BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18296_g1_i3 len=491 path=[1889:0-79 533:80-123 577:124-490]

Length=491
                                                                      Score     E

ref|XP_006350142.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    169   1e-49   
ref|XP_004251782.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    167   4e-49   
ref|XP_009759906.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    164   1e-47   
ref|XP_009607181.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    160   4e-46   
emb|CBI18994.3|  unnamed protein product                                147   3e-41   
ref|XP_010664190.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    147   3e-41   
ref|XP_010664189.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    148   4e-41   
gb|EYU20581.1|  hypothetical protein MIMGU_mgv1a014065mg                139   7e-38   
ref|XP_006383587.1|  hypothetical protein POPTR_0005s20250g             135   5e-37   
ref|XP_007019133.1|  RING/U-box superfamily protein, putative           135   4e-36   
ref|XP_004173830.1|  PREDICTED: uncharacterized LOC101217935            134   8e-36   
ref|XP_004149804.1|  PREDICTED: uncharacterized protein LOC101217935    134   8e-36   
ref|XP_011027491.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    134   9e-36   
ref|XP_004502478.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    135   1e-35   
ref|XP_008466738.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    134   1e-35   
ref|XP_004502471.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    135   2e-35   
ref|XP_011003433.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    133   2e-35   
gb|KDP32837.1|  hypothetical protein JCGZ_12129                         133   2e-35   
ref|XP_002300971.2|  zinc finger family protein                         133   3e-35   Populus trichocarpa [western balsam poplar]
ref|XP_003602037.1|  RING finger protein                                133   3e-35   
ref|XP_009587082.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    128   1e-34   
ref|XP_010667359.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    131   2e-34   
ref|XP_002520340.1|  ring finger protein, putative                      130   3e-34   Ricinus communis
ref|XP_007137421.1|  hypothetical protein PHAVU_009G125700g             129   1e-33   
emb|CDY67192.1|  BnaA06g38750D                                          128   2e-33   
ref|XP_006596212.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    127   3e-33   
ref|XP_003544702.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    127   3e-33   
gb|KHN21712.1|  E3 ubiquitin ligase BIG BROTHER-related                 125   8e-33   
ref|NP_001235447.1|  uncharacterized protein LOC100526881               126   9e-33   
gb|KHN05193.1|  E3 ubiquitin ligase BIG BROTHER-related                 126   1e-32   
ref|XP_009150236.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    125   2e-32   
ref|XP_003542148.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    124   4e-32   
gb|ACU24020.1|  unknown                                                 124   6e-32   Glycine max [soybeans]
ref|XP_010065007.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    124   1e-31   
ref|XP_008347746.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    124   1e-31   
ref|XP_006292300.1|  hypothetical protein CARUB_v10018510mg             123   2e-31   
ref|XP_010277675.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    122   2e-31   
emb|CDX77848.1|  BnaC03g53710D                                          122   3e-31   
ref|XP_010530207.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    123   3e-31   
ref|XP_009379051.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    122   4e-31   
ref|XP_009347272.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    122   4e-31   
ref|NP_190302.1|  C3HC4 type RING finger protein                        122   5e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009376874.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    122   6e-31   
ref|XP_010426169.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    122   6e-31   
ref|XP_007226705.1|  hypothetical protein PRUPE_ppa020151mg             121   7e-31   
ref|XP_007161474.1|  hypothetical protein PHAVU_001G072100g             121   7e-31   
ref|XP_010515040.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    121   7e-31   
ref|XP_002877551.1|  zinc finger family protein                         121   8e-31   
ref|XP_008338661.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    121   1e-30   
ref|XP_004290892.1|  PREDICTED: uncharacterized protein LOC101313173    121   1e-30   
ref|XP_010503329.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    120   1e-30   
ref|XP_008219608.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    120   3e-30   
ref|XP_002445741.1|  hypothetical protein SORBIDRAFT_07g024936          115   1e-29   Sorghum bicolor [broomcorn]
ref|XP_006404408.1|  hypothetical protein EUTSA_v10010717mg             118   1e-29   
ref|XP_010277674.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    117   3e-29   
ref|XP_010261280.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    117   1e-28   
ref|XP_002445744.1|  hypothetical protein SORBIDRAFT_07g024950          117   3e-28   Sorghum bicolor [broomcorn]
gb|KFK32642.1|  hypothetical protein AALP_AA6G269700                    119   3e-28   
ref|XP_010245103.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    114   5e-28   
ref|XP_004974139.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    115   6e-28   
ref|XP_004231468.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    115   7e-28   
gb|KDP37529.1|  hypothetical protein JCGZ_05968                         115   1e-27   
ref|XP_010688664.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    115   1e-27   
ref|XP_010095417.1|  Proteasome subunit beta type-3-A                   118   1e-27   
ref|XP_006365590.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    115   1e-27   
ref|XP_010688665.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    115   1e-27   
ref|XP_009622651.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    115   1e-27   
ref|NP_001131853.1|  uncharacterized LOC100193231                       114   1e-27   Zea mays [maize]
gb|ACG31571.1|  hypothetical protein                                    114   2e-27   Zea mays [maize]
ref|XP_006859208.1|  hypothetical protein AMTR_s00070p00189230          114   2e-27   
ref|XP_009775151.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    114   2e-27   
gb|KDO80559.1|  hypothetical protein CISIN_1g044318mg                   112   2e-27   
ref|XP_011002254.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    114   3e-27   
ref|XP_011002252.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    114   3e-27   
dbj|BAK04753.1|  predicted protein                                      114   3e-27   
ref|XP_011002253.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    114   3e-27   
ref|XP_006472813.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    112   4e-27   
ref|XP_010655908.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    113   8e-27   
ref|XP_003574899.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    112   9e-27   
ref|XP_010235389.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    112   9e-27   
ref|XP_010655907.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    112   1e-26   
ref|NP_001062434.1|  Os08g0548300                                       112   1e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659662.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    112   1e-26   
ref|XP_006661480.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    111   1e-26   
gb|EAZ07897.1|  hypothetical protein OsI_30152                          112   2e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_002310069.1|  zinc finger family protein                         112   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_008445883.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    112   2e-26   
ref|XP_009587083.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    106   3e-26   
ref|XP_010932524.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    111   3e-26   
ref|XP_006851962.1|  hypothetical protein AMTR_s00041p00192380          110   5e-26   
ref|XP_003578515.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    111   5e-26   
ref|XP_004143619.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    110   6e-26   
ref|XP_002521533.1|  ring finger protein, putative                      110   7e-26   Ricinus communis
emb|CDP14406.1|  unnamed protein product                                110   8e-26   
dbj|BAJ88925.1|  predicted protein                                      110   8e-26   
ref|XP_008795341.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    109   1e-25   
gb|EMS64698.1|  E3 ubiquitin ligase BIG BROTHER-related protein         108   1e-25   
gb|KHG29072.1|  E3 ubiquitin ligase BIG BROTHER-related -like pro...    108   2e-25   
ref|XP_010906327.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    108   3e-25   
ref|XP_009395387.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    108   3e-25   
ref|XP_007043263.1|  RING/U-box superfamily protein                     109   3e-25   
ref|XP_006437609.1|  hypothetical protein CICLE_v10032094mg             108   3e-25   
gb|AAM61025.1|  unknown                                                 108   4e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566651.1|  E3 ubiquitin ligase BIG BROTHER-like protein          108   5e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KDO52706.1|  hypothetical protein CISIN_1g019980mg                   108   5e-25   
ref|XP_004957470.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    108   5e-25   
gb|KFK39312.1|  hypothetical protein AALP_AA3G228600                    108   5e-25   
ref|XP_010466157.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    108   6e-25   
ref|XP_010487948.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    108   6e-25   
ref|XP_010487949.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    108   6e-25   
ref|XP_002883210.1|  zinc finger family protein                         108   6e-25   
ref|XP_010508204.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    108   6e-25   
gb|KHG07975.1|  E3 ubiquitin ligase BIG BROTHER-related -like pro...    105   7e-25   
ref|XP_011070448.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    107   9e-25   
ref|XP_010112544.1|  E3 ubiquitin ligase BIG BROTHER-related protein    107   1e-24   
tpg|DAA40634.1|  TPA: putative RING zinc finger domain superfamil...    107   1e-24   
ref|XP_006382946.1|  hypothetical protein POPTR_0005s09300g             107   1e-24   
ref|XP_006382945.1|  hypothetical protein POPTR_0005s09300g             107   1e-24   
ref|XP_008243095.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    107   1e-24   
ref|XP_007202272.1|  hypothetical protein PRUPE_ppa008876mg             107   1e-24   
ref|XP_009366273.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    107   1e-24   
ref|XP_008789253.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    106   2e-24   
ref|XP_009366271.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    107   2e-24   
ref|XP_006406443.1|  hypothetical protein EUTSA_v10021098mg             107   2e-24   
emb|CDY33429.1|  BnaC01g32960D                                          107   2e-24   
ref|XP_009111410.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    106   2e-24   
ref|XP_001769627.1|  predicted protein                                  106   2e-24   
emb|CDY42218.1|  BnaA01g25770D                                          106   2e-24   
gb|EPS72594.1|  hypothetical protein M569_02164                         102   2e-24   
gb|EEC84951.1|  hypothetical protein OsI_32172                          106   2e-24   Oryza sativa Indica Group [Indian rice]
ref|NP_001063778.1|  Os09g0535100                                       106   2e-24   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001149296.1|  LOC100282919                                       106   3e-24   Zea mays [maize]
ref|XP_006298094.1|  hypothetical protein CARUB_v10014137mg             106   4e-24   
ref|XP_002460573.1|  hypothetical protein SORBIDRAFT_02g031050          105   4e-24   Sorghum bicolor [broomcorn]
ref|XP_011022025.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    105   4e-24   
ref|XP_011022026.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    105   4e-24   
ref|XP_008383698.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    105   4e-24   
ref|XP_008383690.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    105   5e-24   
ref|XP_008461284.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER i...    104   5e-24   
gb|KGN45134.1|  hypothetical protein Csa_7G428220                       104   6e-24   
ref|NP_001150748.1|  protein binding protein                            105   6e-24   Zea mays [maize]
tpg|DAA62493.1|  TPA: putative RING zinc finger domain superfamil...    105   6e-24   
ref|XP_008461282.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER i...    104   6e-24   
emb|CDX93901.1|  BnaC04g20600D                                          103   6e-24   
ref|XP_009392890.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    104   7e-24   
ref|XP_009138675.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER i...    103   7e-24   
ref|XP_009138670.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER i...    103   9e-24   
ref|XP_009145730.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    104   1e-23   
gb|KDO52705.1|  hypothetical protein CISIN_1g019980mg                   104   1e-23   
emb|CDY25357.1|  BnaA05g19270D                                          104   1e-23   
ref|XP_008394237.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    103   2e-23   
gb|EYU20483.1|  hypothetical protein MIMGU_mgv1a013375mg                102   2e-23   
ref|XP_009138669.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER i...    103   2e-23   
ref|XP_006482888.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    102   2e-23   
ref|XP_009395284.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    103   2e-23   
ref|XP_006482886.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    102   3e-23   
gb|KDP43466.1|  hypothetical protein JCGZ_16753                         102   4e-23   
ref|XP_006439127.1|  hypothetical protein CICLE_v10032570mg             102   4e-23   
ref|XP_006292296.1|  hypothetical protein CARUB_v10018505mg             101   5e-23   
emb|CDP07764.1|  unnamed protein product                                102   5e-23   
gb|EYU35575.1|  hypothetical protein MIMGU_mgv1a010240mg                102   5e-23   
ref|XP_008364357.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    101   5e-23   
gb|ADE77661.1|  unknown                                                 102   7e-23   
ref|XP_007132006.1|  hypothetical protein PHAVU_011G058800g             101   7e-23   
ref|NP_680148.1|  E3 ubiquitin ligase BIG BROTHER                       101   8e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CDY24595.1|  BnaC05g32790D                                          102   9e-23   
ref|XP_008231277.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER         100   1e-22   
ref|XP_006591894.1|  PREDICTED: uncharacterized protein LOC100805...    100   1e-22   
ref|XP_004142225.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    100   1e-22   
ref|XP_010536033.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    100   1e-22   
ref|XP_003558702.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER i...    100   1e-22   
ref|XP_004507101.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    100   1e-22   
gb|KGN54171.1|  hypothetical protein Csa_4G290860                       100   1e-22   
ref|XP_008449726.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    100   1e-22   
ref|XP_006590306.1|  PREDICTED: uncharacterized protein LOC100793...    100   2e-22   
ref|NP_001242079.1|  uncharacterized protein LOC100793907               100   2e-22   
ref|XP_008449725.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    100   2e-22   
ref|XP_002531910.1|  protein binding protein, putative                  100   2e-22   Ricinus communis
ref|XP_010413127.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    100   2e-22   
ref|NP_001242183.1|  uncharacterized protein LOC100805963             99.0    2e-22   
ref|XP_009418697.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    100   2e-22   
ref|XP_009397505.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    100   2e-22   
ref|XP_002878521.1|  hypothetical protein ARALYDRAFT_324777             100   2e-22   
ref|XP_010512780.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER         100   2e-22   
ref|XP_007218202.1|  hypothetical protein PRUPE_ppa010554mg           99.8    2e-22   
ref|XP_009375062.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  99.8    3e-22   
ref|XP_009364991.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  99.8    3e-22   
ref|XP_003606782.1|  E3 ubiquitin-protein ligase                      99.8    3e-22   
ref|XP_003606783.1|  E3 ubiquitin-protein ligase                      99.4    3e-22   
ref|XP_003592713.1|  RING finger protein                                100   4e-22   
ref|XP_010229112.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER i...  99.4    4e-22   
gb|ACJ85919.1|  unknown                                                 100   4e-22   Medicago truncatula
ref|XP_003592714.1|  RING finger protein                                100   4e-22   
gb|AES88979.2|  E3 ubiquitin ligase BIG brother-like protein          99.4    4e-22   
gb|AES88980.2|  E3 ubiquitin ligase BIG brother-like protein          99.4    4e-22   
gb|AFW65659.1|  putative RING zinc finger domain superfamily protein  99.8    4e-22   
ref|XP_004165039.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  97.1    4e-22   
gb|AFK44486.1|  unknown                                               99.4    4e-22   
gb|EPS58031.1|  hypothetical protein M569_16786                       95.9    5e-22   
ref|XP_011042092.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  99.0    5e-22   
ref|XP_007052540.1|  RING/U-box superfamily protein isoform 1         99.0    5e-22   
ref|XP_002303894.2|  hypothetical protein POPTR_0003s20350g           99.0    6e-22   Populus trichocarpa [western balsam poplar]
ref|XP_010031812.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  99.0    6e-22   
gb|AFK40026.1|  unknown                                               96.7    7e-22   
ref|XP_004151219.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  97.4    8e-22   
ref|XP_009376879.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  98.6    8e-22   
ref|XP_002299947.2|  hypothetical protein POPTR_0001s27470g           98.6    8e-22   Populus trichocarpa [western balsam poplar]
ref|XP_009355176.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  98.6    8e-22   
ref|XP_008349929.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  98.2    9e-22   
ref|XP_007142774.1|  hypothetical protein PHAVU_007G015800g           99.4    9e-22   
dbj|BAJ88799.1|  predicted protein                                    96.7    9e-22   
ref|XP_008349923.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  98.2    9e-22   
ref|NP_001131757.1|  LOC100193125                                     96.7    1e-21   Zea mays [maize]
ref|XP_008450441.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  98.2    1e-21   
ref|XP_010255520.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER       98.2    1e-21   
ref|NP_001049123.1|  Os03g0173900                                     98.2    1e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAC10211.1|  E3 ubiquitin ligase BIG BROTHER-related protein      97.8    1e-21   Cicer arietinum [garbanzo]
ref|XP_004287200.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  98.6    1e-21   
ref|XP_004985526.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  97.8    1e-21   
ref|XP_006649482.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  97.8    1e-21   
ref|XP_009354734.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  97.8    2e-21   
ref|XP_008778611.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  95.9    2e-21   
gb|EAY88740.1|  hypothetical protein OsI_10215                        98.6    2e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_002468417.1|  hypothetical protein SORBIDRAFT_01g045580        97.8    2e-21   Sorghum bicolor [broomcorn]
ref|XP_010936603.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER       97.8    2e-21   
dbj|BAK04699.1|  predicted protein                                    97.8    2e-21   
ref|XP_003536731.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  98.6    2e-21   
ref|XP_011087589.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER       97.4    2e-21   
gb|EEE58414.1|  hypothetical protein OsJ_09608                        97.8    2e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EMT12530.1|  RING finger protein 44                                98.2    2e-21   
ref|XP_011011041.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  97.4    2e-21   
ref|XP_004497226.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  98.2    2e-21   
ref|XP_004497227.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  98.2    2e-21   
gb|KHN23096.1|  E3 ubiquitin ligase BIG BROTHER-related               98.2    2e-21   
ref|XP_003555846.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  98.2    3e-21   
ref|XP_003555845.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  97.8    3e-21   
gb|ACJ86011.1|  unknown                                               97.8    3e-21   Medicago truncatula
ref|NP_001140719.1|  uncharacterized LOC100272794                     97.1    3e-21   Zea mays [maize]
gb|ACU23155.1|  unknown                                               97.1    3e-21   Glycine max [soybeans]
gb|EYU27063.1|  hypothetical protein MIMGU_mgv1a012318mg              97.1    3e-21   
gb|KGN66475.1|  hypothetical protein Csa_1G613470                     96.7    3e-21   
ref|XP_002462697.1|  hypothetical protein SORBIDRAFT_02g030410        95.5    3e-21   Sorghum bicolor [broomcorn]
ref|XP_010246935.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  96.7    4e-21   
ref|XP_007150374.1|  hypothetical protein PHAVU_005G148200g           96.7    4e-21   
gb|EEE70120.1|  hypothetical protein OsJ_30137                        97.1    5e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009354732.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  96.3    5e-21   
gb|EMS63320.1|  E3 ubiquitin ligase BIG BROTHER                       97.1    5e-21   
ref|XP_009354730.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  96.3    5e-21   
ref|XP_008375171.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER       96.3    5e-21   
ref|XP_008651491.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  96.3    5e-21   
gb|ABK26080.1|  unknown                                               96.7    5e-21   Picea sitchensis
ref|XP_010032421.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  96.3    6e-21   
ref|XP_002279794.2|  PREDICTED: E3 ubiquitin ligase BIG BROTHER       96.3    6e-21   Vitis vinifera
gb|AIZ68183.1|  E3 ubiquitin ligase BIG BROTHER-like protein          96.3    6e-21   
ref|XP_007133839.1|  hypothetical protein PHAVU_011G213300g           95.9    7e-21   
ref|XP_003540530.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  95.9    8e-21   
ref|XP_004510966.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  95.9    8e-21   
ref|XP_009396390.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  95.9    8e-21   
gb|KEH19070.1|  E3 ubiquitin ligase BIG brother-like protein          95.5    1e-20   
ref|XP_008227150.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  95.5    1e-20   
ref|XP_010673617.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  95.5    1e-20   
ref|NP_001148727.1|  LOC100282343                                     95.5    1e-20   Zea mays [maize]
ref|XP_007213834.1|  hypothetical protein PRUPE_ppa010371mg           95.5    1e-20   
ref|XP_007014997.1|  RING/U-box superfamily protein isoform 1         95.5    1e-20   
ref|XP_003542854.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  95.5    1e-20   
gb|KHG02120.1|  E3 ubiquitin ligase BIG BROTHER -like protein         95.1    1e-20   
ref|XP_009599844.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  95.1    1e-20   
ref|XP_010257293.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  95.1    1e-20   
ref|XP_009763746.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  95.1    1e-20   
ref|XP_010031808.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  91.7    2e-20   
ref|XP_004957408.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  93.6    2e-20   
ref|XP_004306531.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  95.1    2e-20   
gb|KHN19446.1|  E3 ubiquitin ligase BIG BROTHER                       95.5    2e-20   
ref|XP_006345461.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  94.7    2e-20   
gb|ABR17882.1|  unknown                                               94.4    3e-20   Picea sitchensis
ref|XP_006850185.1|  hypothetical protein AMTR_s00022p00246320        94.7    3e-20   
emb|CDP05240.1|  unnamed protein product                              94.0    3e-20   
gb|KDP22078.1|  hypothetical protein JCGZ_25909                       94.0    3e-20   
gb|EMT04037.1|  RING-H2 finger protein ATL3F                          94.4    4e-20   
ref|XP_006356379.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  94.0    4e-20   
ref|XP_009414750.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  94.4    4e-20   
ref|XP_004250877.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  94.0    4e-20   
ref|XP_009394740.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  93.6    4e-20   
ref|XP_009394737.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  94.0    5e-20   
ref|XP_008800799.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  93.6    5e-20   
ref|XP_009394739.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  94.0    5e-20   
ref|XP_004291799.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  93.6    5e-20   
ref|XP_011080278.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  93.6    6e-20   
ref|XP_009624975.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  93.6    6e-20   
ref|XP_009622995.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  93.2    6e-20   
emb|CDP18780.1|  unnamed protein product                              93.2    6e-20   
ref|XP_009769401.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  93.2    7e-20   
ref|XP_007150376.1|  hypothetical protein PHAVU_005G148200g           92.8    7e-20   
gb|EYU46268.1|  hypothetical protein MIMGU_mgv1a012496mg              93.2    8e-20   
ref|XP_010238402.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  91.7    8e-20   
ref|XP_003578472.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  91.7    1e-19   
ref|XP_006470593.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  92.8    1e-19   
ref|XP_002299230.1|  hypothetical protein POPTR_0001s05710g           92.8    1e-19   
ref|XP_002285497.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER       92.4    1e-19   
ref|NP_001063719.1|  Os09g0525400                                     90.9    2e-19   
ref|XP_010527674.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  92.4    2e-19   
ref|XP_010324408.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER i...  92.8    2e-19   
ref|XP_011099668.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  88.2    2e-19   
ref|XP_010695299.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER       91.7    3e-19   
ref|XP_006660863.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  90.1    3e-19   
ref|XP_011025427.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  91.7    3e-19   
ref|XP_010934460.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  91.3    3e-19   
ref|XP_002313299.2|  hypothetical protein POPTR_0009s06680g           90.9    4e-19   
gb|EPS68702.1|  hypothetical protein M569_06065                       87.8    4e-19   
ref|XP_003633258.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  90.5    5e-19   
ref|XP_002282713.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  90.9    5e-19   
ref|XP_010919236.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  91.3    5e-19   
ref|XP_010933875.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  90.9    5e-19   
ref|XP_010919239.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  91.3    5e-19   
ref|XP_011037811.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  90.5    7e-19   
gb|KCW65071.1|  hypothetical protein EUGRSUZ_G02582                   90.5    9e-19   
ref|NP_001131721.1|  uncharacterized protein LOC100193086             90.1    1e-18   
ref|XP_008667134.1|  PREDICTED: uncharacterized protein LOC100193...  90.1    1e-18   
ref|XP_010067008.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  90.5    1e-18   
gb|EMT14836.1|  RING finger protein 44                                89.7    1e-18   
ref|XP_008383707.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  89.7    2e-18   
ref|XP_005650352.1|  hypothetical protein COCSUDRAFT_60820            93.2    2e-18   
ref|XP_002983644.1|  hypothetical protein SELMODRAFT_19194            85.5    3e-18   
ref|XP_002317370.2|  zinc finger family protein                       91.3    3e-18   
dbj|BAG92476.1|  unnamed protein product                              89.0    3e-18   
dbj|BAH56825.1|  AT3G63530                                            88.6    3e-18   
emb|CAD41576.3|  OSJNBa0088I22.8                                      89.0    3e-18   
emb|CAH67282.1|  OSIGBa0111L12.9                                      88.6    3e-18   
gb|EAY95219.1|  hypothetical protein OsI_17037                        89.0    3e-18   
ref|XP_003580354.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  88.6    3e-18   
ref|XP_002883900.1|  zinc finger family protein                       91.7    3e-18   
ref|XP_010906570.1|  PREDICTED: probable E3 ubiquitin-protein lig...  91.7    3e-18   
ref|NP_001053604.1|  Os04g0571200                                     88.6    4e-18   
ref|XP_008789252.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  88.6    5e-18   
gb|KDO83394.1|  hypothetical protein CISIN_1g026092mg                 87.8    6e-18   
ref|XP_008651502.1|  PREDICTED: protein binding protein isoform X2    88.2    6e-18   
ref|XP_002446955.1|  hypothetical protein SORBIDRAFT_06g025850        87.8    6e-18   
ref|XP_006495092.1|  PREDICTED: uncharacterized protein LOC102621...  90.1    7e-18   
ref|XP_006451752.1|  hypothetical protein CICLE_v10007976mg           90.1    8e-18   
dbj|BAK01921.1|  predicted protein                                    87.4    8e-18   
emb|CAE01827.2|  OSJNBa0041A02.20                                     88.2    1e-17   
ref|XP_008651501.1|  PREDICTED: protein binding protein isoform X1    87.8    1e-17   
ref|XP_010536035.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  87.0    1e-17   
ref|XP_011101177.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  86.7    1e-17   
ref|XP_007014999.1|  RING/U-box superfamily protein isoform 3         86.7    2e-17   
emb|CDP05971.1|  unnamed protein product                              89.0    2e-17   
ref|XP_003541829.1|  PREDICTED: uncharacterized protein LOC100800642  88.6    2e-17   
ref|XP_009612485.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  85.9    2e-17   
ref|XP_004507099.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  86.3    2e-17   
ref|XP_009615957.1|  PREDICTED: uncharacterized protein LOC104108...  88.6    3e-17   
ref|XP_009615954.1|  PREDICTED: uncharacterized protein LOC104108...  88.6    3e-17   
ref|XP_004976537.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  85.9    3e-17   
ref|XP_009767003.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  85.9    3e-17   
ref|XP_008226444.1|  PREDICTED: uncharacterized protein LOC103326020  88.6    3e-17   
ref|XP_007212380.1|  hypothetical protein PRUPE_ppa003782mg           88.6    3e-17   
ref|XP_010317579.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  85.5    3e-17   
ref|XP_006857887.1|  hypothetical protein AMTR_s00069p00114060        85.9    4e-17   
ref|XP_006652662.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  85.5    4e-17   
ref|XP_010447158.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  88.2    5e-17   
ref|XP_002282878.1|  PREDICTED: uncharacterized protein LOC100264059  87.8    6e-17   
ref|XP_008795395.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  85.1    6e-17   
ref|XP_008795391.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  85.1    6e-17   
ref|XP_011008298.1|  PREDICTED: E3 ubiquitin-protein ligase arkad...  87.4    6e-17   
ref|NP_179155.1|  RING/U-box domain-containing protein                87.8    7e-17   
ref|XP_011076491.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  84.7    8e-17   
gb|EMS50286.1|  E3 ubiquitin ligase BIG BROTHER                       84.0    1e-16   
ref|XP_010437676.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2 ...  87.4    1e-16   
ref|XP_010437680.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2 ...  87.4    1e-16   
ref|XP_007160476.1|  hypothetical protein PHAVU_002G325200g           85.1    1e-16   
ref|XP_010088242.1|  hypothetical protein L484_012525                 87.0    1e-16   
ref|XP_006283256.1|  hypothetical protein CARUB_v10004296mg           87.0    1e-16   
ref|XP_006283257.1|  hypothetical protein CARUB_v10004296mg           87.0    1e-16   
ref|XP_006412283.1|  hypothetical protein EUTSA_v10024583mg           87.0    1e-16   
gb|ACU20643.1|  unknown                                               82.0    1e-16   
ref|XP_011038901.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1-...  86.7    1e-16   
ref|XP_006370029.1|  hypothetical protein POPTR_0001s38280g           86.7    1e-16   
ref|XP_008378025.1|  PREDICTED: E3 ubiquitin-protein ligase arkad...  87.0    1e-16   
ref|XP_008378024.1|  PREDICTED: uncharacterized protein LOC103441...  87.0    1e-16   
ref|XP_010693485.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  84.0    1e-16   
gb|KDO60069.1|  hypothetical protein CISIN_1g045064mg                 82.0    1e-16   
ref|XP_004294077.1|  PREDICTED: uncharacterized protein LOC101312325  86.7    1e-16   
ref|XP_003627695.1|  E3 ubiquitin-protein ligase Arkadia              84.0    2e-16   
ref|XP_010517416.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1 ...  86.7    2e-16   
ref|XP_010517398.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1 ...  86.7    2e-16   
gb|AFA26144.1|  E3 ubiquitin ligase big-brother-like protein          80.5    2e-16   
gb|AET02171.2|  E3 ubiquitin ligase BIG brother, putative             84.0    2e-16   
ref|XP_002867137.1|  zinc finger family protein                       86.7    2e-16   
ref|XP_008220246.1|  PREDICTED: uncharacterized protein LOC103320352  86.7    2e-16   
ref|XP_007225192.1|  hypothetical protein PRUPE_ppa002107mg           86.7    2e-16   
gb|KEH38658.1|  zinc finger, C3HC4 type (RING finger) protein         85.9    2e-16   
ref|XP_006587489.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  84.0    2e-16   
ref|XP_010540364.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  86.3    2e-16   
ref|XP_010540360.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  86.3    2e-16   
ref|XP_010432474.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  86.3    2e-16   
ref|XP_009762157.1|  PREDICTED: uncharacterized protein LOC104214213  85.9    3e-16   
gb|KHG14993.1|  E3 ubiquitin ligase BIG BROTHER -like protein         85.5    3e-16   
ref|XP_006652769.1|  PREDICTED: uncharacterized protein LOC102712...  84.0    3e-16   
ref|XP_008367657.1|  PREDICTED: E3 ubiquitin-protein ligase arkad...  85.9    3e-16   
ref|XP_008367658.1|  PREDICTED: E3 ubiquitin-protein ligase arkad...  85.9    3e-16   
gb|KHN44580.1|  E3 ubiquitin ligase BIG BROTHER-related               84.0    3e-16   
ref|XP_010102330.1|  hypothetical protein L484_015278                 83.2    3e-16   
ref|XP_004489089.1|  PREDICTED: RING finger protein 44-like           85.1    4e-16   
gb|ACN31440.1|  unknown                                               82.0    4e-16   
ref|NP_001147890.1|  LOC100281500                                     85.5    4e-16   
gb|KHN23749.1|  E3 ubiquitin ligase BIG BROTHER-related               84.0    4e-16   
ref|XP_004248251.1|  PREDICTED: uncharacterized protein LOC101263764  85.1    4e-16   
ref|XP_009359854.1|  PREDICTED: probable E3 ubiquitin-protein lig...  85.9    4e-16   
ref|XP_009359841.1|  PREDICTED: probable E3 ubiquitin-protein lig...  85.9    4e-16   
ref|NP_001152137.1|  protein binding protein                          81.6    4e-16   
gb|KHN21637.1|  E3 ubiquitin ligase BIG BROTHER                       83.6    4e-16   
ref|XP_002518375.1|  ring finger protein, putative                    85.1    4e-16   
ref|XP_010461481.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  85.5    4e-16   
emb|CDX69813.1|  BnaA10g21620D                                        85.1    4e-16   
ref|XP_010488964.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1-...  80.9    4e-16   
emb|CDP01312.1|  unnamed protein product                              85.5    4e-16   
ref|XP_008663067.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  81.3    4e-16   
ref|XP_006360055.1|  PREDICTED: uncharacterized protein LOC102588...  85.1    4e-16   
emb|CDX78393.1|  BnaA03g03050D                                        84.7    4e-16   
ref|XP_003530039.1|  PREDICTED: uncharacterized protein LOC100807785  83.2    5e-16   
ref|XP_010279213.1|  PREDICTED: uncharacterized protein LOC104613187  85.1    5e-16   
ref|XP_002873468.1|  zinc finger family protein                       84.7    5e-16   
ref|XP_009122034.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  84.7    5e-16   
ref|XP_010488963.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1-...  85.1    5e-16   
ref|NP_195130.1|  RING/U-box superfamily protein                      85.1    6e-16   
emb|CAE02518.2|  OSJNBb0003A12.5                                      85.1    6e-16   
emb|CAH65886.1|  OSIGBa0148J22.5                                      85.1    6e-16   
ref|XP_011082723.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1      84.7    6e-16   
ref|XP_009758408.1|  PREDICTED: uncharacterized protein LOC104211...  84.7    6e-16   
ref|XP_009758406.1|  PREDICTED: uncharacterized protein LOC104211...  84.7    6e-16   
ref|NP_001141674.1|  uncharacterized protein LOC100273800             84.7    7e-16   
ref|XP_002451554.1|  hypothetical protein SORBIDRAFT_04g003650        84.3    7e-16   
ref|XP_006652918.1|  PREDICTED: uncharacterized protein LOC102709835  84.7    7e-16   
ref|XP_009119409.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1      84.7    7e-16   
ref|NP_001052192.1|  Os04g0185500                                     85.1    7e-16   
ref|XP_007021617.1|  Ring finger protein, putative isoform 1          84.3    7e-16   
ref|XP_006852545.1|  hypothetical protein AMTR_s00021p00189960        84.3    7e-16   
ref|XP_007149419.1|  hypothetical protein PHAVU_005G068800g           84.3    7e-16   
ref|NP_001148380.1|  LOC100281993                                     82.4    8e-16   
ref|XP_008655108.1|  PREDICTED: protein binding protein isoform X2    82.8    8e-16   
emb|CDY17114.1|  BnaC06g00470D                                        84.3    8e-16   
ref|XP_009131171.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  84.0    8e-16   
sp|Q7XTV7.2|HIP1_ORYSJ  RecName: Full=Probable E3 ubiquitin-prote...  84.7    9e-16   
ref|XP_010919085.1|  PREDICTED: uncharacterized protein LOC105043...  84.3    9e-16   
ref|XP_010541856.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  82.4    9e-16   
ref|XP_010928343.1|  PREDICTED: probable E3 ubiquitin-protein lig...  84.7    1e-15   
ref|XP_010928342.1|  PREDICTED: probable E3 ubiquitin-protein lig...  84.7    1e-15   
ref|XP_009395494.1|  PREDICTED: probable E3 ubiquitin-protein lig...  84.3    1e-15   
ref|XP_006655556.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  80.9    1e-15   
ref|XP_006280121.1|  hypothetical protein CARUB_v10026015mg           84.3    1e-15   
ref|XP_009798737.1|  PREDICTED: probable E3 ubiquitin-protein lig...  84.0    1e-15   
ref|XP_002988343.1|  hypothetical protein SELMODRAFT_447294           84.3    1e-15   
ref|XP_010919076.1|  PREDICTED: uncharacterized protein LOC105043...  84.0    1e-15   
ref|XP_009336167.1|  PREDICTED: probable E3 ubiquitin-protein lig...  84.0    1e-15   
ref|XP_008811558.1|  PREDICTED: probable E3 ubiquitin-protein lig...  83.6    1e-15   
ref|XP_008811557.1|  PREDICTED: probable E3 ubiquitin-protein lig...  84.0    1e-15   
ref|XP_010473673.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  81.3    1e-15   
emb|CAN79375.1|  hypothetical protein VITISV_014611                   84.0    1e-15   
gb|KDP36261.1|  hypothetical protein JCGZ_09826                       84.0    1e-15   
ref|XP_010919014.1|  PREDICTED: uncharacterized protein LOC105043...  84.0    1e-15   
ref|XP_003525211.2|  PREDICTED: uncharacterized protein LOC100788837  83.2    1e-15   
ref|XP_010906571.1|  PREDICTED: probable E3 ubiquitin-protein lig...  84.3    1e-15   
ref|XP_008811553.1|  PREDICTED: probable E3 ubiquitin-protein lig...  83.6    1e-15   
ref|XP_009396260.1|  PREDICTED: probable E3 ubiquitin-protein lig...  84.0    1e-15   
ref|XP_006393660.1|  hypothetical protein EUTSA_v10011314mg           84.0    1e-15   
ref|XP_007134874.1|  hypothetical protein PHAVU_010G083200g           80.1    1e-15   
ref|XP_009396259.1|  PREDICTED: probable E3 ubiquitin-protein lig...  84.0    1e-15   
ref|XP_010479079.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  84.0    1e-15   
ref|XP_010653005.1|  PREDICTED: uncharacterized protein LOC104879941  83.6    1e-15   
ref|XP_010675444.1|  PREDICTED: probable E3 ubiquitin-protein lig...  83.6    1e-15   
ref|XP_010500194.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  84.0    2e-15   
ref|XP_002946544.1|  hypothetical protein VOLCADRAFT_86603            79.3    2e-15   
ref|XP_003530938.1|  PREDICTED: uncharacterized protein LOC100819...  82.0    2e-15   
gb|KHG28620.1|  E3 ubiquitin ligase BIG BROTHER-related               84.0    2e-15   
tpg|DAA35698.1|  TPA: putative RING zinc finger domain superfamil...  79.3    2e-15   
gb|KHN16504.1|  E3 ubiquitin ligase BIG BROTHER                       82.0    2e-15   
ref|XP_010442736.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  80.5    2e-15   
ref|XP_004977034.1|  PREDICTED: uncharacterized protein LOC101771165  83.6    2e-15   
ref|XP_002991447.1|  hypothetical protein SELMODRAFT_448412           83.2    2e-15   
ref|XP_006353353.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  80.5    2e-15   
ref|XP_006342462.1|  PREDICTED: uncharacterized protein DDB_G0271...  83.2    2e-15   
ref|XP_010324381.1|  PREDICTED: uncharacterized protein LOC101248...  83.6    2e-15   
ref|XP_003580036.1|  PREDICTED: probable E3 ubiquitin-protein lig...  83.6    2e-15   
ref|XP_001690515.1|  hypothetical protein CHLREDRAFT_161785           80.1    2e-15   
emb|CDX97032.1|  BnaC09g45930D                                        81.3    2e-15   
ref|XP_006304873.1|  hypothetical protein CARUB_v10012632mg           83.2    2e-15   
ref|XP_009418514.1|  PREDICTED: probable E3 ubiquitin-protein lig...  83.6    2e-15   
ref|XP_006409547.1|  hypothetical protein EUTSA_v10022580mg           83.6    2e-15   
ref|XP_010239610.1|  PREDICTED: probable E3 ubiquitin-protein lig...  83.6    2e-15   
ref|XP_010519597.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1-...  82.8    2e-15   
ref|XP_010324380.1|  PREDICTED: uncharacterized protein LOC101248...  83.6    2e-15   
ref|NP_001169344.1|  uncharacterized LOC100383211                     83.2    3e-15   
ref|XP_006584888.1|  PREDICTED: uncharacterized protein LOC100819...  81.6    3e-15   
ref|XP_009123238.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1-...  83.2    3e-15   
ref|NP_001189530.1|  RING/U-box domain-containing protein             83.6    3e-15   
ref|XP_007199723.1|  hypothetical protein PRUPE_ppa002397mg           83.2    3e-15   
emb|CDY71882.1|  BnaAnng39150D                                        81.3    3e-15   
ref|XP_009107452.1|  PREDICTED: probable E3 ubiquitin-protein lig...  82.8    3e-15   
emb|CDY43220.1|  BnaC08g04930D                                        82.8    3e-15   
ref|XP_011038595.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  78.6    3e-15   
ref|XP_011017179.1|  PREDICTED: probable E3 ubiquitin-protein lig...  83.2    3e-15   



>ref|XP_006350142.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Solanum 
tuberosum]
Length=177

 Score =   169 bits (428),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELIALGE VGVE+RGL+E EI KSLH STFQS  SKTLVD+CVVCQLEY+EGE
Sbjct  76   PDELSYEELIALGEFVGVENRGLTEEEINKSLHSSTFQSNNSKTLVDKCVVCQLEYEEGE  135

Query  287  KLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
            KLVALPCDHPYH +CI  WLQIKKVCPICS+EVSS   P+
Sbjct  136  KLVALPCDHPYHLDCIKKWLQIKKVCPICSDEVSSTNVPK  175



>ref|XP_004251782.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Solanum 
lycopersicum]
Length=179

 Score =   167 bits (424),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELIALGE VGVE+RGL+E EI KSLH STFQS  SKTLV++CVVCQLEY+EGE
Sbjct  78   PDELSYEELIALGEFVGVENRGLTEEEINKSLHSSTFQSNNSKTLVNKCVVCQLEYEEGE  137

Query  287  KLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPRIL  412
            KLVALPCDHPYH +CI  WLQIKKVCPICS+EVSS   P+ L
Sbjct  138  KLVALPCDHPYHLDCIKKWLQIKKVCPICSDEVSSTNVPKEL  179



>ref|XP_009759906.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Nicotiana 
sylvestris]
Length=179

 Score =   164 bits (415),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +2

Query  116  LSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEKLV  295
            LSYEELIALGE VGVE+RGLSEAEI+K LH STFQS +SKTL+DRCVVCQLEY+EGE LV
Sbjct  81   LSYEELIALGEFVGVENRGLSEAEISKHLHSSTFQSNSSKTLIDRCVVCQLEYEEGENLV  140

Query  296  ALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSP  403
            ALPCDHPYH +CI  WLQIKK+CPICS+EVSS   P
Sbjct  141  ALPCDHPYHSDCIQKWLQIKKICPICSDEVSSTDVP  176



>ref|XP_009607181.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Nicotiana 
tomentosiformis]
Length=179

 Score =   160 bits (405),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +2

Query  116  LSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEKLV  295
            LSYEELIALGE VGVE+RGLSEAEI+K LH  TFQS +SKTL+DRCVVCQLEY+EGE LV
Sbjct  81   LSYEELIALGEFVGVENRGLSEAEISKHLHSYTFQSNSSKTLIDRCVVCQLEYEEGENLV  140

Query  296  ALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
            AL CDHPYH +CI  WLQIKK+CPICS+EVSS   P+
Sbjct  141  ALSCDHPYHSDCIQKWLQIKKICPICSDEVSSTDVPK  177



>emb|CBI18994.3| unnamed protein product [Vitis vinifera]
Length=188

 Score =   147 bits (372),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELIALGE+VG ESRGLS  EI+ SL P T  SL SKT VDRCV+CQ+EY+E E
Sbjct  92   PDQLSYEELIALGEIVGEESRGLSMEEISASLRPYTCHSLRSKTAVDRCVICQVEYEEEE  151

Query  287  KLVALPCDHPYHCECITTWLQIKKVCPICSEEVSS  391
            KLVALPC+HPYH +CIT WLQIKK CPICS EVSS
Sbjct  152  KLVALPCEHPYHADCITKWLQIKKTCPICSTEVSS  186



>ref|XP_010664190.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X2 
[Vitis vinifera]
Length=189

 Score =   147 bits (372),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELIALGE+VG ESRGLS  EI+ SL P T  SL SKT VDRCV+CQ+EY+E E
Sbjct  93   PDQLSYEELIALGEIVGEESRGLSMEEISASLRPYTCHSLRSKTAVDRCVICQVEYEEEE  152

Query  287  KLVALPCDHPYHCECITTWLQIKKVCPICSEEVSS  391
            KLVALPC+HPYH +CIT WLQIKK CPICS EVSS
Sbjct  153  KLVALPCEHPYHADCITKWLQIKKTCPICSTEVSS  187



>ref|XP_010664189.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X1 
[Vitis vinifera]
Length=207

 Score =   148 bits (373),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELIALGE+VG ESRGLS  EI+ SL P T  SL SKT VDRCV+CQ+EY+E E
Sbjct  111  PDQLSYEELIALGEIVGEESRGLSMEEISASLRPYTCHSLRSKTAVDRCVICQVEYEEEE  170

Query  287  KLVALPCDHPYHCECITTWLQIKKVCPICSEEVSS  391
            KLVALPC+HPYH +CIT WLQIKK CPICS EVSS
Sbjct  171  KLVALPCEHPYHADCITKWLQIKKTCPICSTEVSS  205



>gb|EYU20581.1| hypothetical protein MIMGU_mgv1a014065mg [Erythranthe guttata]
Length=202

 Score =   139 bits (351),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELIALGE+VGVE+RGLSEAEI K L+P      T+  L+DRCV+CQ+EY++G+
Sbjct  89   PDELSYEELIALGEMVGVENRGLSEAEINKHLNPIILCQSTTNLLIDRCVICQVEYEKGD  148

Query  287  KLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAK  397
            KLV L CDHPYH +CI  WLQIKK+CPIC+ EV+  +
Sbjct  149  KLVTLGCDHPYHGDCIAKWLQIKKICPICNNEVTRVE  185



>ref|XP_006383587.1| hypothetical protein POPTR_0005s20250g, partial [Populus trichocarpa]
 gb|ERP61384.1| hypothetical protein POPTR_0005s20250g, partial [Populus trichocarpa]
Length=125

 Score =   135 bits (339),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +2

Query  119  SYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEKLVA  298
            SYEELIALGE +G E RGLS  EI+  LHP  ++SL +KT  DRCV+CQ+EY+E E LVA
Sbjct  29   SYEELIALGEFIGQEKRGLSVNEISTCLHPWKYRSLANKTGTDRCVICQMEYEEDESLVA  88

Query  299  LPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            L CDHPYH EC+T WLQI K+CPICS EVSSA
Sbjct  89   LSCDHPYHSECLTKWLQINKICPICSTEVSSA  120



>ref|XP_007019133.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOY16358.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=205

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = +2

Query  116  LSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEKLV  295
            LSYEELIALGE++GVE RGLS+ EI+  L P  FQS+   T +DRC +CQ+EY+E E +V
Sbjct  106  LSYEELIALGEIIGVERRGLSQNEISSCLIPWKFQSVKCNTGIDRCAICQMEYEEEEGVV  165

Query  296  ALP-CDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
            ALP C+HPYH ECI+ WLQIK++CPICS E+SS+K+ R
Sbjct  166  ALPNCEHPYHSECISKWLQIKRICPICSTEISSSKNAR  203



>ref|XP_004173830.1| PREDICTED: uncharacterized LOC101217935 [Cucumis sativus]
Length=217

 Score =   134 bits (338),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +2

Query  110  DLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEK  289
            D L+YEELIALGE +G E RGL   EI   LH S FQ++ +++ +DRCV+CQ+EYD+GE+
Sbjct  117  DELTYEELIALGEFIGEEKRGLPINEIPSCLHSSKFQTIENRSGIDRCVICQVEYDDGEE  176

Query  290  LVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
            L ALPC+HPYH ECI  WLQIK+VCPIC  EVSS    +
Sbjct  177  LAALPCEHPYHSECIGEWLQIKRVCPICGTEVSSPNGSK  215



>ref|XP_004149804.1| PREDICTED: uncharacterized protein LOC101217935 [Cucumis sativus]
 gb|KGN47704.1| hypothetical protein Csa_6G382920 [Cucumis sativus]
Length=217

 Score =   134 bits (338),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +2

Query  110  DLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEK  289
            D L+YEELIALGE +G E RGL   EI   LH S FQ++ +++ +DRCV+CQ+EYD+GE+
Sbjct  117  DELTYEELIALGEFIGEEKRGLPINEIPSCLHSSKFQTIENRSGIDRCVICQVEYDDGEE  176

Query  290  LVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
            L ALPC+HPYH ECI  WLQIK+VCPIC  EVSS    +
Sbjct  177  LAALPCEHPYHSECIGEWLQIKRVCPICGTEVSSPNGSK  215



>ref|XP_011027491.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Populus 
euphratica]
Length=210

 Score =   134 bits (337),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +2

Query  116  LSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEKLV  295
            LSYE+LIALGE +G E RGLS  EI+  L P  ++S  SKT  DRCV+CQ+EY+E E LV
Sbjct  114  LSYEDLIALGEFIGQEKRGLSRNEISACLRPCNYESSASKTGTDRCVICQMEYEEDESLV  173

Query  296  ALPCDHPYHCECITTWLQIKKVCPICSEEVSS  391
            AL CDHPYH ECIT WLQI K+CPIC+ EVSS
Sbjct  174  ALSCDHPYHSECITNWLQINKICPICTTEVSS  205



>ref|XP_004502478.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X8 [Cicer arietinum]
Length=260

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 80/102 (78%), Gaps = 3/102 (3%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELI LGEL+G E RGLS  EI+  L+  T Q+  SK+ +DRCV+CQ+EY++GE
Sbjct  159  PDELSYEELIELGELIGDEKRGLSANEISSCLNSYTSQTAESKSGIDRCVICQIEYEKGE  218

Query  287  KLVALPCDHPYHCECITTWLQIKKVCPICSEEVSS---AKSP  403
             LVAL CDHPYH +CI+ WLQIKKVCPICS EVS+   AK+P
Sbjct  219  ALVALQCDHPYHKDCISKWLQIKKVCPICSNEVSTPNKAKNP  260



>ref|XP_008466738.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Cucumis 
melo]
Length=228

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +2

Query  110  DLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEK  289
            D L+YEELIALGE +G E RGL   EI   LH S FQ++ +K+ +DRCV+CQ+EYD+GE+
Sbjct  128  DELTYEELIALGEFIGEEKRGLPINEIPSCLHSSKFQTIENKSGIDRCVICQVEYDDGEE  187

Query  290  LVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
            L ALPC HPYH ECI  WLQIK+VCPIC  EVSS    +
Sbjct  188  LAALPCQHPYHSECIGEWLQIKRVCPICGTEVSSPNGSK  226



>ref|XP_004502471.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Cicer arietinum]
 ref|XP_004502472.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Cicer arietinum]
 ref|XP_004502473.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X3 [Cicer arietinum]
 ref|XP_004502474.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X4 [Cicer arietinum]
 ref|XP_004502475.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X5 [Cicer arietinum]
 ref|XP_004502476.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X6 [Cicer arietinum]
 ref|XP_004502477.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X7 [Cicer arietinum]
Length=287

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 80/102 (78%), Gaps = 3/102 (3%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELI LGEL+G E RGLS  EI+  L+  T Q+  SK+ +DRCV+CQ+EY++GE
Sbjct  186  PDELSYEELIELGELIGDEKRGLSANEISSCLNSYTSQTAESKSGIDRCVICQIEYEKGE  245

Query  287  KLVALPCDHPYHCECITTWLQIKKVCPICSEEVSS---AKSP  403
             LVAL CDHPYH +CI+ WLQIKKVCPICS EVS+   AK+P
Sbjct  246  ALVALQCDHPYHKDCISKWLQIKKVCPICSNEVSTPNKAKNP  287



>ref|XP_011003433.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Populus 
euphratica]
Length=206

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +2

Query  116  LSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEKLV  295
            LSYEELIALGE +G E RGLS  EI+  LHP  ++SL +KT  D CV+CQ+EY+E E LV
Sbjct  107  LSYEELIALGEFIGQEKRGLSVNEISTCLHPWKYRSLATKTGTDLCVICQMEYEEDESLV  166

Query  296  ALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            AL CDHPYH EC+T WLQI ++CPICS EVSS ++
Sbjct  167  ALSCDHPYHSECLTKWLQINRICPICSTEVSSPRN  201



>gb|KDP32837.1| hypothetical protein JCGZ_12129 [Jatropha curcas]
Length=211

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +2

Query  116  LSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEKLV  295
            LSYEELIALGE +G E RGLS  EI+K L P   + + +K+ +DRCV+CQ+EY+  E LV
Sbjct  111  LSYEELIALGEFIGEEKRGLSMDEISKCLKPFKHKCVENKSGIDRCVICQVEYEGDESLV  170

Query  296  ALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
            ALPCDHPYH ECI+ WLQIKK+CPIC+ EVSS K  R
Sbjct  171  ALPCDHPYHSECISNWLQIKKICPICNSEVSSPKIVR  207



>ref|XP_002300971.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE80244.2| zinc finger family protein [Populus trichocarpa]
Length=210

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +2

Query  116  LSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEKLV  295
            LSYE+LIALGE VG E RGLS  EI+  L P  ++SL SKT  DRCV+CQ+EY+E E LV
Sbjct  114  LSYEDLIALGEFVGQEKRGLSRNEISTCLRPCKYESLASKTGTDRCVICQMEYEEDESLV  173

Query  296  ALPCDHPYHCECITTWLQIKKVCPICSEEVSS  391
            AL CDHPYH ECI  WLQI K+CPIC+ EVSS
Sbjct  174  ALSCDHPYHPECIANWLQINKICPICTTEVSS  205



>ref|XP_003602037.1| RING finger protein [Medicago truncatula]
 gb|AES72288.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=211

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELI LG  +G E RGL   EI+  LHP T +   S + +DRCV+CQ+EY+EGE
Sbjct  110  PDELSYEELIELGNFIGEEKRGLPANEISSCLHPYTSKIAESTSGIDRCVICQIEYEEGE  169

Query  287  KLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
             LVAL CDHPYH +CI+ WLQIKKVCPICS EVS+    +
Sbjct  170  SLVALHCDHPYHTDCISKWLQIKKVCPICSNEVSTTNKAK  209



>ref|XP_009587082.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X1 [Nicotiana 
tomentosiformis]
Length=95

 Score =   128 bits (321),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  173  LSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEKLVALPCDHPYHCECITTWLQI  352
            LSEAEI K LH  TFQS  SKTL+DRCVVCQ+EY+EGEKLVALPCDHP+H +CI  WLQI
Sbjct  16   LSEAEIRKYLHSFTFQSNNSKTLIDRCVVCQMEYEEGEKLVALPCDHPFHSDCINKWLQI  75

Query  353  KKVCPICSEEVSSAKSPR  406
            KK+CPIC +EVSS K PR
Sbjct  76   KKICPICCDEVSSTKFPR  93



>ref|XP_010667359.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Beta 
vulgaris subsp. vulgaris]
Length=222

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD +SYEEL+ALGE+VG E RGLS  EI  S+ P   + + SKT++DRCV+CQ+EY+EGE
Sbjct  120  PDEMSYEELMALGEIVGEECRGLSIEEINSSISPYNHKFVQSKTIIDRCVICQIEYEEGE  179

Query  287  KLVALPCDHPYHCECITTWLQIKKVCPICSEEVS  388
            +LVAL C HP+H +CI  WLQIKKVCPICS E++
Sbjct  180  QLVALNCQHPFHTDCINQWLQIKKVCPICSIEIT  213



>ref|XP_002520340.1| ring finger protein, putative [Ricinus communis]
 gb|EEF42126.1| ring finger protein, putative [Ricinus communis]
Length=213

 Score =   130 bits (327),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 80/100 (80%), Gaps = 3/100 (3%)
 Frame = +2

Query  116  LSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEKLV  295
            LSYEEL+ALGE +G E RGLS  EI+K L+PS ++S+ +K+ +DRCV+CQ+EY  GE LV
Sbjct  114  LSYEELLALGEFIGEEKRGLSIEEISKCLNPSKYKSVENKSEIDRCVICQVEYQGGEPLV  173

Query  296  A-LPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPRIL  412
            + LPC HPYH ECI  WLQ+KK+CPIC+ EVSS  SP+++
Sbjct  174  SLLPCQHPYHSECIINWLQVKKICPICTTEVSS--SPKLV  211



>ref|XP_007137421.1| hypothetical protein PHAVU_009G125700g [Phaseolus vulgaris]
 gb|ESW09415.1| hypothetical protein PHAVU_009G125700g [Phaseolus vulgaris]
Length=202

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEEL+ LGE +G E+RGLS  EI+  L+P T+     K  +DRCV+CQ+EY++GE
Sbjct  101  PDELSYEELMELGEFIGEETRGLSANEISLCLNPYTYYCADRKIGIDRCVICQVEYEDGE  160

Query  287  KLVALPCDHPYHCECITTWLQIKKVCPICSEEVSS  391
             LVAL C+HPYH +CI+ WLQIKKVCPICS EVS+
Sbjct  161  ALVALQCEHPYHADCISKWLQIKKVCPICSNEVST  195



>emb|CDY67192.1| BnaA06g38750D [Brassica napus]
Length=213

 Score =   128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 73/95 (77%), Gaps = 1/95 (1%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELIALGE +GVE RGL++ EI+  L PS+++   +K  +DRCVVCQ+E++EGE
Sbjct  117  PDQLSYEELIALGEFIGVEKRGLTQTEISTCLKPSSYEFSHNKNEIDRCVVCQMEFEEGE  176

Query  287  KLVALP-CDHPYHCECITTWLQIKKVCPICSEEVS  388
             LV L  C+HPYH ECIT WLQ KKVCPIC  E S
Sbjct  177  SLVVLRLCNHPYHSECITKWLQTKKVCPICGSEPS  211



>ref|XP_006596212.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Glycine max]
Length=203

 Score =   127 bits (320),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +2

Query  116  LSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEKLV  295
            L+YEELI LG+ +G E RGLS  EI   LH  TF S  +K+ +DRCV+CQ+EY+EGE LV
Sbjct  109  LTYEELIELGDFIGQEKRGLSAHEICSCLHSHTFHSAENKSGIDRCVICQVEYEEGESLV  168

Query  296  ALPCDHPYHCECITTWLQIKKVCPICSEEVSSAK  397
            A+ C+HPYH +CI+ WLQIKKVCPIC+ E+S+ K
Sbjct  169  AIQCEHPYHTDCISKWLQIKKVCPICNIEISAPK  202



>ref|XP_003544702.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Glycine max]
 gb|KHN33975.1| E3 ubiquitin ligase BIG BROTHER-related [Glycine soja]
Length=205

 Score =   127 bits (320),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +2

Query  116  LSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEKLV  295
            L+YEELI LG+ +G E RGLS  EI   LH  TF S  +K+ +DRCV+CQ+EY+EGE LV
Sbjct  109  LTYEELIELGDFIGQEKRGLSAHEICSCLHSHTFHSAENKSGIDRCVICQVEYEEGESLV  168

Query  296  ALPCDHPYHCECITTWLQIKKVCPICSEEVSSAK  397
            A+ C+HPYH +CI+ WLQIKKVCPIC+ E+S+ K
Sbjct  169  AIQCEHPYHTDCISKWLQIKKVCPICNIEISAPK  202



>gb|KHN21712.1| E3 ubiquitin ligase BIG BROTHER-related [Glycine soja]
Length=175

 Score =   125 bits (315),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +2

Query  110  DLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEK  289
            D LSYEEL+ L E +G E+RGLS  EI+  L+P T Q   SK+ +DRCV+CQ+EY+EGE 
Sbjct  75   DELSYEELMELEEFIGEETRGLSANEISLCLYPYTCQCAESKSGIDRCVICQVEYEEGEA  134

Query  290  LVALPCDHPYHCECITTWLQIKKVCPICSEEVSS  391
            LVAL C+HPYH +CI+ WLQIKKVCPICS EVS+
Sbjct  135  LVALQCEHPYHSDCISKWLQIKKVCPICSNEVST  168



>ref|NP_001235447.1| uncharacterized protein LOC100526881 [Glycine max]
 gb|ACU15889.1| unknown [Glycine max]
 gb|KHN47017.1| E3 ubiquitin ligase BIG BROTHER-related [Glycine soja]
Length=202

 Score =   126 bits (317),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEEL+ L E +G E+RGLS  EI+  L+P T Q   SK+ +DRCV+CQ+EY+EGE
Sbjct  101  PDELSYEELMELEEFIGEETRGLSANEISLCLYPYTCQCAESKSGIDRCVICQVEYEEGE  160

Query  287  KLVALPCDHPYHCECITTWLQIKKVCPICSEEVSS  391
             LVAL C+HPYH +CI  WLQIKKVCPIC  EVS+
Sbjct  161  ALVALQCEHPYHSDCIRKWLQIKKVCPICGNEVST  195



>gb|KHN05193.1| E3 ubiquitin ligase BIG BROTHER-related [Glycine soja]
Length=203

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +2

Query  110  DLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEK  289
            D L+YEELI LG+ +G E RGLS  EI   LH   F S  +K+ +DRCV+CQ+EY+EGE 
Sbjct  105  DELTYEELIELGDFIGQEKRGLSAHEICSCLHIHIFHSAENKSGIDRCVICQVEYEEGEP  164

Query  290  LVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAK  397
            LVA+ C+HPYH +CI+ WLQIKKVCPIC+ E+S+ K
Sbjct  165  LVAIQCEHPYHTDCISKWLQIKKVCPICNTEISAPK  200



>ref|XP_009150236.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Brassica 
rapa]
Length=217

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELIALGE +GVE RGL++ EI+  L PS++    +K  +DRCVVCQ+E++EGE
Sbjct  121  PDQLSYEELIALGEFIGVEKRGLTQIEISTCLKPSSYVFSHNKNEIDRCVVCQMEFEEGE  180

Query  287  KLVALP-CDHPYHCECITTWLQIKKVCPICSEEVS  388
             LV L  C+HPYH ECIT WLQ KKVCPIC  E S
Sbjct  181  SLVVLRLCNHPYHSECITKWLQTKKVCPICGSEPS  215



>ref|XP_003542148.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Glycine 
max]
Length=203

 Score =   124 bits (312),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +2

Query  116  LSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEKLV  295
            L+YEELI LG+ +G E RGLS  EI   LH   F S  +K+ +DRCV+CQ+EY+EGE LV
Sbjct  107  LTYEELIELGDFIGQEKRGLSAHEICSCLHIHIFHSAENKSGIDRCVICQVEYEEGEPLV  166

Query  296  ALPCDHPYHCECITTWLQIKKVCPICSEEVSSAK  397
            A+ C+HPYH +CI+ WLQIKKVCPIC+ E+S+ K
Sbjct  167  AIQCEHPYHTDCISKWLQIKKVCPICNTEISAPK  200



>gb|ACU24020.1| unknown [Glycine max]
Length=203

 Score =   124 bits (311),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +2

Query  116  LSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEKLV  295
            L+YEELI LG+ +G E RGLS  EI   LH   F S  +K+ +DRCV+CQ+EY+EGE LV
Sbjct  107  LTYEELIELGDFIGQEKRGLSAHEICSCLHIHIFHSAENKSGIDRCVICQVEYEEGELLV  166

Query  296  ALPCDHPYHCECITTWLQIKKVCPICSEEVSSAK  397
            A+ C+HPYH +CI+ WLQIKKVCPIC+ E+S+ K
Sbjct  167  AIQCEHPYHTDCISKWLQIKKVCPICNTEISAPK  200



>ref|XP_010065007.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Eucalyptus 
grandis]
 gb|KCW70633.1| hypothetical protein EUGRSUZ_F03807 [Eucalyptus grandis]
Length=233

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 74/102 (73%), Gaps = 5/102 (5%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTS----KTLVDRCVVCQLEY  274
            PD LSYEELI LGE++G E RGLS  +I K   P TFQS ++       +DRCV+CQ+EY
Sbjct  128  PDELSYEELIELGEIIGEERRGLSLEQIGKCFGPFTFQSQSAVERKMGAIDRCVICQIEY  187

Query  275  DEGEKLVALP-CDHPYHCECITTWLQIKKVCPICSEEVSSAK  397
            +EGEKLV L  CDH YH ECIT WLQ+KK CPICS EVS+ K
Sbjct  188  EEGEKLVILDSCDHSYHSECITQWLQVKKTCPICSTEVSAPK  229



>ref|XP_008347746.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Malus 
domestica]
Length=216

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 69/94 (73%), Gaps = 2/94 (2%)
 Frame = +2

Query  110  DLLSYEELIALGELVGVESRGLSEAEITKSLHPST--FQSLTSKTLVDRCVVCQLEYDEG  283
            D L+YEE +ALGE +G E RGL  +EI+  LHP T       SKT +DRCVVCQLEYD+G
Sbjct  111  DELTYEEFLALGEFIGEEKRGLPRSEISACLHPYTCELAVGQSKTXIDRCVVCQLEYDDG  170

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
            E L AL C+HPYH ECI+ WLQIKK CPICS +V
Sbjct  171  ESLAALSCEHPYHWECISQWLQIKKSCPICSTQV  204



>ref|XP_006292300.1| hypothetical protein CARUB_v10018510mg [Capsella rubella]
 gb|EOA25198.1| hypothetical protein CARUB_v10018510mg [Capsella rubella]
Length=215

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELIALG+ +GVE RGL+  EI+  L+ ST+    +K  +DRCVVCQ+E++E E
Sbjct  113  PDQLSYEELIALGDFIGVEKRGLTPTEISTCLNASTYVHSNNKNEIDRCVVCQMEFEERE  172

Query  287  KLVAL-PCDHPYHCECITTWLQIKKVCPICSEEVS  388
             LV L PCDHPYH ECIT WL+ KK+CPIC  E S
Sbjct  173  SLVVLRPCDHPYHSECITKWLETKKICPICCSEPS  207



>ref|XP_010277675.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X2 
[Nelumbo nucifera]
Length=203

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = +2

Query  116  LSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTS-KTLVDRCVVCQLEYDEGEKL  292
            LSYEELIALGE+VG  ++GL    +T  LHP  F+  +  K  +DRCV+CQ+EY+EGE L
Sbjct  99   LSYEELIALGEIVGKVNKGLPADAVTALLHPYEFKCQSECKNGLDRCVICQVEYEEGESL  158

Query  293  VALPCDHPYHCECITTWLQIKKVCPICSEEVSSAK  397
            VALPC+HPYH +CI+ WLQIK+VCPICS EVS ++
Sbjct  159  VALPCEHPYHSDCISKWLQIKRVCPICSTEVSPSE  193



>emb|CDX77848.1| BnaC03g53710D [Brassica napus]
Length=212

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELIALGE +GVE RGL++ EI+  L PS++    +K  +DRCVVCQ+E++EGE
Sbjct  116  PDQLSYEELIALGEFIGVEKRGLTQTEISTCLKPSSYVFSHNKNEIDRCVVCQMEFEEGE  175

Query  287  KLVALP-CDHPYHCECITTWLQIKKVCPICSEEVS  388
             LV L  C+H YH ECIT WLQ KKVCPIC  E S
Sbjct  176  SLVILRLCNHSYHSECITKWLQTKKVCPICGSEPS  210



>ref|XP_010530207.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Tarenaya 
hassleriana]
 ref|XP_010530208.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Tarenaya 
hassleriana]
 ref|XP_010530209.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Tarenaya 
hassleriana]
 ref|XP_010530210.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Tarenaya 
hassleriana]
Length=234

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELIALGE +GVE RGL   EI+  L+   + S   K  +DRCVVCQ+E+ EGE
Sbjct  132  PDELSYEELIALGEFIGVEKRGLDPGEISTCLNEFKYVSSQIKNGIDRCVVCQMEFQEGE  191

Query  287  KLVAL-PCDHPYHCECITTWLQIKKVCPICSEEVSS  391
             LV L PCDHPYH EC+T WL+ KK+CPIC  E SS
Sbjct  192  SLVILRPCDHPYHSECVTKWLRTKKICPICGSEPSS  227



>ref|XP_009379051.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Pyrus 
x bretschneideri]
 ref|XP_009379052.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Pyrus 
x bretschneideri]
Length=204

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +2

Query  110  DLLSYEELIALGELVGVESRGLSEAEITKSLHPST--FQSLTSKTLVDRCVVCQLEYDEG  283
            D L++EEL+ALGE +G E RGL  +EI++ LHP T       SKT +DRCVVCQLEYD+G
Sbjct  111  DELTFEELLALGEFIGEEKRGLPSSEISECLHPYTCELAVGQSKTSIDRCVVCQLEYDDG  170

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
            E L AL C HPYH ECI+ WLQIKK CPICS +V
Sbjct  171  ESLAALSCGHPYHWECISQWLQIKKSCPICSTQV  204



>ref|XP_009347272.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Pyrus 
x bretschneideri]
Length=203

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 69/94 (73%), Gaps = 2/94 (2%)
 Frame = +2

Query  110  DLLSYEELIALGELVGVESRGLSEAEITKSLHPST--FQSLTSKTLVDRCVVCQLEYDEG  283
            D L+YEEL+ LGE +G E RGL  +EI++ LHP T       SKT +DRCVVCQLEYD+G
Sbjct  110  DELTYEELLGLGEFIGEEKRGLPSSEISECLHPYTCELAVGQSKTSIDRCVVCQLEYDDG  169

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
            E L AL C HPYH ECI+ WLQIKK CPICS +V
Sbjct  170  ESLAALSCGHPYHWECISQWLQIKKSCPICSTQV  203



>ref|NP_190302.1| C3HC4 type RING finger protein [Arabidopsis thaliana]
 emb|CAB61964.1| zinc-finger-like protein [Arabidopsis thaliana]
 gb|AAS65938.1| At3g47180 [Arabidopsis thaliana]
 gb|AAS88778.1| At3g47180 [Arabidopsis thaliana]
 gb|AEE78252.1| C3HC4 type RING finger protein [Arabidopsis thaliana]
Length=210

 Score =   122 bits (305),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELIALG+ +GVE+RGL+  EI+  L+ ST+    +K  +DRCVVCQ+E++E E
Sbjct  114  PDQLSYEELIALGDFIGVENRGLTPIEISTCLNASTYVFSHNKNEIDRCVVCQMEFEERE  173

Query  287  KLVAL-PCDHPYHCECITTWLQIKKVCPICSEEVS  388
             LV L PCDHPYH ECIT WL+ KK+CPIC  E S
Sbjct  174  SLVVLRPCDHPYHSECITKWLETKKICPICCSEPS  208



>ref|XP_009376874.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Pyrus 
x bretschneideri]
Length=215

 Score =   122 bits (305),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +2

Query  110  DLLSYEELIALGELVGVESRGLSEAEITKSLHPST--FQSLTSKTLVDRCVVCQLEYDEG  283
            D L+YEEL+ALGE +G E RGL  +EI+  LHP T       SKT +DRCVVCQ+EY++G
Sbjct  110  DELTYEELLALGEFIGEEKRGLPSSEISTCLHPYTCKLAVDQSKTSIDRCVVCQIEYEDG  169

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
            E L AL C+HPYH ECI+ WLQIKK CPICS EV
Sbjct  170  ELLAALSCEHPYHWECISQWLQIKKSCPICSTEV  203



>ref|XP_010426169.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Camelina 
sativa]
Length=213

 Score =   122 bits (305),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELIALG+ +GVE RGL+  EI+  L+ ST+    +K  +DRCVVCQ+E++E E
Sbjct  117  PDQLSYEELIALGDFIGVEKRGLTPTEISTCLNASTYVFSNNKNEIDRCVVCQMEFEERE  176

Query  287  KLVAL-PCDHPYHCECITTWLQIKKVCPICSEEVS  388
             LV L PCDHPYH +CIT WL+ KK+CPIC  E S
Sbjct  177  SLVVLRPCDHPYHSDCITKWLETKKICPICCSEPS  211



>ref|XP_007226705.1| hypothetical protein PRUPE_ppa020151mg [Prunus persica]
 gb|EMJ27904.1| hypothetical protein PRUPE_ppa020151mg [Prunus persica]
Length=211

 Score =   121 bits (304),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 71/95 (75%), Gaps = 3/95 (3%)
 Frame = +2

Query  110  DLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQS---LTSKTLVDRCVVCQLEYDE  280
            D L+YEELIALGE +G E RGL   EI+  L P T +S   + SKT +DRCV+CQ+EY++
Sbjct  106  DELTYEELIALGEFIGEEKRGLPSNEISTCLQPYTSKSPSSIQSKTSIDRCVICQIEYED  165

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
            GE LVAL C HPYH +CI+ WL+IKK CPICS EV
Sbjct  166  GEALVALSCQHPYHWDCISKWLEIKKSCPICSTEV  200



>ref|XP_007161474.1| hypothetical protein PHAVU_001G072100g [Phaseolus vulgaris]
 gb|ESW33468.1| hypothetical protein PHAVU_001G072100g [Phaseolus vulgaris]
Length=202

 Score =   121 bits (304),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +2

Query  116  LSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEKLV  295
            L+YEELI LG+ +G E RGLS  EI   LH  T+ S  SK+ ++ CV+CQ+EY+EGE LV
Sbjct  106  LTYEELIELGDFIGQEKRGLSANEICSCLHSHTYHSAESKSGINLCVICQVEYEEGEALV  165

Query  296  ALPCDHPYHCECITTWLQIKKVCPICSEEVSSAK  397
            +L C+HPYH +CI+ WLQ+KKVCPIC+ E+S+ K
Sbjct  166  SLQCEHPYHTDCISKWLQMKKVCPICNTEISAPK  199



>ref|XP_010515040.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Camelina 
sativa]
Length=213

 Score =   121 bits (304),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELIALG+ +GVE RGL+  EI+  L+ ST+    +K  +DRCVVCQ+E++E E
Sbjct  117  PDQLSYEELIALGDFIGVEKRGLTPTEISTCLNASTYVFSNNKNEIDRCVVCQMEFEERE  176

Query  287  KLVAL-PCDHPYHCECITTWLQIKKVCPICSEEVS  388
             LV L PCDHPYH +CIT WL+ KK+CPIC  E S
Sbjct  177  SLVVLRPCDHPYHSDCITKWLETKKICPICCSEPS  211



>ref|XP_002877551.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53810.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=211

 Score =   121 bits (304),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELIALG+ +GVE RG++ +EI+  L+ ST+    +K  +DRCVVCQ+E++E E
Sbjct  115  PDQLSYEELIALGDFIGVEKRGMNPSEISTCLNASTYIFSHNKNEIDRCVVCQMEFEERE  174

Query  287  KLVAL-PCDHPYHCECITTWLQIKKVCPIC  373
             LV L PCDHPYH ECIT WL+ KK+CPIC
Sbjct  175  SLVVLRPCDHPYHSECITKWLETKKICPIC  204



>ref|XP_008338661.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Malus domestica]
 ref|XP_008352622.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Malus 
domestica]
Length=217

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +2

Query  110  DLLSYEELIALGELVGVESRGLSEAEITKSLHPST--FQSLTSKTLVDRCVVCQLEYDEG  283
            D L+YEEL+ALGE +G E RGL  +EI+  LHP T       S+T +DRCVVCQ+EY++G
Sbjct  112  DELTYEELLALGEFIGEEKRGLPSSEISTCLHPYTCKLAVDQSETSIDRCVVCQIEYEDG  171

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
            E L AL C+HPYH ECI+ WLQIKK CPICS EV
Sbjct  172  ESLAALSCEHPYHWECISQWLQIKKSCPICSTEV  205



>ref|XP_004290892.1| PREDICTED: uncharacterized protein LOC101313173 [Fragaria vesca 
subsp. vesca]
Length=216

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 71/96 (74%), Gaps = 4/96 (4%)
 Frame = +2

Query  110  DLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQ----SLTSKTLVDRCVVCQLEYD  277
            D L+YEEL+ALGE +GVE RGL   EI+  LHP T++      +  +++D+CVVCQ EY+
Sbjct  108  DELTYEELLALGEFIGVEKRGLPSNEISTCLHPHTYRLSPVHQSKNSVIDKCVVCQYEYE  167

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
            +GE L ALPC+H YH ECI+ WLQIKK CPICS EV
Sbjct  168  DGEALAALPCEHSYHLECISNWLQIKKCCPICSTEV  203



>ref|XP_010503329.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Camelina 
sativa]
Length=213

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELIALG+ +GVE RGL+  EI+  L+ ST+    +K  +DRCVVCQ+E++E E
Sbjct  117  PDQLSYEELIALGDFIGVEKRGLTPTEISTCLNASTYVFSNNKNEIDRCVVCQMEFEERE  176

Query  287  KLVAL-PCDHPYHCECITTWLQIKKVCPICSEEVS  388
             LV L PCDHPYH +CIT WL+ KK CPIC  E S
Sbjct  177  SLVVLRPCDHPYHSDCITKWLETKKTCPICCSEPS  211



>ref|XP_008219608.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Prunus mume]
Length=211

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 71/95 (75%), Gaps = 3/95 (3%)
 Frame = +2

Query  110  DLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTS---KTLVDRCVVCQLEYDE  280
            D L+YEELIALGE +G E RGL   EI+  L P T +S +S   KT +DRCV+CQ+EY++
Sbjct  106  DELTYEELIALGEFIGEEKRGLPTNEISTCLQPYTSKSPSSNQSKTGIDRCVICQIEYED  165

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
            GE LVAL C HPYH +CI+ WL+IKK CPICS EV
Sbjct  166  GEALVALSCQHPYHWDCISKWLEIKKSCPICSTEV  200



>ref|XP_002445741.1| hypothetical protein SORBIDRAFT_07g024936 [Sorghum bicolor]
 gb|EES15236.1| hypothetical protein SORBIDRAFT_07g024936 [Sorghum bicolor]
Length=106

 Score =   115 bits (289),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD  SYEELIALGE+VG+ES+GL+      SL   T+Q+   +   +++CV+C++E+DEG
Sbjct  8    PDEYSYEELIALGEVVGMESKGLAADTTIASLPSVTYQAQDKQDGNMEQCVICRVEFDEG  67

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
              LVALPC HPYH ECI  WLQ+KKVCP+CS EVS++
Sbjct  68   GSLVALPCKHPYHSECINQWLQLKKVCPMCSAEVSTS  104



>ref|XP_006404408.1| hypothetical protein EUTSA_v10010717mg [Eutrema salsugineum]
 gb|ESQ45861.1| hypothetical protein EUTSA_v10010717mg [Eutrema salsugineum]
Length=213

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELIALG+ +GVE RGL+  EI+  L+ ST+    +K  +DRCVVCQ+E++E E
Sbjct  117  PDQLSYEELIALGDFIGVEKRGLTPTEISTCLNASTYVFSHNKNEIDRCVVCQMEFEEAE  176

Query  287  KLVALP-CDHPYHCECITTWLQIKKVCPICSEEVS  388
             LV L  C+HPYH ECIT WLQ KK+CPIC  E S
Sbjct  177  SLVVLRLCNHPYHSECITKWLQTKKICPICCSEPS  211



>ref|XP_010277674.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X1 
[Nelumbo nucifera]
Length=206

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 72/95 (76%), Gaps = 4/95 (4%)
 Frame = +2

Query  116  LSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTS-KTLVDR---CVVCQLEYDEG  283
            LSYEELIALGE+VG  ++GL    +T  LHP  F+  +  K  +DR   CV+CQ+EY+EG
Sbjct  99   LSYEELIALGEIVGKVNKGLPADAVTALLHPYEFKCQSECKNGLDRNGRCVICQVEYEEG  158

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVS  388
            E LVALPC+HPYH +CI+ WLQIK+VCPICS EVS
Sbjct  159  ESLVALPCEHPYHSDCISKWLQIKRVCPICSTEVS  193



>ref|XP_010261280.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Nelumbo nucifera]
Length=278

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG ESRGLS A++  SL   ++ + +++    D+CV+C+L+Y++G
Sbjct  180  PDELSYEELLALGEVVGTESRGLS-ADMIASLPSVSYNAQSNQDGSTDQCVICRLDYEDG  238

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E L  L C H YH ECIT WLQI KVCP+CS EVS+++S
Sbjct  239  ETLTVLSCKHSYHSECITNWLQINKVCPVCSAEVSTSES  277



>ref|XP_002445744.1| hypothetical protein SORBIDRAFT_07g024950 [Sorghum bicolor]
 gb|EES15239.1| hypothetical protein SORBIDRAFT_07g024950 [Sorghum bicolor]
Length=314

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD  SYEELIALGE+VG ES+GL+ A+   SL   T+ +   +   +++CV+C++E+DEG
Sbjct  211  PDEYSYEELIALGEVVGTESKGLA-ADTIASLPSVTYHAQDKQDGNMEQCVICRVEFDEG  269

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E LVALPC HPYH ECI  WLQ+ KVCP+CS EVS++ +
Sbjct  270  ESLVALPCKHPYHSECINQWLQLNKVCPMCSAEVSTSAN  308



>gb|KFK32642.1| hypothetical protein AALP_AA6G269700 [Arabis alpina]
Length=637

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD LSYEELIALG+ +GVE RGL+  EI+  L+ S +    +K  +DRCVVCQ+E++EGE
Sbjct  541  PDQLSYEELIALGDFIGVEKRGLTTTEISTCLNESNYVFSHNKNDIDRCVVCQMEFEEGE  600

Query  287  KLVALP-CDHPYHCECITTWLQIKKVCPICSEEVS  388
             LV L  C+HPYH ECIT WLQ KK+CPIC  E S
Sbjct  601  SLVVLRLCNHPYHSECITKWLQTKKICPICCSEPS  635



>ref|XP_010245103.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Nelumbo 
nucifera]
Length=234

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 2/94 (2%)
 Frame = +2

Query  110  DLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEK  289
            D  SYE LI LGE++G+ +RGL   E+TK L P  ++ +  K  +DRCV+CQ++Y+EGE 
Sbjct  137  DEFSYEGLILLGEILGM-NRGLPADEVTKFLRPCEYK-IECKNGLDRCVICQVDYEEGES  194

Query  290  LVALPCDHPYHCECITTWLQIKKVCPICSEEVSS  391
            LV+LPC+HPYH +CI+ WLQIKKVCPICS +VSS
Sbjct  195  LVSLPCEHPYHSDCISNWLQIKKVCPICSTDVSS  228



>ref|XP_004974139.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Setaria 
italica]
Length=301

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 76/102 (75%), Gaps = 2/102 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSK-TLVDRCVVCQLEYDEG  283
            PD  SYEELIALGE+VG ES+GLS A+   SL   T+Q+   +   +++CV+C++E+DEG
Sbjct  201  PDEYSYEELIALGEVVGTESKGLS-ADTIGSLPSVTYQAQDKQEGNMEQCVICRVEFDEG  259

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPRI  409
            E LVALPC H YH ECI  WLQ+ KVCP+CS EVS++ + ++
Sbjct  260  ESLVALPCKHLYHSECINQWLQLNKVCPMCSAEVSTSVNKKL  301



>ref|XP_004231468.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Solanum lycopersicum]
Length=314

 Score =   115 bits (289),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLT-SKTLVDRCVVCQLEYDEG  283
            PD LSYEELIALG++VG ESRGLS A+   SL    +++ T S+   D CV+C+L+Y++G
Sbjct  216  PDELSYEELIALGDVVGTESRGLS-ADTIASLPSVNYKTQTASEGTTDSCVICRLDYEDG  274

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            EKL  L C H YH EC+  WLQI KVCPICS EVS++ +
Sbjct  275  EKLTVLSCKHTYHSECLNNWLQINKVCPICSTEVSTSGN  313



>gb|KDP37529.1| hypothetical protein JCGZ_05968 [Jatropha curcas]
Length=314

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 71/97 (73%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG ESRGLS A+   SL    F++ +S+    D CV+C+L+YD+G
Sbjct  219  PDELSYEELLALGEVVGTESRGLS-ADTIASLPSVNFKAGSSQNGSNDSCVICRLDYDDG  277

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            E L  L C H YH ECI  WL+I KVCP+CS+EVSS+
Sbjct  278  ETLTVLSCKHSYHSECINDWLKINKVCPVCSKEVSSS  314



>ref|XP_010688664.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=336

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSK-TLVDRCVVCQLEYDEG  283
            PD LSYEELIALGE+VG ESRGLS A+   SL  + + S  +K T  D CV+C+L+Y++G
Sbjct  238  PDELSYEELIALGEVVGTESRGLS-ADTIASLPSTNYISPDNKETEADTCVICRLDYEDG  296

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            + L  LPC H YH +CI  WL+IKK CP+CS EVS++ +
Sbjct  297  DALTTLPCKHAYHSDCINNWLEIKKACPVCSTEVSTSGN  335



>ref|XP_010095417.1| Proteasome subunit beta type-3-A [Morus notabilis]
 gb|EXB60109.1| Proteasome subunit beta type-3-A [Morus notabilis]
Length=693

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 80/115 (70%), Gaps = 18/115 (16%)
 Frame = +2

Query  116  LSYEELIALGELVGVESRGLSEAEITKSLHPSTFQS----------------LTSKTLVD  247
            L+YEELIALGE +GVE RGLS  EI+  LHP  +++                ++S    D
Sbjct  575  LTYEELIALGEFIGVEKRGLSMNEISSCLHPIVWKTTSSVNSNNKNHKNIKMMSSFNDSD  634

Query  248  RCVVCQLEYDEGEKLVALP-CDHPYHCECITTWLQIKKVCPICSEEV-SSAKSPR  406
            RCV+CQ+EY++GE+LV+LP C+HPYH ECI+ WLQIKK CPICS EV SS+ SP+
Sbjct  635  RCVICQIEYEDGEELVSLPNCEHPYHSECISKWLQIKKSCPICSTEVISSSPSPK  689



>ref|XP_006365590.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Solanum 
tuberosum]
Length=313

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLT-SKTLVDRCVVCQLEYDEG  283
            PD LSYEELIALGE+VG ESRGLS A+   SL    +++ T S+   D CV+C+L+Y++G
Sbjct  215  PDELSYEELIALGEVVGTESRGLS-ADTIASLPSVIYKTQTASEGTTDSCVICRLDYEDG  273

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            +KL  L C H YH EC+  WLQI KVCPICS EVS++ +
Sbjct  274  DKLTVLSCKHTYHSECLNNWLQINKVCPICSTEVSTSGN  312



>ref|XP_010688665.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=333

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSK-TLVDRCVVCQLEYDEG  283
            PD LSYEELIALGE+VG ESRGLS A+   SL  + + S  +K T  D CV+C+L+Y++G
Sbjct  235  PDELSYEELIALGEVVGTESRGLS-ADTIASLPSTNYISPDNKETEADTCVICRLDYEDG  293

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            + L  LPC H YH +CI  WL+IKK CP+CS EVS++ +
Sbjct  294  DALTTLPCKHAYHSDCINNWLEIKKACPVCSTEVSTSGN  332



>ref|XP_009622651.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Nicotiana 
tomentosiformis]
Length=331

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLT-SKTLVDRCVVCQLEYDEG  283
            PD LSYEELIALGE+VG ESRGLS A+   SL    +++ T S+   D CV+C+LEY++G
Sbjct  233  PDELSYEELIALGEVVGTESRGLS-ADTIASLPSVNYKAQTASEGTTDSCVICRLEYEDG  291

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            ++L  L C H YH EC+  WLQI KVCP+CS EVS++ +
Sbjct  292  DQLTVLSCKHSYHSECLNNWLQINKVCPMCSTEVSTSGN  330



>ref|NP_001131853.1| uncharacterized LOC100193231 [Zea mays]
 gb|ACF80448.1| unknown [Zea mays]
 gb|AFW65658.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=287

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD  SYEELIALGE+VG ES+GL+ A+   SL   T+Q+   +   +++CV+C++E+DEG
Sbjct  187  PDEYSYEELIALGEVVGTESKGLA-ADTIASLPWVTYQAQDKQDGNMEQCVICRVEFDEG  245

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            E LVALPC HPYH ECI  WLQ+ KVCP+CS EV ++
Sbjct  246  ESLVALPCKHPYHSECINQWLQLNKVCPMCSAEVPTS  282



>gb|ACG31571.1| hypothetical protein [Zea mays]
Length=288

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD  SYEELIALGE+VG ES+GL+ A+   SL   T+Q+   +   +++CV+C++E+DEG
Sbjct  188  PDEYSYEELIALGEVVGTESKGLA-ADTIASLPWVTYQAQDKQDGNMEQCVICRVEFDEG  246

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            E LVALPC HPYH ECI  WLQ+ KVCP+CS EV ++
Sbjct  247  ESLVALPCKHPYHSECINQWLQLNKVCPMCSAEVPTS  283



>ref|XP_006859208.1| hypothetical protein AMTR_s00070p00189230 [Amborella trichopoda]
 gb|ERN20675.1| hypothetical protein AMTR_s00070p00189230 [Amborella trichopoda]
Length=261

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD LSYEELIALGE+VG +S+GLS + I  SL    F+  ++    +D+C +CQ++Y+EG
Sbjct  164  PDELSYEELIALGEVVGTQSKGLS-SNIISSLPSIVFRPASANDGNLDQCAICQVDYEEG  222

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSS  391
            E LV LPC H YH ECI  W QI KVCP+C++EVS+
Sbjct  223  EALVNLPCKHAYHLECINNWFQINKVCPVCNKEVST  258



>ref|XP_009775151.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Nicotiana 
sylvestris]
Length=319

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLT-SKTLVDRCVVCQLEYDEG  283
            PD LSYEELIALGE+VG ESRGLS A+   SL    +++ T S    D CV+C+LEY++G
Sbjct  221  PDELSYEELIALGEVVGTESRGLS-ADTIASLPSVNYKAQTASDGTTDSCVICRLEYEDG  279

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            ++L  L C H YH EC+  WLQI KVCP+CS EVS++ +
Sbjct  280  DQLTVLSCKHSYHSECLNNWLQINKVCPMCSTEVSTSGN  318



>gb|KDO80559.1| hypothetical protein CISIN_1g044318mg, partial [Citrus sinensis]
Length=195

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = +2

Query  119  SYEELIALGELVGVESRGLSEAEITKSLHP-STFQSLTSKTLVDRCVVCQLEYDEGEKLV  295
            +YEELIALGE +G E RGLS  +I+  LH   +  +  +K+ +DRCV+CQ+EY+EGE +V
Sbjct  91   TYEELIALGEFIGQEKRGLSLNQISTCLHACKSPPADGTKSGIDRCVICQVEYEEGESIV  150

Query  296  AL-PCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            AL PC+H YH ECI+ WLQIKK+CPICS E S  K+
Sbjct  151  ALLPCEHLYHSECISNWLQIKKICPICSTEASPPKN  186



>ref|XP_011002254.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X3 
[Populus euphratica]
Length=326

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 72/97 (74%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG+ESRGLS A+I  SL    +++ +S+    D CV+C+L+Y++G
Sbjct  228  PDELSYEELLALGEVVGIESRGLS-ADIIASLASINYKAGSSQNGSNDTCVICRLDYEDG  286

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            E L  L C H YH ECI  WL+I KVCP+CS EVS+A
Sbjct  287  ETLTLLSCKHSYHSECINNWLKINKVCPVCSTEVSTA  323



>ref|XP_011002252.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X1 
[Populus euphratica]
Length=329

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 72/97 (74%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG+ESRGLS A+I  SL    +++ +S+    D CV+C+L+Y++G
Sbjct  231  PDELSYEELLALGEVVGIESRGLS-ADIIASLASINYKAGSSQNGSNDTCVICRLDYEDG  289

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            E L  L C H YH ECI  WL+I KVCP+CS EVS+A
Sbjct  290  ETLTLLSCKHSYHSECINNWLKINKVCPVCSTEVSTA  326



>dbj|BAK04753.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSK-TLVDRCVVCQLEYDEG  283
            PD  SYEEL+ALGE+VG ESRG+S A+   SL   T+Q+   + + +++CV+C++E++EG
Sbjct  192  PDEYSYEELVALGEVVGTESRGVS-ADTLASLPSVTYQAQDKQESNMEQCVICRVEFEEG  250

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E LVALPC H YH +CI  WLQ+ KVCP+CS EVS++ +
Sbjct  251  ESLVALPCKHSYHSDCINQWLQLNKVCPMCSAEVSTSDN  289



>ref|XP_011002253.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X2 
[Populus euphratica]
Length=327

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 72/97 (74%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG+ESRGLS A+I  SL    +++ +S+    D CV+C+L+Y++G
Sbjct  229  PDELSYEELLALGEVVGIESRGLS-ADIIASLASINYKAGSSQNGSNDTCVICRLDYEDG  287

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            E L  L C H YH ECI  WL+I KVCP+CS EVS+A
Sbjct  288  ETLTLLSCKHSYHSECINNWLKINKVCPVCSTEVSTA  324



>ref|XP_006472813.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Citrus 
sinensis]
Length=219

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = +2

Query  119  SYEELIALGELVGVESRGLSEAEITKSLHP-STFQSLTSKTLVDRCVVCQLEYDEGEKLV  295
            +YEELIALGE +G E RGLS  +I+  LH   +  +  +K+ +DRCV+CQ+EY+EGE +V
Sbjct  115  TYEELIALGEFIGQEKRGLSLNQISTCLHACKSPPADGTKSGIDRCVICQVEYEEGESIV  174

Query  296  AL-PCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            AL PC+H YH ECI+ WLQ+KK+CPICS E S  K+
Sbjct  175  ALLPCEHLYHSECISNWLQVKKICPICSTEASPPKN  210



>ref|XP_010655908.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X2 
[Vitis vinifera]
 emb|CBI29028.3| unnamed protein product [Vitis vinifera]
Length=308

 Score =   113 bits (282),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 72/98 (73%), Gaps = 2/98 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSK-TLVDRCVVCQLEYDEG  283
            PD LSYEEL+ALGE++G ESRGLS ++   SL   T+++ +++    D CV+C+L+Y++G
Sbjct  212  PDELSYEELLALGEVIGTESRGLS-SDTIASLPSVTYKAQSNQEGSNDSCVICRLDYEDG  270

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAK  397
            E L  L C H YH ECI  WLQI KVCPICS EVSS++
Sbjct  271  ETLTVLSCKHSYHSECINNWLQINKVCPICSTEVSSSR  308



>ref|XP_003574899.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Brachypodium distachyon]
Length=302

 Score =   112 bits (281),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSK-TLVDRCVVCQLEYDEG  283
            PD  SYEEL+ALGE+VG ESRGLS A+   SL   T+++   + +  ++CV+C++E++EG
Sbjct  202  PDEYSYEELVALGEVVGTESRGLS-ADTLASLPSVTYEAKDKQDSNTEQCVICRVEFEEG  260

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSS  391
            E LVALPC H YH ECI  WLQ+ KVCP+CS EVS+
Sbjct  261  ESLVALPCKHSYHSECINQWLQLNKVCPMCSAEVST  296



>ref|XP_010235389.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Brachypodium distachyon]
Length=301

 Score =   112 bits (281),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSK-TLVDRCVVCQLEYDEG  283
            PD  SYEEL+ALGE+VG ESRGLS A+   SL   T+++   + +  ++CV+C++E++EG
Sbjct  201  PDEYSYEELVALGEVVGTESRGLS-ADTLASLPSVTYEAKDKQDSNTEQCVICRVEFEEG  259

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSS  391
            E LVALPC H YH ECI  WLQ+ KVCP+CS EVS+
Sbjct  260  ESLVALPCKHSYHSECINQWLQLNKVCPMCSAEVST  295



>ref|XP_010655907.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X1 
[Vitis vinifera]
Length=314

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 72/98 (73%), Gaps = 2/98 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSK-TLVDRCVVCQLEYDEG  283
            PD LSYEEL+ALGE++G ESRGLS ++   SL   T+++ +++    D CV+C+L+Y++G
Sbjct  218  PDELSYEELLALGEVIGTESRGLS-SDTIASLPSVTYKAQSNQEGSNDSCVICRLDYEDG  276

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAK  397
            E L  L C H YH ECI  WLQI KVCPICS EVSS++
Sbjct  277  ETLTVLSCKHSYHSECINNWLQINKVCPICSTEVSSSR  314



>ref|NP_001062434.1| Os08g0548300 [Oryza sativa Japonica Group]
 dbj|BAD10755.1| putative RING-H2 finger protein RHG1a [Oryza sativa Japonica 
Group]
 dbj|BAD09949.1| putative RING-H2 finger protein RHG1a [Oryza sativa Japonica 
Group]
 dbj|BAF24348.1| Os08g0548300 [Oryza sativa Japonica Group]
 gb|EAZ43565.1| hypothetical protein OsJ_28186 [Oryza sativa Japonica Group]
 dbj|BAG93370.1| unnamed protein product [Oryza sativa Japonica Group]
Length=305

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 74/101 (73%), Gaps = 2/101 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD  SYEEL+ALGE+VG ESRGLS A+   SL   T+++   +   +++CV+C++E++EG
Sbjct  205  PDEYSYEELVALGEVVGTESRGLS-ADTLASLPSITYRAQDKQDGNMEQCVICRVEFEEG  263

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
            E LVALPC H YH ECI  WLQ+ KVCP+CS EV +++  R
Sbjct  264  ESLVALPCKHSYHSECINQWLQLNKVCPMCSAEVPTSQDTR  304



>ref|XP_006659662.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Oryza 
brachyantha]
Length=301

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 74/98 (76%), Gaps = 2/98 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSK-TLVDRCVVCQLEYDEG  283
            PD  SYEEL+ALGE+VG ESRGLS A+   SL   T+++   + + +++CV+C++E++EG
Sbjct  201  PDEYSYEELVALGEVVGTESRGLS-ADTLASLPSITYRAQDKQDSNMEQCVICRVEFEEG  259

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAK  397
            E LVALPC H YH ECI  WLQ+ KVCP+CS EV +++
Sbjct  260  ESLVALPCKHSYHSECINQWLQLNKVCPMCSAEVPTSQ  297



>ref|XP_006661480.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like, partial 
[Oryza brachyantha]
Length=269

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD  SYEEL+ALGE+VG ++RGLS A+I  SL   TF++  ++    ++CV+C++E+++G
Sbjct  169  PDEYSYEELVALGEVVGTQNRGLS-ADILASLPSLTFKAKGAQDGNSEQCVICRVEFEDG  227

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E L+ALPC H YH ECI  WLQI KVCP+CS EVS++ +
Sbjct  228  ESLIALPCKHSYHPECINQWLQINKVCPMCSSEVSTSDN  266



>gb|EAZ07897.1| hypothetical protein OsI_30152 [Oryza sativa Indica Group]
Length=300

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 74/101 (73%), Gaps = 2/101 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD  SYEEL+ALGE+VG ESRGLS A+   SL   T+++   +   +++CV+C++E++EG
Sbjct  200  PDEYSYEELVALGEVVGTESRGLS-ADTLASLPSITYRAQDKQDGNMEQCVICRVEFEEG  258

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
            E LVALPC H YH ECI  WLQ+ KVCP+CS EV +++  R
Sbjct  259  ESLVALPCKHSYHSECINQWLQLNKVCPMCSAEVPTSQDTR  299



>ref|XP_002310069.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE90519.1| zinc finger family protein [Populus trichocarpa]
Length=320

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 70/97 (72%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG ESRGLS A+I  SL    +++ +S+    D CV+C+L+Y++G
Sbjct  222  PDELSYEELLALGEVVGTESRGLS-ADIIASLPSINYKAGSSQNGSNDSCVICRLDYEDG  280

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            E L  L C H YH ECI  WL+I KVCP CS EVS+A
Sbjct  281  ETLTLLSCKHSYHSECINNWLKINKVCPFCSTEVSTA  317



>ref|XP_008445883.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Cucumis melo]
Length=328

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 71/97 (73%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG ESRGLS A+   SL    F++ + +T   D CV+C+L++++G
Sbjct  229  PDELSYEELLALGEVVGTESRGLS-ADTIASLPSINFKAGSDQTGSNDSCVICRLDFEDG  287

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            E L  L C H YH +CIT WL+I KVCP+CS EVS+A
Sbjct  288  ETLTVLSCKHSYHSDCITNWLKINKVCPVCSAEVSTA  324



>ref|XP_009587083.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X2 [Nicotiana 
tomentosiformis]
Length=83

 Score =   106 bits (264),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  173  LSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGEKLVALPCDHPYHCECITTWLQI  352
            LSEAEI K LH  TFQS  SKTL+DRCVVCQ+EY+EGEKLVALPCDHP+H +CI  WLQI
Sbjct  16   LSEAEIRKYLHSFTFQSNNSKTLIDRCVVCQMEYEEGEKLVALPCDHPFHSDCINKWLQI  75

Query  353  KK  358
            KK
Sbjct  76   KK  77



>ref|XP_010932524.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Elaeis 
guineensis]
Length=285

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD  SYEEL+ALGE+VG E+RGLS A+   SL    +++ +++    D+CV+C+LEY++G
Sbjct  185  PDDYSYEELVALGEVVGTENRGLS-ADTIASLPSVNYEAGSAQDGNTDQCVICRLEYEDG  243

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E LV L C H YH ECI  WLQI KVCP+CS EVS++ +
Sbjct  244  ESLVMLSCKHTYHSECINKWLQINKVCPVCSTEVSTSGN  282



>ref|XP_006851962.1| hypothetical protein AMTR_s00041p00192380 [Amborella trichopoda]
 gb|ERN13429.1| hypothetical protein AMTR_s00041p00192380 [Amborella trichopoda]
Length=279

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSL-TSKTLVDRCVVCQLEYDEG  283
            PD LSYEELIALGE+VG E+RGLS A++  SL  S +++  T++  +++CV+C+++Y+EG
Sbjct  179  PDDLSYEELIALGEVVGTETRGLS-ADMIASLPSSKYKAQSTAEGAIEQCVICRVDYEEG  237

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            + L  L C H YH ECI  WL+I KVCP+CS EVS++
Sbjct  238  DDLTDLLCKHRYHSECINNWLKINKVCPLCSTEVSTS  274



>ref|XP_003578515.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Brachypodium 
distachyon]
Length=337

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSL-TSKTLVDRCVVCQLEYDEG  283
            PD  SYEEL+ALGE+VG ESRGLS A+   SL   T+++        ++CV+C++E++EG
Sbjct  237  PDEYSYEELVALGEVVGTESRGLS-ADTLASLPSVTYKTKDVQDGNTEQCVICRVEFEEG  295

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E LVALPC H YH +CI  WLQI KVCP+CS EVS++++
Sbjct  296  ESLVALPCKHSYHPDCINQWLQINKVCPMCSAEVSTSEN  334



>ref|XP_004143619.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Cucumis 
sativus]
 ref|XP_004165268.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Cucumis 
sativus]
 gb|KGN50445.1| hypothetical protein Csa_5G175690 [Cucumis sativus]
Length=323

 Score =   110 bits (276),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 71/97 (73%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG ESRGLS A+   SL    F++ + +T   D CV+C+L++++G
Sbjct  224  PDELSYEELLALGEVVGTESRGLS-ADTIASLPSINFKAGSDQTGSNDSCVICRLDFEDG  282

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            E L  L C H YH +C+T WL+I K+CP+CS EVS+A
Sbjct  283  ETLTVLSCKHSYHSDCVTNWLKINKICPVCSAEVSTA  319



>ref|XP_002521533.1| ring finger protein, putative [Ricinus communis]
 gb|EEF40804.1| ring finger protein, putative [Ricinus communis]
Length=316

 Score =   110 bits (275),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 70/97 (72%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLV-DRCVVCQLEYDEG  283
            PD LSYEELIALGE+VG ESRGLS A+   SL    +++ +S+    D CV+C+L+Y++G
Sbjct  218  PDELSYEELIALGEVVGSESRGLS-ADTIASLPTVNYKAGSSQNGTNDSCVICRLDYEDG  276

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            E L  L C H YH ECI  WL+I KVCP+CS EVS++
Sbjct  277  ETLTLLSCKHSYHSECINNWLKINKVCPVCSTEVSTS  313



>emb|CDP14406.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   110 bits (275),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 87/138 (63%), Gaps = 8/138 (6%)
 Frame = +2

Query  8    KKLC*RLIIMFLKIYMVAGSELF------N*eieeddidPDLLSYEELIALGELVGVESR  169
            +++  RL+ M     MV G          N +   +++DPD LSYEEL+ALGE+VG ESR
Sbjct  165  REMAARLLSMAGINEMVIGEADDEEEDDGNSQDAWEEVDPDELSYEELLALGEVVGTESR  224

Query  170  GLSEAEITKSLHPSTFQSL-TSKTLVDRCVVCQLEYDEGEKLVALPCDHPYHCECITTWL  346
            GLS A+   SL   +++S  T     D CV+C+L+Y+EG++L  L C H YH +CI  WL
Sbjct  225  GLS-ADTIASLPAMSYKSQCTEAGSTDSCVICRLDYEEGDRLTVLSCKHSYHPDCINNWL  283

Query  347  QIKKVCPICSEEVSSAKS  400
            +I KVCP+CS EVS++ +
Sbjct  284  KINKVCPVCSAEVSTSGN  301



>dbj|BAJ88925.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=346

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 75/101 (74%), Gaps = 2/101 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD  SYEEL+ALG++VG ESRGLS A+   SL   T+++   +    ++CV+C++E++EG
Sbjct  246  PDEYSYEELVALGDVVGTESRGLS-ADTLASLPSVTYKTKDMQDGNTEQCVICRVEFEEG  304

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
            E LVALPC+H YH +CI  WLQI KVCP+CS EVS++ + +
Sbjct  305  ESLVALPCNHSYHPDCINQWLQINKVCPMCSAEVSTSANKQ  345



>ref|XP_008795341.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Phoenix 
dactylifera]
Length=285

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLT-SKTLVDRCVVCQLEYDEG  283
            PD  SYEEL+ALGE+VG ESRGLS   I  SL    +++ +      D+CV+C+LEY++G
Sbjct  185  PDEYSYEELVALGEVVGTESRGLSAVTIA-SLPSVNYKAGSVQDGNTDQCVICRLEYEDG  243

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
            E +V L C H YH ECI  WLQI KVCPICS EVS++ + +
Sbjct  244  ESIVVLSCKHAYHSECIYKWLQINKVCPICSTEVSTSGNKQ  284



>gb|EMS64698.1| E3 ubiquitin ligase BIG BROTHER-related protein [Triticum urartu]
Length=241

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSK-TLVDRCVVCQLEYDEG  283
            PD  SYEEL+ALGE+VG ESRG+S A+   SL   T+Q+  ++ + +++CV+C++E++E 
Sbjct  141  PDEYSYEELVALGEVVGTESRGVS-ADTLASLPSVTYQAEDNQDSNMEQCVICRVEFEES  199

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSS  391
            E LVALPC H YH +CI  WLQ+ KVCP+CS EVS+
Sbjct  200  ESLVALPCKHSYHSDCIKQWLQLNKVCPMCSAEVST  235



>gb|KHG29072.1| E3 ubiquitin ligase BIG BROTHER-related -like protein [Gossypium 
arboreum]
Length=243

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 71/97 (73%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG ESRGLS A+   SL    +++ +S+T   D CV+C+++YD+G
Sbjct  145  PDELSYEELLALGEVVGTESRGLS-ADSLASLPSIKYKAGSSQTGSNDSCVICRVDYDDG  203

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            + L  L C H YH ECI  WL+I KVCP+CS EVS++
Sbjct  204  DSLTVLSCKHSYHPECINNWLKINKVCPVCSAEVSTS  240



>ref|XP_010906327.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Elaeis 
guineensis]
Length=280

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 71/101 (70%), Gaps = 2/101 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD  SYEEL+ALGE++G  SRGLS A+   SL    F++ + +    D+CV+C+LEY++G
Sbjct  180  PDEYSYEELVALGEVIGSASRGLS-ADRIASLPSVNFKAGSMQDGNTDQCVICRLEYEDG  238

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
            E LV L C H YH ECI  WLQI KVCP+CS EVS++ + +
Sbjct  239  ESLVVLSCKHTYHSECINKWLQINKVCPLCSTEVSTSGNKQ  279



>ref|XP_009395387.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Musa acuminata 
subsp. malaccensis]
Length=296

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 72/98 (73%), Gaps = 2/98 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD  SYEEL+ALGE+VG ESRGLS A+   +L   ++++  ++    ++CV+C+LEY+EG
Sbjct  199  PDEYSYEELVALGEVVGTESRGLS-ADTIAALPSVSYKAENAQDGSAEQCVICRLEYEEG  257

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAK  397
            + LV L C H YH EC+  WLQI KVCP+CS EVS+++
Sbjct  258  DSLVLLSCKHKYHSECVNKWLQINKVCPVCSAEVSTSE  295



>ref|XP_007043263.1| RING/U-box superfamily protein [Theobroma cacao]
 gb|EOX99094.1| RING/U-box superfamily protein [Theobroma cacao]
Length=392

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG ESRGLS A+   SL   T+++ +S+T   D CVVC+++Y++G
Sbjct  296  PDELSYEELLALGEVVGTESRGLS-ADSIASLPSVTYKAGSSQTGSNDSCVVCRVDYEDG  354

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            + L  L C H YH ECI  WL+I KVCP+CS EVS++
Sbjct  355  DSLTVLSCKHSYHPECINNWLKINKVCPVCSAEVSTS  391



>ref|XP_006437609.1| hypothetical protein CICLE_v10032094mg [Citrus clementina]
 ref|XP_006484518.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Citrus 
sinensis]
 gb|ESR50849.1| hypothetical protein CICLE_v10032094mg [Citrus clementina]
Length=328

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 70/97 (72%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG ESRGLS A+   +L    +++ TS+    D CV+C+L+Y++G
Sbjct  230  PDELSYEELLALGEVVGSESRGLS-ADTLATLPTVNYKAGTSQNGSNDSCVICRLDYEDG  288

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            E L  L C H YH ECI  WL+I KVCP+CS EVS++
Sbjct  289  ETLTVLSCKHSYHSECINNWLKINKVCPVCSAEVSTS  325



>gb|AAM61025.1| unknown [Arabidopsis thaliana]
Length=340

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL+ALG++VG ESRGLS A+   SL    ++   ++   +  CV+C+L+Y++ 
Sbjct  240  PDELSYEELLALGDIVGTESRGLS-ADTIASLPSKRYKEGDNQNGTNESCVICRLDYEDD  298

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E L+ LPC H YH ECI  WL+I KVCP+CS EVS++ S
Sbjct  299  EDLILLPCKHSYHSECINNWLKINKVCPVCSAEVSTSTS  337



>ref|NP_566651.1| E3 ubiquitin ligase BIG BROTHER-like protein [Arabidopsis thaliana]
 sp|Q9LT17.1|BBR_ARATH RecName: Full=E3 ubiquitin ligase BIG BROTHER-related; Short=AtBBR 
[Arabidopsis thaliana]
 dbj|BAB01306.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK73948.1| AT3g19910/MPN9_15 [Arabidopsis thaliana]
 gb|AAK76658.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85084.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76307.1| E3 ubiquitin ligase BIG BROTHER-like protein [Arabidopsis thaliana]
Length=340

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL+ALG++VG ESRGLS A+   SL    ++   ++   +  CV+C+L+Y++ 
Sbjct  240  PDELSYEELLALGDIVGTESRGLS-ADTIASLPSKRYKEGDNQNGTNESCVICRLDYEDD  298

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E L+ LPC H YH ECI  WL+I KVCP+CS EVS++ S
Sbjct  299  EDLILLPCKHSYHSECINNWLKINKVCPVCSAEVSTSTS  337



>gb|KDO52706.1| hypothetical protein CISIN_1g019980mg [Citrus sinensis]
Length=328

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG ESRGLS A+   +L    ++  TS+    D CV+C+L+Y++G
Sbjct  230  PDELSYEELLALGEVVGSESRGLS-ADTLATLPTVNYKGGTSQNGSNDSCVICRLDYEDG  288

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            E L  L C H YH ECI  WL+I KVCP+CS EVS++
Sbjct  289  ETLTVLSCKHSYHSECINNWLKINKVCPVCSAEVSTS  325



>ref|XP_004957470.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Setaria 
italica]
Length=323

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD  SYEEL+ALGE+VG ESRGLS A+   SL    +++   +    ++CV+C++E+++G
Sbjct  223  PDEYSYEELVALGEVVGTESRGLS-ADTLASLPSVKYKAQNVQDGNTEQCVICRVEFEDG  281

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E L+ALPC H YH ECI  WLQI KVCP+CS EVS++ +
Sbjct  282  ESLIALPCKHSYHPECINQWLQINKVCPMCSAEVSTSGN  320



>gb|KFK39312.1| hypothetical protein AALP_AA3G228600 [Arabis alpina]
Length=316

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 70/102 (69%), Gaps = 8/102 (8%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEI----TKSLHPSTFQSLTSKTLVDRCVVCQLEY  274
            PD LSYEEL+ALGE VG ESRGLS  +I    +K       Q+ T+++    CV+C+L+Y
Sbjct  216  PDELSYEELLALGEFVGTESRGLSADKIASLPSKRYKEGDNQNGTNES----CVICRLDY  271

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            ++ + L+ LPC H YH ECI  WL+I KVCP+CS EVS++ S
Sbjct  272  EDEDDLILLPCKHSYHSECINNWLKINKVCPVCSAEVSASSS  313



>ref|XP_010466157.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Camelina 
sativa]
Length=336

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL+ALG++VG ESRGLS A+   SL    ++   ++   +  CV+C+L+Y++ 
Sbjct  236  PDELSYEELLALGDIVGTESRGLS-ADTIASLPSKRYKDGDNQNGTNESCVICRLDYEDD  294

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            + L+ LPC H YH ECI  WL+I KVCP+CS EVS++ S
Sbjct  295  DDLILLPCKHSYHSECINNWLKINKVCPVCSAEVSASTS  333



>ref|XP_010487948.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Camelina sativa]
Length=339

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL+ALG++VG ESRGLS A+   SL    ++   ++   +  CV+C+L+Y++ 
Sbjct  239  PDELSYEELLALGDIVGTESRGLS-ADTIASLPSKRYKDGDNQNGTNESCVICRLDYEDD  297

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            + L+ LPC H YH ECI  WL+I KVCP+CS EVS++ S
Sbjct  298  DDLILLPCKHSYHSECINNWLKINKVCPVCSAEVSASTS  336



>ref|XP_010487949.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Camelina sativa]
Length=338

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL+ALG++VG ESRGLS A+   SL    ++   ++   +  CV+C+L+Y++ 
Sbjct  238  PDELSYEELLALGDIVGTESRGLS-ADTIASLPSKRYKDGDNQNGTNESCVICRLDYEDD  296

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            + L+ LPC H YH ECI  WL+I KVCP+CS EVS++ S
Sbjct  297  DDLILLPCKHSYHSECINNWLKINKVCPVCSAEVSASTS  335



>ref|XP_002883210.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59469.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=337

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL+ALG++VG ESRGLS A+   SL    ++   ++   +  CV+C+L+Y++ 
Sbjct  237  PDELSYEELLALGDIVGTESRGLS-ADTIASLPSKRYKEGDNQNGTNESCVICRLDYEDD  295

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E L+ LPC H YH ECI  WL+I KVCP+CS EVS++ S
Sbjct  296  EDLILLPCKHSYHSECINNWLKINKVCPVCSAEVSTSTS  334



>ref|XP_010508204.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Camelina 
sativa]
Length=337

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL+ALG++VG ESRGLS A+   SL    ++   ++   +  CV+C+L+Y++ 
Sbjct  237  PDELSYEELLALGDIVGTESRGLS-ADTIASLPSKRYKDGDNQNGTNESCVICRLDYEDD  295

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            + L+ LPC H YH ECI  WL+I KVCP+CS EVS++ S
Sbjct  296  DDLILLPCKHSYHSECINNWLKINKVCPVCSAEVSTSTS  334



>gb|KHG07975.1| E3 ubiquitin ligase BIG BROTHER-related -like protein [Gossypium 
arboreum]
Length=193

 Score =   105 bits (262),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (72%), Gaps = 2/96 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLV-DRCVVCQLEYDEG  283
            PD LSYEEL+AL E+VG ESRGLS A+   SL    +++  S+T   D CV+C+++Y++G
Sbjct  99   PDELSYEELLALAEVVGTESRGLS-ADSIASLPSLIYKAGNSQTGTNDSCVICRVDYEDG  157

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSS  391
            + L AL C H YH ECI  WL+I KVCP+CS EVS+
Sbjct  158  DSLTALSCKHSYHPECINNWLKINKVCPVCSAEVST  193



>ref|XP_011070448.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Sesamum indicum]
Length=303

 Score =   107 bits (267),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 68/97 (70%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLT-SKTLVDRCVVCQLEYDEG  283
            PD LSYEEL+ALG++VG ESRGLS A+   SL    ++S    +   D CV+C+L+Y++G
Sbjct  205  PDELSYEELLALGDVVGTESRGLS-ADTIASLPSINYKSQGIQEGSNDTCVICRLDYEDG  263

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            + L  L C H YH ECI  WLQI KVCP+CS EVS++
Sbjct  264  DTLTVLSCKHSYHSECINNWLQINKVCPVCSAEVSTS  300



>ref|XP_010112544.1| E3 ubiquitin ligase BIG BROTHER-related protein [Morus notabilis]
 gb|EXC33997.1| E3 ubiquitin ligase BIG BROTHER-related protein [Morus notabilis]
Length=342

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG ESRGLS + I  SL    +++ +S++   D CV+C+L+Y++G
Sbjct  244  PDELSYEELLALGEVVGTESRGLSASGIA-SLPSVNYKTGSSQSGSNDSCVICRLDYEDG  302

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E L  L C H YH ECI  WL+I KVCP+CS EVS++ +
Sbjct  303  ETLTLLSCKHSYHPECINNWLKINKVCPVCSTEVSTSGN  341



>tpg|DAA40634.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=323

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 72/100 (72%), Gaps = 4/100 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTF--QSLTSKTLVDRCVVCQLEYDE  280
            PD  SYEEL+ALGE+VG E+RGLS A+   SL   T+  QS+      ++CV+C++E +E
Sbjct  223  PDEYSYEELVALGEVVGTENRGLS-ADALASLPSVTYKMQSVQDGN-TEQCVICRVELEE  280

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            GE L+ALPC H YH ECI  WLQI KVCP+CS EVS++ +
Sbjct  281  GESLIALPCKHLYHPECINQWLQINKVCPMCSAEVSTSSN  320



>ref|XP_006382946.1| hypothetical protein POPTR_0005s09300g [Populus trichocarpa]
 gb|ERP60743.1| hypothetical protein POPTR_0005s09300g [Populus trichocarpa]
Length=316

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 69/97 (71%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG ESRGLS A+   SL    +++ +S+    D CV+C+L+Y++G
Sbjct  218  PDELSYEELLALGEVVGTESRGLS-ADTIASLPSINYKTGSSQNGSNDSCVICRLDYEDG  276

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            E L  L C H YH ECI  WL+I K CP+C+ EVS++
Sbjct  277  ETLTLLSCKHSYHSECINNWLKINKACPVCNTEVSTS  313



>ref|XP_006382945.1| hypothetical protein POPTR_0005s09300g [Populus trichocarpa]
 gb|ERP60742.1| hypothetical protein POPTR_0005s09300g [Populus trichocarpa]
Length=314

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 69/97 (71%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG ESRGLS A+   SL    +++ +S+    D CV+C+L+Y++G
Sbjct  216  PDELSYEELLALGEVVGTESRGLS-ADTIASLPSINYKTGSSQNGSNDSCVICRLDYEDG  274

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            E L  L C H YH ECI  WL+I K CP+C+ EVS++
Sbjct  275  ETLTLLSCKHSYHSECINNWLKINKACPVCNTEVSTS  311



>ref|XP_008243095.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Prunus mume]
Length=316

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEELIALGE+VG ESRGLS A+   SL   ++++ + +   +  CV+C+L+Y+ G
Sbjct  218  PDELSYEELIALGEVVGTESRGLS-ADTIASLPSVSYKTGSGQNGSNESCVICRLDYEAG  276

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E L  L C H YH ECI  WL I KVCP+CS EVS++ +
Sbjct  277  ENLTILSCKHSYHSECINNWLTINKVCPVCSAEVSTSGN  315



>ref|XP_007202272.1| hypothetical protein PRUPE_ppa008876mg [Prunus persica]
 gb|EMJ03471.1| hypothetical protein PRUPE_ppa008876mg [Prunus persica]
Length=316

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEELIALGE+VG ESRGLS A+   SL   ++++ + +   +  CV+C+L+Y+ G
Sbjct  218  PDELSYEELIALGEVVGTESRGLS-ADTIASLPSVSYKTGSGQNGSNESCVICRLDYEAG  276

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E L  L C H YH ECI  WL I KVCP+CS EVS++ +
Sbjct  277  ENLTILSCKHSYHSECINNWLTINKVCPVCSAEVSTSGN  315



>ref|XP_009366273.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X2 
[Pyrus x bretschneideri]
Length=317

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG ESRGLS A+   SL   ++++ +S+   +  CV+C+L++++G
Sbjct  219  PDELSYEELLALGEVVGTESRGLS-ADTIASLPSVSYKTGSSQNGSNESCVICRLDFEDG  277

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E L  L C H YH ECI  WL I KVCP+CS EVS++ +
Sbjct  278  ENLTILSCKHSYHSECINNWLTINKVCPVCSAEVSTSGN  316



>ref|XP_008789253.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X2 
[Phoenix dactylifera]
Length=285

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD  SYEEL+ALGE+VG E+RGLS A+   SL    +++ +++    D+CV+C+LEY++G
Sbjct  185  PDDYSYEELVALGEVVGTENRGLS-ADTIASLPSVNYKAGSAQDGNTDQCVICRLEYEDG  243

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E LV L C H YH ECI  WL I KVCP+CS EVS++ +
Sbjct  244  ESLVMLSCKHTYHSECINKWLLINKVCPVCSTEVSTSGT  282



>ref|XP_009366271.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X1 
[Pyrus x bretschneideri]
Length=320

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG ESRGLS A+   SL   ++++ +S+   +  CV+C+L++++G
Sbjct  222  PDELSYEELLALGEVVGTESRGLS-ADTIASLPSVSYKTGSSQNGSNESCVICRLDFEDG  280

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E L  L C H YH ECI  WL I KVCP+CS EVS++ +
Sbjct  281  ENLTILSCKHSYHSECINNWLTINKVCPVCSAEVSTSGN  319



>ref|XP_006406443.1| hypothetical protein EUTSA_v10021098mg [Eutrema salsugineum]
 gb|ESQ47896.1| hypothetical protein EUTSA_v10021098mg [Eutrema salsugineum]
Length=335

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG ESRGLS A+   +L    ++   ++   +  CV+C+L+Y++ 
Sbjct  235  PDELSYEELLALGEIVGTESRGLS-ADTIATLPSKRYKDGDNQNGTNESCVICRLDYEDN  293

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            + L+ LPC H YH ECI  WL+I K+CP+CS EVS++ +
Sbjct  294  DDLILLPCKHSYHSECINNWLKINKICPVCSAEVSTSSA  332



>emb|CDY33429.1| BnaC01g32960D [Brassica napus]
Length=330

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL+ALG++VG ESRGLS A+   SL    ++   ++   +  CV+C+L+Y++ 
Sbjct  230  PDELSYEELLALGDIVGTESRGLS-ADTIASLPSKRYKDGENQNGTNESCVICRLDYEDD  288

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            + L+ LPC H YH ECI  WL+I K+CP+CS EVS++ +
Sbjct  289  DDLILLPCKHSYHSECINNWLKINKICPVCSAEVSTSSA  327



>ref|XP_009111410.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Brassica 
rapa]
Length=333

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL+ALG++VG ESRGLS A+   SL    ++   ++   +  CV+C+L+Y++ 
Sbjct  233  PDELSYEELLALGDIVGTESRGLS-ADTIASLPSKRYKDGENQNGTNESCVICRLDYEDD  291

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            + L+ LPC H YH ECI  WL+I K+CP+CS EVS++ +
Sbjct  292  DDLILLPCKHSYHSECINNWLKINKICPVCSAEVSTSSA  330



>ref|XP_001769627.1| predicted protein [Physcomitrella patens]
 gb|EDQ65620.1| predicted protein [Physcomitrella patens]
Length=306

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 68/96 (71%), Gaps = 3/96 (3%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTF--QSLTSKTLVDRCVVCQLEYDE  280
            PD +SYEELIALGE VG ES+GL+ A+   SL   T+   S    T  ++CVVC+LEY++
Sbjct  199  PDNMSYEELIALGEAVGTESKGLN-AQSVASLQQFTYVPDSKDISTDQEQCVVCRLEYEK  257

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVS  388
            G+K++ LPC H YH ECI  WLQ  KVCP+CS EV+
Sbjct  258  GDKMLRLPCKHHYHSECIQQWLQHNKVCPVCSAEVT  293



>emb|CDY42218.1| BnaA01g25770D [Brassica napus]
Length=334

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL+ALG++VG ESRGLS A+   SL    ++   ++   +  CV+C+L+Y++ 
Sbjct  234  PDELSYEELLALGDIVGTESRGLS-ADTIASLPSKRYKDGENQNGTNESCVICRLDYEDD  292

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            + L+ LPC H YH ECI  WL+I K+CP+CS EVS++ +
Sbjct  293  DDLILLPCKHSYHSECINNWLKINKICPVCSAEVSTSSA  331



>gb|EPS72594.1| hypothetical protein M569_02164, partial [Genlisea aurea]
Length=108

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 69/97 (71%), Gaps = 3/97 (3%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTF--QSLTSKTLVDRCVVCQLEYDE  280
            PD LSYEEL+ALG++VG ESRGLS A+   SL  + F  Q   ++   D CV+C+L+Y++
Sbjct  9    PDELSYEELLALGDVVGTESRGLS-ADTLASLPFTEFKSQGTAAEGSCDSCVICRLDYED  67

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSS  391
            G+ L  L C H YH ECI +WL+I KVCP+CS EVS+
Sbjct  68   GDTLTVLSCKHLYHPECIKSWLKINKVCPVCSAEVST  104



>gb|EEC84951.1| hypothetical protein OsI_32172 [Oryza sativa Indica Group]
Length=325

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQS-LTSKTLVDRCVVCQLEYDEG  283
            PD  SYEEL+ALGE VG   RGLS A +  SL   T+++        ++CV+C++E+++G
Sbjct  225  PDEYSYEELVALGEAVGTGHRGLSAATLA-SLPSVTYKAEGVQDGNTEQCVICRVEFEDG  283

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E L+ALPC H YH ECI  WLQI KVCP+CS EVS++ S
Sbjct  284  ESLIALPCKHSYHPECINQWLQINKVCPMCSAEVSTSDS  322



>ref|NP_001063778.1| Os09g0535100 [Oryza sativa Japonica Group]
 dbj|BAD34213.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF25692.1| Os09g0535100 [Oryza sativa Japonica Group]
 dbj|BAG91659.1| unnamed protein product [Oryza sativa Japonica Group]
Length=325

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQS-LTSKTLVDRCVVCQLEYDEG  283
            PD  SYEEL+ALGE VG   RGLS A +  SL   T+++        ++CV+C++E+++G
Sbjct  225  PDEYSYEELVALGEAVGTGHRGLSAATLA-SLPSVTYKAEGVQDGNTEQCVICRVEFEDG  283

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E L+ALPC H YH ECI  WLQI KVCP+CS EVS++ S
Sbjct  284  ESLIALPCKHSYHPECINQWLQINKVCPMCSAEVSTSDS  322



>ref|NP_001149296.1| LOC100282919 [Zea mays]
 gb|ACG34901.1| protein binding protein [Zea mays]
Length=323

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 72/100 (72%), Gaps = 4/100 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTF--QSLTSKTLVDRCVVCQLEYDE  280
            PD  SYEEL+ALGE+VG E+RGLS A+   SL   T+  QS+      ++CV+C++E ++
Sbjct  223  PDEYSYEELVALGEVVGTENRGLS-ADALASLPSVTYKMQSVQDGN-TEQCVICRVELED  280

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            GE L+ALPC H YH ECI  WLQI KVCP+CS EVS++ +
Sbjct  281  GESLIALPCKHLYHPECINQWLQINKVCPMCSAEVSTSSN  320



>ref|XP_006298094.1| hypothetical protein CARUB_v10014137mg [Capsella rubella]
 gb|EOA30992.1| hypothetical protein CARUB_v10014137mg [Capsella rubella]
Length=335

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL+ALG++VG ESRGLS A+   SL    ++   ++   +  CV+C+L+Y+  
Sbjct  235  PDELSYEELLALGDIVGTESRGLS-ADTIASLTSKRYKDGDNQNGTNESCVICRLDYEVD  293

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            + L+ LPC H YH ECI  WL+I KVCP+CS EVS++ S
Sbjct  294  DDLILLPCKHSYHSECINNWLKINKVCPVCSAEVSTSTS  332



>ref|XP_002460573.1| hypothetical protein SORBIDRAFT_02g031050 [Sorghum bicolor]
 gb|EER97094.1| hypothetical protein SORBIDRAFT_02g031050 [Sorghum bicolor]
Length=324

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQ-SLTSKTLVDRCVVCQLEYDEG  283
            PD  SYEEL+ALGE+VG E+RGLS A+   SL   T++         ++CV+C++E +EG
Sbjct  224  PDEYSYEELVALGEVVGTENRGLS-ADTLASLPSVTYKMQDVQDGNTEQCVICRVELEEG  282

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E L+ALPC H YH ECI  WLQI KVCP+CS EVS++ +
Sbjct  283  ESLIALPCKHLYHPECINQWLQINKVCPMCSAEVSTSGN  321



>ref|XP_011022025.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Populus euphratica]
Length=311

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 69/97 (71%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG ESRGLS A+   SL    +++ +++    D CV+C+L+Y++G
Sbjct  213  PDELSYEELLALGEVVGTESRGLS-ADTIASLPSINYKTGSNQNGSNDSCVICRLDYEDG  271

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            E L  L C H YH +CI  WL+I K CP+CS EVS++
Sbjct  272  ETLTLLSCKHSYHSDCINNWLKINKACPLCSTEVSTS  308



>ref|XP_011022026.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Populus euphratica]
Length=309

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 69/97 (71%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG ESRGLS A+   SL    +++ +++    D CV+C+L+Y++G
Sbjct  211  PDELSYEELLALGEVVGTESRGLS-ADTIASLPSINYKTGSNQNGSNDSCVICRLDYEDG  269

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            E L  L C H YH +CI  WL+I K CP+CS EVS++
Sbjct  270  ETLTLLSCKHSYHSDCINNWLKINKACPLCSTEVSTS  306



>ref|XP_008383698.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Malus domestica]
Length=312

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG E+RGLS A+   SL   ++++ +S+   +  CV+C+L++++G
Sbjct  214  PDELSYEELLALGEVVGTENRGLS-ADTIASLPSVSYKTGSSQNGSNESCVICRLDFEDG  272

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E L  L C H YH ECI  WL I K+CP+CS EVS++ +
Sbjct  273  ENLTILSCKHSYHSECINNWLTINKICPVCSAEVSTSGN  311



>ref|XP_008383690.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Malus domestica]
Length=315

 Score =   105 bits (262),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG E+RGLS A+   SL   ++++ +S+   +  CV+C+L++++G
Sbjct  217  PDELSYEELLALGEVVGTENRGLS-ADTIASLPSVSYKTGSSQNGSNESCVICRLDFEDG  275

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E L  L C H YH ECI  WL I K+CP+CS EVS++ +
Sbjct  276  ENLTILSCKHSYHSECINNWLTINKICPVCSAEVSTSGN  314



>ref|XP_008461284.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X2 [Cucumis 
melo]
Length=248

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 67/97 (69%), Gaps = 6/97 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTS----KTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG ESRGLSE +I  SL P+    LTS    K L +RCV+CQ+ Y
Sbjct  141  PDHMTYEELLDLGESVGTESRGLSEEQI--SLLPTARCKLTSFFSRKKLDERCVICQMRY  198

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
              G+K + LPC H YH +CIT WL I K+CPIC+ EV
Sbjct  199  KRGDKQIKLPCKHFYHNKCITKWLTINKICPICNIEV  235



>gb|KGN45134.1| hypothetical protein Csa_7G428220 [Cucumis sativus]
Length=248

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 67/97 (69%), Gaps = 6/97 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTS----KTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG ESRGLSE +I  SL P+    LTS    K L +RCV+CQ+ Y
Sbjct  141  PDHMTYEELLDLGESVGTESRGLSEEQI--SLLPTARCKLTSFFSRKKLDERCVICQMRY  198

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
              G+K + LPC H YH +CIT WL I K+CPIC+ EV
Sbjct  199  KRGDKQIKLPCKHFYHNKCITKWLTINKICPICNIEV  235



>ref|NP_001150748.1| protein binding protein [Zea mays]
 gb|ACG40201.1| protein binding protein [Zea mays]
Length=322

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQ-SLTSKTLVDRCVVCQLEYDEG  283
            PD  SYEEL+ALGE+VG E+RGLS A+   SL   T++         ++CV+C++E +EG
Sbjct  222  PDEYSYEELVALGEVVGTENRGLS-ADTLGSLPSVTYKLQHVQDGNTEQCVICRVELEEG  280

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E L+ALPC H YH ECI  WLQI KVCP+CS EVS++ +
Sbjct  281  ESLIALPCKHLYHPECINQWLQINKVCPMCSAEVSTSGN  319



>tpg|DAA62493.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=322

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQ-SLTSKTLVDRCVVCQLEYDEG  283
            PD  SYEEL+ALGE+VG E+RGLS A+   SL   T++         ++CV+C++E +EG
Sbjct  222  PDEYSYEELVALGEVVGTENRGLS-ADTLGSLPSVTYKLQHVQDGNTEQCVICRVELEEG  280

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E L+ALPC H YH ECI  WLQI KVCP+CS EVS++ +
Sbjct  281  ESLIALPCKHLYHPECINQWLQINKVCPMCSAEVSTSGN  319



>ref|XP_008461282.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X1 [Cucumis 
melo]
 ref|XP_008461283.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X1 [Cucumis 
melo]
Length=254

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 67/97 (69%), Gaps = 6/97 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTS----KTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG ESRGLSE +I  SL P+    LTS    K L +RCV+CQ+ Y
Sbjct  147  PDHMTYEELLDLGESVGTESRGLSEEQI--SLLPTARCKLTSFFSRKKLDERCVICQMRY  204

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
              G+K + LPC H YH +CIT WL I K+CPIC+ EV
Sbjct  205  KRGDKQIKLPCKHFYHNKCITKWLTINKICPICNIEV  241



>emb|CDX93901.1| BnaC04g20600D [Brassica napus]
Length=240

 Score =   103 bits (258),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 64/97 (66%), Gaps = 6/97 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEI----TKSLHPSTFQSLTSKTLVDRCVVCQLEY  274
            PD ++YEELI LGE VG ESRGLS+  I    T+     +F   + K   DRCV+CQL+Y
Sbjct  139  PDTMTYEELIELGEAVGSESRGLSQELIETLPTRKYKFGSF--FSRKRAGDRCVICQLKY  196

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
              GEK + LPC H YH ECI+ WL I K+CP+C+ EV
Sbjct  197  KIGEKQMNLPCKHVYHSECISKWLNINKICPVCNSEV  233



>ref|XP_009392890.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Musa 
acuminata subsp. malaccensis]
Length=292

 Score =   104 bits (260),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLT-SKTLVDRCVVCQLEYDEG  283
            PD   YEEL+ALGE+VG ESRGLS A++  SL    +++        ++CVVC+LEY++G
Sbjct  192  PDEYVYEELVALGEVVGTESRGLS-ADMIASLPSVNYKAENIQDDNSEQCVVCRLEYEDG  250

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
            + LV L C H YH ECI  WLQI KVCP+C+ EVS++ + +
Sbjct  251  DSLVLLSCKHKYHSECINKWLQINKVCPVCNAEVSTSGTKQ  291



>ref|XP_009138675.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X3 [Brassica 
rapa]
Length=204

 Score =   103 bits (256),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 64/97 (66%), Gaps = 6/97 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEI----TKSLHPSTFQSLTSKTLVDRCVVCQLEY  274
            PD ++YEELI LGE VG ESRGLS+  I    T+     +F   + K   DRCV+CQL+Y
Sbjct  103  PDTMTYEELIELGEAVGSESRGLSQELIETLPTRKYKFGSF--FSRKRAGDRCVICQLKY  160

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
              GEK + LPC H YH ECI+ WL I K+CP+C+ EV
Sbjct  161  KIGEKQMNLPCKHVYHSECISKWLSINKICPVCNSEV  197



>ref|XP_009138670.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X2 [Brassica 
rapa]
 ref|XP_009138671.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X2 [Brassica 
rapa]
 ref|XP_009138672.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X2 [Brassica 
rapa]
 ref|XP_009138674.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X2 [Brassica 
rapa]
 emb|CDY53710.1| BnaAnng12510D [Brassica napus]
Length=242

 Score =   103 bits (257),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 64/97 (66%), Gaps = 6/97 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEI----TKSLHPSTFQSLTSKTLVDRCVVCQLEY  274
            PD ++YEELI LGE VG ESRGLS+  I    T+     +F   + K   DRCV+CQL+Y
Sbjct  141  PDTMTYEELIELGEAVGSESRGLSQELIETLPTRKYKFGSF--FSRKRAGDRCVICQLKY  198

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
              GEK + LPC H YH ECI+ WL I K+CP+C+ EV
Sbjct  199  KIGEKQMNLPCKHVYHSECISKWLSINKICPVCNSEV  235



>ref|XP_009145730.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Brassica 
rapa]
Length=324

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 68/97 (70%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL+ALG++VG ESRGLS A+   SL    ++   ++   +  CV+C+L+Y++ 
Sbjct  224  PDELSYEELLALGDIVGTESRGLS-ADTIASLPSKRYKDGDNQNGTNESCVICRLDYEDD  282

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            + L+ LPC H YH ECI  WL+I K CP+CS EVS++
Sbjct  283  DDLILLPCKHSYHSECINNWLKINKSCPVCSAEVSTS  319



>gb|KDO52705.1| hypothetical protein CISIN_1g019980mg [Citrus sinensis]
Length=333

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 69/102 (68%), Gaps = 7/102 (7%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVD------RCVVCQL  268
            PD LSYEEL+ALGE+VG ESRGLS A+   +L    ++  TS+   +       CV+C+L
Sbjct  230  PDELSYEELLALGEVVGSESRGLS-ADTLATLPTVNYKGGTSQNGSNDSCLGFSCVICRL  288

Query  269  EYDEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            +Y++GE L  L C H YH ECI  WL+I KVCP+CS EVS++
Sbjct  289  DYEDGETLTVLSCKHSYHSECINNWLKINKVCPVCSAEVSTS  330



>emb|CDY25357.1| BnaA05g19270D [Brassica napus]
Length=320

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 68/97 (70%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL+ALG++VG ESRGLS A+   SL    ++   ++   +  CV+C+L+Y++ 
Sbjct  220  PDELSYEELLALGDIVGTESRGLS-ADTIASLPSKRYKDGDNQNGTNESCVICRLDYEDD  278

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            + L+ LPC H YH ECI  WL+I K CP+CS EVS++
Sbjct  279  DDLILLPCKHSYHSECINNWLKINKSCPVCSAEVSTS  315



>ref|XP_008394237.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Malus 
domestica]
Length=319

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL AL E+VG ESRGLS A+   SL   ++++ + +   +  CV+C+L+Y++G
Sbjct  221  PDELSYEELJALAEVVGTESRGLS-ADNIASLPSVSYKTGSXQNGSNESCVICRLDYEDG  279

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E L  L C H YH ECI  WL I KVCP+CS EVS++ +
Sbjct  280  ENLTLLSCKHSYHSECINNWLXINKVCPVCSAEVSTSGN  318



>gb|EYU20483.1| hypothetical protein MIMGU_mgv1a013375mg [Erythranthe guttata]
Length=222

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 65/95 (68%), Gaps = 2/95 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSL-TSKTLVDRCVVCQLEYDEG  283
            PD LSYEELIALG+++G ESRGLS A+   SL    + S  T +   D CV+C+L+Y++ 
Sbjct  124  PDELSYEELIALGDVIGTESRGLS-ADAIASLPSVNYNSKGTHEGNGDSCVICRLDYEDD  182

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVS  388
            + L  L C H YH ECI+ WL I KVCP+CS EVS
Sbjct  183  DNLTVLSCKHLYHPECISNWLNINKVCPVCSAEVS  217



>ref|XP_009138669.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X1 [Brassica 
rapa]
Length=303

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 64/97 (66%), Gaps = 6/97 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEI----TKSLHPSTFQSLTSKTLVDRCVVCQLEY  274
            PD ++YEELI LGE VG ESRGLS+  I    T+     +F   + K   DRCV+CQL+Y
Sbjct  202  PDTMTYEELIELGEAVGSESRGLSQELIETLPTRKYKFGSF--FSRKRAGDRCVICQLKY  259

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
              GEK + LPC H YH ECI+ WL I K+CP+C+ EV
Sbjct  260  KIGEKQMNLPCKHVYHSECISKWLSINKICPVCNSEV  296



>ref|XP_006482888.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X3 [Citrus 
sinensis]
Length=239

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 70/102 (69%), Gaps = 6/102 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPST---FQSLT-SKTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG +SRGLS+ +I  +L P++   F +L   K   +RCV+CQ++Y
Sbjct  138  PDNMTYEELLDLGETVGTQSRGLSQEQI--NLLPTSKYKFGNLFLRKRSGERCVICQMKY  195

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
              G++ + LPC H YH ECIT WL I K+CPIC+ EV   +S
Sbjct  196  KRGDRQMKLPCRHVYHSECITKWLGINKICPICNNEVFGDES  237



>ref|XP_009395284.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Musa 
acuminata subsp. malaccensis]
Length=282

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 68/98 (69%), Gaps = 0/98 (0%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDRCVVCQLEYDEGE  286
            PD  SYEELIALGE+VG E+RGLS  +I+     S   +    +  ++CV+C+LEY++G+
Sbjct  184  PDEYSYEELIALGEVVGTENRGLSVDKISALPLVSYTANNVQDSNAEQCVICRLEYEDGD  243

Query  287  KLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             L+ L C H YH ECI  WLQI KVCP C+ EVS++++
Sbjct  244  SLMLLSCKHRYHFECINKWLQINKVCPACNAEVSTSEN  281



>ref|XP_006482886.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X1 [Citrus 
sinensis]
 ref|XP_006482887.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X2 [Citrus 
sinensis]
Length=247

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 70/102 (69%), Gaps = 6/102 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPST---FQSLT-SKTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG +SRGLS+ +I  +L P++   F +L   K   +RCV+CQ++Y
Sbjct  146  PDNMTYEELLDLGETVGTQSRGLSQEQI--NLLPTSKYKFGNLFLRKRSGERCVICQMKY  203

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
              G++ + LPC H YH ECIT WL I K+CPIC+ EV   +S
Sbjct  204  KRGDRQMKLPCRHVYHSECITKWLGINKICPICNNEVFGDES  245



>gb|KDP43466.1| hypothetical protein JCGZ_16753 [Jatropha curcas]
Length=238

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 67/102 (66%), Gaps = 6/102 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPST---FQSLTS-KTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG +SRGLSE  I  SL P++   F    S K   +RCV+CQ+ Y
Sbjct  137  PDNMTYEELLDLGETVGTQSRGLSEELI--SLLPTSKCKFGGFFSRKKAGERCVICQMRY  194

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
              G+K + LPC H YH ECIT WL I K+CP+C+ EV   +S
Sbjct  195  KRGDKQMKLPCKHVYHSECITKWLGINKICPVCNNEVFGEES  236



>ref|XP_006439127.1| hypothetical protein CICLE_v10032570mg [Citrus clementina]
 gb|ESR52367.1| hypothetical protein CICLE_v10032570mg [Citrus clementina]
Length=245

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 70/102 (69%), Gaps = 6/102 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPST---FQSLT-SKTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG +SRGLS+ +I  +L P++   F +L   K   +RCV+CQ++Y
Sbjct  144  PDNMTYEELLDLGETVGTQSRGLSQEQI--NLLPTSKYKFGNLFLRKRSGERCVICQMKY  201

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
              G++ + LPC H YH ECIT WL I K+CPIC+ EV   +S
Sbjct  202  KRGDRQMKLPCRHVYHSECITKWLGINKICPICNNEVFGDES  243



>ref|XP_006292296.1| hypothetical protein CARUB_v10018505mg [Capsella rubella]
 gb|EOA25194.1| hypothetical protein CARUB_v10018505mg [Capsella rubella]
Length=243

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (69%), Gaps = 4/96 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQS---LTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG ESRGLS+ E+ ++L    F+     + K   +RCV+CQL+Y 
Sbjct  142  PDTMTYEELVELGEAVGTESRGLSQ-ELIETLPTRKFKFGSIFSRKRAGERCVICQLKYK  200

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
             GE+ + LPC H YH ECI+ WL I KVCP+C+ EV
Sbjct  201  IGERQMNLPCKHVYHSECISKWLSINKVCPVCNTEV  236



>emb|CDP07764.1| unnamed protein product [Coffea canephora]
Length=262

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 67/101 (66%), Gaps = 4/101 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQS---LTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG E+RGLS+ E+   L  S ++S    + K   +RCV+CQ+ Y 
Sbjct  161  PDNMTYEELLELGEAVGTENRGLSQ-ELIDLLPTSKYKSGGIFSKKRSTERCVICQMRYK  219

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             G++ + LPC H YH  C + WL+I K CPIC+ EVSS +S
Sbjct  220  RGDRQINLPCKHVYHAHCGSKWLRINKTCPICNTEVSSEES  260



>gb|EYU35575.1| hypothetical protein MIMGU_mgv1a010240mg [Erythranthe guttata]
Length=318

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 65/95 (68%), Gaps = 2/95 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSL-TSKTLVDRCVVCQLEYDEG  283
            PD LSYEELIALG+++G ESRGLS A+   SL    + S  T +   D CV+C+L+Y++ 
Sbjct  220  PDELSYEELIALGDVIGTESRGLS-ADAIASLPSVNYNSKGTHEGNGDSCVICRLDYEDD  278

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVS  388
            + L  L C H YH ECI+ WL I KVCP+CS EVS
Sbjct  279  DNLTVLSCKHLYHPECISNWLNINKVCPVCSAEVS  313



>ref|XP_008364357.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Malus domestica]
Length=253

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 67/103 (65%), Gaps = 4/103 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITK---SLHPSTFQSLTSKTLVDRCVVCQLEYD  277
            PD++SYEEL+ LGE VG ++RGLS+ +I+    S +  +F S   K+  +RCV+CQ+EY 
Sbjct  150  PDIMSYEELLELGETVGTQNRGLSQDQISLLPISKYKCSFFS-RKKSRDERCVICQMEYK  208

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
             G++ +ALPC H YH  C T WL I K CPIC  EV    S R
Sbjct  209  RGDRRIALPCKHLYHAGCGTRWLSINKACPICYTEVFGDASKR  251



>gb|ADE77661.1| unknown [Picea sitchensis]
Length=282

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 68/95 (72%), Gaps = 2/95 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLT-SKTLVDRCVVCQLEYDEG  283
            PD + YEEL+AL E+VG ESRGL+  ++  SL  S F   T S +  +RCV+C+LEY+ G
Sbjct  184  PDNMLYEELVALSEVVGTESRGLA-PDLISSLPLSKFVPETPSSSNSERCVICRLEYEGG  242

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVS  388
            + ++ LPC H YH +CI  WLQIKKVCP+C+ EVS
Sbjct  243  DIILTLPCKHQYHSDCIKNWLQIKKVCPVCNVEVS  277



>ref|XP_007132006.1| hypothetical protein PHAVU_011G058800g [Phaseolus vulgaris]
 gb|ESW04000.1| hypothetical protein PHAVU_011G058800g [Phaseolus vulgaris]
Length=248

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 65/101 (64%), Gaps = 4/101 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQ---SLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGL+  +I+ SL  S F+    L  K+  +RCV+CQ+EY 
Sbjct  146  PDNMTYEELLELGEAVGTQSRGLTHEQIS-SLPVSKFKCGFFLRKKSRGERCVICQMEYK  204

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             G+K + LPC H YH  C   WL I K CPIC  EV + KS
Sbjct  205  RGDKRITLPCKHLYHASCGNRWLSINKACPICYTEVFADKS  245



>ref|NP_680148.1| E3 ubiquitin ligase BIG BROTHER [Arabidopsis thaliana]
 ref|NP_001030922.1| E3 ubiquitin ligase BIG BROTHER [Arabidopsis thaliana]
 sp|Q8L649.1|BB_ARATH RecName: Full=E3 ubiquitin ligase BIG BROTHER; AltName: Full=Protein 
ENHANCER OF DA1-1 [Arabidopsis thaliana]
 emb|CAD32249.1| putative protein [Arabidopsis thaliana]
 gb|AAQ22666.1| At3g63530 [Arabidopsis thaliana]
 dbj|BAE99660.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE80499.1| E3 ubiquitin ligase BIG BROTHER [Arabidopsis thaliana]
 gb|AEE80500.1| E3 ubiquitin ligase BIG BROTHER [Arabidopsis thaliana]
Length=248

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 66/96 (69%), Gaps = 4/96 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQS---LTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG ESRGLS+ E+ ++L    ++     + K   +RCV+CQL+Y 
Sbjct  147  PDTMTYEELVELGEAVGTESRGLSQ-ELIETLPTKKYKFGSIFSRKRAGERCVICQLKYK  205

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
             GE+ + LPC H YH ECI+ WL I KVCP+C+ EV
Sbjct  206  IGERQMNLPCKHVYHSECISKWLSINKVCPVCNSEV  241



>emb|CDY24595.1| BnaC05g32790D [Brassica napus]
Length=315

 Score =   102 bits (253),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 67/97 (69%), Gaps = 2/97 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL+ALG++VG ESRGLS A+   SL    ++   ++   +  CV+C+L+Y++ 
Sbjct  215  PDELSYEELLALGDIVGTESRGLS-ADTIASLPSKRYKDGDNQNGTNESCVICRLDYEDD  273

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSA  394
            + L+ LPC H YH  CI  WL+I K CP+CS EVS++
Sbjct  274  DDLILLPCKHSYHSGCINNWLKINKSCPVCSAEVSTS  310



>ref|XP_008231277.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Prunus mume]
Length=245

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQ---SLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGLS+ E+   L  S ++     + K   +RCV+CQ+ Y 
Sbjct  144  PDNMTYEELLDLGEAVGTQSRGLSD-ELISLLPTSKYKCGSFFSRKKSGERCVICQMRYK  202

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             G++ + LPC H YH ECI+ WL I KVCP+C+ EVSS +S
Sbjct  203  RGDRQINLPCKHVYHSECISKWLGINKVCPVCNLEVSSEES  243



>ref|XP_006591894.1| PREDICTED: uncharacterized protein LOC100805963 isoform X1 [Glycine 
max]
 ref|XP_006591895.1| PREDICTED: uncharacterized protein LOC100805963 isoform X2 [Glycine 
max]
 ref|XP_006591896.1| PREDICTED: uncharacterized protein LOC100805963 isoform X3 [Glycine 
max]
 ref|XP_006591897.1| PREDICTED: uncharacterized protein LOC100805963 isoform X4 [Glycine 
max]
 ref|XP_006591898.1| PREDICTED: uncharacterized protein LOC100805963 isoform X5 [Glycine 
max]
 gb|KHN25248.1| E3 ubiquitin ligase BIG BROTHER [Glycine soja]
Length=248

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 66/101 (65%), Gaps = 4/101 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQ---SLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGL++ +I+ SL  S ++    L  K+  +RCV+CQ+EY 
Sbjct  146  PDNMTYEELLELGEAVGTQSRGLTQEQIS-SLPVSKYKCGFFLRKKSRDERCVICQMEYK  204

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             G+K + LPC H YH  C   WL I K CPIC  EV + KS
Sbjct  205  RGDKRITLPCKHVYHASCGNKWLSINKACPICYTEVFADKS  245



>ref|XP_004142225.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Cucumis sativus]
 ref|XP_004161701.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Cucumis sativus]
Length=241

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 65/103 (63%), Gaps = 4/103 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSE---AEITKSLHPSTFQSLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGL++   A +  S +   F S   K+  +RCV+CQ+EY 
Sbjct  140  PDNMTYEELVDLGETVGTQSRGLTQELIALLPVSRYRWGFFS-RKKSRNERCVICQMEYK  198

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
             G+K++ LPC H YH  C T WL IKK CPIC  EV    S R
Sbjct  199  RGDKIITLPCKHKYHTSCGTKWLSIKKACPICYTEVFGDTSKR  241



>ref|XP_010536033.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X1 [Tarenaya 
hassleriana]
Length=255

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 67/103 (65%), Gaps = 4/103 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQ-SLTS--KTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGLS+ +I   L  S ++ SL +  K+  DRCV+CQ+EY 
Sbjct  153  PDNMTYEELLELGETVGTQSRGLSQ-DIISRLPVSKYKCSLFTRKKSGKDRCVICQMEYK  211

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
              E+++ LPC H YH +C T WL I K CPIC  EVS     R
Sbjct  212  RRERMITLPCTHAYHVDCGTKWLSINKACPICYTEVSVGAKSR  254



>ref|XP_003558702.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X2 [Brachypodium 
distachyon]
Length=251

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 66/103 (64%), Gaps = 4/103 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITK---SLHPSTFQSLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGLS+  I+    + +   F S   KT  +RCV+CQ+EY 
Sbjct  149  PDNMTYEELLDLGEAVGTQSRGLSQERISSLPVTKYKCGFFS-RKKTRRERCVICQMEYR  207

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
             G+  +ALPC H YH  C+T WL I KVCP+C  EV S +  R
Sbjct  208  RGDLQMALPCKHVYHASCVTRWLSINKVCPVCFAEVPSEEPSR  250



>ref|XP_004507101.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X3 [Cicer 
arietinum]
Length=248

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 66/102 (65%), Gaps = 6/102 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHP-STFQ---SLTSKTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG +SRGL++ +I  SL P S F+    L  K+  +RCV+CQ+EY
Sbjct  146  PDNMTYEELLELGEAVGTQSRGLTQEQI--SLLPVSKFKCGFFLRKKSRDERCVICQMEY  203

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
              G+K + LPC H YH  C   WL I K CPIC  EV + KS
Sbjct  204  KRGDKRITLPCKHVYHASCGNKWLSINKACPICYTEVFADKS  245



>gb|KGN54171.1| hypothetical protein Csa_4G290860 [Cucumis sativus]
Length=249

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 65/103 (63%), Gaps = 4/103 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSE---AEITKSLHPSTFQSLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGL++   A +  S +   F S   K+  +RCV+CQ+EY 
Sbjct  148  PDNMTYEELVDLGETVGTQSRGLTQELIALLPVSRYRWGFFS-RKKSRNERCVICQMEYK  206

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
             G+K++ LPC H YH  C T WL IKK CPIC  EV    S R
Sbjct  207  RGDKIITLPCKHKYHTSCGTKWLSIKKACPICYTEVFGDTSKR  249



>ref|XP_008449726.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X2 [Cucumis 
melo]
Length=237

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 62/104 (60%), Gaps = 6/104 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEIT----KSLHPSTFQSLTSKTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG +SRGL++  I      S     F    S+   +RCV+CQ+EY
Sbjct  136  PDNMTYEELVDLGETVGTQSRGLTQELIALLPVSSYRWGFFSRKKSRN--ERCVICQMEY  193

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
              G+K++ LPC H YH  C T WL IKK CPIC  EV    S R
Sbjct  194  KRGDKIITLPCKHRYHTSCGTKWLSIKKACPICYTEVFGDTSKR  237



>ref|XP_006590306.1| PREDICTED: uncharacterized protein LOC100793907 isoform X1 [Glycine 
max]
 ref|XP_006590307.1| PREDICTED: uncharacterized protein LOC100793907 isoform X2 [Glycine 
max]
 ref|XP_006590308.1| PREDICTED: uncharacterized protein LOC100793907 isoform X3 [Glycine 
max]
 ref|XP_006590309.1| PREDICTED: uncharacterized protein LOC100793907 isoform X4 [Glycine 
max]
 gb|KHN21899.1| E3 ubiquitin ligase BIG BROTHER [Glycine soja]
Length=248

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 66/101 (65%), Gaps = 4/101 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQ---SLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGL++ +I+ SL  S ++    L  K+  +RCV+CQ+EY 
Sbjct  146  PDNMTYEELLELGEAVGTQSRGLTQEQIS-SLPVSKYKCGFFLRKKSRDERCVICQMEYR  204

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             G+K + LPC H YH  C   WL I K CPIC  EV + KS
Sbjct  205  RGDKRITLPCKHVYHASCGNKWLSINKACPICYTEVFADKS  245



>ref|NP_001242079.1| uncharacterized protein LOC100793907 [Glycine max]
 gb|ACU17934.1| unknown [Glycine max]
Length=248

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 66/101 (65%), Gaps = 4/101 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQ---SLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGL++ +I+ SL  S ++    L  K+  +RCV+CQ+EY 
Sbjct  146  PDNMTYEELLELGEAVGTQSRGLTQEQIS-SLPVSKYKCGFFLRKKSRDERCVICQMEYR  204

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             G+K + LPC H YH  C   WL I K CPIC  EV + KS
Sbjct  205  RGDKRITLPCKHVYHASCGNKWLSINKACPICYTEVFADKS  245



>ref|XP_008449725.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X1 [Cucumis 
melo]
Length=242

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 62/104 (60%), Gaps = 6/104 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEIT----KSLHPSTFQSLTSKTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG +SRGL++  I      S     F    S+   +RCV+CQ+EY
Sbjct  141  PDNMTYEELVDLGETVGTQSRGLTQELIALLPVSSYRWGFFSRKKSRN--ERCVICQMEY  198

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
              G+K++ LPC H YH  C T WL IKK CPIC  EV    S R
Sbjct  199  KRGDKIITLPCKHRYHTSCGTKWLSIKKACPICYTEVFGDTSKR  242



>ref|XP_002531910.1| protein binding protein, putative [Ricinus communis]
 gb|EEF30483.1| protein binding protein, putative [Ricinus communis]
Length=240

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 67/102 (66%), Gaps = 6/102 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPST---FQSLT-SKTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG +SRGLS+  I  SL P++   F+S    K   +RCV+CQ+ Y
Sbjct  139  PDNMTYEELLDLGETVGTQSRGLSQELI--SLLPTSKCKFRSFFLRKKAGERCVICQMRY  196

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
              G+K + LPC H YH ECI+ WL I KVCP+C+ EV    S
Sbjct  197  KRGDKQMKLPCKHVYHSECISKWLGINKVCPVCNNEVFGEDS  238



>ref|XP_010413127.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Camelina sativa]
 ref|XP_010413129.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Camelina sativa]
 ref|XP_010413130.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Camelina sativa]
Length=245

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 64/95 (67%), Gaps = 2/95 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEI-TKSLHPSTFQSLTS-KTLVDRCVVCQLEYDE  280
            PD ++YEEL+ LGE VG ESRGLS+  I T       F S+ S K   +RCV+CQL+Y  
Sbjct  144  PDTMTYEELVELGEAVGTESRGLSQELIETLPTRKYKFGSIFSRKRAGERCVICQLKYKI  203

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
            GE+ + LPC H YH ECI+ WL I KVCP+C+ EV
Sbjct  204  GERQMDLPCKHVYHSECISKWLSINKVCPVCNTEV  238



>ref|NP_001242183.1| uncharacterized protein LOC100805963 [Glycine max]
 gb|ACU17830.1| unknown [Glycine max]
Length=192

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 66/101 (65%), Gaps = 4/101 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQ---SLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGL++ +I+ SL  S ++    L  K+  +RCV+CQ+EY 
Sbjct  90   PDNMTYEELLELGEAVGTQSRGLTQEQIS-SLPVSKYKCGFFLRKKSRDERCVICQMEYK  148

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             G++ + LPC H YH  C   WL I K CPIC  EV + KS
Sbjct  149  RGDERITLPCKHVYHASCGNKWLSINKACPICYTEVFADKS  189



>ref|XP_009418697.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Musa 
acuminata subsp. malaccensis]
Length=264

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 71/101 (70%), Gaps = 2/101 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLT-SKTLVDRCVVCQLEYDEG  283
            PD   YEEL+ALGELVG ESRGLS A+   +L   ++++ +      ++C++C+LE+++G
Sbjct  164  PDEFMYEELVALGELVGTESRGLS-ADTISALPSVSYKAESVQDDNAEQCIICRLEFEDG  222

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
            + LV L C H YH +CI  WLQI K CP+C+ EVS++++ +
Sbjct  223  DSLVLLSCKHKYHPDCINKWLQINKACPMCNTEVSTSENKQ  263



>ref|XP_009397505.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397506.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Musa acuminata 
subsp. malaccensis]
Length=255

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 64/95 (67%), Gaps = 3/95 (3%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQS--LTSKTLVDRCVVCQLEYDE  280
            PD +SYEEL  LGE +G ESRGLS+ E+   L  ST+++   + K   ++CV+C + Y  
Sbjct  159  PDSMSYEELQQLGETIGAESRGLSD-ELISLLQSSTYKTGLFSRKDKSEKCVICCMAYKN  217

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
             +KL+ LPC H YH  CIT WL+I K CP+CSEEV
Sbjct  218  RDKLIKLPCQHQYHKVCITKWLKINKACPVCSEEV  252



>ref|XP_002878521.1| hypothetical protein ARALYDRAFT_324777 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54780.1| hypothetical protein ARALYDRAFT_324777 [Arabidopsis lyrata subsp. 
lyrata]
Length=247

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 64/95 (67%), Gaps = 2/95 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEI-TKSLHPSTFQSLTS-KTLVDRCVVCQLEYDE  280
            PD ++YEEL+ LGE VG ESRGLS+  I T       F S+ S K   +RCV+CQL+Y  
Sbjct  146  PDTMTYEELVELGEAVGTESRGLSQELIETLPTRKYKFGSIFSRKRAGERCVICQLKYKI  205

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
            G++ + LPC H YH ECI+ WL I KVCP+C+ EV
Sbjct  206  GDRQMNLPCKHVYHSECISKWLSINKVCPVCNSEV  240



>ref|XP_010512780.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Camelina sativa]
 ref|XP_010512781.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Camelina sativa]
 ref|XP_010512782.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Camelina sativa]
Length=245

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 64/95 (67%), Gaps = 2/95 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEI-TKSLHPSTFQSLTS-KTLVDRCVVCQLEYDE  280
            PD ++YEEL+ LGE VG ESRGLS+  I T       F S+ S K   +RCV+CQL+Y  
Sbjct  144  PDTMTYEELVELGEAVGSESRGLSQELIETLPTRKYKFGSIFSRKRAGERCVICQLKYKI  203

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
            GE+ + LPC H YH ECI+ WL I KVCP+C+ EV
Sbjct  204  GERQMDLPCKHVYHSECISKWLSINKVCPVCNTEV  238



>ref|XP_007218202.1| hypothetical protein PRUPE_ppa010554mg [Prunus persica]
 gb|EMJ19401.1| hypothetical protein PRUPE_ppa010554mg [Prunus persica]
Length=245

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 67/101 (66%), Gaps = 4/101 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQ---SLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGLS+ E+   L  S ++     + K   +RCV+CQ+ Y 
Sbjct  144  PDNMTYEELLDLGEAVGTQSRGLSD-ELISLLPTSKYKCGSFFSRKKSGERCVICQMRYK  202

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             G++ + LPC H YH ECI+ WL I KVCP+C+ EVS  +S
Sbjct  203  RGDRQINLPCKHVYHSECISKWLGINKVCPVCNLEVSGEES  243



>ref|XP_009375062.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Pyrus x bretschneideri]
Length=253

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 65/96 (68%), Gaps = 4/96 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITK---SLHPSTFQSLTSKTLVDRCVVCQLEYD  277
            PD++SYEEL+ LGE VG ++RGLS+ +I+    S +  +F S   K+  +RCV+CQ+EY 
Sbjct  150  PDIMSYEELLELGETVGTQNRGLSQDQISLLPISKYKCSFFS-RKKSRDERCVICQMEYK  208

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
             G++ +ALPC H YH  C T WL I K CPIC  EV
Sbjct  209  RGDRRIALPCKHLYHAGCGTRWLSINKACPICYTEV  244



>ref|XP_009364991.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Pyrus x bretschneideri]
Length=245

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 66/102 (65%), Gaps = 6/102 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPST----FQSLTSKTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG +SRGLSE  I  SL PS+          K   +RCV+CQ++Y
Sbjct  144  PDTMTYEELLDLGEAVGTQSRGLSEELI--SLLPSSKYKCGNFFLRKKSGERCVICQMQY  201

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
              G++ + LPC H YH ECI+ WL I KVCP+C+ EV   +S
Sbjct  202  KRGDRQITLPCKHVYHSECISKWLGINKVCPVCNLEVFGEES  243



>ref|XP_003606782.1| E3 ubiquitin-protein ligase [Medicago truncatula]
Length=254

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 65/102 (64%), Gaps = 6/102 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHP-STFQ---SLTSKTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG +SRGL++ +I  SL P S F+       K+  +RCV+CQ+EY
Sbjct  152  PDNMTYEELLELGEAVGTQSRGLTQEQI--SLLPVSKFKCGFFFRKKSRNERCVICQMEY  209

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
              G+K + LPC H YH  C   WL I K CPIC  EV + KS
Sbjct  210  KRGDKRITLPCKHLYHASCGNKWLTINKACPICYTEVFADKS  251



>ref|XP_003606783.1| E3 ubiquitin-protein ligase [Medicago truncatula]
Length=242

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 65/102 (64%), Gaps = 6/102 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHP-STFQ---SLTSKTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG +SRGL++ +I  SL P S F+       K+  +RCV+CQ+EY
Sbjct  140  PDNMTYEELLELGEAVGTQSRGLTQEQI--SLLPVSKFKCGFFFRKKSRNERCVICQMEY  197

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
              G+K + LPC H YH  C   WL I K CPIC  EV + KS
Sbjct  198  KRGDKRITLPCKHLYHASCGNKWLTINKACPICYTEVFADKS  239



>ref|XP_003592713.1| RING finger protein [Medicago truncatula]
 gb|AES62964.1| RING-finger ubiquitin ligase [Medicago truncatula]
Length=333

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 66/100 (66%), Gaps = 4/100 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTL--VDRCVVCQLEYDE  280
            PD LSYEEL+ALGE+VG ESRGLS   I  +  PS      S  L   D CV+C+++Y++
Sbjct  234  PDELSYEELLALGEVVGTESRGLSTDTI--ACLPSVNYKAGSDQLGSNDSCVICRVDYED  291

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             E L  L C H YH ECI  WL+I KVCP+CS EVS++ S
Sbjct  292  DESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVSASGS  331



>ref|XP_010229112.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X1 [Brachypodium 
distachyon]
Length=252

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 63/103 (61%), Gaps = 3/103 (3%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITK---SLHPSTFQSLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGLS+  I+    + +   F S        RCV+CQ+EY 
Sbjct  149  PDNMTYEELLDLGEAVGTQSRGLSQERISSLPVTKYKCGFFSRKKTRRESRCVICQMEYR  208

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
             G+  +ALPC H YH  C+T WL I KVCP+C  EV S +  R
Sbjct  209  RGDLQMALPCKHVYHASCVTRWLSINKVCPVCFAEVPSEEPSR  251



>gb|ACJ85919.1| unknown [Medicago truncatula]
 gb|AFK45820.1| unknown [Medicago truncatula]
Length=339

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 66/100 (66%), Gaps = 4/100 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTL--VDRCVVCQLEYDE  280
            PD LSYEEL+ALGE+VG ESRGLS   I  +  PS      S  L   D CV+C+++Y++
Sbjct  240  PDELSYEELLALGEVVGTESRGLSTDTI--ACLPSVNYKAGSDQLGSNDSCVICRVDYED  297

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             E L  L C H YH ECI  WL+I KVCP+CS EVS++ S
Sbjct  298  DESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVSASGS  337



>ref|XP_003592714.1| RING finger protein [Medicago truncatula]
 gb|AES62965.1| RING-finger ubiquitin ligase [Medicago truncatula]
Length=339

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 66/100 (66%), Gaps = 4/100 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTL--VDRCVVCQLEYDE  280
            PD LSYEEL+ALGE+VG ESRGLS   I  +  PS      S  L   D CV+C+++Y++
Sbjct  240  PDELSYEELLALGEVVGTESRGLSTDTI--ACLPSVNYKAGSDQLGSNDSCVICRVDYED  297

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             E L  L C H YH ECI  WL+I KVCP+CS EVS++ S
Sbjct  298  DESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVSASGS  337



>gb|AES88979.2| E3 ubiquitin ligase BIG brother-like protein [Medicago truncatula]
Length=248

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 65/102 (64%), Gaps = 6/102 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHP-STFQ---SLTSKTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG +SRGL++ +I  SL P S F+       K+  +RCV+CQ+EY
Sbjct  146  PDNMTYEELLELGEAVGTQSRGLTQEQI--SLLPVSKFKCGFFFRKKSRNERCVICQMEY  203

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
              G+K + LPC H YH  C   WL I K CPIC  EV + KS
Sbjct  204  KRGDKRITLPCKHLYHASCGNKWLTINKACPICYTEVFADKS  245



>gb|AES88980.2| E3 ubiquitin ligase BIG brother-like protein [Medicago truncatula]
Length=255

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 65/102 (64%), Gaps = 6/102 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHP-STFQ---SLTSKTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG +SRGL++ +I  SL P S F+       K+  +RCV+CQ+EY
Sbjct  153  PDNMTYEELLELGEAVGTQSRGLTQEQI--SLLPVSKFKCGFFFRKKSRNERCVICQMEY  210

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
              G+K + LPC H YH  C   WL I K CPIC  EV + KS
Sbjct  211  KRGDKRITLPCKHLYHASCGNKWLTINKACPICYTEVFADKS  252



>gb|AFW65659.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=271

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKT-LVDRCVVCQLEYDEG  283
            PD  SYEELIALGE+VG ES+GL+ A+   SL   T+Q+   +   +++CV+C++E+DEG
Sbjct  187  PDEYSYEELIALGEVVGTESKGLA-ADTIASLPWVTYQAQDKQDGNMEQCVICRVEFDEG  245

Query  284  EKLVALPCDHPYHCECITTWLQIKKV  361
            E LVALPC HPYH ECI  WLQ+ K 
Sbjct  246  ESLVALPCKHPYHSECINQWLQLNKA  271



>ref|XP_004165039.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like, partial [Cucumis 
sativus]
Length=138

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 64/103 (62%), Gaps = 4/103 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSE---AEITKSLHPSTFQSLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGLS+   A +  S +  +F S   K+  +RCV+CQ+EY 
Sbjct  37   PDNMTYEELLELGETVGTQSRGLSQELIALLPISKYKYSFFS-RKKSRGERCVICQMEYK  95

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
             G++ + LPC H YH  C T WL I K CPIC  EV    S R
Sbjct  96   RGDRRITLPCKHIYHAGCGTKWLSINKACPICYTEVFGDTSKR  138



>gb|AFK44486.1| unknown [Medicago truncatula]
Length=248

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 65/102 (64%), Gaps = 6/102 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHP-STFQ---SLTSKTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG +SRGL++ +I  SL P S F+       K+  +RCV+CQ+EY
Sbjct  146  PDNMTYEELLELGEAVGTQSRGLTQEQI--SLLPVSKFKCGFFFRKKSRNERCVICQMEY  203

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
              G+K + LPC H YH  C   WL I K CPIC  EV + KS
Sbjct  204  KRGDKRITLPCKHLYHASCGNKWLTINKACPICYTEVFADKS  245



>gb|EPS58031.1| hypothetical protein M569_16786, partial [Genlisea aurea]
Length=103

 Score = 95.9 bits (237),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 63/96 (66%), Gaps = 4/96 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQS---LTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE+VG ESRGLS+ E+   L  S  +S    + +   DRC++CQ+ Y 
Sbjct  8    PDNMTYEELLDLGEVVGRESRGLSQ-ELIDLLPTSKHKSSGIFSRRKSEDRCIICQMRYK  66

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
             G++L+ LPC H YH  C + WL I K CP+C+ EV
Sbjct  67   RGDRLINLPCKHAYHAHCGSKWLSINKTCPVCNIEV  102



>ref|XP_011042092.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Populus euphratica]
 ref|XP_011042093.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Populus euphratica]
 ref|XP_011042094.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Populus euphratica]
 ref|XP_011042096.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Populus euphratica]
 ref|XP_011042097.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Populus euphratica]
 ref|XP_011042098.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Populus euphratica]
Length=249

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 63/96 (66%), Gaps = 4/96 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEIT---KSLHPSTFQSLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG ++RGLS+ +I+    S +  +F S   K+  +RCV+CQ+EY 
Sbjct  148  PDNMTYEELLELGETVGTQNRGLSQEQISLLPTSKYKRSFFS-RRKSRSERCVICQMEYK  206

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
             G++ + LPC H YH  C T WL I K CPIC  EV
Sbjct  207  RGDRQITLPCKHIYHAGCGTRWLSINKACPICYSEV  242



>ref|XP_007052540.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007052541.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX96697.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX96698.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
Length=242

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 67/101 (66%), Gaps = 6/101 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPST---FQSLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE +G +SRGLS+  I   L P++   F S  S T  +RCV+CQ+ Y 
Sbjct  143  PDNMTYEELLDLGETIGSQSRGLSQELI--DLLPTSKCKFGSFFS-TKRERCVICQMRYK  199

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             GE+ + LPC H YH +CIT WL I K+CP+C+ EV   +S
Sbjct  200  RGEQQMKLPCKHVYHSQCITKWLSINKICPVCNNEVFGEES  240



>ref|XP_002303894.2| hypothetical protein POPTR_0003s20350g [Populus trichocarpa]
 ref|XP_006386020.1| hypothetical protein POPTR_0003s20350g [Populus trichocarpa]
 ref|XP_006386021.1| hypothetical protein POPTR_0003s20350g [Populus trichocarpa]
 ref|XP_006386022.1| hypothetical protein POPTR_0003s20350g [Populus trichocarpa]
 gb|EEE78873.2| hypothetical protein POPTR_0003s20350g [Populus trichocarpa]
 gb|ERP63817.1| hypothetical protein POPTR_0003s20350g [Populus trichocarpa]
 gb|ERP63818.1| hypothetical protein POPTR_0003s20350g [Populus trichocarpa]
 gb|ERP63819.1| hypothetical protein POPTR_0003s20350g [Populus trichocarpa]
Length=249

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 63/96 (66%), Gaps = 4/96 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEIT---KSLHPSTFQSLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG ++RGLS+ +I+    S +  +F S   K+  +RCV+CQ+EY 
Sbjct  148  PDNMTYEELLELGETVGTQNRGLSQEQISLLPTSKYKRSFFS-RRKSRSERCVICQMEYK  206

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
             G++ + LPC H YH  C T WL I K CPIC  EV
Sbjct  207  RGDRQITLPCKHIYHAGCGTRWLSINKACPICYSEV  242



>ref|XP_010031812.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Eucalyptus grandis]
 ref|XP_010031813.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Eucalyptus grandis]
 gb|KCW51197.1| hypothetical protein EUGRSUZ_J00783 [Eucalyptus grandis]
Length=251

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 65/104 (63%), Gaps = 4/104 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITK---SLHPSTFQSLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGLS+ +I+    S +   F S   K+  +RCV+CQ+EY 
Sbjct  145  PDNMTYEELLELGETVGTQSRGLSQEQISLLPISKYKRGFFS-RRKSRDERCVICQMEYK  203

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPRI  409
             G++ + LPC+H YH  C   WL I K CPIC  EV    S R+
Sbjct  204  RGDRRMTLPCNHMYHAGCGAKWLSINKACPICYTEVFVDASKRV  247



>gb|AFK40026.1| unknown [Lotus japonicus]
Length=149

 Score = 96.7 bits (239),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 65/102 (64%), Gaps = 6/102 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHP-STFQ---SLTSKTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG +SRGL+  +I  SL P S ++    L  K+  +RCV+CQ+EY
Sbjct  47   PDDMTYEELLELGEAVGTQSRGLTPEQI--SLLPVSKYKCGFFLRKKSRDERCVICQMEY  104

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
              G+K + LPC H YH  C   WL I K CPIC  EV + KS
Sbjct  105  KRGDKRITLPCKHVYHASCGNRWLSINKACPICYTEVFADKS  146



>ref|XP_004151219.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Cucumis sativus]
Length=187

 Score = 97.4 bits (241),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 64/103 (62%), Gaps = 4/103 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSE---AEITKSLHPSTFQSLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGLS+   A +  S +  +F S   K+  +RCV+CQ+EY 
Sbjct  86   PDNMTYEELLELGETVGTQSRGLSQELIALLPISKYKYSFFS-RKKSRGERCVICQMEYK  144

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
             G++ + LPC H YH  C T WL I K CPIC  EV    S R
Sbjct  145  RGDRRITLPCKHIYHAGCGTKWLSINKACPICYTEVFGDTSKR  187



>ref|XP_009376879.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Pyrus x bretschneideri]
Length=252

 Score = 98.6 bits (244),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 64/96 (67%), Gaps = 4/96 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITK---SLHPSTFQSLTSKTLVDRCVVCQLEYD  277
            PD +SYEEL+ LGE VG +SRGLS+ +I+    S +  +F S   K+  +RCV+CQ+EY 
Sbjct  149  PDSMSYEELLELGEAVGTQSRGLSQDQISLLPISKYKCSFFS-RKKSRDERCVICQMEYK  207

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
             G++ +ALPC H YH  C T WL I K CP+C  EV
Sbjct  208  RGDRRIALPCKHLYHAGCGTRWLSINKACPMCYTEV  243



>ref|XP_002299947.2| hypothetical protein POPTR_0001s27470g [Populus trichocarpa]
 ref|XP_006369632.1| hypothetical protein POPTR_0001s27470g [Populus trichocarpa]
 gb|EEE84752.2| hypothetical protein POPTR_0001s27470g [Populus trichocarpa]
 gb|ERP66201.1| hypothetical protein POPTR_0001s27470g [Populus trichocarpa]
Length=245

 Score = 98.6 bits (244),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 68/102 (67%), Gaps = 6/102 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPST---FQSLTS-KTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG +S+GLS   I  SL P++   F S  S K   +RCV+CQ++Y
Sbjct  144  PDTMTYEELVDLGETVGSQSKGLSPELI--SLLPTSKCKFGSFFSRKRSGERCVICQMKY  201

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
              G+K + L C H YH ECIT WL I KVCP+C++EV   +S
Sbjct  202  KRGDKQIKLLCKHAYHSECITKWLGINKVCPVCNDEVFGEES  243



>ref|XP_009355176.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Pyrus x bretschneideri]
Length=252

 Score = 98.6 bits (244),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 64/96 (67%), Gaps = 4/96 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITK---SLHPSTFQSLTSKTLVDRCVVCQLEYD  277
            PD +SYEEL+ LGE VG +SRGLS+ +I+    S +  +F S   K+  +RCV+CQ+EY 
Sbjct  149  PDSMSYEELLELGEAVGTQSRGLSQDQISLLPISKYKCSFFS-RKKSRDERCVICQMEYK  207

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
             G++ +ALPC H YH  C T WL I K CP+C  EV
Sbjct  208  RGDRRIALPCKHLYHAGCGTRWLSINKACPMCYTEV  243



>ref|XP_008349929.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X2 [Malus 
domestica]
Length=245

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 66/102 (65%), Gaps = 6/102 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPST----FQSLTSKTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG +SRGLS+  I  SL PS+          K   +RCV+CQ++Y
Sbjct  144  PDNMTYEELLDLGEAVGTQSRGLSDELI--SLLPSSKYKCGNFFLRKKSGERCVICQMQY  201

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
              G++ + LPC H YH ECI+ WL I KVCP+C+ EV   +S
Sbjct  202  KRGDRQITLPCKHVYHSECISKWLGINKVCPVCNLEVFGEES  243



>ref|XP_007142774.1| hypothetical protein PHAVU_007G015800g [Phaseolus vulgaris]
 gb|AGV54364.1| RING-finger protein [Phaseolus vulgaris]
 gb|ESW14768.1| hypothetical protein PHAVU_007G015800g [Phaseolus vulgaris]
Length=347

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 67/100 (67%), Gaps = 4/100 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTL--VDRCVVCQLEYDE  280
            PD LSYEEL+ALGE+VG ESRGLS   I  +  PS    + S      D CV+C++++++
Sbjct  248  PDELSYEELLALGEVVGTESRGLSTDTI--ACLPSLNYKIGSDQHGSNDSCVICRVDFED  305

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            GE L  L C H YH ECI  WL+I KVCP+CS EVS++ S
Sbjct  306  GESLTHLSCKHLYHPECINNWLKINKVCPVCSTEVSASGS  345



>dbj|BAJ88799.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=171

 Score = 96.7 bits (239),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 62/95 (65%), Gaps = 3/95 (3%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHP--STFQSLTSKTLVDRCVVCQLEYDE  280
            PD +SYE+L A+GE VG +SRGLS+ ++   L P  +     +SK   D CV+C+  Y  
Sbjct  76   PDNMSYEQLQAIGEEVGTQSRGLSD-DLISYLEPFRNKCNFFSSKKNTDECVICKSNYKS  134

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
             EKL+ LPC H YH  CIT WL+I K CP+C+EEV
Sbjct  135  REKLIRLPCSHCYHAGCITRWLKINKACPVCNEEV  169



>ref|XP_008349923.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X1 [Malus 
domestica]
Length=246

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 66/102 (65%), Gaps = 6/102 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPST----FQSLTSKTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG +SRGLS+  I  SL PS+          K   +RCV+CQ++Y
Sbjct  145  PDNMTYEELLDLGEAVGTQSRGLSDELI--SLLPSSKYKCGNFFLRKKSGERCVICQMQY  202

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
              G++ + LPC H YH ECI+ WL I KVCP+C+ EV   +S
Sbjct  203  KRGDRQITLPCKHVYHSECISKWLGINKVCPVCNLEVFGEES  244



>ref|NP_001131757.1| LOC100193125 [Zea mays]
 ref|XP_008650870.1| PREDICTED: LOC100193125 isoform X1 [Zea mays]
 ref|XP_008650871.1| PREDICTED: LOC100193125 isoform X1 [Zea mays]
 gb|ACF80307.1| unknown [Zea mays]
 gb|ACG32225.1| protein binding protein [Zea mays]
 gb|ACG33487.1| protein binding protein [Zea mays]
 tpg|DAA62373.1| TPA: putative RING zinc finger domain superfamily protein isoform 
1 [Zea mays]
 tpg|DAA62374.1| TPA: putative RING zinc finger domain superfamily protein isoform 
2 [Zea mays]
 tpg|DAA62375.1| TPA: putative RING zinc finger domain superfamily protein isoform 
3 [Zea mays]
Length=175

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 65/97 (67%), Gaps = 7/97 (7%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQS----LTSKTLVDRCVVCQLEY  274
            PD +SYE+L ALGE VG++SRGLS+ E+   L P  F++     + K   + CV+C+  Y
Sbjct  80   PDNMSYEQLQALGEAVGIQSRGLSD-ELISYLEP--FRNKCTFFSRKKNSEECVICKTTY  136

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
               +KL+ LPC H YH +CIT WL+I K CP+C+EEV
Sbjct  137  RSRQKLIRLPCSHCYHADCITRWLKINKACPVCNEEV  173



>ref|XP_008450441.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Cucumis melo]
 ref|XP_008450442.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Cucumis melo]
Length=248

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 63/103 (61%), Gaps = 4/103 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSE---AEITKSLHPSTFQSLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGLS+   A +  S +   F S   K+  DRCV+CQ+EY 
Sbjct  147  PDNMTYEELLELGETVGTQSRGLSQELIALLPISKYKYGFFS-RKKSRGDRCVICQMEYK  205

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
             G++ + LPC H YH  C T WL I K CPIC  EV    S R
Sbjct  206  RGDRRITLPCKHIYHAGCGTKWLSINKACPICYTEVFGDTSKR  248



>ref|XP_010255520.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Nelumbo nucifera]
 ref|XP_010255521.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Nelumbo nucifera]
Length=243

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 62/95 (65%), Gaps = 2/95 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITK--SLHPSTFQSLTSKTLVDRCVVCQLEYDE  280
            PD ++YEEL +LGE +G ESRGLSE  I    S+   T    + K   ++CV+C +EY  
Sbjct  147  PDNMAYEELQSLGEAIGTESRGLSEELIDYLPSIKYKTGCFFSRKDKHEQCVICYMEYKN  206

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
             EKL  LPC H YH +CIT WL++KK CP+C EEV
Sbjct  207  REKLTILPCQHQYHSKCITVWLKLKKACPVCGEEV  241



>ref|NP_001049123.1| Os03g0173900 [Oryza sativa Japonica Group]
 gb|ABF94247.1| Zinc finger, C3HC4 type family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11037.1| Os03g0173900 [Oryza sativa Japonica Group]
 dbj|BAG88942.1| unnamed protein product [Oryza sativa Japonica Group]
Length=250

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 64/105 (61%), Gaps = 8/105 (8%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPST-----FQSLTSKTLVDRCVVCQLE  271
            PD ++YEEL+ LGE VG +SRGLS+  I  SL P T     F S   KT  +RCV+CQ+E
Sbjct  148  PDNMTYEELLDLGEAVGTQSRGLSQERI--SLLPVTKYKCGFFS-RKKTRRERCVICQME  204

Query  272  YDEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
            Y  G   + LPC H YH  C+T WL I KVCP+C  EV   +  R
Sbjct  205  YRRGNLQMTLPCKHVYHASCVTRWLSINKVCPVCFAEVPGDEPKR  249



>emb|CAC10211.1| E3 ubiquitin ligase BIG BROTHER-related protein, partial [Cicer 
arietinum]
Length=233

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 65/103 (63%), Gaps = 4/103 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEIT--KSLHPSTFQSLTSKTLVDRCVVCQLEYDE  280
            PD LSYEEL+ALGE+VG ESRGLS   I    S++  T          D CV+C+++Y++
Sbjct  133  PDELSYEELLALGEVVGTESRGLSTDTIACLPSVNYKTGSDQHGSN--DSCVICRVDYED  190

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPRI  409
             E L  L C H YH ECI  WL+I KVCP+CS EVS++    +
Sbjct  191  DESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVSASSGSNL  233



>ref|XP_004287200.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Fragaria 
vesca subsp. vesca]
Length=306

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 65/99 (66%), Gaps = 2/99 (2%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR-CVVCQLEYDEG  283
            PD LSYEEL+ALGE+VG ESRGL  A+   SL   +++    +   +  C +C+L+Y++G
Sbjct  208  PDELSYEELLALGEVVGTESRGLP-ADTIASLPSVSYKMGNGQNGSNESCAICRLDYEDG  266

Query  284  EKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            E L  L C H YH ECI  WL I KVCP+C  EVS++ +
Sbjct  267  ENLTVLSCTHSYHSECINNWLTINKVCPVCIAEVSTSGN  305



>ref|XP_004985526.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Setaria italica]
Length=249

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 64/105 (61%), Gaps = 8/105 (8%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPST-----FQSLTSKTLVDRCVVCQLE  271
            PD ++YEEL+ LGE VG +SRGLS+  I  SL P T     F S   KT  +RCV+CQ+E
Sbjct  147  PDNMTYEELLDLGEAVGTQSRGLSQERI--SLLPVTKYKCGFFS-RKKTRRERCVICQME  203

Query  272  YDEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
            Y  G   + LPC H YH  C+T WL I KVCP+C  EV   +  R
Sbjct  204  YRRGNLQMTLPCKHVYHASCVTRWLSINKVCPVCFAEVPGEEPKR  248



>ref|XP_006649482.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Oryza brachyantha]
Length=250

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 64/105 (61%), Gaps = 8/105 (8%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPST-----FQSLTSKTLVDRCVVCQLE  271
            PD ++YEEL+ LGE VG +SRGLS+  I  SL P T     F S   KT  +RCV+CQ+E
Sbjct  148  PDNMTYEELLDLGEAVGTQSRGLSQEHI--SLLPVTKYKCGFFS-RRKTRRERCVICQME  204

Query  272  YDEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
            Y  G   + LPC H YH  C+T WL I KVCP+C  EV   +  R
Sbjct  205  YRRGNLQMTLPCKHVYHASCVTRWLSINKVCPVCFAEVPGDEPKR  249



>ref|XP_009354734.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Pyrus x bretschneideri]
Length=241

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 65/102 (64%), Gaps = 6/102 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPST----FQSLTSKTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG +SRGLS+  I  SL PS+          K   +RCV+CQ+ Y
Sbjct  140  PDNMTYEELLDLGEAVGTQSRGLSDELI--SLLPSSKYKCGNFFLRKKSGERCVICQMRY  197

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
              G++ + LPC H YH ECI+ WL I KVCP+C+ EV   +S
Sbjct  198  KRGDRQITLPCKHVYHNECISKWLGINKVCPVCNLEVFGEES  239



>ref|XP_008778611.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Phoenix dactylifera]
Length=153

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 63/96 (66%), Gaps = 4/96 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITK---SLHPSTFQSLTSKTLVDRCVVCQLEYD  277
            PD+++YEEL+ LGE VG +SRGLSE  I+    + +  +F S   K   +RCV+CQ++Y 
Sbjct  51   PDIMTYEELLDLGEAVGTQSRGLSEEHISSLPVTKYKCSFFSRKKKR-GERCVICQMDYK  109

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
             G++ + LPC H YH  C+T WL I K CPIC  EV
Sbjct  110  RGDRQMILPCKHVYHAGCVTRWLGINKACPICFAEV  145



>gb|EAY88740.1| hypothetical protein OsI_10215 [Oryza sativa Indica Group]
Length=316

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 64/105 (61%), Gaps = 8/105 (8%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPST-----FQSLTSKTLVDRCVVCQLE  271
            PD ++YEEL+ LGE VG +SRGLS+  I  SL P T     F S   KT  +RCV+CQ+E
Sbjct  214  PDNMTYEELLDLGEAVGTQSRGLSQERI--SLLPVTKYKCGFFS-RKKTRRERCVICQME  270

Query  272  YDEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
            Y  G   + LPC H YH  C+T WL I KVCP+C  EV   +  R
Sbjct  271  YRRGNLQMTLPCKHVYHASCVTRWLSINKVCPVCFAEVPGDEPKR  315



>ref|XP_002468417.1| hypothetical protein SORBIDRAFT_01g045580 [Sorghum bicolor]
 gb|EER95415.1| hypothetical protein SORBIDRAFT_01g045580 [Sorghum bicolor]
Length=249

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 64/103 (62%), Gaps = 4/103 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITK---SLHPSTFQSLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE+VG +SRGLS+  I+    + +   F S   KT  +RCV+CQ+EY 
Sbjct  147  PDNMTYEELLDLGEVVGTQSRGLSQERISSLPVTKYKCGFFS-RKKTRRERCVICQMEYR  205

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
             G   + LPC H YH  C+T WL I KVCP+C  EV   +  R
Sbjct  206  RGNLQMTLPCKHVYHASCVTRWLSINKVCPVCFAEVPGDEPKR  248



>ref|XP_010936603.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Elaeis guineensis]
 ref|XP_010936604.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Elaeis guineensis]
Length=251

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 63/96 (66%), Gaps = 4/96 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITK---SLHPSTFQSLTSKTLVDRCVVCQLEYD  277
            PD+++YEEL+ LGE VG +SRGLSE  I+    + +  +F S   K   +RCV+CQ++Y 
Sbjct  149  PDIMTYEELLDLGEAVGTQSRGLSEERISSLPVTKYKCSFFSRKKKR-GERCVICQMDYK  207

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
             G++ + LPC H YH  C+T WL I K CPIC  EV
Sbjct  208  RGDRQMILPCKHVYHAGCVTRWLGINKACPICFAEV  243



>dbj|BAK04699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 65/103 (63%), Gaps = 4/103 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQ---SLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGLS+  I+ +L  + F+       K   +RCVVCQ+EY 
Sbjct  148  PDNMTYEELLDLGEAVGTQSRGLSQESIS-ALPVTKFKCGFFSRKKKRRERCVVCQMEYR  206

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
             G+  +ALPC H YH  C+T WL I KVCP+C  EV   +  R
Sbjct  207  RGDLQMALPCKHVYHASCVTKWLTINKVCPVCFAEVPGEEPKR  249



>ref|XP_003536731.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform 1 
[Glycine max]
Length=344

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 67/104 (64%), Gaps = 12/104 (12%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTLVDR------CVVCQL  268
            PD LSYEEL+AL E+VG ESRGLS   I      +   S+  KT  D+      CV+C++
Sbjct  245  PDELSYEELLALSEVVGTESRGLSTDTI------ACLPSVNYKTGSDQHGSHDSCVICRV  298

Query  269  EYDEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            +Y++GE L  L C H YH ECI  WL+I KVCP+CS EVS++ S
Sbjct  299  DYEDGESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVSASGS  342



>ref|XP_011087589.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Sesamum indicum]
Length=248

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQS---LTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGLS+ E+   L  S  +S    + +   DRCV+CQ+ Y 
Sbjct  147  PDTMTYEELLDLGEAVGTQSRGLSQ-ELINMLPTSKHKSGGIFSRRKSGDRCVICQMRYK  205

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             G++ + LPC H YH +C + WL I K CP+C+ EV   +S
Sbjct  206  RGDRQINLPCKHAYHTDCGSKWLSINKTCPVCNTEVFGDES  246



>gb|EEE58414.1| hypothetical protein OsJ_09608 [Oryza sativa Japonica Group]
Length=272

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 64/105 (61%), Gaps = 8/105 (8%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPST-----FQSLTSKTLVDRCVVCQLE  271
            PD ++YEEL+ LGE VG +SRGLS+  I  SL P T     F S   KT  +RCV+CQ+E
Sbjct  170  PDNMTYEELLDLGEAVGTQSRGLSQERI--SLLPVTKYKCGFFS-RKKTRRERCVICQME  226

Query  272  YDEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
            Y  G   + LPC H YH  C+T WL I KVCP+C  EV   +  R
Sbjct  227  YRRGNLQMTLPCKHVYHASCVTRWLSINKVCPVCFAEVPGDEPKR  271



>gb|EMT12530.1| RING finger protein 44 [Aegilops tauschii]
Length=295

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 67/103 (65%), Gaps = 4/103 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQ-SLTS--KTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGLS+  I+ +L  + F+  L S  K   +RCV+CQ+EY 
Sbjct  193  PDNMTYEELLDLGEAVGTQSRGLSQESIS-ALPVTKFKCGLFSRKKKRRERCVICQMEYR  251

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
             G+  +ALPC H YH  C+T WL I KVCP+C  EV   +  R
Sbjct  252  RGDLQMALPCKHVYHASCVTKWLTINKVCPVCFAEVPGEEPKR  294



>ref|XP_011011041.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Populus euphratica]
 ref|XP_011011042.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Populus euphratica]
 ref|XP_011011043.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Populus euphratica]
Length=245

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 68/102 (67%), Gaps = 6/102 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPST---FQSLTS-KTLVDRCVVCQLEY  274
            PD ++YEEL+ LGE VG +S+GLS   I  SL P++   F S  S K   +RCV+CQ++Y
Sbjct  144  PDTMTYEELVDLGETVGTQSKGLSPELI--SLLPTSKCKFGSFFSRKRSGERCVICQMKY  201

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
              G+K + L C H YH ECIT WL I KVCP+C++EV   +S
Sbjct  202  KIGDKQIKLLCKHAYHSECITKWLGINKVCPVCNDEVFGEES  243



>ref|XP_004497226.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Cicer arietinum]
Length=342

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 65/103 (63%), Gaps = 4/103 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEIT--KSLHPSTFQSLTSKTLVDRCVVCQLEYDE  280
            PD LSYEEL+ALGE+VG ESRGLS   I    S++  T          D CV+C+++Y++
Sbjct  242  PDELSYEELLALGEVVGTESRGLSTDTIACLPSVNYKTGSDQHGSN--DSCVICRVDYED  299

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPRI  409
             E L  L C H YH ECI  WL+I KVCP+CS EVS++    +
Sbjct  300  DESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVSASSGSNL  342



>ref|XP_004497227.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Cicer arietinum]
Length=336

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 65/103 (63%), Gaps = 4/103 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEIT--KSLHPSTFQSLTSKTLVDRCVVCQLEYDE  280
            PD LSYEEL+ALGE+VG ESRGLS   I    S++  T          D CV+C+++Y++
Sbjct  236  PDELSYEELLALGEVVGTESRGLSTDTIACLPSVNYKTGSDQHGSN--DSCVICRVDYED  293

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPRI  409
             E L  L C H YH ECI  WL+I KVCP+CS EVS++    +
Sbjct  294  DESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVSASSGSNL  336



>gb|KHN23096.1| E3 ubiquitin ligase BIG BROTHER-related [Glycine soja]
Length=335

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEIT--KSLHPSTFQSLTSKTLVDRCVVCQLEYDE  280
            PD LSYEEL+ALGE VG ESRGLS   I    S++  T          D CV+C+++Y++
Sbjct  236  PDELSYEELLALGEAVGTESRGLSTDTIACLPSVNYKTGSDQHGSN--DSCVICRVDYED  293

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             E L  L C H YH ECI  WL+I KVCP+CS EVS++ S
Sbjct  294  DESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVSASGS  333



>ref|XP_003555846.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
2 [Glycine max]
Length=341

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEIT--KSLHPSTFQSLTSKTLVDRCVVCQLEYDE  280
            PD LSYEEL+ALGE VG ESRGLS   I    S++  T          D CV+C+++Y++
Sbjct  242  PDELSYEELLALGEAVGTESRGLSTDTIACLPSVNYKTGSDQHGSN--DSCVICRVDYED  299

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             E L  L C H YH ECI  WL+I KVCP+CS EVS++ S
Sbjct  300  DESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVSASGS  339



>ref|XP_003555845.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
1 [Glycine max]
Length=335

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEIT--KSLHPSTFQSLTSKTLVDRCVVCQLEYDE  280
            PD LSYEEL+ALGE VG ESRGLS   I    S++  T          D CV+C+++Y++
Sbjct  236  PDELSYEELLALGEAVGTESRGLSTDTIACLPSVNYKTGSDQHGSN--DSCVICRVDYED  293

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             E L  L C H YH ECI  WL+I KVCP+CS EVS++ S
Sbjct  294  DESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVSASGS  333



>gb|ACJ86011.1| unknown [Medicago truncatula]
Length=332

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 65/100 (65%), Gaps = 4/100 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQSLTSKTL--VDRCVVCQLEYDE  280
            PD LSYEEL+ALGE+VG ESRGLS   I  +  PS      S  L   D CV+C+++Y++
Sbjct  233  PDELSYEELLALGEVVGTESRGLSTDTI--ACLPSVNYKAGSDQLGSNDSCVICRVDYED  290

Query  281  GEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             E L  L C H YH ECI  WL+I KVCP+CS EV ++ S
Sbjct  291  DESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVFASGS  330



>ref|NP_001140719.1| uncharacterized LOC100272794 [Zea mays]
 gb|ACF84454.1| unknown [Zea mays]
 gb|AFW89514.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=249

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 64/105 (61%), Gaps = 8/105 (8%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPST-----FQSLTSKTLVDRCVVCQLE  271
            PD ++YEEL+ LGE VG +SRGLS+  I  SL P T     F S   KT  +RCV+CQ+E
Sbjct  147  PDNMTYEELLDLGEAVGTQSRGLSQECI--SLLPITKYKCGFFS-RKKTRRERCVICQME  203

Query  272  YDEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
            Y  G   + LPC H YH  C+T WL I KVCP+C  EV    S R
Sbjct  204  YRRGNLQITLPCKHVYHASCVTRWLSINKVCPVCFAEVPGEDSLR  248



>gb|ACU23155.1| unknown [Glycine max]
Length=247

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQS---LTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGLS+ E+   L  S ++       K    RCV+CQ+ Y 
Sbjct  146  PDDMTYEELLDLGEAVGTQSRGLSQ-ELIDMLPTSKYKFGSLFKRKNFGKRCVICQMTYR  204

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             G++ + LPC H YH ECIT WL I K CP+C+ EV   +S
Sbjct  205  RGDQQMKLPCSHVYHGECITKWLSINKKCPVCNTEVFGEES  245



>gb|EYU27063.1| hypothetical protein MIMGU_mgv1a012318mg [Erythranthe guttata]
Length=254

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 66/102 (65%), Gaps = 6/102 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPST---FQSLTSKTLV-DRCVVCQLEY  274
            PD ++YEEL+ LGE VG ESRGL +  I  +L P++   F  + S+    DRCV+CQ+ Y
Sbjct  153  PDNMTYEELLDLGEAVGTESRGLPQELI--NLLPTSKHKFGGIFSRRKSGDRCVICQMRY  210

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
              G++ + LPC H YH +C++ WL I K CP+C+ EV   +S
Sbjct  211  KRGDRQINLPCKHAYHADCVSKWLSINKACPVCNTEVFGEES  252



>gb|KGN66475.1| hypothetical protein Csa_1G613470 [Cucumis sativus]
Length=248

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 64/103 (62%), Gaps = 4/103 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSE---AEITKSLHPSTFQSLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGLS+   A +  S +  +F S   K+  +RCV+CQ+EY 
Sbjct  147  PDNMTYEELLELGETVGTQSRGLSQELIALLPISKYKYSFFS-RKKSRGERCVICQMEYK  205

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
             G++ + LPC H YH  C T WL I K CPIC  EV    S R
Sbjct  206  RGDRRITLPCKHIYHAGCGTKWLSINKACPICYTEVFGDTSKR  248



>ref|XP_002462697.1| hypothetical protein SORBIDRAFT_02g030410 [Sorghum bicolor]
 gb|EER99218.1| hypothetical protein SORBIDRAFT_02g030410 [Sorghum bicolor]
Length=175

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 64/97 (66%), Gaps = 7/97 (7%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQS----LTSKTLVDRCVVCQLEY  274
            PD +SYE+L ALGE VG +SRGLS+ E+   L P  F++     + K   + CV+C+  Y
Sbjct  80   PDNMSYEQLQALGEAVGTQSRGLSD-ELIAYLEP--FRNKCTFFSRKKNSEECVICKTTY  136

Query  275  DEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
               ++++ LPC H YH +CIT WL+I K CPIC+EEV
Sbjct  137  KSRQRMIRLPCSHCYHADCITRWLKINKACPICNEEV  173



>ref|XP_010246935.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Nelumbo nucifera]
 ref|XP_010246936.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Nelumbo nucifera]
 ref|XP_010246937.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Nelumbo nucifera]
 ref|XP_010246938.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Nelumbo nucifera]
Length=249

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 62/103 (60%), Gaps = 4/103 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQ---SLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG  SRGLS+  I++ L  S F+       K+  +RCV+CQ+EY 
Sbjct  147  PDNMTYEELLDLGEAVGTHSRGLSQEHISQ-LPISKFKCGFFSRKKSRGERCVICQMEYK  205

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
             G++ + LPC H YH  C   WL I K CPIC  EV   K  R
Sbjct  206  RGDRQITLPCKHVYHAGCGARWLSINKACPICYREVCGNKESR  248



>ref|XP_007150374.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris]
 ref|XP_007150375.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris]
 ref|XP_007150378.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris]
 gb|ESW22368.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris]
 gb|ESW22369.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris]
 gb|ESW22372.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris]
Length=246

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQ-----SLTSKTLVDRCVVCQLE  271
            PD ++YEEL+ LGE VG ESRGLS+ +I+ S+  S ++         K+  +RCV+CQ+E
Sbjct  142  PDNMTYEELLELGETVGTESRGLSQEQIS-SIPISKYKCGRFFFFRRKSREERCVICQME  200

Query  272  YDEGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
            Y  G+K + LPC H YH  C   WL I K CP+C  EV
Sbjct  201  YRRGDKRMTLPCKHAYHASCGNKWLSINKACPMCYREV  238



>gb|EEE70120.1| hypothetical protein OsJ_30137 [Oryza sativa Japonica Group]
Length=300

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 65/93 (70%), Gaps = 2/93 (2%)
 Frame = +2

Query  125  EELIALGELVGVESRGLSEAEITKSLHPSTFQS-LTSKTLVDRCVVCQLEYDEGEKLVAL  301
            +EL+ALGE VG   RGLS A +  SL   T+++        ++CV+C++E+++GE L+AL
Sbjct  206  QELVALGEAVGTGHRGLSAATLA-SLPSVTYKAEGVQDGNTEQCVICRVEFEDGESLIAL  264

Query  302  PCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
            PC H YH ECI  WLQI KVCP+CS EVS++ S
Sbjct  265  PCKHSYHPECINQWLQINKVCPMCSAEVSTSDS  297



>ref|XP_009354732.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X2 [Pyrus 
x bretschneideri]
Length=245

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 66/101 (65%), Gaps = 4/101 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQ---SLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGLS+ E+   L  S ++       K   +RCV+CQ++Y 
Sbjct  144  PDNMTYEELLDLGEAVGTQSRGLSD-ELISLLPLSKYKCGNFFLRKKSGERCVICQMQYK  202

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             G++ + LPC H YH ECI+ WL I KVCP+C+ EV   +S
Sbjct  203  RGDRQITLPCKHVYHSECISKWLGINKVCPVCNLEVFGEES  243



>gb|EMS63320.1| E3 ubiquitin ligase BIG BROTHER [Triticum urartu]
Length=305

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 67/103 (65%), Gaps = 4/103 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQ-SLTS--KTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGLS+  I+ +L  + F+  L S  K   +RCV+CQ+EY 
Sbjct  203  PDNMTYEELLDLGEAVGTQSRGLSQESIS-ALPITKFKCGLFSRKKKRRERCVICQMEYR  261

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKSPR  406
             G+  +ALPC H YH  C+T WL I KVCP+C  EV   +  R
Sbjct  262  RGDLQMALPCKHVYHASCVTKWLTINKVCPVCFAEVPGEEPKR  304



>ref|XP_009354730.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009354731.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X1 [Pyrus 
x bretschneideri]
Length=246

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 66/101 (65%), Gaps = 4/101 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQ---SLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGLS+ E+   L  S ++       K   +RCV+CQ++Y 
Sbjct  145  PDNMTYEELLDLGEAVGTQSRGLSD-ELISLLPLSKYKCGNFFLRKKSGERCVICQMQYK  203

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             G++ + LPC H YH ECI+ WL I KVCP+C+ EV   +S
Sbjct  204  RGDRQITLPCKHVYHSECISKWLGINKVCPVCNLEVFGEES  244



>ref|XP_008375171.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Malus domestica]
 ref|XP_008375172.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Malus domestica]
Length=247

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 66/101 (65%), Gaps = 4/101 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITKSLHPSTFQ---SLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGLS+ E+   L  S ++       K   +RCV+CQ++Y 
Sbjct  146  PDNMTYEELLDLGEAVGTQSRGLSD-ELISLLPLSKYKCGNFFLRKKSGERCVICQMQYK  204

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEVSSAKS  400
             G++ + LPC H YH ECI+ WL I KVCP+C+ EV   +S
Sbjct  205  RGDRQITLPCKHVYHSECISKWLGINKVCPVCNLEVFGEES  245



>ref|XP_008651491.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Zea mays]
 gb|ACN31149.1| unknown [Zea mays]
 tpg|DAA43637.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=253

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 61/96 (64%), Gaps = 4/96 (4%)
 Frame = +2

Query  107  PDLLSYEELIALGELVGVESRGLSEAEITK---SLHPSTFQSLTSKTLVDRCVVCQLEYD  277
            PD ++YEEL+ LGE VG +SRGLS+  I+    + +   F S   KT  +RCV+CQ+EY 
Sbjct  147  PDNMTYEELLDLGEAVGTQSRGLSQERISSLPVTKYKCGFFS-RKKTRRERCVICQMEYR  205

Query  278  EGEKLVALPCDHPYHCECITTWLQIKKVCPICSEEV  385
             G   + LPC H YH  C+T WL I KVCP+C  EV
Sbjct  206  RGNLQMTLPCKHVYHASCVTRWLGINKVCPVCFAEV  241



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513327796892