNCGKRKKANPYRRGC  100

Query  54   SMITH  40
            S+ITH
Sbjct  101  SVITH  105



>emb|CDX92081.1| BnaA05g23260D [Brassica napus]
Length=127

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -2

Query  216  EMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHC  37
            E  M+  ++RR+L   +YISY AL  NS+PC+ RG SYYNC    + NPY+RGCS+IT C
Sbjct  66   EFEMDSEINRRMLANRRYISYGALRRNSVPCSRRGASYYNCRRGAQANPYSRGCSVITRC  125

Query  36   AR  31
             R
Sbjct  126  RR  127



>ref|XP_009629090.1| PREDICTED: rapid alkalinization factor [Nicotiana tomentosiformis]
 sp|Q945T0.1|RALF_TOBAC RecName: Full=Rapid alkalinization factor; Short=NtRALF; Flags: 
Precursor [Nicotiana tabacum]
 gb|AAL26478.1|AF407278_1 RALF precursor [Nicotiana tabacum]
Length=115

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            C G++   +C+ E+EE  ++   +RR+L   KYISY AL  NS+PC+ RG SYYNC    
Sbjct  41   CKGSI--GECIAEEEEFELDSESNRRILATKKYISYGALQKNSVPCSRRGASYYNCKPGA  98

Query  81   KVNPYNRGCSMITHC  37
            + NPY+RGCS IT C
Sbjct  99   QANPYSRGCSAITRC  113



>ref|XP_010440247.1| PREDICTED: protein RALF-like 33 [Camelina sativa]
Length=122

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -2

Query  195  MSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            ++RR+L  TKYISY AL  N++PC+ RG SYYNC    + NPY+RGCS IT C R
Sbjct  68   INRRILATTKYISYGALKRNTVPCSRRGASYYNCRRGAQANPYSRGCSAITRCRR  122



>ref|XP_002883013.1| hypothetical protein ARALYDRAFT_897975 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59272.1| hypothetical protein ARALYDRAFT_897975 [Arabidopsis lyrata subsp. 
lyrata]
Length=137

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = -2

Query  237  DCVFEDEEMAMELGM----SRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNP  70
            D  +   EM  E  M    +RR+L   +YISY AL  N++PC+ RG SYYNC    + NP
Sbjct  65   DLFYGGGEMGAEFEMDSEINRRILATRRYISYGALRRNTVPCSRRGASYYNCRRGAQANP  124

Query  69   YNRGCSMITHCAR  31
            Y+RGCS IT C R
Sbjct  125  YSRGCSTITRCRR  137



>gb|KDP28133.1| hypothetical protein JCGZ_13904 [Jatropha curcas]
Length=128

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 52/81 (64%), Gaps = 3/81 (4%)
 Frame = -2

Query  279  PTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYY  100
            PTR  +  G++   +C+ E EE+ M+  + RR+L  T+YISYAAL   S+PC+ RG +YY
Sbjct  48   PTRRGQWEGSI--AECIGE-EELDMDSEIHRRILQTTRYISYAALQRGSVPCSHRGATYY  104

Query  99   NCHTHQKVNPYNRGCSMITHC  37
            NC    + N Y RGC+ IT C
Sbjct  105  NCQPGAEANAYTRGCNAITRC  125



>ref|XP_004502245.1| PREDICTED: protein RALF-like 24-like [Cicer arietinum]
 ref|XP_004502246.1| PREDICTED: protein RALF-like 24-like [Cicer arietinum]
Length=132

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 55/94 (59%), Gaps = 7/94 (7%)
 Frame = -2

Query  306  LMVHGNHATPTRPRKCTGNVIGDDCVFEDEEMAMELGMSRRVLG-QTKYISYAALAANSI  130
            L+ H    T    R CT ++   +C+ E E   M+   +RRVL  Q KYISY  L  + +
Sbjct  39   LLKHSEIDTVITKRVCTKSI--GECLTEPE---MDSETNRRVLAMQKKYISYDTLKRDMV  93

Query  129  PCNARGRSYYNCHTHQKVNPYNRGCSMITHCARG  28
            PC+  G SYYNCH  Q  NPY+RGC +IT CARG
Sbjct  94   PCDRAGASYYNCHPRQ-ANPYSRGCEVITACARG  126



>emb|CDM82107.1| unnamed protein product [Triticum aestivum]
Length=127

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 56/90 (62%), Gaps = 9/90 (10%)
 Frame = -2

Query  276  TRPRKCTGNVIGDDCVFEDEEM---AMELGMS-RRVLGQ---TKYISYAALAANSIPCNA  118
            +R   C G  +G+  V EDEEM   A   G + RR L +    +YISYAAL A+ +PCN 
Sbjct  36   SRAATCDG-AVGECGVDEDEEMGTGAYGTGEALRRSLARKPTARYISYAALRADQVPCNK  94

Query  117  RGRSYY-NCHTHQKVNPYNRGCSMITHCAR  31
            R +SYY NC + Q+ NPY RGCS IT CAR
Sbjct  95   RDKSYYTNCGSMQQANPYTRGCSAITRCAR  124



>ref|XP_009775621.1| PREDICTED: rapid alkalinization factor-like [Nicotiana sylvestris]
Length=116

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -2

Query  216  EMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHC  37
            E  M+   +RR+L    YISY AL  N++PC+ RG SYYNC T  + NPY RGCS IT C
Sbjct  55   EFEMDSESNRRILATDDYISYGALQRNTVPCSRRGASYYNCQTGAEANPYTRGCSAITRC  114



>ref|XP_003609670.1| Rapid alkalinization factor [Medicago truncatula]
Length=139

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 3/71 (4%)
 Frame = -2

Query  249  VIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNP  70
            + GD+   +D E  M+   +RR+L   +YISY AL  N++PC+ RG SYYNC    + NP
Sbjct  57   LAGDE---DDSEFMMDSESNRRILAARRYISYGALRRNTVPCSRRGASYYNCRPGAQANP  113

Query  69   YNRGCSMITHC  37
            Y RGCS IT C
Sbjct  114  YRRGCSAITRC  124



>ref|XP_009373554.1| PREDICTED: LOW QUALITY PROTEIN: protein RALF-like 24 [Pyrus x 
bretschneideri]
Length=152

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 46/71 (65%), Gaps = 5/71 (7%)
 Frame = -2

Query  237  DCVFEDEEMAMELGMSRRVLG-QTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNR  61
            +C+ E E   ME   SRR+L  QTKYISY  L  +S+PC   G SYYNCH     NPYNR
Sbjct  85   ECMTEPE---MESESSRRILAMQTKYISYGTLKRDSVPCGTPGASYYNCHA-VAANPYNR  140

Query  60   GCSMITHCARG  28
            GC +IT CARG
Sbjct  141  GCEVITGCARG  151



>gb|KHN20242.1| hypothetical protein glysoja_023805 [Glycine soja]
Length=81

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            C G +   DC    EE  ++  ++RR+L   KYISY AL  N+ PC+ RG SYYNC    
Sbjct  8    CKGTIA--DC-LGGEEYELDSEINRRILATNKYISYVALQRNTAPCSRRGASYYNCRPGA  64

Query  81   KVNPYNRGCSMITHC  37
            + NPY+RGCS IT C
Sbjct  65   QANPYSRGCSAITRC  79



>emb|CAN78122.1| hypothetical protein VITISV_041547 [Vitis vinifera]
Length=65

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = -2

Query  213  MAMELGMSRRVLGQTK-YISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHC  37
            M M+   +RR L Q + YISY AL  N +PCN RGRSYYNC    + NPY RGCS+IT C
Sbjct  1    MMMDSETNRRSLAQRRRYISYGALRRNQVPCNRRGRSYYNCRRGGRANPYRRGCSVITKC  60

Query  36   AR  31
             R
Sbjct  61   HR  62



>ref|XP_004143090.1| PREDICTED: protein RALF-like 33-like [Cucumis sativus]
 ref|XP_004163235.1| PREDICTED: protein RALF-like 33-like [Cucumis sativus]
 gb|KGN47180.1| hypothetical protein Csa_6G194150 [Cucumis sativus]
Length=118

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  216  EMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHC  37
            E  M+  ++RR+L  T+YISY AL  N++PC+ RG SYYNC    + NPY RGCS IT C
Sbjct  57   EFQMDSEINRRILATTRYISYGALRRNNVPCSRRGASYYNCRPGAQANPYTRGCSAITRC  116



>gb|EPS59172.1| rapid alkalinization factor 2, partial [Genlisea aurea]
Length=106

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  225  EDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMI  46
            ED+E+ M+  ++RR+L  T+YISY AL A  +PC  RG SYYNC      NPY R CS I
Sbjct  43   EDDEIRMDSEVNRRILATTRYISYGALQAGIVPCPRRGASYYNCRPGAPANPYTRSCSAI  102

Query  45   THC  37
            T C
Sbjct  103  TQC  105



>gb|KDP27792.1| hypothetical protein JCGZ_18872 [Jatropha curcas]
Length=118

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = -2

Query  249  VIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNP  70
            +I  D  FE E  AM+  ++RR+L    YISY AL  NS+PC+ RG SYYNC    + NP
Sbjct  47   LINGDEDFETE-FAMDSEINRRILATRTYISYGALRRNSVPCSRRGASYYNCRAGAQANP  105

Query  69   YNRGCSMITHC  37
            Y+RGC+ IT C
Sbjct  106  YSRGCNRITRC  116



>ref|XP_007030995.1| Rapid alkalinization factor 1, putative [Theobroma cacao]
 gb|EOY11497.1| Rapid alkalinization factor 1, putative [Theobroma cacao]
Length=118

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            C G++   +C    EE  ++  +SRR+L   +YISY AL  N++PC+ RG SYYNC    
Sbjct  45   CKGSI--AEC-LAGEEFQLDSEISRRILATAQYISYGALQRNTVPCSRRGASYYNCQPGA  101

Query  81   KVNPYNRGCSMITHC  37
            + NPY+RGC+ IT C
Sbjct  102  QANPYSRGCNRITRC  116



>ref|XP_010550987.1| PREDICTED: protein RALF-like 22 [Tarenaya hassleriana]
Length=117

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -2

Query  195  MSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHCAR  31
            +SRR+L   +YISY AL  NS+PC+ RG SYYNC    + NPY+RGCS IT C R
Sbjct  63   ISRRILAMNRYISYGALQRNSVPCSRRGASYYNCRRGAQANPYSRGCSTITRCRR  117



>ref|XP_009604381.1| PREDICTED: rapid alkalinization factor-like [Nicotiana tomentosiformis]
Length=117

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -2

Query  216  EMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHC  37
            E  M+   +RR+L    YISY AL  N++PC+ RG SYYNC T  + NPY RGCS IT C
Sbjct  56   EFEMDSESNRRILATDDYISYGALQRNTVPCSRRGASYYNCQTGAEANPYTRGCSAITRC  115



>ref|XP_003536069.1| PREDICTED: protein RALF-like 1-like [Glycine max]
Length=117

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            C G++   +C    EE  ++  ++RR+L   KYISY AL  N++PC+ RG SYYNC    
Sbjct  44   CKGSI--AEC-LGGEEYELDSEINRRILATNKYISYGALQRNTVPCSRRGASYYNCRPGA  100

Query  81   KVNPYNRGCSMITHC  37
            + NPY+RGCS IT C
Sbjct  101  QANPYSRGCSAITRC  115



>gb|KHN31786.1| hypothetical protein glysoja_050399, partial [Glycine soja]
Length=86

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            C G +   DC    EE  ++  ++RR+L   KYISY AL  N+ PC+ RG SYYNC    
Sbjct  13   CKGTIA--DC-LGGEEYELDSEINRRILATNKYISYVALQRNTAPCSRRGASYYNCRPGA  69

Query  81   KVNPYNRGCSMITHC  37
            + NPY+RGCS IT C
Sbjct  70   QANPYSRGCSAITRC  84



>ref|XP_006433408.1| hypothetical protein CICLE_v10002897mg [Citrus clementina]
 ref|XP_006472087.1| PREDICTED: protein RALF-like 33-like [Citrus sinensis]
 gb|ESR46648.1| hypothetical protein CICLE_v10002897mg [Citrus clementina]
Length=112

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -2

Query  195  MSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQKVNPYNRGCSMITHC  37
            ++RR+L   KYISY AL  N++PC+ RG SYYNC    + NPYNRGCS IT C
Sbjct  58   INRRILATNKYISYGALQRNTVPCSRRGASYYNCQNGGQANPYNRGCSAITRC  110



>ref|XP_008454184.1| PREDICTED: protein RALF-like 33 [Cucumis melo]
Length=121

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 3/75 (4%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            C G++   +C F  EE   +  ++RR+L  ++YISY AL  N++PC+ RG SYYNC    
Sbjct  48   CKGSI--AEC-FGGEEFEFDSEINRRILATSQYISYGALRRNNVPCSRRGASYYNCQPGA  104

Query  81   KVNPYNRGCSMITHC  37
            + NPY+RGC+ IT C
Sbjct  105  QANPYSRGCNAITRC  119



>ref|XP_008775576.1| PREDICTED: protein RALF-like 33 [Phoenix dactylifera]
Length=119

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            C G +   +C+   EE  +   ++RR+L  + YISY AL  N++PC+ RG SYYNC    
Sbjct  46   CQGTIA--ECL-AGEEFDLSSDVARRMLATSNYISYNALKRNNVPCSRRGASYYNCRPGA  102

Query  81   KVNPYNRGCSMITHCAR  31
            + NPYNRGCS IT C R
Sbjct  103  QANPYNRGCSAITRCRR  119



>ref|XP_010921813.1| PREDICTED: protein RALF-like 33 [Elaeis guineensis]
Length=123

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = -2

Query  261  CTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTHQ  82
            C G +   +C+   EE  ++  +SRR+L  ++YISY AL  +S PC+ RG SYYNC    
Sbjct  50   CQGTI--AECL-AGEEFELDSEISRRILATSRYISYDALRRDSTPCSRRGASYYNCRPGA  106

Query  81   KVNPYNRGCSMITHCAR  31
              NPY+RGCS IT C R
Sbjct  107  HANPYSRGCSAITRCRR  123



>ref|XP_008789920.1| PREDICTED: protein RALF-like 33 [Phoenix dactylifera]
Length=126

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 3/78 (4%)
 Frame = -2

Query  264  KCTGNVIGDDCVFEDEEMAMELGMSRRVLGQTKYISYAALAANSIPCNARGRSYYNCHTH  85
            +C G V   +C+  DE   +E  +SRR+L   +YISY +L   S+PC+ RG SYYNC   
Sbjct  52   ECRGTV--AECIAGDE-FELESEISRRILAFRRYISYNSLRRGSVPCSRRGASYYNCRPG  108

Query  84   QKVNPYNRGCSMITHCAR  31
               NPY+RGCS IT C R
Sbjct  109  AHANPYSRGCSAITRCRR  126



>gb|KDP38641.1| hypothetical protein JCGZ_03994 [Jatropha curcas]
Length=114

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 48/80 (60%), Gaps = 5/80 (6%)
 Frame = -2

Query  258  TGNVIGDDCVFEDEEMAMELGMSRRVLGQ----TKYISYAALAANSIPCNARGRSYYNCH  91
            T  ++GD+ + EDEEM ++   + R+L       K++SY  L AN+ PC  RG SYY C 
Sbjct  33   TRKLVGDE-INEDEEMMVDSEATHRLLAGRRKFKKFLSYDVLKANATPCKKRGNSYYGCR  91

Query  90   THQKVNPYNRGCSMITHCAR  31
               K NPY RGCS+IT C R
Sbjct  92   VKTKANPYRRGCSVITLCYR  111



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507948461360