BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18275_g1_i1 len=724 path=[702:0-290 993:291-330 2265:331-333
1036:334-723]

Length=724
                                                                      Score     E

ref|XP_009757896.1|  PREDICTED: protein MOTHER of FT and TF 1-like      287   1e-94   
ref|XP_009589130.1|  PREDICTED: protein MOTHER of FT and TF 1-like      284   2e-93   
ref|XP_004232787.1|  PREDICTED: protein MOTHER of FT and TF 1           280   8e-92   
gb|AAO31791.1|  SP2G                                                    279   2e-91   Solanum lycopersicum
gb|KDP20872.1|  hypothetical protein JCGZ_21343                         258   3e-83   
ref|XP_010268882.1|  PREDICTED: protein MOTHER of FT and TF 1-like      258   4e-83   
ref|XP_010096797.1|  hypothetical protein L484_002399                   254   7e-82   
gb|KHG10593.1|  Protein MOTHER of FT and TF 1 -like protein             249   1e-79   
ref|XP_006467912.1|  PREDICTED: protein MOTHER of FT and TF 1-like      248   1e-79   
ref|XP_010277909.1|  PREDICTED: protein MOTHER of FT and TF 1-like      248   1e-79   
ref|XP_006449196.1|  hypothetical protein CICLE_v10016917mg             248   2e-79   
ref|XP_008441938.1|  PREDICTED: protein MOTHER of FT and TF 1-like      247   3e-79   
gb|AGJ98454.1|  MFT1                                                    247   5e-79   
ref|XP_010686259.1|  PREDICTED: protein MOTHER of FT and TF 1-like      248   5e-79   
ref|XP_004146579.1|  PREDICTED: protein MOTHER of FT and TF 1-like      246   2e-78   
ref|NP_001267935.1|  MFT-like protein                                   243   2e-77   
emb|CDO99645.1|  unnamed protein product                                243   2e-77   
emb|CBI40863.3|  unnamed protein product                                242   4e-77   
gb|KDO75687.1|  hypothetical protein CISIN_1g030480mg                   240   2e-76   
ref|XP_007025823.1|  Phosphatidylethanolamine-binding protein, pu...    236   8e-75   
ref|XP_006841865.1|  hypothetical protein AMTR_s00003p00271590          235   1e-73   
ref|XP_002524698.1|  phosphatidylethanolamine-binding protein, pu...    230   2e-72   Ricinus communis
gb|EYU27885.1|  hypothetical protein MIMGU_mgv1a022275mg                228   1e-71   
ref|XP_006849745.1|  hypothetical protein AMTR_s00024p00249400          224   4e-70   
ref|XP_007025824.1|  Phosphatidylethanolamine-binding protein, pu...    223   9e-70   
ref|XP_011096184.1|  PREDICTED: protein MOTHER of FT and TF 1-like      223   2e-69   
gb|ABK22769.1|  unknown                                                 219   5e-68   Picea sitchensis
gb|AHG97810.1|  MOTHER OF FT AND TFL1 1                                 217   2e-67   
gb|AEH59566.1|  MFT2-like protein                                       217   2e-67   
ref|XP_002990227.1|  TF1-like protein                                   216   8e-67   
gb|AHY23236.1|  flowering locus T                                       215   1e-66   
ref|XP_007025825.1|  PEBP (phosphatidylethanolamine-binding prote...    214   1e-66   
gb|AEH59565.1|  MFT1-like protein                                       215   2e-66   
gb|AHM25239.1|  flowering locus T                                       213   9e-66   
ref|XP_002990226.1|  hypothetical protein SELMODRAFT_229523             212   2e-65   
gb|AIJ02001.1|  mother of FT and TFL1-like 1                            211   4e-65   
ref|XP_010032693.1|  PREDICTED: protein MOTHER of FT and TF 1           210   1e-64   
ref|XP_009360092.1|  PREDICTED: protein MOTHER of FT and TF 1           209   3e-64   
emb|CDY21719.1|  BnaA09g44700D                                          209   3e-64   
ref|XP_009117626.1|  PREDICTED: protein MOTHER of FT and TF 1           210   4e-64   
emb|CDX81861.1|  BnaC08g37400D                                          209   5e-64   
ref|NP_001281044.1|  uncharacterized protein LOC103455721               209   5e-64   
ref|XP_001778686.1|  predicted protein                                  209   5e-64   
ref|NP_001106249.1|  ZCN10 protein                                      209   5e-64   Zea mays [maize]
ref|XP_002457494.1|  hypothetical protein SORBIDRAFT_03g008270          208   5e-64   Sorghum bicolor [broomcorn]
ref|XP_011047546.1|  PREDICTED: protein MOTHER of FT and TF 1-like      208   6e-64   
gb|AFK45387.1|  unknown                                                 209   6e-64   
gb|EYU17649.1|  hypothetical protein MIMGU_mgv1a014889mg                208   6e-64   
ref|NP_001147266.1|  MFT2 - Corn MFT-like protein                       208   6e-64   Zea mays [maize]
ref|XP_002321507.1|  MOTHER of FT and TF1 family protein                208   7e-64   Populus trichocarpa [western balsam poplar]
ref|XP_010498189.1|  PREDICTED: protein MOTHER of FT and TF 1-like      208   8e-64   
ref|XP_010936814.1|  PREDICTED: protein MOTHER of FT and TF 1-like      208   9e-64   
ref|XP_009149260.1|  PREDICTED: protein MOTHER of FT and TF 1           208   1e-63   
ref|XP_010476978.1|  PREDICTED: protein MOTHER of FT and TF 1           207   1e-63   
ref|XP_008782387.1|  PREDICTED: protein MOTHER of FT and TF 1-like      207   2e-63   
ref|XP_001769136.1|  predicted protein                                  207   2e-63   
ref|XP_007160508.1|  hypothetical protein PHAVU_002G327700g             207   3e-63   
ref|XP_006305921.1|  hypothetical protein CARUB_v10011138mg             206   3e-63   
ref|XP_008787928.1|  PREDICTED: protein MOTHER of FT and TF 1-like      206   3e-63   
gb|ACN54547.1|  mother of FT and TFL1-like protein                      207   4e-63   Physcomitrella patens
ref|NP_173250.1|  protein MOTHER of FT and TF 1                         206   5e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001758845.1|  predicted protein                                  206   5e-63   
ref|XP_010537488.1|  PREDICTED: protein MOTHER of FT and TF 1           206   6e-63   
gb|KFK43979.1|  hypothetical protein AALP_AA1G199000                    206   7e-63   
emb|CDY60777.1|  BnaC05g50120D                                          205   1e-62   
ref|XP_002892983.1|  E12A11                                             205   1e-62   
ref|XP_010097584.1|  hypothetical protein L484_017394                   205   2e-62   
ref|XP_010260703.1|  PREDICTED: protein MOTHER of FT and TF 1           205   2e-62   
gb|AIE37919.1|  phosphatidylethanolamine-binding protein                204   2e-62   
ref|XP_003566347.1|  PREDICTED: protein MOTHER of FT and TF 1-like      204   2e-62   
ref|XP_010686257.1|  PREDICTED: protein MOTHER of FT and TF 1-lik...    204   2e-62   
ref|XP_009393599.1|  PREDICTED: protein MOTHER of FT and TF 1-like      204   2e-62   
ref|XP_007209687.1|  hypothetical protein PRUPE_ppa012388mg             204   2e-62   
ref|XP_004299541.1|  PREDICTED: protein MOTHER of FT and TF 1-like      204   3e-62   
ref|XP_006416640.1|  hypothetical protein EUTSA_v10009636mg             204   4e-62   
ref|XP_009757930.1|  PREDICTED: protein MOTHER of FT and TF 1           203   5e-62   
ref|XP_006451659.1|  hypothetical protein CICLE_v10009697mg             203   5e-62   
ref|XP_006341565.1|  PREDICTED: protein MOTHER of FT and TF 1-like      203   5e-62   
ref|XP_004967983.1|  PREDICTED: protein MOTHER of FT and TF 1-like      203   6e-62   
ref|XP_004235817.1|  PREDICTED: protein MOTHER of FT and TF 1           203   6e-62   
gb|ACA24491.1|  mother of flowering locus T-like protein                204   6e-62   
ref|NP_001106248.1|  ZCN9 protein                                       203   7e-62   Zea mays [maize]
ref|XP_011072991.1|  PREDICTED: protein MOTHER of FT and TF 1           203   7e-62   
gb|ADM92615.1|  mother of FT AND TFL1-like protein MFT1                 203   7e-62   
gb|ABF65987.1|  CETS1                                                   203   8e-62   Glycine max [soybeans]
ref|XP_010940015.1|  PREDICTED: protein MOTHER of FT and TF 1-like      202   1e-61   
gb|ABX11011.1|  ZCN9                                                    202   1e-61   Zea mays [maize]
ref|XP_009403936.1|  PREDICTED: protein MOTHER of FT and TF 1-like      202   2e-61   
gb|AFP33419.1|  mother of FT and TFL1                                   202   2e-61   
gb|ACN54543.1|  mother of FT and TFL1-like protein                      202   2e-61   Physcomitrella patens
ref|XP_008374830.1|  PREDICTED: protein MOTHER of FT and TF 1           202   2e-61   
dbj|BAK78896.1|  MFT                                                    202   2e-61   
ref|NP_001236894.1|  uncharacterized LOC100306314 precursor             202   2e-61   
ref|XP_007036754.1|  PEBP family protein isoform 1                      203   4e-61   
ref|XP_009621088.1|  PREDICTED: protein MOTHER of FT and TF 1           201   5e-61   
gb|ABB90591.1|  terminal flower 1                                       200   7e-61   Aquilegia formosa
gb|AFW79812.1|  MFT2-Corn MFT-like protein                              201   7e-61   
ref|XP_001764385.1|  predicted protein                                  200   1e-60   
ref|XP_008360924.1|  PREDICTED: LOW QUALITY PROTEIN: protein MOTH...    200   1e-60   
ref|XP_009387733.1|  PREDICTED: protein MOTHER of FT and TF 1-like      200   1e-60   
dbj|BAK06374.1|  predicted protein                                      200   1e-60   
ref|XP_004169652.1|  PREDICTED: LOW QUALITY PROTEIN: protein MOTH...    199   2e-60   
ref|XP_003634198.1|  PREDICTED: protein MOTHER of FT and TF 1           199   2e-60   
emb|CAN80336.1|  hypothetical protein VITISV_038913                     199   2e-60   Vitis vinifera
dbj|BAK78893.1|  MFT                                                    199   4e-60   
gb|ABK25607.1|  unknown                                                 198   4e-60   Picea sitchensis
gb|ABQ85553.1|  flowering locus T-like/terminal flower1-like protein    198   6e-60   Picea abies
ref|XP_008443056.1|  PREDICTED: protein MOTHER of FT and TF 1-like      198   8e-60   
gb|AJD87372.1|  MFT                                                     198   8e-60   
ref|NP_001152713.1|  MFT2 - Corn MFT-like protein                       198   8e-60   Zea mays [maize]
gb|ABR23052.1|  terminal flower-like protein                            197   1e-59   Picea abies
dbj|BAK78908.1|  Mother of FT and TFL1                                  197   1e-59   
gb|ADP95116.1|  flowering locus T-like protein                          198   1e-59   
ref|XP_004136734.1|  PREDICTED: protein MOTHER of FT and TF 1-like      197   2e-59   
gb|AEH59567.1|  flowering locus T/Terminal flower1-like protein         197   2e-59   
ref|NP_001057701.1|  Os06g0498800                                       197   2e-59   Oryza sativa Japonica Group [Japonica rice]
gb|AIJ02002.1|  FT/TFL1-like 2                                          196   3e-59   
ref|XP_003563887.1|  PREDICTED: protein MOTHER of FT and TF 1-like      196   5e-59   
gb|ACN54544.1|  mother of FT and TFL1-like protein variant a            196   1e-58   Physcomitrella patens
gb|AGY34592.1|  MFT-A1                                                  195   1e-58   
gb|EAY84662.1|  hypothetical protein OsI_06032                          194   1e-58   Oryza sativa Indica Group [Indian rice]
gb|KHN21660.1|  Protein MOTHER of FT and TF 1                           195   2e-58   
gb|AID67173.1|  MFT2-like protein                                       193   3e-58   
ref|XP_003631075.1|  Protein MOTHER of FT and TF                        194   3e-58   
gb|EMT22371.1|  hypothetical protein F775_09897                         194   3e-58   
gb|AET05551.2|  mother of FT and TFL1-like protein                      194   3e-58   
ref|XP_004503299.1|  PREDICTED: protein MOTHER of FT and TF 1-like      193   5e-58   
gb|AID67177.1|  MFT2-like protein                                       192   5e-58   
ref|XP_006643665.1|  PREDICTED: protein MOTHER of FT and TF 1-like      193   5e-58   
ref|NP_001236597.1|  brother of FT and TFL1 protein                     193   6e-58   
ref|XP_008240174.1|  PREDICTED: protein MOTHER of FT and TF 1           193   6e-58   
gb|AID67220.1|  MFT2-like protein                                       192   1e-57   
gb|AID67210.1|  MFT2-like protein                                       192   1e-57   
ref|NP_001041806.1|  Os01g0111600                                       191   3e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010274753.1|  PREDICTED: protein MOTHER of FT and TF 1-like      193   3e-57   
ref|XP_010523529.1|  PREDICTED: protein BROTHER of FT and TFL 1         191   3e-57   
gb|KDP42735.1|  hypothetical protein JCGZ_23675                         191   6e-57   
gb|AID67196.1|  MFT2-like protein                                       189   8e-57   
gb|AEO72023.1|  TFL1-like protein                                       190   1e-56   
ref|XP_010244607.1|  PREDICTED: CEN-like protein 2                      190   1e-56   
gb|AFW79811.1|  hypothetical protein ZEAMMB73_034486                    190   2e-56   
gb|ACN54549.1|  mother of FT and TFL1-like protein                      188   2e-56   Selaginella erythropus
ref|XP_010543489.1|  PREDICTED: protein TERMINAL FLOWER 1               190   2e-56   
ref|XP_003568618.1|  PREDICTED: protein MOTHER of FT and TF 1-like      189   2e-56   
ref|XP_011076204.1|  PREDICTED: CEN-like protein 1                      189   3e-56   
ref|XP_008241250.1|  PREDICTED: CEN-like protein 2                      188   4e-56   
ref|XP_002528731.1|  phosphatidylethanolamine-binding protein, pu...    188   4e-56   Ricinus communis
gb|AID67184.1|  MFT2-like protein                                       187   5e-56   
ref|XP_006587343.1|  PREDICTED: CEN-like protein 1-like isoform X2      188   7e-56   
ref|XP_006656987.1|  PREDICTED: protein MOTHER of FT and TF 1-like      188   7e-56   
ref|XP_007027716.1|  Centroradialis                                     187   8e-56   
ref|NP_001276314.1|  uncharacterized protein LOC100783608               187   9e-56   
ref|XP_003635936.1|  CEN-like protein                                   187   1e-55   
ref|XP_010101582.1|  hypothetical protein L484_015411                   187   1e-55   
dbj|BAJ22383.1|  terminal flower 1b                                     187   2e-55   
ref|XP_010278585.1|  PREDICTED: CEN-like protein 1                      187   2e-55   
dbj|BAD10971.1|  TFL1-like protein                                      186   2e-55   Chaenomeles sinensis
ref|XP_008784004.1|  PREDICTED: CEN-like protein 2                      186   2e-55   
ref|XP_004515713.1|  PREDICTED: CEN-like protein 1-like                 186   3e-55   
gb|ABY62770.1|  terminal flower 1b                                      185   7e-55   Gossypium hirsutum [American cotton]
gb|AID67182.1|  MFT2-like protein                                       184   7e-55   
dbj|BAD10970.1|  TFL1-like protein                                      185   8e-55   Cydonia oblonga [wen po]
gb|ABW24964.1|  terminal flower 1b                                      185   8e-55   Gossypium hirsutum [American cotton]
ref|XP_007152319.1|  hypothetical protein PHAVU_004G119700g             185   8e-55   
dbj|BAD10972.1|  TFL1-like protein                                      184   1e-54   Eriobotrya japonica [loquat]
ref|NP_001267931.1|  TFL1B protein                                      184   2e-54   
gb|AHZ46122.1|  TFL1-like flowering time protein                        184   2e-54   
gb|ABW24962.1|  terminal flower 1b                                      184   2e-54   Gossypium arboreum [tree cotton]
ref|NP_001240029.1|  CEN-like protein 2-like                            184   2e-54   
ref|XP_002450283.1|  hypothetical protein SORBIDRAFT_05g003200          184   2e-54   Sorghum bicolor [broomcorn]
gb|AGX25254.1|  MCN5                                                    184   2e-54   
gb|ABX11008.1|  ZCN6                                                    184   2e-54   Zea mays [maize]
ref|XP_010271687.1|  PREDICTED: protein SELF-PRUNING-like               184   2e-54   
gb|AGN29206.1|  TFL1                                                    184   3e-54   
ref|XP_006365770.1|  PREDICTED: CEN-like protein 1-like                 184   3e-54   
gb|EMS48180.1|  hypothetical protein TRIUR3_17327                       184   3e-54   
ref|XP_010049502.1|  PREDICTED: protein TERMINAL FLOWER 1-like          184   3e-54   
gb|ABW24968.1|  terminal flower 1b                                      184   3e-54   Gossypium hirsutum [American cotton]
ref|XP_010693475.1|  PREDICTED: CEN-like protein 1                      184   3e-54   
ref|XP_004228452.1|  PREDICTED: CEN-like protein 1                      183   4e-54   
ref|XP_009356062.1|  PREDICTED: protein MOTHER of FT and TF 1-like      184   5e-54   
gb|AAM27952.1|AF466812_1  terminal flower 1                             183   5e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009390100.1|  PREDICTED: protein FLOWERING LOCUS T-like          183   5e-54   
ref|XP_002442808.1|  hypothetical protein SORBIDRAFT_08g003210          183   5e-54   Sorghum bicolor [broomcorn]
ref|NP_001289244.1|  protein TERMINAL FLOWER 1-like                     183   5e-54   
gb|EMT24999.1|  hypothetical protein F775_30083                         183   5e-54   
ref|XP_009592311.1|  PREDICTED: protein SELF-PRUNING-like isoform X2    183   6e-54   
ref|XP_007036755.1|  PEBP (phosphatidylethanolamine-binding prote...    182   6e-54   
ref|XP_004952639.1|  PREDICTED: protein SELF-PRUNING-like               182   6e-54   
dbj|BAD10966.1|  TFL1-like protein                                      182   7e-54   Eriobotrya japonica [loquat]
ref|XP_002436981.1|  hypothetical protein SORBIDRAFT_10g013070          183   7e-54   Sorghum bicolor [broomcorn]
ref|XP_006430226.1|  hypothetical protein CICLE_v10013475mg             182   7e-54   
ref|XP_006647339.1|  PREDICTED: protein SELF-PRUNING-like               182   8e-54   
gb|ADF30920.1|  Dt1                                                     182   8e-54   
gb|AAM27947.1|AF466807_1  terminal flower 1                             182   8e-54   Arabidopsis thaliana [mouse-ear cress]
gb|ADC32542.1|  terminal flower 1-like protein                          182   8e-54   Leavenworthia crassa
ref|XP_004308107.1|  PREDICTED: CEN-like protein 1-like                 182   9e-54   
ref|XP_004978696.1|  PREDICTED: CEN-like protein 2-like                 182   9e-54   
ref|NP_001173006.1|  Os02g0531600                                       182   9e-54   
gb|ABR53775.2|  TFL1y                                                   182   1e-53   Phaseolus vulgaris [French bean]
ref|NP_001280887.1|  protein TERMINAL FLOWER 1-like                     182   1e-53   
gb|AGX25242.1|  MCN3                                                    182   1e-53   
gb|AFA25738.1|  hypothetical protein                                    182   1e-53   
dbj|BAK18560.1|  flowering locus T-like protein                         182   1e-53   
ref|XP_003578901.1|  PREDICTED: CEN-like protein 2                      182   1e-53   
gb|AAM27957.1|AF466817_1  terminal flower 1                             182   1e-53   Arabidopsis lyrata [lyrate rockcress]
ref|XP_009384535.1|  PREDICTED: CEN-like protein 1                      182   1e-53   
gb|AID67229.1|  MFT2-like protein                                       181   1e-53   
dbj|BAI60052.1|  flowering locus T-like protein                         182   1e-53   Ficus carica
gb|ABW24966.1|  terminal flower 1b                                      182   1e-53   Gossypium raimondii
ref|XP_002453931.1|  hypothetical protein SORBIDRAFT_04g021650          182   1e-53   Sorghum bicolor [broomcorn]
ref|NP_001280770.1|  CEN-like protein 1                                 182   1e-53   
ref|XP_011094363.1|  PREDICTED: CEN-like protein 2 isoform X2           182   1e-53   
ref|NP_196004.1|  protein TERMINAL FLOWER 1                             182   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001267006.1|  protein TERMINAL FLOWER 1-like                     182   2e-53   
ref|XP_002447782.1|  hypothetical protein SORBIDRAFT_06g015490          182   2e-53   Sorghum bicolor [broomcorn]
ref|XP_002873117.1|  hypothetical protein ARALYDRAFT_487163             182   2e-53   
ref|NP_001106244.1|  ZCN5 protein                                       182   2e-53   Zea mays [maize]
ref|XP_007162890.1|  hypothetical protein PHAVU_001G189200g             183   2e-53   
pdb|1WKO|A  Chain A, Terminal Flower 1 (Tfl1) From Arabidopsis Th...    182   2e-53   
ref|XP_007202664.1|  hypothetical protein PRUPE_ppa012369mg             181   2e-53   
ref|XP_009374732.1|  PREDICTED: protein TERMINAL FLOWER 1-like          181   2e-53   
gb|EYU25074.1|  hypothetical protein MIMGU_mgv1a022196mg                181   2e-53   
gb|ABX11007.1|  ZCN5                                                    181   2e-53   Zea mays [maize]
ref|NP_001106241.1|  ZCN2 protein                                       181   2e-53   Zea mays [maize]
gb|AFK32780.1|  TFL1-like protein                                       181   2e-53   
gb|AGX25244.1|  MCN5                                                    181   2e-53   
gb|ABY91243.1|  CTRSTFL-like protein                                    181   2e-53   Citrus trifoliata [hardy orange]
dbj|BAH24197.1|  homologous protein to TFL1                             181   2e-53   Hordeum vulgare [barley]
ref|XP_011077877.1|  PREDICTED: CEN-like protein 2                      181   3e-53   
gb|ADF30943.1|  Dt1                                                     181   3e-53   
gb|AEO72027.1|  TFL1-like protein                                       181   3e-53   
ref|NP_001280794.1|  protein TERMINAL FLOWER 1-like                     181   3e-53   
gb|ADK95113.1|  flowering locus T-like protein                          181   3e-53   
gb|KDP22308.1|  hypothetical protein JCGZ_26139                         181   3e-53   
gb|AGX25243.1|  MCN4                                                    181   3e-53   
gb|ACJ61501.1|  terminal flower                                         181   3e-53   
gb|AFA42328.1|  TFL1-like protein                                       181   4e-53   
ref|XP_006481791.1|  PREDICTED: protein TERMINAL FLOWER 1 isoform X1    181   4e-53   
ref|XP_009379789.1|  PREDICTED: protein SELF-PRUNING-like               181   4e-53   
ref|XP_002864769.1|  brother of FT and TFL1 protein                     181   4e-53   
ref|XP_009390747.1|  PREDICTED: CEN-like protein 2                      181   4e-53   
ref|XP_010919262.1|  PREDICTED: CEN-like protein 1                      181   4e-53   
ref|NP_001239629.1|  protein TERMINAL FLOWER 1-like                     180   4e-53   
ref|XP_010907126.1|  PREDICTED: protein SELF-PRUNING-like               181   5e-53   
gb|ACF18111.1|  terminal flower 1                                       180   5e-53   Malus baccata [shan jing zi]
ref|NP_001275848.1|  terminal flower                                    181   5e-53   
ref|XP_006353340.1|  PREDICTED: CEN-like protein 1-like                 181   5e-53   
gb|EPS71350.1|  hypothetical protein M569_03409                         181   5e-53   
gb|AEO72025.1|  TFL1-like protein                                       180   5e-53   
dbj|BAK40196.1|  terminal flower 1                                      180   5e-53   
gb|ACF18112.1|  terminal flower 1                                       180   5e-53   Malus floribunda [Japanese crab apple]
ref|NP_001066172.1|  Os12g0152000                                       180   5e-53   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001105959.1|  LOC100037785                                       180   5e-53   Zea mays [maize]
ref|NP_001106245.1|  ZCN6 protein                                       181   5e-53   Zea mays [maize]
ref|XP_010912272.1|  PREDICTED: protein SELF-PRUNING-like               180   6e-53   
ref|NP_001289254.1|  protein HEADING DATE 3A                            180   6e-53   
ref|NP_001052733.1|  Os04g0411400                                       180   6e-53   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001106256.1|  ZCN19 protein                                      180   6e-53   Zea mays [maize]
gb|ACX34055.1|  FT-like protein 1                                       180   7e-53   Platanus x hispanica [London plane tree]
gb|AHX00603.1|  TFL1a                                                   180   7e-53   
gb|AEO72024.1|  TFL1-like protein                                       180   7e-53   
ref|XP_009130785.1|  PREDICTED: protein TERMINAL FLOWER 1               180   7e-53   
gb|ADO64261.1|  KSN                                                     180   7e-53   
ref|XP_008799538.1|  PREDICTED: CEN-like protein 1                      180   7e-53   
gb|KHN14994.1|  Protein CENTRORADIALIS-like                             180   8e-53   
ref|XP_006652260.1|  PREDICTED: protein SELF-PRUNING-like               180   8e-53   
gb|ABY79180.1|  At5g03840                                               180   8e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AID67244.1|  MFT2-like protein                                       179   8e-53   
ref|XP_006836050.1|  hypothetical protein AMTR_s00114p00070400          180   9e-53   
ref|XP_010490878.1|  PREDICTED: protein TERMINAL FLOWER 1-like          180   9e-53   
ref|XP_006365775.1|  PREDICTED: CEN-like protein 1-like                 180   9e-53   
ref|XP_009401773.1|  PREDICTED: CEN-like protein 1                      180   9e-53   
gb|AEH43348.1|  TFL1                                                    180   1e-52   
ref|XP_010423657.1|  PREDICTED: protein TERMINAL FLOWER 1               180   1e-52   
ref|XP_002446704.1|  hypothetical protein SORBIDRAFT_06g020850          179   1e-52   Sorghum bicolor [broomcorn]
ref|XP_010089842.1|  hypothetical protein L484_022359                   179   1e-52   
gb|ABF85670.1|  terminal flower 1-like protein                          179   1e-52   Hordeum vulgare subsp. vulgare [barley]
emb|CDP15403.1|  unnamed protein product                                179   1e-52   
ref|XP_008788083.1|  PREDICTED: protein SELF-PRUNING-like               179   1e-52   
ref|XP_009792306.1|  PREDICTED: CEN-like protein 2                      179   1e-52   
dbj|BAD10964.1|  TFL1-like protein                                      179   1e-52   
gb|AGX25252.1|  MCN3                                                    179   1e-52   
gb|AAR03725.1|  TFL1a                                                   179   1e-52   
emb|CAH67157.1|  H0717B12.4                                             179   1e-52   
dbj|BAD10965.1|  TFL1-like protein                                      179   1e-52   
gb|KGN48258.1|  hypothetical protein Csa_6G452100                       179   1e-52   
ref|XP_009780427.1|  PREDICTED: CEN-like protein 1                      179   1e-52   
gb|ACF18113.1|  terminal flower 1                                       179   1e-52   
gb|ABX11005.1|  ZCN3                                                    179   1e-52   
gb|AFP33418.1|  terminal flower 1                                       179   1e-52   
gb|ABB99414.1|  FT-like protein                                         179   1e-52   
ref|XP_008662652.1|  PREDICTED: protein TWIN SISTER of FT               179   1e-52   
gb|KDO61123.1|  hypothetical protein CISIN_1g035977mg                   179   2e-52   
ref|XP_008234274.1|  PREDICTED: CEN-like protein 1                      179   2e-52   
ref|XP_010444040.1|  PREDICTED: protein BROTHER of FT and TFL 1         179   2e-52   
gb|AAM27953.1|AF466813_1  terminal flower 1                             179   2e-52   
dbj|BAH82787.1|  flowering locus T protein                              179   2e-52   
ref|XP_002443085.1|  hypothetical protein SORBIDRAFT_08g008180          179   2e-52   
gb|ABY79175.1|  At5g03840                                               179   2e-52   
gb|ACX53295.1|  terminal flower 1-like protein                          179   2e-52   
gb|ADL62862.1|  terminal flower 1                                       179   2e-52   
gb|AEU08964.1|  flowering locus T                                       179   2e-52   
ref|NP_001267654.1|  protein SELF-PRUNING-like                          179   2e-52   
ref|XP_006662737.1|  PREDICTED: CEN-like protein 2-like                 179   2e-52   
gb|ACX85427.1|  flowering locus T                                       179   2e-52   
ref|NP_001065771.1|  Os11g0152500                                       179   2e-52   
dbj|BAH37010.1|  terminal flower1-like protein                          179   2e-52   
ref|XP_010452279.1|  PREDICTED: protein TERMINAL FLOWER 1-like          179   2e-52   
ref|XP_011094364.1|  PREDICTED: protein TERMINAL FLOWER 1-like is...    179   2e-52   
ref|XP_009379923.1|  PREDICTED: protein HEADING DATE 3A                 179   2e-52   
ref|XP_010255492.1|  PREDICTED: CEN-like protein 1                      179   2e-52   
gb|KEH17362.1|  terminal flower 1                                       178   2e-52   
emb|CBY25181.1|  flowering locus T protein                              179   2e-52   
ref|XP_004977568.1|  PREDICTED: CEN-like protein 2-like                 179   2e-52   
dbj|BAP28173.1|  flowering locus T-like protein                         179   2e-52   
ref|XP_003579695.1|  PREDICTED: CEN-like protein 2                      179   3e-52   
ref|NP_001106242.1|  ZCN3 protein                                       179   3e-52   
ref|XP_009389894.1|  PREDICTED: protein HEADING DATE 3A-like            179   3e-52   
ref|XP_003575068.1|  PREDICTED: CEN-like protein 2                      178   3e-52   
ref|XP_009151327.1|  PREDICTED: protein BROTHER of FT and TFL 1         179   3e-52   
ref|XP_009125522.1|  PREDICTED: protein TERMINAL FLOWER 1-like          179   3e-52   
gb|ABP73384.1|  TFL1                                                    178   3e-52   
emb|CDX86931.1|  BnaC03g52010D                                          179   3e-52   
dbj|BAJ22384.1|  terminal flower 1a                                     178   3e-52   
ref|NP_001280810.1|  protein HEADING DATE 3A                            178   3e-52   
gb|AFK91525.1|  FT-like protein                                         178   3e-52   
ref|NP_001274853.1|  CEN-like protein 1-like                            178   3e-52   
gb|AEU08960.1|  flowering locus T                                       178   3e-52   
ref|NP_201010.1|  protein BROTHER of FT and TFL 1                       178   4e-52   
ref|XP_006858639.1|  hypothetical protein AMTR_s00066p00045830          178   4e-52   
ref|XP_009592303.1|  PREDICTED: protein SELF-PRUNING-like isoform X1    178   4e-52   
ref|XP_006281443.1|  hypothetical protein CARUB_v10027522mg             178   4e-52   
gb|AAQ93599.1|  CEN/TFL1-like GTP-associated binding protein            178   4e-52   
ref|NP_001280182.1|  protein HEADING DATE 3A                            178   4e-52   
dbj|BAI66119.1|  terminal flower 1b                                     178   4e-52   
ref|XP_006663820.1|  PREDICTED: CEN-like protein 2-like                 178   4e-52   
ref|XP_002312811.1|  TFL1a family protein                               178   4e-52   
gb|EMS62911.1|  hypothetical protein TRIUR3_23342                       178   5e-52   
gb|ABP73380.1|  TFL1                                                    178   5e-52   
ref|XP_007150078.1|  hypothetical protein PHAVU_005G124600g             178   5e-52   
ref|XP_004976027.1|  PREDICTED: protein FLOWERING LOCUS T-like          178   5e-52   
ref|NP_001239678.1|  protein SELF-PRUNING-like                          178   5e-52   
gb|AFV67448.1|  centroradialis                                          178   5e-52   
emb|CBI75519.1|  Flowering Locus T-like protein, putative               178   5e-52   
gb|AEU08961.1|  flowering locus T                                       178   5e-52   
gb|ADA77529.1|  flowering locus T protein                               178   5e-52   
gb|AGI74990.1|  flowering locus T protein                               178   5e-52   
ref|XP_004234370.1|  PREDICTED: CEN-like protein 1                      178   6e-52   
gb|EAY80666.1|  hypothetical protein OsI_35843                          178   6e-52   
ref|NP_001280940.1|  CEN-like protein 2                                 177   6e-52   
ref|XP_004163314.1|  PREDICTED: CEN-like protein 2-like                 178   6e-52   
ref|XP_010109942.1|  hypothetical protein L484_011784                   177   7e-52   
gb|ADF30918.1|  Dt1                                                     177   7e-52   
gb|KDP31551.1|  hypothetical protein JCGZ_15206                         177   7e-52   
gb|EMT03780.1|  hypothetical protein F775_20562                         180   7e-52   
gb|ACG31744.1|  RCN4 - Corn Centroradialis/TFL1-like protein            177   7e-52   
ref|NP_001106264.1|  ZCN11 protein                                      177   7e-52   
gb|EMT05258.1|  hypothetical protein F775_30982                         177   7e-52   
gb|ABX11019.1|  ZCN17                                                   177   7e-52   
ref|NP_001106243.1|  ZCN4 protein                                       177   7e-52   
dbj|BAO93910.1|  terminal flower 1                                      177   7e-52   
gb|ABP73382.1|  TFL1                                                    177   7e-52   
ref|XP_007015849.1|  Centroradialis                                     177   8e-52   
ref|XP_009766168.1|  PREDICTED: protein TERMINAL FLOWER 1-like          177   8e-52   
gb|AEU08962.1|  flowering locus T                                       177   8e-52   
emb|CDX80890.1|  BnaC03g01440D                                          177   9e-52   
dbj|BAK40194.1|  flowering locus T                                      177   9e-52   
dbj|BAD22601.1|  flowering locus T like protein                         177   9e-52   
gb|AIA10356.1|  TFL1                                                    177   1e-51   
gb|AEH41277.1|  terminal flower 1                                       177   1e-51   
ref|XP_011000909.1|  PREDICTED: CEN-like protein 2                      177   1e-51   
ref|XP_006398842.1|  hypothetical protein EUTSA_v10015708mg             177   1e-51   
ref|XP_003625808.1|  TFL1                                               177   1e-51   
gb|AGX25240.1|  MCN1                                                    177   1e-51   
ref|XP_007028083.1|  PEBP (phosphatidylethanolamine-binding prote...    177   1e-51   
gb|ACF18115.1|  terminal flower 1                                       177   1e-51   
ref|XP_010045223.1|  PREDICTED: CEN-like protein 2                      177   1e-51   
ref|XP_004979174.1|  PREDICTED: protein FLOWERING LOCUS T-like          177   1e-51   
ref|XP_010683747.1|  PREDICTED: CEN-like protein 4                      177   1e-51   
ref|XP_007206006.1|  hypothetical protein PRUPE_ppa012343mg             177   1e-51   
ref|XP_006394441.1|  hypothetical protein EUTSA_v10005589mg             177   1e-51   
ref|XP_009371917.1|  PREDICTED: CEN-like protein 2 isoform X2           177   1e-51   
ref|XP_009611986.1|  PREDICTED: CEN-like protein 1                      177   1e-51   
ref|XP_008462564.1|  PREDICTED: CEN-like protein 2 isoform X2           177   1e-51   
ref|XP_009364306.1|  PREDICTED: CEN-like protein 2 isoform X2           177   2e-51   
gb|ABI98712.1|  terminal flower 1                                       176   2e-51   
dbj|BAI99731.2|  flowering locus T                                      176   2e-51   
ref|XP_007206002.1|  hypothetical protein PRUPE_ppa012320mg             176   2e-51   
ref|XP_007221173.1|  hypothetical protein PRUPE_ppa021829mg             176   2e-51   
gb|AGS32268.1|  TFL1-1                                                  176   2e-51   
ref|XP_006289547.1|  hypothetical protein CARUB_v10003093mg             176   2e-51   
gb|KHN18765.1|  Protein TERMINAL FLOWER 1                               176   2e-51   
ref|NP_001280813.1|  CEN-like protein 2                                 176   2e-51   
gb|AFS60093.1|  flowering locus T                                       176   2e-51   
gb|AGC92994.1|  flowering locus T                                       176   2e-51   
ref|NP_001106254.1|  ZCN17 protein                                      176   2e-51   
ref|XP_004493127.1|  PREDICTED: protein FLOWERING LOCUS T-like          176   2e-51   
dbj|BAD10962.1|  TFL1-like protein                                      176   2e-51   
gb|AGT41971.1|  TFL1                                                    176   2e-51   
dbj|BAM73643.1|  terminal flower1 homologue                             176   2e-51   
emb|CDY14173.1|  BnaC02g02900D                                          176   2e-51   
ref|XP_009411957.1|  PREDICTED: CEN-like protein 2                      176   2e-51   
gb|ACF18116.1|  terminal flower 1                                       176   3e-51   
ref|XP_004975557.1|  PREDICTED: CEN-like protein 1-like                 176   3e-51   
gb|AFR31531.1|  flowering locus T protein                               176   3e-51   
gb|ACF18100.1|  terminal flower 1                                       176   3e-51   
ref|XP_010915639.1|  PREDICTED: protein HEADING DATE 3A-like isof...    176   3e-51   
gb|ACY80737.1|  TFL1A protein                                           176   3e-51   
gb|ADU15498.1|  flowering locus T-like protein                          176   3e-51   
gb|ACV92037.1|  flowering locus T                                       176   3e-51   
gb|AIA10351.1|  TFL1                                                    176   3e-51   
gb|ADF80896.1|  terminal flower 1                                       176   3e-51   
ref|XP_009416652.1|  PREDICTED: protein FLOWERING LOCUS T-like          176   3e-51   
ref|XP_002489297.1|  hypothetical protein SORBIDRAFT_0010s003120        176   3e-51   
gb|ABF56526.1|  flowering locus T-like protein                          176   3e-51   
ref|XP_009371916.1|  PREDICTED: CEN-like protein 2 isoform X1           176   4e-51   
gb|ABP73381.1|  TFL1                                                    176   4e-51   
emb|CAI61980.1|  TERMINAL FLOWER 1 protein                              176   4e-51   
ref|XP_004228449.1|  PREDICTED: CEN-like protein 1                      176   4e-51   
ref|NP_001267929.1|  TFL1A protein                                      176   4e-51   
ref|XP_010268289.1|  PREDICTED: protein HEADING DATE 3A                 176   4e-51   
ref|NP_001106255.1|  ZCN18 protein                                      176   4e-51   
gb|AIW39809.1|  flowering locus T-like protein                          176   4e-51   
gb|AEO72026.1|  TFL1-like protein                                       175   4e-51   
gb|AGH33864.1|  flowering locus T protein                               176   4e-51   
ref|XP_009364305.1|  PREDICTED: CEN-like protein 2 isoform X1           176   4e-51   
ref|XP_006480699.1|  PREDICTED: protein HEADING DATE 3A-like            176   4e-51   
ref|XP_008804208.1|  PREDICTED: protein FLOWERING LOCUS T-like          176   5e-51   
ref|XP_008666991.1|  PREDICTED: ZCN18 protein isoform X1                176   5e-51   
dbj|BAM10941.1|  flowering locus T-like protein                         176   5e-51   
gb|EMT02924.1|  hypothetical protein F775_21216                         175   5e-51   
gb|AFV67432.1|  centroradialis                                          175   5e-51   
gb|AHF27445.1|  flowering locus T-like 3                                175   5e-51   
gb|AHB63017.1|  FLOWERING LOCUS T 1                                     175   5e-51   
ref|XP_003565602.1|  PREDICTED: protein HEADING DATE 3A-like            175   5e-51   
gb|ACF18104.1|  terminal flower 1                                       175   5e-51   
gb|KDO46010.1|  hypothetical protein CISIN_1g030371mg                   175   5e-51   
gb|AFP33421.1|  terminal flower 1                                       175   6e-51   
dbj|BAO03055.1|  Hd3a                                                   175   6e-51   
ref|NP_001106257.1|  ZCN25 protein                                      175   6e-51   
ref|XP_006428231.1|  hypothetical protein CICLE_v10012629mg             177   6e-51   
emb|CAI61981.1|  TERMINAL FLOWER 1 protein                              175   6e-51   
dbj|BAA33415.1|  BNTFL1-1                                               175   6e-51   
ref|XP_011094361.1|  PREDICTED: CEN-like protein 2 isoform X1           175   6e-51   
gb|EAZ11052.1|  hypothetical protein OsJ_00896                          175   6e-51   
ref|XP_006652439.1|  PREDICTED: protein FLOWERING LOCUS T-like          175   6e-51   
ref|XP_004515607.1|  PREDICTED: CEN-like protein 4-like                 175   7e-51   
gb|ACF18122.1|  terminal flower 1                                       174   7e-51   
dbj|BAA33417.1|  BNTFL1-3                                               175   7e-51   
gb|AAX96155.1|  Phosphatidylethanolamine-binding protein, putative      175   7e-51   
dbj|BAG72285.1|  Hd3a                                                   175   7e-51   
ref|XP_002316173.1|  flowering locus T family protein                   175   8e-51   
gb|ACH73165.1|  flower locus T                                          175   8e-51   
ref|XP_009122666.1|  PREDICTED: protein TERMINAL FLOWER 1-like          175   8e-51   
ref|XP_004246534.1|  PREDICTED: CEN-like protein 2                      175   8e-51   
ref|XP_010247852.1|  PREDICTED: protein FLOWERING LOCUS T-like is...    175   8e-51   
gb|AFK31136.1|  Hd3a                                                    175   8e-51   
gb|ABP73383.1|  TFL1                                                    175   8e-51   
ref|XP_010458097.1|  PREDICTED: protein BROTHER of FT and TFL 1-like    175   9e-51   
gb|AGC92991.1|  flowering locus T                                       174   9e-51   
gb|ABI94605.1|  flowering locus T-like 1                                175   1e-50   
dbj|BAO02994.1|  Hd3a                                                   175   1e-50   
ref|XP_009620724.1|  PREDICTED: protein FLOWERING LOCUS T-like          174   1e-50   
gb|AFK31129.1|  Hd3a                                                    175   1e-50   
gb|EMT02925.1|  hypothetical protein F775_25832                         174   1e-50   
ref|XP_011007279.1|  PREDICTED: CEN-like protein 2                      174   1e-50   
ref|XP_008376539.1|  PREDICTED: CEN-like protein 1                      174   1e-50   
ref|XP_010247850.1|  PREDICTED: protein FLOWERING LOCUS T-like is...    174   1e-50   
gb|AEK06124.1|  terminal flowering 1 protein 1                          174   1e-50   
gb|EMT27170.1|  hypothetical protein F775_12355                         174   1e-50   
dbj|BAG72295.1|  Hd3a                                                   174   1e-50   
dbj|BAH56285.1|  FT-like protein                                        174   1e-50   
ref|XP_009609848.1|  PREDICTED: CEN-like protein 1                      174   1e-50   
dbj|BAA33419.1|  BRTFL1-2                                               174   1e-50   
ref|XP_010483896.1|  PREDICTED: protein BROTHER of FT and TFL 1-like    174   1e-50   
gb|AFI93431.1|  terminal flower 1                                       174   1e-50   
ref|XP_010912140.1|  PREDICTED: protein HEADING DATE 3A-like            174   1e-50   
gb|ABR20498.1|  FTL1                                                    174   1e-50   
ref|XP_006384827.1|  TFL1a family protein                               174   1e-50   
gb|AAM46142.1|AF378127_1  terminal flower-like protein 1                174   1e-50   
ref|NP_001241437.1|  protein TERMINAL FLOWER 1-like                     174   1e-50   
dbj|BAL70256.1|  centroradialis                                         174   1e-50   
gb|AAZ38709.1|  FT-like protein                                         174   1e-50   
dbj|BAG72293.1|  Hd3a                                                   174   1e-50   
ref|XP_009385785.1|  PREDICTED: protein FLOWERING LOCUS T-like          174   1e-50   
gb|AGX25250.1|  MCN1                                                    174   1e-50   
ref|XP_004494168.1|  PREDICTED: protein CENTRORADIALIS-like             174   1e-50   
ref|XP_004291610.1|  PREDICTED: CEN-like protein 2-like                 174   1e-50   
dbj|BAO03052.1|  Hd3a                                                   174   1e-50   
gb|ADW82821.1|  flowering time locus T-like protein 1                   174   1e-50   
dbj|BAO02982.1|  Hd3a                                                   174   1e-50   
gb|AFK31118.1|  Hd3a                                                    174   1e-50   
gb|AGD93126.1|  flowering locus T                                       174   1e-50   
gb|AFV67438.1|  centroradialis                                          174   1e-50   
dbj|BAO03056.1|  Hd3a                                                   174   1e-50   
dbj|BAD02371.1|  flowering locus T                                      174   2e-50   
gb|AFK31134.1|  Hd3a                                                    174   2e-50   
gb|AHF27444.1|  flowering locus T-like 2                                174   2e-50   
gb|ACF18118.1|  terminal flower 1                                       174   2e-50   



>ref|XP_009757896.1| PREDICTED: protein MOTHER of FT and TF 1-like [Nicotiana sylvestris]
Length=180

 Score =   287 bits (734),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RSVDPLVVGKVIGDV+DMFVPVVEF+V+YGSK+I+NGVEI P++AA KP +HI GSP S 
Sbjct  6    RSVDPLVVGKVIGDVVDMFVPVVEFSVEYGSKQISNGVEIKPAAAAHKPRLHIQGSPDSN  65

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            NLYTL+M DPDAPSPSEPTFREWLHW+VTDIPEG DAS+GRE+ EY+GP PPTGIHRYVF
Sbjct  66   NLYTLVMADPDAPSPSEPTFREWLHWIVTDIPEGGDASEGRELTEYMGPQPPTGIHRYVF  125

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQ-SATNKKR  557
             LFRQ EA QV  KPP  R NF TR+FA+ NGLGLPVAALYFNSQK+ +A NKKR
Sbjct  126  TLFRQTEAEQVPHKPPAGRANFNTRKFASDNGLGLPVAALYFNSQKEHNAANKKR  180



>ref|XP_009589130.1| PREDICTED: protein MOTHER of FT and TF 1-like [Nicotiana tomentosiformis]
Length=184

 Score =   284 bits (727),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 152/177 (86%), Gaps = 2/177 (1%)
 Frame = +3

Query  33   PRSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKK-IANGVEITPSSAAQKPSVHINGSPA  209
            PRSVDPLVVGKVIGDVLDMFVPV+EFTV+YGSKK I+NGVEI P++AAQ+P VHI GS  
Sbjct  8    PRSVDPLVVGKVIGDVLDMFVPVIEFTVEYGSKKQISNGVEIKPAAAAQRPRVHIQGSRD  67

Query  210  SPNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRY  389
            S NLYTL+M DPDAPSPSEPTFREWLHW+VTDIPEG DAS+GREV EY+G  PPTGIHRY
Sbjct  68   SNNLYTLVMADPDAPSPSEPTFREWLHWIVTDIPEGGDASEGREVMEYMGAQPPTGIHRY  127

Query  390  VFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQ-SATNKKR  557
            VF LFRQ EA QV  KPPE R NF TR+FA+ NGLG PVAALYFNS K+ +A NKKR
Sbjct  128  VFTLFRQTEAEQVPHKPPERRANFNTRKFASDNGLGFPVAALYFNSHKEHAAANKKR  184



>ref|XP_004232787.1| PREDICTED: protein MOTHER of FT and TF 1 [Solanum lycopersicum]
Length=181

 Score =   280 bits (716),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 152/180 (84%), Gaps = 3/180 (2%)
 Frame = +3

Query  18   MAN--ANPRSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIAN-GVEITPSSAAQKPSV  188
            MAN   + RSVDPLVVGKVIGDVLDMFVPVV+FTV+Y SK+I+N GVEI P+ AAQKP V
Sbjct  1    MANMETSARSVDPLVVGKVIGDVLDMFVPVVDFTVEYASKQISNNGVEIKPAEAAQKPRV  60

Query  189  HINGSPASPNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSP  368
            HI GS  S NLYTL+M DPDAPSPSEPTFREWLHW+VTDIPEG DAS+GRE+ EY+GP P
Sbjct  61   HIKGSLHSNNLYTLVMADPDAPSPSEPTFREWLHWIVTDIPEGGDASQGREMVEYMGPKP  120

Query  369  PTGIHRYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATN  548
            P GIHRYVF LFRQ+EA QV  KPP+ R NF+TRQFA+ NGL LPVAALYFNSQK+ A +
Sbjct  121  PAGIHRYVFTLFRQKEAEQVPHKPPQGRSNFKTRQFASDNGLDLPVAALYFNSQKEHAAH  180



>gb|AAO31791.1| SP2G [Solanum lycopersicum]
Length=178

 Score =   279 bits (713),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 148/172 (86%), Gaps = 1/172 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIAN-GVEITPSSAAQKPSVHINGSPAS  212
            RSVDPLVVGKVIGDVLDMFVPVV+FTV+Y SK+I+N GVEI P+ AAQKP VHI GS  S
Sbjct  6    RSVDPLVVGKVIGDVLDMFVPVVDFTVEYASKQISNNGVEIKPAEAAQKPRVHIKGSLHS  65

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             NLYTL+M DPDAPSPSEPTFREWLHW+VTDIPEG DAS+GRE+ EY+GP PP GIHRYV
Sbjct  66   NNLYTLVMADPDAPSPSEPTFREWLHWIVTDIPEGGDASQGREMVEYMGPKPPAGIHRYV  125

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATN  548
            F LFRQ+EA QV  KPP+ R NF+TRQFA+ NGL LPVAALYFNSQK+ A +
Sbjct  126  FTLFRQKEAEQVPHKPPQGRSNFKTRQFASDNGLDLPVAALYFNSQKEHAAH  177



>gb|KDP20872.1| hypothetical protein JCGZ_21343 [Jatropha curcas]
 gb|AID51390.1| mother of FT and TFL1 2 [Jatropha curcas]
 gb|AID51395.1| mother of FT and TFL1 2 [Jatropha curcas]
Length=175

 Score =   258 bits (659),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RS++PLVVGKVIG+VLDM+ PV EFTV YGSK++ANG EI PS AAQKP VHI GS  S 
Sbjct  3    RSLEPLVVGKVIGEVLDMYNPVAEFTVHYGSKQVANGCEIKPSVAAQKPHVHILGSRLSS  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTL+MVDPDAPSPSEP +REWL W+V DIPEGSDA+KG E+  Y+GP PPTGIHRYVF
Sbjct  63   DLYTLVMVDPDAPSPSEPKWREWLLWIVVDIPEGSDATKGHELVSYMGPQPPTGIHRYVF  122

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            ALF+Q+ A+    +PP+ RGNF TR FAA +GLGLPVAA+YFNSQK+ A  K+
Sbjct  123  ALFKQKGALMGRIQPPDGRGNFNTRHFAAQSGLGLPVAAVYFNSQKEPAVKKR  175



>ref|XP_010268882.1| PREDICTED: protein MOTHER of FT and TF 1-like [Nelumbo nucifera]
Length=175

 Score =   258 bits (658),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RS++PL VGKVIGDVLDMF P +EFTV YGSK++ANG EI PS+AA KP V ++GS  S 
Sbjct  3    RSIEPLAVGKVIGDVLDMFSPTLEFTVHYGSKQVANGCEIKPSAAANKPKVQLSGSRLSN  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            NLYTL+M DPDAPSPSEPT REWLHW+V DI EGSDA+KG+E+  Y+GP PPTGIHRYVF
Sbjct  63   NLYTLVMTDPDAPSPSEPTMREWLHWIVVDIAEGSDATKGKELVSYMGPRPPTGIHRYVF  122

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q+  +    +PP++RG+F TR FAA NGLGLPVAA+YFN+QK+ AT K+
Sbjct  123  TLFQQKGPITEETRPPDARGSFNTRNFAAQNGLGLPVAAVYFNAQKEPATRKR  175



>ref|XP_010096797.1| hypothetical protein L484_002399 [Morus notabilis]
 gb|EXB66020.1| hypothetical protein L484_002399 [Morus notabilis]
Length=177

 Score =   254 bits (650),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 139/175 (79%), Gaps = 2/175 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RS++PLVVGKVIGDV+DMF P VE TV YGSK++ NG EI PS+AA +P   I G P   
Sbjct  3    RSLEPLVVGKVIGDVVDMFSPAVELTVRYGSKQVGNGCEIKPSAAADRPKAQILGPPNHA  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            NLYTL+MVDPDAPSPSEPT REWLHW+V DIPEG DA+KG+EV  Y+GP PPTGIHRY+F
Sbjct  63   NLYTLVMVDPDAPSPSEPTLREWLHWIVVDIPEGLDATKGKEVVPYMGPKPPTGIHRYMF  122

Query  396  ALFRQREAMQVAQK--PPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            ALFRQR    +A     PE+RGNFRTRQFAA  GLGLPVAA+YFNSQK+  T K+
Sbjct  123  ALFRQRSGTILAGNVPSPEARGNFRTRQFAAQYGLGLPVAAVYFNSQKEPGTRKR  177



>gb|KHG10593.1| Protein MOTHER of FT and TF 1 -like protein [Gossypium arboreum]
Length=175

 Score =   249 bits (635),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 137/173 (79%), Gaps = 0/173 (0%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RSV+PLVVG+VIGDVLDMF P  EFTV YG+K++ NG +I PS+AA KP V I G P S 
Sbjct  3    RSVEPLVVGRVIGDVLDMFTPASEFTVRYGTKQVTNGCDIKPSAAADKPHVQILGHPFSS  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            NLYTL+MVDPDAPSPSEP  REWLHW+V DIPEG DA+KGRE+  Y+GP PPTGIHRY+ 
Sbjct  63   NLYTLVMVDPDAPSPSEPRLREWLHWIVVDIPEGQDATKGRELVAYMGPQPPTGIHRYIL  122

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            ALF+Q  AM+   +  ++R NF TR+FAA N LGLPVAA+YFNSQK+ A  K+
Sbjct  123  ALFKQEGAMEGRIQVADARANFSTRRFAAQNRLGLPVAAVYFNSQKEPAAKKR  175



>ref|XP_006467912.1| PREDICTED: protein MOTHER of FT and TF 1-like [Citrus sinensis]
 gb|KDO75688.1| hypothetical protein CISIN_1g030480mg [Citrus sinensis]
Length=176

 Score =   248 bits (634),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 141/174 (81%), Gaps = 1/174 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSP-AS  212
            RS++PLVVG+VIGDV+DMF P  E TV YG+K++ANG EI PS++A KPSV I+  P AS
Sbjct  3    RSMEPLVVGRVIGDVVDMFTPATEMTVHYGTKQVANGCEIKPSASADKPSVQIHAPPPAS  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             NLYTL+MVDPDAPSPSEP +REWLHW+V DIPEGSDA+KG+E+  Y+GP PPTGIHRYV
Sbjct  63   SNLYTLVMVDPDAPSPSEPRYREWLHWIVVDIPEGSDATKGKELVAYMGPQPPTGIHRYV  122

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            FALF Q+  +    +PP++R NF TR+FAA NGL  PVAA+YFNSQK+ A  K+
Sbjct  123  FALFNQKGKVMAGCRPPDARSNFSTRRFAADNGLQPPVAAVYFNSQKEVAVRKR  176



>ref|XP_010277909.1| PREDICTED: protein MOTHER of FT and TF 1-like [Nelumbo nucifera]
Length=175

 Score =   248 bits (634),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 139/173 (80%), Gaps = 0/173 (0%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RS++PLVVGKVIGDVLDMF P +EFTV YGSK+IANG EI PS  A KP VH++GS  S 
Sbjct  3    RSIEPLVVGKVIGDVLDMFTPTIEFTVHYGSKQIANGCEIKPSVVANKPRVHLSGSRLSN  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTL+M DPDAPSPSEP  REWL+W+V DIPEGSDA+ G+E+  Y+GPSPPTGIHRYVF
Sbjct  63   SLYTLVMTDPDAPSPSEPNLREWLNWIVVDIPEGSDATNGKEMVVYMGPSPPTGIHRYVF  122

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            ALF+Q+  M    + P +R NF TR FAA  GLGLPVAA+YFN+QK+ A+ K+
Sbjct  123  ALFQQKGPMTEGIRLPVARSNFSTRSFAAEIGLGLPVAAVYFNAQKEPASRKR  175



>ref|XP_006449196.1| hypothetical protein CICLE_v10016917mg [Citrus clementina]
 gb|ESR62436.1| hypothetical protein CICLE_v10016917mg [Citrus clementina]
Length=176

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 141/174 (81%), Gaps = 1/174 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHING-SPAS  212
            RS++PLVVG+VIGDV+DMF P  E TV YG+K++ANG EI PS++A KPSV I+  +PAS
Sbjct  3    RSMEPLVVGRVIGDVVDMFTPATEMTVHYGTKQVANGCEIKPSASADKPSVQIHAPAPAS  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             NLYTL+MVDPDAPSPSEP +REWLHW+V DIPEGSDA+KG+E+  Y+GP PPTGIHRYV
Sbjct  63   SNLYTLVMVDPDAPSPSEPRYREWLHWIVVDIPEGSDATKGKELVAYMGPQPPTGIHRYV  122

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF Q+  +    +PP++R NF TR+FAA NGL  PVAA+YFNSQK+ A  K+
Sbjct  123  FVLFNQKGKVMAGCRPPDARSNFSTRRFAADNGLQPPVAAVYFNSQKEVAVRKR  176



>ref|XP_008441938.1| PREDICTED: protein MOTHER of FT and TF 1-like [Cucumis melo]
Length=174

 Score =   247 bits (631),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 139/173 (80%), Gaps = 1/173 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RSVD LVVG+VIGDVLDMF P  + +V YGSK++ANG EI P  AA +P+VHI  +P S 
Sbjct  3    RSVDSLVVGRVIGDVLDMFTPAADVSVSYGSKQVANGCEIKPFVAADRPTVHIQ-APISN  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
             LYTL+MVDPDAPSPSEPTFREWLHW+V DIPEG+DA+KG+EV +Y+GP PPTGIHRYVF
Sbjct  62   QLYTLVMVDPDAPSPSEPTFREWLHWIVVDIPEGADANKGKEVVQYMGPQPPTGIHRYVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            A F+Q   +    +PP +R NF TRQFA+ + LGLPVAA+YFNSQKQ A+ K+
Sbjct  122  AFFKQNTHLGGRLRPPTTRSNFSTRQFASQHALGLPVAAVYFNSQKQPASKKR  174



>gb|AGJ98454.1| MFT1 [Gossypium barbadense]
Length=175

 Score =   247 bits (631),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 136/173 (79%), Gaps = 0/173 (0%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RSV+PLVVG+VIGDVLDMF P  EFTV YG+K++ NG +I PS+AA KP V I G P S 
Sbjct  3    RSVEPLVVGRVIGDVLDMFTPASEFTVRYGTKQVTNGCDIKPSAAADKPHVQILGHPFSS  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            NLYTL+MVDPDAPSPSEP  REWLHW+V DIPEG DA+KGRE+  Y+GP PPTGIHRY+ 
Sbjct  63   NLYTLVMVDPDAPSPSEPRLREWLHWIVVDIPEGQDATKGRELVAYMGPQPPTGIHRYIL  122

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            ALF+Q  AM+   +   +R NF TR+FAA N LGLPVAA+YFNSQK+ A  K+
Sbjct  123  ALFKQEGAMEGRIQVAGARANFSTRRFAAQNRLGLPVAAVYFNSQKEPAAKKR  175



>ref|XP_010686259.1| PREDICTED: protein MOTHER of FT and TF 1-like [Beta vulgaris 
subsp. vulgaris]
Length=189

 Score =   248 bits (632),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 136/172 (79%), Gaps = 0/172 (0%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RS+DPLVVG+VIGDVLDMFVPV +F V YG+K I NG EI PS A ++P V I+G P++ 
Sbjct  17   RSIDPLVVGRVIGDVLDMFVPVADFRVQYGTKHIFNGCEIKPSLAIERPIVQISGIPSTD  76

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            N Y+LIMVDPDAPSPSEP  REWLHWVV DIP+G DASKGRE+ EY+GP PPTGIHRYVF
Sbjct  77   NHYSLIMVDPDAPSPSEPKMREWLHWVVADIPQGLDASKGRELVEYMGPKPPTGIHRYVF  136

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNK  551
             LFRQ+  +    + P +R NF TR FA  NGLGLPVAA+YFNSQK++A  K
Sbjct  137  VLFRQKGPIAKPWQLPHARNNFSTRNFAIQNGLGLPVAAVYFNSQKEAAKKK  188



>ref|XP_004146579.1| PREDICTED: protein MOTHER of FT and TF 1-like [Cucumis sativus]
 ref|XP_004158023.1| PREDICTED: protein MOTHER of FT and TF 1-like [Cucumis sativus]
 gb|KGN64620.1| hypothetical protein Csa_1G071830 [Cucumis sativus]
Length=174

 Score =   246 bits (627),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 139/173 (80%), Gaps = 1/173 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RSVD LVVG+VIGDVLDMF P  + +V YGSK +ANG EI P  AA +P+V I  +P S 
Sbjct  3    RSVDSLVVGRVIGDVLDMFTPAADVSVSYGSKHVANGGEIKPFVAADRPTVLIQ-APVSN  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
             LYTL+MVDPDAPSPSEPTFREWLHW+V DIPEG+DA+KG+EV  Y+GP PPTGIHRYVF
Sbjct  62   QLYTLVMVDPDAPSPSEPTFREWLHWIVVDIPEGADANKGKEVVHYMGPQPPTGIHRYVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            A+F+Q   +    +PP +R NF+TRQFA+ NGLGLPVAA+YFNSQKQ A+ K+
Sbjct  122  AVFKQNTPLGGRLRPPTTRSNFKTRQFASQNGLGLPVAAVYFNSQKQPASKKR  174



>ref|NP_001267935.1| MFT-like protein [Vitis vinifera]
 gb|ABI99469.1| MFT-like protein [Vitis vinifera]
Length=175

 Score =   243 bits (621),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 135/173 (78%), Gaps = 1/173 (1%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            S++ LVVGKVIGDV++MF P  EFTV YGS+++ANG  I PS+A  KP V I+G   S N
Sbjct  4    SLESLVVGKVIGDVVNMFTPAAEFTVHYGSRQVANGRMIPPSAAVDKPKVQIHGHRLSSN  63

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+MVDPDAPSPSEPT REWLHW+V DIPEG DA++GREV  Y+GP PPTGIHRY+F 
Sbjct  64   LYTLVMVDPDAPSPSEPTLREWLHWIVVDIPEGCDATQGREVVPYMGPQPPTGIHRYIFT  123

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LF+Q+ A      PPE+R NF TRQFAA NGLG PVA +YFNSQK+  TN+K 
Sbjct  124  LFKQKAAAMSGTLPPETRSNFSTRQFAAGNGLGPPVALVYFNSQKER-TNRKH  175



>emb|CDO99645.1| unnamed protein product [Coffea canephora]
Length=177

 Score =   243 bits (620),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 139/175 (79%), Gaps = 1/175 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGS-PAS  212
            R V+PLVVG+VIGDVLDMFVP  E  V YGSK++ NG EI PS +A KP+V +NGS   +
Sbjct  3    RPVEPLVVGRVIGDVLDMFVPAAELIVQYGSKQVGNGCEIKPSHSAHKPAVRVNGSRDRA  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             +L+TL+MVDPDAPSPS+PTFREWLHW+V +IPEG DAS+G+E+  Y GP PP GIHRYV
Sbjct  63   ASLFTLVMVDPDAPSPSDPTFREWLHWIVVNIPEGGDASEGKELVAYQGPQPPAGIHRYV  122

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            FALF+QR  M+  +  PE R NF TRQFA+ N LGLPVAA+YFNSQK+ A N+KR
Sbjct  123  FALFKQRGRMEKPKTLPEPRHNFTTRQFASHNELGLPVAAVYFNSQKEPAGNRKR  177



>emb|CBI40863.3| unnamed protein product [Vitis vinifera]
Length=175

 Score =   242 bits (618),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 136/173 (79%), Gaps = 1/173 (1%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            S++ LVVGKVIGDV++MF P  EFTV +GS+++ANG  I PS+A  KP V I+G   S N
Sbjct  4    SLESLVVGKVIGDVVNMFTPAAEFTVHFGSRQVANGRMIPPSAAVDKPKVQIHGHRLSSN  63

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+MVDPDAPSPSEPTFREWLHW+V DIPEG DA++GREV  Y+GP PPTGIHRY+F 
Sbjct  64   LYTLVMVDPDAPSPSEPTFREWLHWIVVDIPEGCDATQGREVVPYMGPQPPTGIHRYIFT  123

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LF+Q+ A      PP++R NF TRQFAA NGLG PVA +YFNSQK+  TN+K 
Sbjct  124  LFKQKAAAMSGTLPPDTRSNFSTRQFAAGNGLGPPVALVYFNSQKER-TNRKH  175



>gb|KDO75687.1| hypothetical protein CISIN_1g030480mg [Citrus sinensis]
Length=174

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 139/174 (80%), Gaps = 3/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSP-AS  212
            RS++PLVVG+VIGDV+DMF P  E TV YG+K++ANG EI PS++A KPSV I+  P AS
Sbjct  3    RSMEPLVVGRVIGDVVDMFTPATEMTVHYGTKQVANGCEIKPSASADKPSVQIHAPPPAS  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             NLYTL+MVDPDAPSPSEP +REWLHW+V DIPEGSDA+K  E+  Y+GP PPTGIHRYV
Sbjct  63   SNLYTLVMVDPDAPSPSEPRYREWLHWIVVDIPEGSDATK--ELVAYMGPQPPTGIHRYV  120

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            FALF Q+  +    +PP++R NF TR+FAA NGL  PVAA+YFNSQK+ A  K+
Sbjct  121  FALFNQKGKVMAGCRPPDARSNFSTRRFAADNGLQPPVAAVYFNSQKEVAVRKR  174



>ref|XP_007025823.1| Phosphatidylethanolamine-binding protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY28445.1| Phosphatidylethanolamine-binding protein, putative isoform 1 
[Theobroma cacao]
Length=175

 Score =   236 bits (603),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 132/173 (76%), Gaps = 0/173 (0%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RSV+PLVVG+VIGDVLD+F P  E TV Y +K++ NG +I PSSAA KP V I     S 
Sbjct  3    RSVEPLVVGRVIGDVLDIFTPAAELTVHYSTKQVHNGCDIKPSSAADKPHVRILSPVVSS  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTL+MVDPDAP+PSEP  REWLHW+V DIPEG DA+KG+E+  Y+GP PPTGIHRY+ 
Sbjct  63   SLYTLVMVDPDAPTPSEPRLREWLHWIVVDIPEGHDATKGKEMVPYMGPQPPTGIHRYIL  122

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q  A +   + P++R NF TRQFAA N LGLPVAA+YFNSQK+ A  K+
Sbjct  123  VLFKQERATEGGCQLPDARANFSTRQFAAQNSLGLPVAAVYFNSQKEPAVKKR  175



>ref|XP_006841865.1| hypothetical protein AMTR_s00003p00271590 [Amborella trichopoda]
 gb|ERN03540.1| hypothetical protein AMTR_s00003p00271590 [Amborella trichopoda]
Length=225

 Score =   235 bits (599),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 133/173 (77%), Gaps = 0/173 (0%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RSV+PL VGKVIGDV+DMFVP V+ +V Y SK++ANG E+ PS  A++P   ++      
Sbjct  53   RSVEPLAVGKVIGDVIDMFVPTVDVSVSYVSKQVANGCELKPSGTAERPRFQLSARSLDD  112

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            NLYTL+M DPDAPSPSEPT REWLHW+V DIP GSDA +GRE+  Y+GP PPTGIHRYVF
Sbjct  113  NLYTLVMTDPDAPSPSEPTMREWLHWIVVDIPGGSDAMRGREIVSYMGPKPPTGIHRYVF  172

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            +LF+Q+  +    + PE+R NF TR FAA  GLGLPVAA+YFN+QK+ A+ K+
Sbjct  173  SLFKQQGPLGSVARAPEARNNFSTRAFAARLGLGLPVAAVYFNAQKEPASRKR  225



>ref|XP_002524698.1| phosphatidylethanolamine-binding protein, putative [Ricinus communis]
 gb|EEF37717.1| phosphatidylethanolamine-binding protein, putative [Ricinus communis]
Length=161

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 131/173 (76%), Gaps = 14/173 (8%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RS++PLVVGKVIG+VLDM+ PV EFTV YGSK+IANG EI PS+A Q P   I GS  +P
Sbjct  3    RSLEPLVVGKVIGEVLDMYNPVAEFTVHYGSKQIANGCEIKPSAAVQMPRAQILGSRLTP  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTL+MVDPDAPSPS+P +REWLHW+  DIPEGSDA+K              GIHRYVF
Sbjct  63   SLYTLVMVDPDAPSPSDPKWREWLHWIAVDIPEGSDATK--------------GIHRYVF  108

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            A+F+Q EA+    K PE RGNF TRQFAA NGLGLPVAA+YFNSQK+ A  K+
Sbjct  109  AVFKQGEALNGRTKAPEGRGNFSTRQFAAQNGLGLPVAAVYFNSQKEPAVKKR  161



>gb|EYU27885.1| hypothetical protein MIMGU_mgv1a022275mg [Erythranthe guttata]
Length=168

 Score =   228 bits (582),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 127/165 (77%), Gaps = 1/165 (1%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            ++DPLVVGKVIGDVLDMFVP  E  V YG ++I NG E+ PSSAAQ+P V I G+  SP+
Sbjct  5    ALDPLVVGKVIGDVLDMFVPAAELAVHYGGEEIGNGSEVKPSSAAQRPKVQIKGA-ISPS  63

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
             YTL+MVDPDAPSP EPT REWLHW+V DIPEGSDA++G+E+ EY+GP PP G+HRYVFA
Sbjct  64   YYTLVMVDPDAPSPGEPTLREWLHWLVIDIPEGSDATEGKEIMEYMGPKPPAGVHRYVFA  123

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQK  533
            +F+Q   M+  ++ P  R  F TRQFA  N LGLP AALYF S K
Sbjct  124  VFQQHGLMETVKRKPVERQLFDTRQFARENDLGLPAAALYFKSHK  168



>ref|XP_006849745.1| hypothetical protein AMTR_s00024p00249400 [Amborella trichopoda]
 gb|ERN11326.1| hypothetical protein AMTR_s00024p00249400 [Amborella trichopoda]
Length=174

 Score =   224 bits (571),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 132/175 (75%), Gaps = 4/175 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R+VDPLVVGKVIGDV+DMF+P V F V YG K++ NG +I PS     P+V I G P   
Sbjct  3    RTVDPLVVGKVIGDVMDMFMPSVRFVVHYGPKQVTNGCDIKPSITVHPPNVQIAGHPD--  60

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            NL+T++M DPDAPSPSEP+ REW+HW+VT+IP GSD S+GRE+  YI P PP GIHR++F
Sbjct  61   NLFTIVMTDPDAPSPSEPSMREWVHWIVTNIPGGSDPSQGREILPYIAPRPPIGIHRFIF  120

Query  396  ALFRQREAMQVAQKP-PESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
             LF+Q+  + +   P P +R NF TR FAA NGLGLPVAA+YFN+QK+ A NKKR
Sbjct  121  VLFKQQTPLSLVAHPLPSTRANFSTRAFAAHNGLGLPVAAVYFNAQKEPA-NKKR  174



>ref|XP_007025824.1| Phosphatidylethanolamine-binding protein, putative isoform 2, 
partial [Theobroma cacao]
 gb|EOY28446.1| Phosphatidylethanolamine-binding protein, putative isoform 2, 
partial [Theobroma cacao]
Length=165

 Score =   223 bits (568),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = +3

Query  60   GKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNLYTLIMV  239
            G+VIGDVLD+F P  E TV Y +K++ NG +I PSSAA KP V I     S +LYTL+MV
Sbjct  1    GRVIGDVLDIFTPAAELTVHYSTKQVHNGCDIKPSSAADKPHVRILSPVVSSSLYTLVMV  60

Query  240  DPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFALFRQREA  419
            DPDAP+PSEP  REWLHW+V DIPEG DA+KG+E+  Y+GP PPTGIHRY+  LF+Q  A
Sbjct  61   DPDAPTPSEPRLREWLHWIVVDIPEGHDATKGKEMVPYMGPQPPTGIHRYILVLFKQERA  120

Query  420  MQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             +   + P++R NF TRQFAA N LGLPVAA+YFNSQK+ A  K+
Sbjct  121  TEGGCQLPDARANFSTRQFAAQNSLGLPVAAVYFNSQKEPAVKKR  165



>ref|XP_011096184.1| PREDICTED: protein MOTHER of FT and TF 1-like [Sesamum indicum]
Length=182

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 135/175 (77%), Gaps = 2/175 (1%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPA--S  212
            +VDPLVVG VIGDV+DMFVP  + ++ YG+K + NG+EI P SAAQ P + I  S    +
Sbjct  8    AVDPLVVGGVIGDVVDMFVPAADLSLHYGTKHLCNGMEINPHSAAQSPRLLITASVPVPT  67

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
            PN YTL+MVDPDAPSPSEPTFREWLHW+V DIPEGSDAS+G+EV EY+GP PPTGIHRYV
Sbjct  68   PNYYTLVMVDPDAPSPSEPTFREWLHWLVIDIPEGSDASEGKEVMEYMGPQPPTGIHRYV  127

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            F  F+Q   M+  ++ P  RG F TRQFA+ N LGLP AALYFNSQKQ A NKK 
Sbjct  128  FVAFKQNSLMETVRRRPVERGQFNTRQFASENDLGLPAAALYFNSQKQPAGNKKH  182



>gb|ABK22769.1| unknown [Picea sitchensis]
 gb|ACN40175.1| unknown [Picea sitchensis]
Length=174

 Score =   219 bits (557),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 126/173 (73%), Gaps = 1/173 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RS DPLVVG+VIGDV+DMFVP  +  V YGSK++ NG EI PS+   +P V I G     
Sbjct  3    RSTDPLVVGRVIGDVIDMFVPSNDMAVYYGSKQVTNGCEIKPSATVDRPKVQIAGRHFDD  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTL+M DPDAPSPSEP  REW+HWVVTDIP  +DA++GRE+  Y+GP PP GIHRY+F
Sbjct  63   SLYTLVMTDPDAPSPSEPNMREWVHWVVTDIPGATDAAQGREILPYMGPRPPIGIHRYIF  122

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q   M V   PP++R NF TR FA+   LGLPV+A YFN+QK+  T K+
Sbjct  123  VLFKQSGPM-VMMMPPQARNNFSTRAFASEYSLGLPVSAAYFNAQKEPGTRKR  174



>gb|AHG97810.1| MOTHER OF FT AND TFL1 1 [Jatropha curcas]
 gb|KDP41127.1| hypothetical protein JCGZ_03618 [Jatropha curcas]
 gb|AID51389.1| mother of FT and TFL1 1 [Jatropha curcas]
 gb|AID51391.1| mother of FT and TFL1 1 [Jatropha curcas]
Length=172

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 131/172 (76%), Gaps = 3/172 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+D+FVP V  +V YGSK + NG ++ PS+A+  P + I+G P   +
Sbjct  4    SVDPLVVGRVIGDVIDLFVPSVTMSVYYGSKHVTNGCDVKPSTASNPPKLTISGHPN--D  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HWVV DIP G++ +KG+E+  Y+GP PP GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPSMREWVHWVVADIPGGTNPTKGKEILSYVGPRPPVGIHRYILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LFRQ+ AM V ++ P+SR NF TR FAA   LGLPVA +YFN+QK+ A  ++
Sbjct  122  LFRQKAAMGVVEQ-PQSRANFNTRLFAAHLELGLPVATVYFNAQKEPAAKRR  172



>gb|AEH59566.1| MFT2-like protein [Picea abies]
Length=175

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 129/175 (74%), Gaps = 3/175 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RSVDPLVVG V+GDV+D+FV   + TV YG K++ NG EI PS+   +P++ I G     
Sbjct  3    RSVDPLVVGNVVGDVIDIFVRAADMTVHYGPKQVTNGCEIKPSATVHRPNLQIAGRHFDD  62

Query  216  N-LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
            N L+TL+M DPDAPSPSEP  REWLHW+VTDIP  +DAS+GRE+  Y+GP PP GIHRYV
Sbjct  63   NKLFTLVMTDPDAPSPSEPNMREWLHWIVTDIPGAADASQGREIVPYMGPRPPIGIHRYV  122

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            F  FRQ++ M V    P+ R NF TR FAA  GLGLPVAA+YFN+QK+ A NKKR
Sbjct  123  FVAFRQQDPM-VMMMAPQVRHNFSTRAFAAQYGLGLPVAAVYFNAQKEPA-NKKR  175



>ref|XP_002990227.1| TF1-like protein [Selaginella moellendorffii]
 ref|XP_002992458.1| hypothetical protein SELMODRAFT_229690 [Selaginella moellendorffii]
 gb|EFJ06396.1| hypothetical protein SELMODRAFT_229690 [Selaginella moellendorffii]
 gb|EFJ08787.1| TF1-like protein [Selaginella moellendorffii]
Length=174

 Score =   216 bits (549),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 128/173 (74%), Gaps = 2/173 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RS+DPLV+G+VIGDVLDMFVP V+ +V YGSK++ NG E+ PS+   +P V +       
Sbjct  3    RSMDPLVLGRVIGDVLDMFVPAVDMSVCYGSKQVNNGCELKPSATQARPIVQVGSPHEEG  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
             LYTL+MVDPDAPSPSEP+ REW+HW+V DIP G+DAS+GRE+ +YIGP PPTGIHRY+F
Sbjct  63   ALYTLVMVDPDAPSPSEPSMREWVHWIVADIPGGADASQGREILQYIGPKPPTGIHRYIF  122

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             +FRQ     V   PP  R NF TR FA    LGLPV A+Y+N+QK+ A+ ++
Sbjct  123  VVFRQMGP--VLMLPPLMRNNFSTRWFAQEYFLGLPVGAVYYNAQKEPASRRR  173



>gb|AHY23236.1| flowering locus T [Agapanthus praecox subsp. orientalis]
Length=177

 Score =   215 bits (548),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 131/173 (76%), Gaps = 3/173 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
             VDPLVVG+VIG+V+D+FVP +  +V YGSK I NG ++ PS AA+ P+V++ G  +   
Sbjct  6    CVDPLVVGRVIGEVVDLFVPTLTMSVSYGSKHINNGCDVKPSIAAEPPTVNLGGRMS--E  63

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M+DPDAPSPS+PT REW+HWVV +IP G+D S+G+EV  Y+GP PP GIHRYV  
Sbjct  64   LYTLVMIDPDAPSPSDPTMREWVHWVVVNIPGGTDPSQGQEVVPYMGPRPPLGIHRYVLV  123

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LFRQ+  + V   PPESR NF TR FAA   LGLPVA +YFN+QK+ A+ ++R
Sbjct  124  LFRQKAGLPVI-TPPESRANFNTRYFAARYDLGLPVATVYFNAQKEPASRRRR  175



>ref|XP_007025825.1| PEBP (phosphatidylethanolamine-binding protein) family protein 
isoform 3, partial [Theobroma cacao]
 gb|EOY28447.1| PEBP (phosphatidylethanolamine-binding protein) family protein 
isoform 3, partial [Theobroma cacao]
Length=157

 Score =   214 bits (546),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 123/172 (72%), Gaps = 15/172 (9%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SV+PLVVG+VIGDVLD+F P  E TV Y +K++ NG +I PSSAA KP V          
Sbjct  1    SVEPLVVGRVIGDVLDIFTPAAELTVHYSTKQVHNGCDIKPSSAADKPHV----------  50

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
                 MVDPDAP+PSEP  REWLHW+V DIPEG DA+KG+E+  Y+GP PPTGIHRY+  
Sbjct  51   -----MVDPDAPTPSEPRLREWLHWIVVDIPEGHDATKGKEMVPYMGPQPPTGIHRYILV  105

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LF+Q  A +   + P++R NF TRQFAA N LGLPVAA+YFNSQK+ A  K+
Sbjct  106  LFKQERATEGGCQLPDARANFSTRQFAAQNSLGLPVAAVYFNSQKEPAVKKR  157



>gb|AEH59565.1| MFT1-like protein [Picea abies]
Length=174

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 126/173 (73%), Gaps = 1/173 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RS DPLVVG+VIGDV+DMFVP  +  V YGSK++ +G EI PS+   +P V I G     
Sbjct  3    RSTDPLVVGRVIGDVIDMFVPSNDMAVYYGSKQVRDGCEIKPSATVDRPKVQIAGRHFDD  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTL+M DPD+PSPSEP  REW+HWVVTDIP  +DA++GRE+  Y+GP PP GIHRY+F
Sbjct  63   SLYTLVMTDPDSPSPSEPNMREWVHWVVTDIPGATDAAQGREILPYMGPRPPIGIHRYIF  122

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q   M V   PP++R NF TR FA+   LGLPV+A YFN+QK+  T K+
Sbjct  123  VLFKQSGPM-VMMVPPQARNNFSTRAFASEYSLGLPVSAAYFNAQKEPGTRKR  174



>gb|AHM25239.1| flowering locus T [Agapanthus praecox subsp. orientalis]
Length=177

 Score =   213 bits (543),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 130/173 (75%), Gaps = 3/173 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
             VDPLVVG+VIG+V+D+FVP +  +V YGSK I NG ++ PS AA+ P+V++ G  +   
Sbjct  6    CVDPLVVGRVIGEVVDLFVPTLTMSVSYGSKHINNGCDVKPSIAAEPPTVNLGGRMSE--  63

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M+DPDAPSPS+PT REW+HWVV +IP G+D S+G+EV  Y+GP PP GIHRYV  
Sbjct  64   LYTLVMIDPDAPSPSDPTMREWVHWVVVNIPGGTDPSQGQEVVPYMGPRPPLGIHRYVLV  123

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LFRQ+  +     PPESR NF TR FAA   LGLPVA +YFN+QK+ A+ ++R
Sbjct  124  LFRQKAGLP-GITPPESRANFNTRYFAARYDLGLPVATVYFNAQKEPASRRRR  175



>ref|XP_002990226.1| hypothetical protein SELMODRAFT_229523 [Selaginella moellendorffii]
 gb|EFJ08786.1| hypothetical protein SELMODRAFT_229523 [Selaginella moellendorffii]
Length=170

 Score =   212 bits (539),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 126/171 (74%), Gaps = 2/171 (1%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            +DPLV+G+VIGDVLDMFVP V+ +V YGSK++ NG E+ PS+   +P V +        L
Sbjct  1    MDPLVLGRVIGDVLDMFVPAVDMSVCYGSKQVNNGCELKPSATQARPIVQVGSPHEEGAL  60

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            YTL+MVDPDAPSPSEP+ REW+HW+V DIP G+DAS+GRE+ +YIGP PPTGIHRY+F +
Sbjct  61   YTLVMVDPDAPSPSEPSMREWVHWIVADIPGGADASQGREILQYIGPKPPTGIHRYIFVV  120

Query  402  FRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            FRQ     V   PP  R NF TR FA    LGLPV A+Y+N+QK+ A+ ++
Sbjct  121  FRQMGP--VLMLPPLMRNNFSTRWFAQEYFLGLPVGAVYYNAQKEPASRRR  169



>gb|AIJ02001.1| mother of FT and TFL1-like 1 [Pinus sylvestris]
Length=174

 Score =   211 bits (538),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 127/173 (73%), Gaps = 1/173 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RS DPLVVG+VIGDV+DMFVP ++  V YGSK++ NG EI PS+   +P+V I G     
Sbjct  3    RSTDPLVVGRVIGDVIDMFVPSMDMAVYYGSKQVTNGCEIKPSATVDRPNVQIAGRHFDE  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTL+M DPDAPSPSEP  REW+HW+VTDIP  +DA++GRE+  Y+GP PP GIHRY+F
Sbjct  63   SLYTLVMTDPDAPSPSEPNMREWVHWIVTDIPGATDAAQGREILPYMGPRPPIGIHRYIF  122

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q   M +    P++R NF TR FA+   LGLPV+A YFN+QK+  T K+
Sbjct  123  VLFKQPGPMVMMMP-PQARNNFSTRAFASQYSLGLPVSAAYFNAQKEPGTRKR  174



>ref|XP_010032693.1| PREDICTED: protein MOTHER of FT and TF 1 [Eucalyptus grandis]
 gb|KCW83994.1| hypothetical protein EUGRSUZ_B00867 [Eucalyptus grandis]
Length=172

 Score =   210 bits (535),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 126/173 (73%), Gaps = 4/173 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP V  +V YGSK + NG +I PS A   P + I+G P    
Sbjct  4    SVDPLVVGRVIGDVVDMFVPCVNMSVSYGSKHVTNGCDIKPSLAVNAPKISISGHPDE--  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+MVDPDAPSPSEP+ REW+HW+V DIP G++ ++G+E+  Y+GP PP GIHRY+  
Sbjct  62   LYTLVMVDPDAPSPSEPSMREWIHWIVVDIPGGTNPNRGKEILPYVGPRPPVGIHRYILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LF+Q+  +      P SR NF TR FAA   LGLPVA +YFNSQK+ A N++R
Sbjct  122  LFQQKTPIGHIDH-PNSRANFNTRLFAAHLDLGLPVATVYFNSQKEPA-NRRR  172



>ref|XP_009360092.1| PREDICTED: protein MOTHER of FT and TF 1 [Pyrus x bretschneideri]
Length=172

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 130/173 (75%), Gaps = 4/173 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP V  +V +GSK +ANG +I PS A   P + ++G P    
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTVSMSVYFGSKHVANGCDIKPSMAINPPKITVSGHPG--E  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HW+V+DIP G++  +G+E+  Y+GP PP GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPSMREWVHWIVSDIPGGTNPLRGKEILPYVGPRPPVGIHRYILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LF+Q+  M + ++PP SR +F TR FAA   LGLPV+ +YFNSQK+ A N++R
Sbjct  122  LFQQKAPMGLVEQPP-SRAHFNTRFFAAQLDLGLPVSTVYFNSQKEPA-NRRR  172



>emb|CDY21719.1| BnaA09g44700D [Brassica napus]
Length=173

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 124/172 (72%), Gaps = 2/172 (1%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDVLDMF+P    +V +G K I NG EI PS+A   P V+I+G+  S  
Sbjct  4    SVDPLVVGRVIGDVLDMFIPTANMSVYFGPKHITNGCEIKPSAAVNPPKVNISGN--SNE  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP  REW+HW+V DIP G++ SKG+E+  Y+ P PP GIHRY+F 
Sbjct  62   LYTLVMTDPDAPSPSEPNMREWVHWIVVDIPGGTNPSKGKEILPYMEPRPPVGIHRYIFV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LFRQ   + +  + P SR NF TR FA    LGLPVA +YFN+QK+ A+ ++
Sbjct  122  LFRQNSPVGMMVQQPPSRANFSTRMFAGHLDLGLPVATVYFNAQKEPASRRR  173



>ref|XP_009117626.1| PREDICTED: protein MOTHER of FT and TF 1 [Brassica rapa]
Length=206

 Score =   210 bits (534),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 124/172 (72%), Gaps = 2/172 (1%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDVLDMF+P    +V +G K I NG EI PS+A   P V+I+G+  S  
Sbjct  37   SVDPLVVGRVIGDVLDMFIPTANMSVYFGPKHITNGCEIKPSAAVNPPKVNISGN--SNE  94

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP  REW+HW+V DIP G++ SKG+E+  Y+ P PP GIHRY+F 
Sbjct  95   LYTLVMTDPDAPSPSEPNMREWVHWIVVDIPGGTNPSKGKEILPYMEPRPPVGIHRYIFV  154

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LFRQ   + +  + P SR NF TR FA    LGLPVA +YFN+QK+ A+ ++
Sbjct  155  LFRQNSPVGMMVQQPPSRANFSTRMFAGHLDLGLPVATVYFNAQKEPASRRR  206



>emb|CDX81861.1| BnaC08g37400D [Brassica napus]
Length=173

 Score =   209 bits (531),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 123/172 (72%), Gaps = 2/172 (1%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDVLDMF+P    +V +G K I NG EI PS+A   P V I+G+  S  
Sbjct  4    SVDPLVVGRVIGDVLDMFIPTANMSVYFGPKHITNGCEIKPSAAVNPPKVSISGN--SNE  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP  REW+HW+V DIP G++ SKG+E+  Y+ P PP GIHRY+F 
Sbjct  62   LYTLVMTDPDAPSPSEPNMREWVHWIVVDIPGGTNPSKGKEILPYMEPRPPVGIHRYIFV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LFRQ   + +  + P SR NF TR FA    LGLPVA +YFN+QK+ A+ ++
Sbjct  122  LFRQNSPVGMMVQQPPSRANFSTRMFAGHLDLGLPVATVYFNAQKEPASRRR  173



>ref|NP_001281044.1| uncharacterized protein LOC103455721 [Malus domestica]
 gb|AGX15187.1| MFTb [Malus domestica]
Length=172

 Score =   209 bits (531),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 129/173 (75%), Gaps = 4/173 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP V  +V +GSK + NG +I PS A   P + ++G P    
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTVSMSVYFGSKHVTNGCDIKPSMAINPPKITVSGHPG--E  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HW+V+DIP GS+  +G+E+  Y+GP PP GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPSMREWVHWIVSDIPGGSNPLRGKEILPYVGPRPPVGIHRYILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LF+Q+  M + ++PP SR +F TR FAA   LGLPV+ +YFNSQK+ A N++R
Sbjct  122  LFQQKAPMGLVEQPP-SRAHFNTRFFAAQLDLGLPVSTVYFNSQKEPA-NRRR  172



>ref|XP_001778686.1| predicted protein [Physcomitrella patens]
 gb|EDQ56479.1| predicted protein [Physcomitrella patens]
Length=183

 Score =   209 bits (532),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 124/182 (68%), Gaps = 10/182 (5%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RS+DPLVVGKVIGDV+D FVP V+  + Y ++++ NG ++ PS+ AQ P +H++      
Sbjct  3    RSIDPLVVGKVIGDVIDTFVPSVDMAIHYSTRQVTNGCQMMPSATAQAPEIHLSDKSGGN  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASK---------GREVAEYIGPSP  368
            NLYTLIM+DPDAPSPSEPT REWLHW+VTDIP  S  S+         GRE+  Y+GP P
Sbjct  63   NLYTLIMIDPDAPSPSEPTLREWLHWIVTDIPGNSGGSEMTSAPSKSCGRELVPYMGPRP  122

Query  369  PTGIHRYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATN  548
            P GIHRY+F LF+Q         PP  R NF TR FAA  GLGLPVAA Y N+QK+  + 
Sbjct  123  PVGIHRYIFVLFKQ-PLTPFHITPPTVRSNFNTRYFAAQCGLGLPVAATYLNAQKEPGSR  181

Query  549  KK  554
            ++
Sbjct  182  RR  183



>ref|NP_001106249.1| ZCN10 protein [Zea mays]
 ref|XP_008669500.1| PREDICTED: protein MOTHER of FT and TF 1-like [Zea mays]
 gb|ABW96233.1| ZCN10 [Zea mays]
 gb|ABX11012.1| ZCN10 [Zea mays]
 gb|ACG24375.1| MFT2 - Corn MFT-like protein [Zea mays]
 tpg|DAA38133.1| TPA: MFT2-Corn MFT-like protein [Zea mays]
 tpg|DAA53766.1| TPA: MFT2-Corn MFT-like protein [Zea mays]
Length=172

 Score =   209 bits (531),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 128/174 (74%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R VDPLVVG+VIG+V+D+FVP V  TV YG K I+NG  + PS+ A  P V I+G     
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSVSMTVAYGPKDISNGCLLKPSATAAPPLVRISGR--RD  60

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTLIM DPDAPSPS+PT RE+LHW+VT+IP G+DA+KG EV EY+GP PP GIHRYV 
Sbjct  61   DLYTLIMTDPDAPSPSDPTMREYLHWIVTNIPGGTDANKGEEVVEYMGPRPPVGIHRYVL  120

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
             LF Q+   +V  + P  R NF TR FAAA+ LGLP A +YFN+QK+ A +++R
Sbjct  121  VLFEQK--TRVHAEGPGERANFNTRAFAAAHELGLPTAVVYFNAQKEPANHRRR  172



>ref|XP_002457494.1| hypothetical protein SORBIDRAFT_03g008270 [Sorghum bicolor]
 gb|EES02614.1| hypothetical protein SORBIDRAFT_03g008270 [Sorghum bicolor]
Length=171

 Score =   208 bits (530),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 126/173 (73%), Gaps = 4/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R VDPLVVG+VIG+V+D+FVP +  TV YG K I+NG  + PS+ A  P V I+G     
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSISMTVAYGPKDISNGCLLKPSATAAPPLVRISGR--RN  60

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTLIM DPDAPSPS+PT RE+LHW+VT+IP G+DASKG EV EY+GP PP GIHRYV 
Sbjct  61   DLYTLIMTDPDAPSPSDPTMREYLHWIVTNIPGGTDASKGEEVVEYMGPRPPVGIHRYVL  120

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF Q+   +V  + P  R NF TR FAAA+ LGLP A +YFN+QK+ A  ++
Sbjct  121  VLFEQK--TRVHAEAPRERANFNTRAFAAAHELGLPTAVVYFNAQKEPANRRR  171



>ref|XP_011047546.1| PREDICTED: protein MOTHER of FT and TF 1-like [Populus euphratica]
 ref|XP_011000469.1| PREDICTED: protein MOTHER of FT and TF 1 [Populus euphratica]
Length=173

 Score =   208 bits (530),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 128/173 (74%), Gaps = 3/173 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP V  +V YGSK ++NG +I PS +   P V I+G   S  
Sbjct  4    SVDPLVVGRVIGDVVDMFVPAVNMSVYYGSKHVSNGCDIKPSLSVDPPKVTISGH--SDE  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP  REW+HW+V DIP G++ ++G+E+  Y+GP PP GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPRMREWVHWIVADIPGGTNPTRGKEILSYVGPRPPVGIHRYILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LF+Q+  +    +PP++R +F TR +AA   LGLPVA +YFN+QK+ A NK+R
Sbjct  122  LFQQKMPLGSMMEPPQNRSHFNTRLYAAHLDLGLPVATVYFNAQKEPA-NKRR  173



>gb|AFK45387.1| unknown [Lotus japonicus]
Length=189

 Score =   209 bits (532),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 127/172 (74%), Gaps = 3/172 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP V  +V +GSK + NG +I PS     P V + G+    N
Sbjct  21   SVDPLVVGRVIGDVVDMFVPSVNMSVYFGSKHVTNGCDIKPSICISPPKVTLTGN--MDN  78

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HW+V DIP G++ ++G+EV  Y+GP PP GIHR++F 
Sbjct  79   LYTLVMTDPDAPSPSEPSLREWIHWIVVDIPGGTNPNRGKEVLPYVGPRPPVGIHRFIFV  138

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LF+Q+  + + ++PP +R +F TR FA    LGLPVA +YFNSQK+ AT K+
Sbjct  139  LFKQKRPLGLVEQPP-TRASFNTRYFAQQLELGLPVATVYFNSQKEPATKKR  189



>gb|EYU17649.1| hypothetical protein MIMGU_mgv1a014889mg [Erythranthe guttata]
Length=174

 Score =   208 bits (530),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 124/173 (72%), Gaps = 3/173 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            +VDPLVVG+VIGDV+DMFVP V  +V YGSK + NG +I PS AA  P + I G P    
Sbjct  4    NVDPLVVGRVIGDVVDMFVPTVNMSVYYGSKHVNNGCDIKPSLAASPPRLTITGYPNQ--  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HW+VTDIP  S+ ++G+EV EY+GP PP GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPSMREWVHWIVTDIPGCSNVTRGKEVLEYVGPRPPVGIHRYIIV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LFRQ+  +   + PP SR +F TR FA    LG+PVA +YFN+ K+ A  K+ 
Sbjct  122  LFRQKRGLDGVEAPP-SRSHFNTRAFAQDLDLGIPVATVYFNAHKEPANRKRH  173



>ref|NP_001147266.1| MFT2 - Corn MFT-like protein [Zea mays]
 gb|ACG26468.1| MFT2 - Corn MFT-like protein [Zea mays]
Length=172

 Score =   208 bits (530),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 128/174 (74%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R VDPLVVG+VIG+V+D+FVP V  TV YG K I+NG  + PS+ A  P V I+G     
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSVSMTVAYGPKDISNGCLLKPSATAAPPLVRISGR--RD  60

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTLIM DPDAPSPS+PT RE+LHW+VT+IP G+DA+KG EV EY+GP PP GIHRYV 
Sbjct  61   DLYTLIMTDPDAPSPSDPTMREYLHWIVTNIPGGTDANKGEEVVEYMGPRPPVGIHRYVL  120

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
             LF+Q+   +V  + P  R NF TR FAAA+ LGLP A +YFN+QK+ A  ++R
Sbjct  121  VLFQQK--TRVHAEGPGERANFNTRAFAAAHELGLPTAVVYFNAQKEPANRRRR  172



>ref|XP_002321507.1| MOTHER of FT and TF1 family protein [Populus trichocarpa]
 dbj|BAD22677.1| flowering locus T like protein [Populus nigra]
 gb|ABC26020.1| MFT-like protein [Populus trichocarpa]
 dbj|BAG12898.1| FLOWERING LOCUS T/ TERMINAL FLOWER 1-like protein [Populus nigra]
 gb|EEF05634.1| MOTHER of FT and TF1 family protein [Populus trichocarpa]
Length=173

 Score =   208 bits (530),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 129/173 (75%), Gaps = 3/173 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP V+ +V YGSK ++NG +I PS +   P V I+G   S  
Sbjct  4    SVDPLVVGRVIGDVVDMFVPAVKMSVYYGSKHVSNGCDIKPSLSVDPPKVTISGH--SDE  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP  REW+HW+V DIP G++ ++G+E+  Y+GP PP GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPRMREWVHWIVADIPGGTNPTRGKEILSYVGPRPPVGIHRYILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LF+Q+  +    +PP++R +F TR +AA   LGLPVA +YFN+QK+ A NK+R
Sbjct  122  LFQQKMPLGSMVEPPQNRSHFNTRLYAAHLDLGLPVATVYFNAQKEPA-NKRR  173



>ref|XP_010498189.1| PREDICTED: protein MOTHER of FT and TF 1-like [Camelina sativa]
 ref|XP_010459415.1| PREDICTED: protein MOTHER of FT and TF 1-like [Camelina sativa]
Length=173

 Score =   208 bits (529),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 123/172 (72%), Gaps = 2/172 (1%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDVLDMF+P    +V +G K I NG EI PS+    P V+I+G   S  
Sbjct  4    SVDPLVVGRVIGDVLDMFIPTATMSVYFGPKHITNGCEIKPSTTLNPPKVNISGH--SDE  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HW+V DIP G++ SKG+E+  Y+ P PP GIHRY+F 
Sbjct  62   LYTLVMTDPDAPSPSEPSLREWVHWIVVDIPGGTNPSKGKEILPYMEPKPPVGIHRYIFV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LFRQ   + +  + P SR NF TR FA    LGLPVA +YFN+QK+ A+ ++
Sbjct  122  LFRQNSPVGLMVQQPLSRANFSTRMFAGHLDLGLPVATVYFNAQKEPASRRR  173



>ref|XP_010936814.1| PREDICTED: protein MOTHER of FT and TF 1-like [Elaeis guineensis]
Length=175

 Score =   208 bits (529),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 127/175 (73%), Gaps = 5/175 (3%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
             VDPLVVG+VIG+V+D+FVP +  +V+YGSK + NG ++ PS A   P+V I G  +  +
Sbjct  4    CVDPLVVGRVIGEVVDLFVPTMSMSVNYGSKHVNNGCDMKPSMAINPPTVQITGRGS--D  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEPT REWLHWVV +IP G+D S+G EV  Y+GP PP GIHRYV  
Sbjct  62   LYTLVMTDPDAPSPSEPTMREWLHWVVVNIPGGTDPSQGEEVVPYMGPRPPVGIHRYVLV  121

Query  399  LFRQ--REAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LF+Q  R +M +    P SR NF TR FAA   LGLPVA +YFN+QK+ A N++R
Sbjct  122  LFQQKSRFSMGIGLSLPASRANFNTRAFAAQRDLGLPVAVVYFNAQKEPA-NRRR  175



>ref|XP_009149260.1| PREDICTED: protein MOTHER of FT and TF 1 [Brassica rapa]
 emb|CDY26185.1| BnaA06g12320D [Brassica napus]
Length=173

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 124/172 (72%), Gaps = 2/172 (1%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDVLDM++P    +V  G K I NG EI PS+A + P V+I+G+P    
Sbjct  4    SVDPLVVGRVIGDVLDMYIPTANMSVYVGPKHITNGCEIKPSAAVKPPKVNISGNPDE--  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP  REW+HW+V DIP G++ SKG+E+  Y+ P PP GIHRY+F 
Sbjct  62   LYTLVMTDPDAPSPSEPNMREWVHWIVVDIPGGTNPSKGKEILPYMEPKPPVGIHRYIFV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LFRQ   + +  + P SR NF TR FA    LGLPVA +YFN+QK+ A+ ++
Sbjct  122  LFRQISPVGLMVQQPPSRANFSTRMFAGHLDLGLPVATVYFNAQKEPASGRR  173



>ref|XP_010476978.1| PREDICTED: protein MOTHER of FT and TF 1 [Camelina sativa]
Length=173

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 123/172 (72%), Gaps = 2/172 (1%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            S+DPLVVG+VIGDVLDMF+P    +V +G K I NG EI PS+    P V+I+G   S  
Sbjct  4    SIDPLVVGRVIGDVLDMFIPTANMSVYFGPKHITNGCEIKPSTTLNPPKVNISGH--SDE  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HW+V DIP G++ SKG+E+  Y+ P PP GIHRY+F 
Sbjct  62   LYTLVMTDPDAPSPSEPSLREWVHWIVVDIPGGTNPSKGKEILPYMEPKPPVGIHRYIFV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LFRQ   + +  + P SR NF TR FA    LGLPVA +YFN+QK+ A+ ++
Sbjct  122  LFRQNSPVGLMVQQPLSRANFSTRMFAGHLDLGLPVATVYFNAQKEPASRRR  173



>ref|XP_008782387.1| PREDICTED: protein MOTHER of FT and TF 1-like [Phoenix dactylifera]
Length=175

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 125/175 (71%), Gaps = 5/175 (3%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
             VDPLVVG+VIG+V+D+FVP V  TV YG K + NG  + PS A   P V I G  +  +
Sbjct  4    CVDPLVVGRVIGEVVDLFVPTVTMTVSYGLKHVNNGCHVKPSMAINPPMVQIAGRGS--D  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+ +DPDAPSPSEPT REWLHWVV +IP G+D S+G EV  Y+GP PP GIHRYV  
Sbjct  62   LYTLVTIDPDAPSPSEPTMREWLHWVVVNIPGGTDPSQGEEVVPYMGPRPPVGIHRYVLV  121

Query  399  LFRQ--REAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LFRQ  R +M +    P SR NF TR FAA + LGLPVAA+YFN+QK+ A N++R
Sbjct  122  LFRQKSRFSMGMGLSLPASRANFNTRAFAAHHDLGLPVAAVYFNAQKEPA-NRRR  175



>ref|XP_001769136.1| predicted protein [Physcomitrella patens]
 gb|EDQ66008.1| predicted protein [Physcomitrella patens]
Length=176

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 122/174 (70%), Gaps = 1/174 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RSVDPLVVG+VIGDV+DMF P V+  V Y S+K++NG ++ PS+  + P+VH+ G+    
Sbjct  3    RSVDPLVVGRVIGDVIDMFAPSVDMAVVYTSRKVSNGCQMKPSATNEAPTVHVTGNNGDN  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIP-EGSDASKGREVAEYIGPSPPTGIHRYV  392
            N +TLIM DPDAPSPSEP+ REW+HW+VTDIP   S  + G+EV  Y+GP PP GIHRY+
Sbjct  63   NFFTLIMTDPDAPSPSEPSLREWVHWIVTDIPGNSSTTTSGKEVVPYVGPCPPIGIHRYI  122

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q     +    P  R NF TR FA  +GLG PVAA YFN+ K+  + ++
Sbjct  123  FVLFKQPTGKPLLVTAPSVRNNFNTRTFAVEHGLGFPVAATYFNAAKEPGSRRR  176



>ref|XP_007160508.1| hypothetical protein PHAVU_002G327700g [Phaseolus vulgaris]
 gb|ESW32502.1| hypothetical protein PHAVU_002G327700g [Phaseolus vulgaris]
Length=172

 Score =   207 bits (526),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 122/172 (71%), Gaps = 3/172 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP V  +V YGSK + +G +I PS A   P + + G     N
Sbjct  4    SVDPLVVGRVIGDVVDMFVPSVNMSVYYGSKHVTSGCDIKPSIAVNPPKLTLTGK--KEN  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTLIM DPDAPSPSEP  REW+HWVV DIP  ++  +G+E+  Y GP PP GIHRY+F 
Sbjct  62   LYTLIMTDPDAPSPSEPNMREWIHWVVADIPGCTNPFRGKEIIPYTGPKPPVGIHRYIFV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LF Q+  M   ++ PESRGNF TR FA    LGLPVA +YFNSQK+ A+ K+
Sbjct  122  LFEQKAPMGPVEQ-PESRGNFSTRTFAKDMDLGLPVATVYFNSQKEPASRKR  172



>ref|XP_006305921.1| hypothetical protein CARUB_v10011138mg [Capsella rubella]
 gb|EOA38819.1| hypothetical protein CARUB_v10011138mg [Capsella rubella]
Length=173

 Score =   206 bits (525),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDVLDMF+P    +V +G K I NG EI PS+A   P V+I+G   S  
Sbjct  4    SVDPLVVGRVIGDVLDMFIPTANMSVYFGPKHITNGCEIKPSTALNPPKVNISGH--SDE  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP  REW+HW+V DIP G++ SKG+E+  Y+ P PP GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPNMREWVHWIVVDIPGGTNPSKGQEILPYMEPRPPVGIHRYILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LFRQ   + +  + P SR NF TR FA    LGLPVA +YFN+QK+ A+ ++
Sbjct  122  LFRQNSPVGLMVQQPPSRANFSTRMFAGHLDLGLPVATVYFNAQKEPASRRR  173



>ref|XP_008787928.1| PREDICTED: protein MOTHER of FT and TF 1-like [Phoenix dactylifera]
Length=175

 Score =   206 bits (525),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 123/173 (71%), Gaps = 4/173 (2%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            VDPLVVG+VIGDV+D+FVP +  +V YGSK + NG ++ PS A   P+  I G  A  +L
Sbjct  5    VDPLVVGRVIGDVVDLFVPTMSMSVSYGSKHVNNGCDVKPSMAINPPTAQIAGQRA--DL  62

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            YTL+M DPDAPSPS+PT REWLHWVV +IP G+D S+G E   Y+GP PP GIHRYV  L
Sbjct  63   YTLVMTDPDAPSPSDPTMREWLHWVVVNIPGGTDISRGEEAVAYMGPRPPLGIHRYVLVL  122

Query  402  FRQ--REAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F+Q  R +M      P SR NF TR FAA + LGLPVAA+YFN+QK+ A  ++
Sbjct  123  FQQKSRFSMGAGVSLPASRANFNTRAFAARHDLGLPVAAVYFNAQKEPANRRR  175



>gb|ACN54547.1| mother of FT and TFL1-like protein [Physcomitrella patens]
Length=192

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 124/191 (65%), Gaps = 19/191 (10%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RS+DPLVVGKVIGDV+D FVP V+  + Y ++++ NG ++ PS+ AQ P +H++      
Sbjct  3    RSIDPLVVGKVIGDVIDTFVPSVDMAIHYSTRQVTNGCQMMPSATAQAPEIHLSDKSGGN  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASK------------------GRE  341
            NLYTLIM+DPDAPSPSEPT REWLHW+VTDIP  S  S+                  GRE
Sbjct  63   NLYTLIMIDPDAPSPSEPTLREWLHWIVTDIPGNSGGSEMTSGFPRLNELIAPSKSCGRE  122

Query  342  VAEYIGPSPPTGIHRYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYF  521
            +  Y+GP PP GIHRY+F LFRQ         PP  R NF TR FAA  GLGLPVAA Y 
Sbjct  123  LVPYMGPRPPVGIHRYIFVLFRQ-PLTPFHITPPTVRSNFNTRYFAAQCGLGLPVAATYL  181

Query  522  NSQKQSATNKK  554
            N+QK+  + ++
Sbjct  182  NAQKEPGSRRR  192



>ref|NP_173250.1| protein MOTHER of FT and TF 1 [Arabidopsis thaliana]
 sp|Q9XFK7.1|MFT_ARATH RecName: Full=Protein MOTHER of FT and TF 1 [Arabidopsis thaliana]
 gb|AAD37380.1|AF147721_1 E12A11 protein [Arabidopsis thaliana]
 gb|AAF78390.1|AC069551_23 T10O22.8 [Arabidopsis thaliana]
 gb|AAF97827.1|AC034107_10 Identical to E12A11 protein from Arabidopsis thaliana gb|AF147721 
and contains a phosphatidylethanolamine-binding PF|01161 
domain. ESTs gb|AA042630, gb|AI992611, gb|AV537489, gb|AV553444, 
gb|AV549397 come from this gene [Arabidopsis thaliana]
 gb|AAG48769.1|AF332406_1 putative terminal Flower 1 protein [Arabidopsis thaliana]
 gb|AEE29676.1| protein MOTHER of FT and TF 1 [Arabidopsis thaliana]
Length=173

 Score =   206 bits (524),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDVLDMF+P    +V +G K I NG EI PS+A   P V+I+G   S  
Sbjct  4    SVDPLVVGRVIGDVLDMFIPTANMSVYFGPKHITNGCEIKPSTAVNPPKVNISGH--SDE  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP  REW+HW+V DIP G++ S+G+E+  Y+ P PP GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPNMREWVHWIVVDIPGGTNPSRGKEILPYMEPRPPVGIHRYILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LFRQ   + +  + P SR NF TR FA    LGLPVA +YFN+QK+ A+ ++
Sbjct  122  LFRQNSPVGLMVQQPPSRANFSTRMFAGHFDLGLPVATVYFNAQKEPASRRR  173



>ref|XP_001758845.1| predicted protein [Physcomitrella patens]
 gb|EDQ76351.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   206 bits (524),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 124/177 (70%), Gaps = 4/177 (2%)
 Frame = +3

Query  33   PRSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPAS  212
            PRS+DPL+VGKVIGDV+D FVP V+  + Y ++++ NG ++ PS+ AQ P + ++     
Sbjct  2    PRSIDPLIVGKVIGDVIDTFVPRVDMAIHYSTRQVTNGCQLKPSATAQAPEIQLSDKSGD  61

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIP---EGSDASKGREVAEYIGPSPPTGIH  383
             N YTL+M DPDAPSPSEP+ REWLHW+VTDIP    GS+ + G ++  YIGP PP GIH
Sbjct  62   NNYYTLVMTDPDAPSPSEPSLREWLHWIVTDIPGNSGGSETNTGEKLVPYIGPRPPIGIH  121

Query  384  RYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            RY+F LF+Q  +      PP +R NF TR FAA  GLGLPVAA Y NSQK+ A+  +
Sbjct  122  RYIFVLFKQ-PSQSFLISPPAARNNFSTRNFAAYYGLGLPVAATYCNSQKEPASRSR  177



>ref|XP_010537488.1| PREDICTED: protein MOTHER of FT and TF 1 [Tarenaya hassleriana]
Length=172

 Score =   206 bits (524),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 126/172 (73%), Gaps = 3/172 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP    +V YG K I NG EI PS AA  P + I+G   S +
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTANMSVYYGPKHITNGCEIKPSLAASPPKLTISG--LSHD  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HW+V DIP G++ ++G E+  Y+ P P  GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPSLREWVHWIVVDIPGGTNPTRGIEILPYMEPRPTVGIHRYITV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LFRQ+ A+   Q+PP SR NF TR FA+  GLGLPVA +YFN+QK+ A+ ++
Sbjct  122  LFRQKTAVGGMQQPP-SRANFSTRMFASHLGLGLPVATVYFNAQKEPASRRR  172



>gb|KFK43979.1| hypothetical protein AALP_AA1G199000 [Arabis alpina]
Length=173

 Score =   206 bits (523),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDVLDMF+P    +V +G K I NG EI PS+A   P V I+G P    
Sbjct  4    SVDPLVVGRVIGDVLDMFIPTANMSVYFGPKHITNGCEIKPSAALNPPKVIISGHPDE--  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP  REW+HW+V DIP G++ S+G+E+  Y+ P PP GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPNMREWIHWIVVDIPGGTNPSRGKEILPYMEPRPPVGIHRYILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LFRQ   + +  + P SR NF TR FA    LGLPVA +YFN+QK+ A+ ++
Sbjct  122  LFRQNSPVGLMVQQPPSRANFSTRMFAGHFDLGLPVATVYFNAQKEPASRRR  173



>emb|CDY60777.1| BnaC05g50120D [Brassica napus]
Length=174

 Score =   205 bits (522),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDVLDM++P    +V  G K I NG EI PS A   P V+I+G+  S  
Sbjct  5    SVDPLVVGRVIGDVLDMYIPTANMSVYVGPKHITNGCEIKPSVAVNPPKVNISGN--SDE  62

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP  REW+HW+V DIP G++ SKG+E+  Y+ P PP GIHRY+F 
Sbjct  63   LYTLVMTDPDAPSPSEPNMREWVHWIVVDIPGGTNPSKGKEILPYMEPKPPVGIHRYIFV  122

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LFRQ   + +  + P SR NF TR FA    LGLPVA +YFN+QK+ A+ ++
Sbjct  123  LFRQISPVGLMVQQPPSRANFSTRMFAGHLDLGLPVATVYFNAQKEPASRRR  174



>ref|XP_002892983.1| E12A11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69242.1| E12A11 [Arabidopsis lyrata subsp. lyrata]
Length=173

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDVLDMF+P    +V +G K I NG EI PS+A   P V+I+G   S  
Sbjct  4    SVDPLVVGRVIGDVLDMFIPTANMSVYFGPKHITNGCEIKPSTAINPPKVNISGH--SDE  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP  REW+HW+V DIP G+  S+G+E+  Y+ P PP GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPNMREWVHWIVVDIPGGTSPSRGKEILPYMEPRPPVGIHRYILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LFRQ   + +  + P SR NF TR FA    LGLPVA +YFN+QK+ A+ ++
Sbjct  122  LFRQNSPVGLMVQQPPSRANFSTRMFAGHFDLGLPVATVYFNAQKEPASRRR  173



>ref|XP_010097584.1| hypothetical protein L484_017394 [Morus notabilis]
 gb|EXB69116.1| hypothetical protein L484_017394 [Morus notabilis]
Length=172

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 126/172 (73%), Gaps = 3/172 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMF+P +  +V +GSK + NG +I PS A   P V I+G   S  
Sbjct  4    SVDPLVVGRVIGDVVDMFIPTLSVSVYFGSKHVTNGCDIKPSIAISPPKVAISGH--SDE  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HW+V DIP G++ ++G+E+  Y+GP PP GIHR++  
Sbjct  62   LYTLVMTDPDAPSPSEPSMREWVHWIVVDIPGGTNPNRGKEILPYVGPRPPVGIHRFILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LFRQ+  + +  +PP +R NF TR FA    LGLPVA +YFNSQK+ A+ ++
Sbjct  122  LFRQKAPLGLVDQPP-TRANFNTRYFAGNLDLGLPVATVYFNSQKEPASKRR  172



>ref|XP_010260703.1| PREDICTED: protein MOTHER of FT and TF 1 [Nelumbo nucifera]
Length=176

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 127/174 (73%), Gaps = 4/174 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SV+PLVVG+VIGDV+DMFVP V  +V +G K + NG +I PS A   P V ++G   + +
Sbjct  6    SVEPLVVGRVIGDVVDMFVPTVSMSVYFGPKHVTNGCDIKPSMATNPPKVVVSGH--TDD  63

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HW+V DIP G+  SKG+E+  Y+GP PP GIHRY+  
Sbjct  64   LYTLVMTDPDAPSPSEPSMREWVHWIVVDIPGGTSPSKGKEILPYMGPRPPVGIHRYILV  123

Query  399  LFRQREAMQVAQ-KPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LFRQR +M+ A  + P +R NF TR FA    LG+PVA +YFN+QK+ A NKKR
Sbjct  124  LFRQRYSMKDAVIQQPATRANFNTRAFANQLDLGVPVATIYFNAQKEPA-NKKR  176



>gb|AIE37919.1| phosphatidylethanolamine-binding protein [Gossypium barbadense]
 gb|KHG23631.1| Protein MOTHER of FT and TF 1 -like protein [Gossypium arboreum]
Length=172

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 125/172 (73%), Gaps = 3/172 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP V  +V YGSK ++NG +I PS A   P V I+G P    
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTVTMSVYYGSKHVSNGCDIKPSMAINPPKVAIDGLPD--Q  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
             YTL+M DPDAPSPSEPT REW+HW+V+DIP G++ ++G+E+  Y+GP PP GIHRY+  
Sbjct  62   FYTLVMTDPDAPSPSEPTMREWVHWIVSDIPGGTNPTRGKEILAYMGPRPPVGIHRYILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LF+Q+  +   Q+ P +R NF TR FA    LGLPVA +YFN+QK+  + ++
Sbjct  122  LFQQKGPLGAVQQ-PATRANFSTRFFADHLNLGLPVATVYFNAQKEPVSRRR  172



>ref|XP_003566347.1| PREDICTED: protein MOTHER of FT and TF 1-like [Brachypodium distachyon]
Length=175

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 125/175 (71%), Gaps = 3/175 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R VDPLVVG+VIG+V+D+FVP V   V YG K I+NG  I PS AA +P V I+G     
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSVAMAVAYGPKDISNGCHIKPSMAAAQPLVRISGR--RN  60

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTL+M DPDAPSPS+PT RE+LHW+V +IP G+DA+KG  V  Y+GP+PP GIHRYV 
Sbjct  61   DLYTLVMTDPDAPSPSDPTMREYLHWIVVNIPGGTDATKGDTVVPYMGPAPPVGIHRYVL  120

Query  396  ALFRQR-EAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
             LF Q+  A+      P  R  F TR FAAA+ LGLPVA +YFNSQK+ A N++R
Sbjct  121  VLFEQKTRAVDGMTAAPADRAYFSTRAFAAAHDLGLPVAVVYFNSQKEPAHNRRR  175



>ref|XP_010686257.1| PREDICTED: protein MOTHER of FT and TF 1-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=171

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 121/167 (72%), Gaps = 2/167 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVH-INGSPAS  212
            R++ PL+  KVI DV+DMF P  E TV+YG KK+ NGVEI+P+ A++KP    I   P+ 
Sbjct  6    RTLKPLIDSKVIKDVVDMFTPAAELTVEYGGKKVTNGVEISPADASEKPRFEFIFHGPSK  65

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             NL+TL+MVDPDAP P +PT REWLHW+V DIP+G   SKG+E  EY+GP PP GIHRY 
Sbjct  66   DNLFTLVMVDPDAPHPHQPTMREWLHWMVVDIPQGMHPSKGKEKVEYMGPKPPGGIHRYA  125

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQK  533
            F LF+Q+  +    K P++R NF T QFAA N LGLPVAALYF SQK
Sbjct  126  FVLFQQK-GLIPKLKFPDARNNFSTMQFAADNDLGLPVAALYFTSQK  171



>ref|XP_009393599.1| PREDICTED: protein MOTHER of FT and TF 1-like [Musa acuminata 
subsp. malaccensis]
Length=172

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 125/173 (72%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R VDPLVVG+VIGDV+D+FVP V  TV +GSK ++NG +I PS AA  P+V I G  +  
Sbjct  3    RYVDPLVVGRVIGDVVDLFVPTVSMTVRFGSKHVSNGCDIKPSMAANPPTVQIAGQQS--  60

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTL+M DPDAPSPS+PT REWLHW++ ++P G+  S+G EV  Y+GP  P GIHRYV 
Sbjct  61   DLYTLVMTDPDAPSPSDPTMREWLHWMMVNMPGGTFPSQGEEVVPYMGPRLPLGIHRYVM  120

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LFRQ+        PP +R NF TR FAA + LGLPVA +YFNSQK+ AT ++
Sbjct  121  VLFRQKSRFP-GVTPPATRLNFNTRSFAAHHDLGLPVATVYFNSQKEPATRRR  172



>ref|XP_007209687.1| hypothetical protein PRUPE_ppa012388mg [Prunus persica]
 gb|EMJ10886.1| hypothetical protein PRUPE_ppa012388mg [Prunus persica]
Length=172

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 126/173 (73%), Gaps = 4/173 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP V  +V +GSK + NG +I PS A   P + ++G P    
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTVNMSVYFGSKHVTNGCDIKPSMAINPPKITVSGQPG--E  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HW+V DIP G+   +G+E+  Y+GP PP GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPSMREWVHWIVADIPGGTSPVRGKEILAYVGPRPPVGIHRYILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LF+Q+  M + ++ P SR +F TR FAA   LGLPV+ +YFNSQK+ A N++R
Sbjct  122  LFQQKGPMGLVEQ-PSSRAHFNTRFFAAQLDLGLPVSTVYFNSQKEPA-NRRR  172



>ref|XP_004299541.1| PREDICTED: protein MOTHER of FT and TF 1-like [Fragaria vesca 
subsp. vesca]
Length=172

 Score =   204 bits (519),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 127/173 (73%), Gaps = 4/173 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP V  +V +GSK + NG +I PS A   P V  +G P    
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTVNMSVYFGSKHVTNGCDIKPSIAVSPPKVTFSGHPG--E  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HW++ DIP G++  +G+E+  Y+GP PP GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPSMREWVHWILADIPGGTNPIRGKEILPYVGPRPPVGIHRYILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LF+Q+  M + ++PP +R +F TR FAA   LGLPV+ +YFN+QK+ A N++R
Sbjct  122  LFQQKAPMGLVEQPP-TRAHFNTRYFAAQLDLGLPVSTVYFNAQKEPA-NRRR  172



>ref|XP_006416640.1| hypothetical protein EUTSA_v10009636mg [Eutrema salsugineum]
 gb|ESQ34993.1| hypothetical protein EUTSA_v10009636mg [Eutrema salsugineum]
Length=173

 Score =   204 bits (518),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDVLDMF+P    +V +G K I NG EI PS+A   P V+I+G   +  
Sbjct  4    SVDPLVVGRVIGDVLDMFIPTANMSVYFGPKHITNGCEIKPSAAVNPPKVNISGH--ADE  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP  REW+HW+V DIP G+  S+G+E+  Y+ P PP GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPNMREWVHWIVVDIPGGTIPSRGKEILPYMEPRPPVGIHRYILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LFRQ   + +  + P SR NF TR FA    LGLPVA +YFN+QK+ A+ ++
Sbjct  122  LFRQNSPVGLMVQQPPSRANFSTRMFAGHLNLGLPVATVYFNAQKEPASRRR  173



>ref|XP_009757930.1| PREDICTED: protein MOTHER of FT and TF 1 [Nicotiana sylvestris]
Length=173

 Score =   203 bits (517),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            VDPLVVG+VIGDV+DMFVP V  +V +G+K + NG +I PS AA  P + + G  A  +L
Sbjct  5    VDPLVVGRVIGDVVDMFVPSVTMSVHFGNKHVTNGCDIKPSIAADPPKITVGGHAA--DL  62

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            YTL+M DPDAPSPSEP  REW+HW+VTDIP  S+ ++G+EV  Y+GP PP GIHRY+  L
Sbjct  63   YTLVMTDPDAPSPSEPNMREWVHWIVTDIPGCSNVARGKEVLGYVGPRPPVGIHRYILVL  122

Query  402  FRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            FRQ+  M    +PP +R +F TR FA    LG+PVA +YFN+ K+ A N+KR
Sbjct  123  FRQKAPMPGILQPPLARSHFCTRAFAHQLDLGVPVATVYFNAHKEPA-NRKR  173



>ref|XP_006451659.1| hypothetical protein CICLE_v10009697mg [Citrus clementina]
 ref|XP_006490744.1| PREDICTED: protein MOTHER of FT and TF 1-like [Citrus sinensis]
 dbj|BAF93494.1| MOTHER of FT and TFL1-like protein [Citrus unshiu]
 gb|ESR64899.1| hypothetical protein CICLE_v10009697mg [Citrus clementina]
 gb|KDO62889.1| hypothetical protein CISIN_1g037140mg [Citrus sinensis]
Length=172

 Score =   203 bits (517),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP V  +V YGSK + NG ++ PS A   P ++I G   S  
Sbjct  4    SVDPLVVGRVIGDVVDMFVPSVGMSVYYGSKHVTNGCDVKPSMATSPPKLNITGH--SDE  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP  REW+HW+V DIP G++ ++G E+  Y+GP PP GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPRMREWVHWIVVDIPGGTNPAQGMEILPYMGPRPPVGIHRYIMV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LF+Q+  + + ++PP +R NF TR FA    LGLPVA +YFN QK+ A+ ++
Sbjct  122  LFQQKAPLGLVEQPP-TRANFNTRLFAGNLDLGLPVATIYFNCQKEPASRRR  172



>ref|XP_006341565.1| PREDICTED: protein MOTHER of FT and TF 1-like [Solanum tuberosum]
Length=173

 Score =   203 bits (517),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 121/172 (70%), Gaps = 3/172 (2%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            VDPLVVG+VIGDV+DMFVP V  +V Y +K + NG +I PS A + P + I G P     
Sbjct  5    VDPLVVGRVIGDVVDMFVPSVTMSVHYANKHVTNGCDIKPSIAIEPPKITIGGHPDE--F  62

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            YTL+M DPDAPSPSEPT REW+HW+VTDIP  S+ ++G+EV  Y+GP PP GIHRY+  L
Sbjct  63   YTLVMTDPDAPSPSEPTMREWVHWIVTDIPGCSNVARGKEVLGYVGPRPPVGIHRYILVL  122

Query  402  FRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            FRQ   MQ   +PP +R +F TR FA    LG PVA +YFN+ K+ A N+KR
Sbjct  123  FRQNAPMQGILQPPVARAHFCTRVFAHQLDLGTPVATVYFNAHKEPA-NRKR  173



>ref|XP_004967983.1| PREDICTED: protein MOTHER of FT and TF 1-like [Setaria italica]
Length=171

 Score =   203 bits (517),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 126/173 (73%), Gaps = 4/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R V+PLVVG+VIG+V+D+FVP +  TV YG K I+NG  + PS+ A  P V I+G     
Sbjct  3    RFVEPLVVGRVIGEVVDLFVPSISMTVAYGPKDISNGRLLKPSATAAPPLVRISGR--RN  60

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTLIM DPDAPSPS+PT RE+LHW+VT+IP G+DA+KG EV EY+GP PP GIHRYV 
Sbjct  61   DLYTLIMTDPDAPSPSDPTMREYLHWIVTNIPGGTDATKGEEVVEYMGPRPPVGIHRYVL  120

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF Q+   +V  + P  R NF TR FAAA+ LGLP A +YFN+QK+ A  ++
Sbjct  121  VLFEQK--TRVNAEAPGERANFNTRAFAAAHELGLPTAVVYFNAQKEPANRRR  171



>ref|XP_004235817.1| PREDICTED: protein MOTHER of FT and TF 1 [Solanum lycopersicum]
Length=173

 Score =   203 bits (517),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 119/172 (69%), Gaps = 2/172 (1%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
             VDPLVVG+VIGDV+DMFVP V  +V Y +K + NG +I PS A + P + I G P    
Sbjct  4    KVDPLVVGRVIGDVVDMFVPSVTMSVHYANKHVNNGCDIKPSIATEPPKIAIGGQPDE--  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
             YTL+M DPDAPSPSEPT REW+HW+VTDIP  S+  +G+EV  Y+GP PP GIHRY+  
Sbjct  62   FYTLVMTDPDAPSPSEPTMREWVHWIVTDIPGCSNVGRGKEVLGYVGPRPPVGIHRYILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LFRQ   MQ   + P +R +FRTR FA    LG+PVA +YFN+ K+ A  K+
Sbjct  122  LFRQNAPMQEIFQAPVARAHFRTRMFAHQLDLGVPVATVYFNAHKEPANRKR  173



>gb|ACA24491.1| mother of flowering locus T-like protein [Glycine max]
Length=190

 Score =   204 bits (519),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 126/172 (73%), Gaps = 3/172 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMF+P V  +V +GSK + NG +I PS A   P + + G+    N
Sbjct  22   SVDPLVVGRVIGDVVDMFIPSVNMSVYFGSKHVTNGCDIKPSIAISPPKLTLTGN--MDN  79

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HW++ DIP G++  +G+E+  Y+GP PP GIHRY+F 
Sbjct  80   LYTLVMTDPDAPSPSEPSMREWIHWILVDIPGGTNPFRGKEIVSYVGPRPPIGIHRYIFV  139

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LF+Q+  + + ++PP +R +F TR FA    LGLPVA +YFNSQK+ A  ++
Sbjct  140  LFQQKGPLGLVEQPP-TRASFNTRYFARQLDLGLPVATVYFNSQKEPAVKRR  190



>ref|NP_001106248.1| ZCN9 protein [Zea mays]
 gb|ABW96232.1| ZCN9 [Zea mays]
Length=172

 Score =   203 bits (516),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 127/174 (73%), Gaps = 5/174 (3%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDY-GSKKIANGVEITPSSAAQKPSVHINGSPAS  212
            R VDPLVVG+VIG+V+D+FVP +  TV Y GSK I+NG  + PS+ A  P V I+G    
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSISMTVAYDGSKDISNGCLLKPSATAAPPLVRISGR--R  60

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             +LYTLIM DPDAPSPS PT RE+LHW+V +IP G+DA+KG EV EY+GP PP GIHRYV
Sbjct  61   NDLYTLIMTDPDAPSPSNPTMREYLHWIVINIPGGTDATKGEEVVEYMGPRPPVGIHRYV  120

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
              LF Q+   +V  + P  R NF+TR FAAA+ LGLP A +YFN+QK+ A+ ++
Sbjct  121  LVLFEQK--TRVHAEAPGDRANFKTRAFAAAHELGLPTAVVYFNAQKEPASRRR  172



>ref|XP_011072991.1| PREDICTED: protein MOTHER of FT and TF 1 [Sesamum indicum]
Length=174

 Score =   203 bits (516),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 124/173 (72%), Gaps = 3/173 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            +VDPLVVG+VIGDV+DMFVP V  +V YGSK + NG +I PS AA  P V I G   +  
Sbjct  4    NVDPLVVGRVIGDVVDMFVPTVSMSVYYGSKHVNNGCDIKPSMAAAPPRVTITGH--ANE  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HW+VTDIP  S+ ++GREV  YIGP PP GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPSMREWVHWIVTDIPGRSNVTRGREVLPYIGPRPPVGIHRYILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LFRQ  +++  +  P SR +F TR FA    LG+PVA +YFN+ K+ A  K++
Sbjct  122  LFRQNASVEGVEA-PVSRTHFNTRAFAQELDLGMPVATVYFNAHKEPANRKRQ  173



>gb|ADM92615.1| mother of FT AND TFL1-like protein MFT1 [Beta vulgaris]
 gb|ADM92616.1| mother of FT AND TFL1-like protein MFT1 [Beta vulgaris]
Length=171

 Score =   203 bits (516),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 120/167 (72%), Gaps = 2/167 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVH-INGSPAS  212
            R++ PL+  KVI DV+DMF P  E TV+YG KK+ NGVEI+P+ A++KP    I   P+ 
Sbjct  6    RTLKPLIDSKVIKDVVDMFTPAAELTVEYGGKKVTNGVEISPADASEKPRFEFIFHGPSK  65

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             N +TL+MVDPDAP P +PT REWLHW+V DIP+G   SKG+E  EY+GP PP GIHRY 
Sbjct  66   DNFFTLVMVDPDAPHPHQPTMREWLHWMVVDIPQGMHPSKGKEKVEYMGPKPPGGIHRYA  125

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQK  533
            F LF+Q+  +    K P++R NF T QFAA N LGLPVAALYF SQK
Sbjct  126  FVLFQQK-GLIPKLKFPDARNNFSTMQFAADNDLGLPVAALYFTSQK  171



>gb|ABF65987.1| CETS1 [Glycine max]
Length=172

 Score =   203 bits (516),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 126/172 (73%), Gaps = 3/172 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMF+P V  +V +GSK + NG +I PS A   P + + G+    N
Sbjct  4    SVDPLVVGRVIGDVVDMFIPSVNMSVYFGSKHVTNGCDIKPSIAISPPKLTLTGN--MDN  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HW++ DIP G++  +G+E+  Y+GP PP GIHRY+F 
Sbjct  62   LYTLVMTDPDAPSPSEPSMREWIHWILVDIPGGTNPFRGKEIVSYVGPRPPIGIHRYIFV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LF+Q+  + + ++PP +R +F TR FA    LGLPVA +YFNSQK+ A  ++
Sbjct  122  LFQQKGPLGLVEQPP-TRASFNTRYFARQLDLGLPVATVYFNSQKEPAVKRR  172



>ref|XP_010940015.1| PREDICTED: protein MOTHER of FT and TF 1-like [Elaeis guineensis]
Length=175

 Score =   202 bits (515),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 123/174 (71%), Gaps = 5/174 (3%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            VDPLVVG+VIG+V+D+FVP +  +V YG+K + NG ++ PS A   P+V I G  A  +L
Sbjct  5    VDPLVVGRVIGEVVDLFVPTMSMSVSYGTKHVNNGCDVKPSMAINPPTVQIAGRRA--DL  62

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            YTL+M DPDAPSPS+PT REWLHWVV +IP G+D S G EV  Y+GP PP GIHRY   L
Sbjct  63   YTLVMTDPDAPSPSDPTMREWLHWVVVNIPGGTDTSHGEEVVAYMGPRPPVGIHRYALVL  122

Query  402  FRQREAMQVAQ--KPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            F+Q+           P SR NF TR FAA + LGLPVAA+YFN+QK+ A N++R
Sbjct  123  FQQKSRFSTGAGVALPASRANFNTRTFAARHDLGLPVAAVYFNAQKEPA-NRRR  175



>gb|ABX11011.1| ZCN9 [Zea mays]
Length=172

 Score =   202 bits (514),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 126/174 (72%), Gaps = 5/174 (3%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDY-GSKKIANGVEITPSSAAQKPSVHINGSPAS  212
            R VDPLVVG+VIG+V+D+FVP +  TV Y GSK I+NG  + PS+ A  P V I+G    
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSISMTVAYDGSKDISNGCLLKPSATAAPPLVRISGR--R  60

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             +LYTLIM DPDAPSPS PT RE+LHW+V +IP G+DA+KG EV EY+GP PP GIHRYV
Sbjct  61   NDLYTLIMTDPDAPSPSNPTMREYLHWIVINIPGGTDATKGEEVVEYMGPRPPVGIHRYV  120

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
              LF Q+   +V  + P  R NF+TR FAAA+ LGLP A +YFN+QK+ A  ++
Sbjct  121  LVLFEQK--TRVHAEAPGDRANFKTRAFAAAHELGLPTAVVYFNAQKEPANRRR  172



>ref|XP_009403936.1| PREDICTED: protein MOTHER of FT and TF 1-like [Musa acuminata 
subsp. malaccensis]
Length=172

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 121/171 (71%), Gaps = 3/171 (2%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            VDPLVVG+VIGDV+D+FVP +   V +G K + NG +I PS AA  PSV I G  A  +L
Sbjct  5    VDPLVVGRVIGDVVDLFVPTISMMVRFGLKHVNNGCDIKPSMAANPPSVQIAGRQA--DL  62

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            YTL+M DPDAPSPS+PT REWLHW+V ++P G+D S+G+E   Y+GP PP GIHRYV  L
Sbjct  63   YTLVMTDPDAPSPSDPTMREWLHWMVINMPGGTDPSRGQEAVPYMGPRPPVGIHRYVLVL  122

Query  402  FRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F+Q+  +     PP +R NF TR  AA   LGLPVA +YFNSQK+ A  ++
Sbjct  123  FQQKSRLP-GVAPPATRANFNTRSLAAQYDLGLPVATVYFNSQKEPAARRR  172



>gb|AFP33419.1| mother of FT and TFL1 [Arachis hypogaea]
 gb|AFP33422.1| mother of FT and TFL1 [Arachis hypogaea]
Length=176

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 123/172 (72%), Gaps = 2/172 (1%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP V  +V YGSK + NG +I PS A   P V + G     +
Sbjct  7    SVDPLVVGRVIGDVIDMFVPSVGMSVYYGSKHVTNGCDIKPSMAISPPKVTLTGGNIH-S  65

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEPT REWLHWVV DIP G++ ++G+E+  Y+GP PP GIHRY+  
Sbjct  66   LYTLVMTDPDAPSPSEPTMREWLHWVVVDIPGGTNPTQGKEIVAYMGPRPPVGIHRYILI  125

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LF Q+  +   ++ P +R +F TR FA    LGLPVA +YFNSQK+ A+ ++
Sbjct  126  LFEQKGVLGGVEQ-PAARASFNTRYFARQFNLGLPVATVYFNSQKEPASKRR  176



>gb|ACN54543.1| mother of FT and TFL1-like protein [Physcomitrella patens]
Length=192

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 124/192 (65%), Gaps = 19/192 (10%)
 Frame = +3

Query  33   PRSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPAS  212
            PRS+DPL+VGKVIGDV+D FVP V+  + Y ++++ NG ++ PS+ AQ P + ++     
Sbjct  2    PRSIDPLIVGKVIGDVIDTFVPRVDMAIHYSTRQVTNGCQLKPSATAQAPEIQLSDKSGD  61

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASK------------------GR  338
             N YTL+M DPDAPSPSEP+ REWLHW+VTDIP  S  S+                  GR
Sbjct  62   NNYYTLVMTDPDAPSPSEPSLREWLHWIVTDIPGNSGGSETNTGFPWLSEQATSTSSSGR  121

Query  339  EVAEYIGPSPPTGIHRYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALY  518
            E+  YIGP PP GIHRY+F LF+Q  +      PP +R NF TR FAA  GLGLPVAA Y
Sbjct  122  ELVPYIGPRPPIGIHRYIFVLFKQ-PSQSFLISPPAARNNFSTRNFAAYYGLGLPVAATY  180

Query  519  FNSQKQSATNKK  554
             NSQK+ A+  +
Sbjct  181  CNSQKEPASRNR  192



>ref|XP_008374830.1| PREDICTED: protein MOTHER of FT and TF 1 [Malus domestica]
 ref|XP_009347832.1| PREDICTED: protein MOTHER of FT and TF 1-like [Pyrus x bretschneideri]
Length=192

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 126/173 (73%), Gaps = 4/173 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP +  +V +GSK + NG +I PS A   P +   G P    
Sbjct  24   SVDPLVVGRVIGDVVDMFVPTLSMSVYFGSKHVTNGCDIKPSMAINPPKITFTGHPG--E  81

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HW+V+DIP G++  +G+E+  Y+GP PP GIHRY+  
Sbjct  82   LYTLVMTDPDAPSPSEPSMREWVHWIVSDIPGGTNPLRGKEILPYVGPRPPVGIHRYILV  141

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LF+Q+  + + ++PP SR +F TR FAA   LGLPV+ +YFN QK+ A N++R
Sbjct  142  LFQQKAPVGLVEQPP-SRAHFNTRFFAAQLDLGLPVSTVYFNCQKEPA-NRRR  192



>dbj|BAK78896.1| MFT [Triticum aestivum]
Length=175

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 125/175 (71%), Gaps = 3/175 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R VDPLVVG+VIG+V+DMFVP V   V YG++ ++NG  + PS AA +P V I+G     
Sbjct  3    RCVDPLVVGRVIGEVVDMFVPSVAMAVAYGARDLSNGCHVKPSLAADQPLVRISGR--RN  60

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTL+M DPDAPSPSEPT RE+LHW+V ++P G+DA+KG  V  Y+GP PP GIHRYV 
Sbjct  61   DLYTLVMTDPDAPSPSEPTMREYLHWIVVNVPGGTDATKGEVVVPYMGPRPPVGIHRYVL  120

Query  396  ALFRQREAM-QVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
             LF Q+     VA   P+ R  F TR FAA + LGLPVA +YFNSQK+ + +++R
Sbjct  121  VLFEQKTRFPYVAAASPDDRAYFNTRAFAANHELGLPVAVVYFNSQKEPSGHRRR  175



>ref|NP_001236894.1| uncharacterized LOC100306314 precursor [Glycine max]
 gb|ACU14433.1| unknown [Glycine max]
Length=190

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 125/172 (73%), Gaps = 3/172 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMF+P V  +V +GSK + NG +I PS A   P + + G+    N
Sbjct  22   SVDPLVVGRVIGDVVDMFIPSVNMSVYFGSKHVTNGCDIKPSIAISPPKLALTGN--MDN  79

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HW++ DIP G++  +G+E+  Y+GP PP GIHRY+F 
Sbjct  80   LYTLVMTDPDAPSPSEPSMREWIHWILVDIPGGTNPFRGKEIVSYVGPRPPIGIHRYIFV  139

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LF+Q+  + + ++PP +R +F TR FA    LGLPVA +YFNSQK+    ++
Sbjct  140  LFQQKGPLGLVEQPP-TRASFNTRYFARQLDLGLPVATVYFNSQKEPTVKRR  190



>ref|XP_007036754.1| PEBP family protein isoform 1 [Theobroma cacao]
 gb|EOY21255.1| PEBP family protein isoform 1 [Theobroma cacao]
Length=225

 Score =   203 bits (516),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP V  +V YGS+ + NG +I PS+    P V ING   S  
Sbjct  57   SVDPLVVGRVIGDVVDMFVPTVTMSVYYGSRHVTNGCDIKPSTTINPPKVSINGH--SDE  114

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HW+V+DIP G++ ++G+E+  Y+GP PP GIHRY+  
Sbjct  115  LYTLVMTDPDAPSPSEPSMREWVHWIVSDIPGGTNPTRGKEILVYMGPRPPVGIHRYILV  174

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LF+Q+  +   Q+ P SR NF TR FA    LG PVA +YFN+QK+  + ++
Sbjct  175  LFQQKGPLGQVQQ-PASRANFSTRLFAQHLNLGQPVATVYFNAQKEPVSRRR  225



>ref|XP_009621088.1| PREDICTED: protein MOTHER of FT and TF 1 [Nicotiana tomentosiformis]
Length=173

 Score =   201 bits (511),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            VDPLVVG+VIGDV+DMFVP V  +V +G+K + NG +I PS AA  P + + G  A  +L
Sbjct  5    VDPLVVGRVIGDVVDMFVPSVTMSVHFGNKHVTNGCDIKPSIAADPPKITVGGHAA--DL  62

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            YTL+M DPDAPSPSEP  REW+HW+VTDIP  ++ ++G+EV  Y+GP PP GIHRY+  L
Sbjct  63   YTLVMTDPDAPSPSEPNMREWVHWIVTDIPGCTNVARGKEVLGYMGPRPPVGIHRYIVVL  122

Query  402  FRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            FRQ+  M    +PP +R +F TR FA    LG+PVA +YFN+ K+ A N+KR
Sbjct  123  FRQKGPMPGILQPPLARSHFCTRAFAHQLDLGVPVATVYFNAHKEPA-NRKR  173



>gb|ABB90591.1| terminal flower 1 [Aquilegia formosa]
Length=166

 Score =   200 bits (509),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 118/166 (71%), Gaps = 4/166 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVGKVIGDV+DMF+P +  +V YGSK + NG +I PS A   P+VHI+G   S  
Sbjct  4    SVDPLVVGKVIGDVVDMFIPTINMSVYYGSKHVTNGCDIKPSLATAPPTVHISG--FSDE  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEPT REWLHW+V +IP     ++G+EV  Y+GP+PP GIHRY   
Sbjct  62   LYTLVMSDPDAPSPSEPTKREWLHWIVVNIPGAGYVTRGKEVLPYMGPAPPVGIHRYALL  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQ  536
            LFRQ+  + +    P  R NF+TR FA    LGLPVA  YFN+QK+
Sbjct  122  LFRQKNPLSIDN--PPLRANFKTRNFAHQFDLGLPVACAYFNAQKE  165



>gb|AFW79812.1| MFT2-Corn MFT-like protein [Zea mays]
Length=172

 Score =   201 bits (510),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 126/174 (72%), Gaps = 5/174 (3%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDY-GSKKIANGVEITPSSAAQKPSVHINGSPAS  212
            R VDPLVVG+VIG+V+D+FVP +  TV Y G K I+NG  + PS+ A  P V I+G    
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSISMTVAYDGPKDISNGCLLKPSATAAPPLVRISGR--R  60

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             +LYTLIM DPDAPSPS PT RE+LHW+V +IP G+DA+KG EV EY+GP PP GIHRYV
Sbjct  61   NDLYTLIMTDPDAPSPSNPTMREYLHWIVINIPGGTDATKGEEVVEYMGPRPPVGIHRYV  120

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
              LF Q+   +V  + P  R NF+TR FAAA+ LGLP A +YFN+QK+ A+ ++
Sbjct  121  LVLFEQKT--RVHAEAPGDRANFKTRAFAAAHELGLPTAVVYFNAQKEPASRRR  172



>ref|XP_001764385.1| predicted protein [Physcomitrella patens]
 gb|EDQ70652.1| predicted protein [Physcomitrella patens]
Length=180

 Score =   200 bits (509),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 122/179 (68%), Gaps = 7/179 (4%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RS+DPLVVGKVIGDV+D FVP V+  + Y S+++ NG ++ PS+ AQ P + ++ +    
Sbjct  3    RSIDPLVVGKVIGDVIDTFVPSVDMAIHYSSRQVTNGCQMKPSATAQAPEIQLSDNSEGN  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGS------DASKGREVAEYIGPSPPTG  377
            N YTLIM DPDAPSPSEP+ REWLHW+VTDIP  S       +S GRE+  Y+GP PP G
Sbjct  63   NYYTLIMTDPDAPSPSEPSLREWLHWIVTDIPGNSGEQVTHTSSSGRELVPYMGPRPPIG  122

Query  378  IHRYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            IHRY F LF+Q  +      PP  R NF TR FA+  GLGLPVAA Y N+QK+  + ++
Sbjct  123  IHRYAFILFKQ-PSTPFLISPPTVRNNFSTRNFASHYGLGLPVAATYCNAQKEPGSRRR  180



>ref|XP_008360924.1| PREDICTED: LOW QUALITY PROTEIN: protein MOTHER of FT and TF 1-like 
[Malus domestica]
Length=172

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 126/173 (73%), Gaps = 4/173 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP V  +V +GSK + NG +I PS A   P + ++G P    
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTVSMSVYFGSKHVTNGCDIKPSMAINPPKITVSGHPG--E  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HW+V+DIP GS+  +G+E+  Y+GP PP GIHR +  
Sbjct  62   LYTLVMTDPDAPSPSEPSMREWVHWIVSDIPGGSNPLRGKEILPYVGPRPPVGIHRXILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
             F+Q+  M + ++ P SR +F TR FAA   LGLPV+ +YFNSQK+ A N++R
Sbjct  122  XFQQKAPMGLVEQXP-SRAHFNTRFFAAQLDLGLPVSTVYFNSQKEPA-NRRR  172



>ref|XP_009387733.1| PREDICTED: protein MOTHER of FT and TF 1-like [Musa acuminata 
subsp. malaccensis]
Length=172

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 125/172 (73%), Gaps = 4/172 (2%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            VDPLVVG+VIGDV+D+FVP +  TV +GSK + NG +I PS AA  PSV+I+G  +  +L
Sbjct  5    VDPLVVGRVIGDVVDLFVPTINMTVSFGSKHVNNGCDIKPSMAANPPSVYISGQQS--DL  62

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            YTL+M DPDAPSPS+PT REWLHW+V ++P G+D S+G E   Y+GP+P  GIHRYV  L
Sbjct  63   YTLVMTDPDAPSPSDPTMREWLHWMVINMPGGTDPSRGEEAVPYMGPAPRVGIHRYVLVL  122

Query  402  FRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            FRQ+  +      P +R NF TR FAA + L  PVA ++FNSQK+ A N++R
Sbjct  123  FRQKSRLPGVAS-PATRANFNTRWFAAQHDLSFPVATVFFNSQKEPA-NRRR  172



>dbj|BAK06374.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=175

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 123/175 (70%), Gaps = 3/175 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R VDPLVVG+VIG+V+DMFVP V   V YG++ ++NG  + PS AA +P V I+G     
Sbjct  3    RCVDPLVVGRVIGEVVDMFVPSVAMAVAYGARDLSNGCHVKPSLAADQPLVRISGR--RN  60

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTL+M DPDAPSPSEPT RE+LHW+V +IP G+DA+KG  V  Y+GP PP GIHRYV 
Sbjct  61   DLYTLVMTDPDAPSPSEPTMREYLHWIVVNIPGGTDATKGEVVVPYMGPRPPVGIHRYVL  120

Query  396  ALFRQREAM-QVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
             LF Q+     V    PE R  F TR FA  + LGLPVA +YFNSQK+ + +++R
Sbjct  121  VLFEQKTRFPYVDAASPEDRAYFNTRAFAGNHELGLPVAVVYFNSQKEPSGHRRR  175



>ref|XP_004169652.1| PREDICTED: LOW QUALITY PROTEIN: protein MOTHER of FT and TF 1-like 
[Cucumis sativus]
Length=176

 Score =   199 bits (507),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 121/171 (71%), Gaps = 3/171 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP    +V + SK + NG +I PS A   P + I+G P   +
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTATMSVYFNSKHVTNGCDIKPSLAVNPPRLVISGHPC--D  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP  REW+HW++ DIP G++ ++G+E+  Y GP PP GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPHMREWVHWIIVDIPGGANLTQGKEIVPYSGPRPPIGIHRYILL  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNK  551
            LF+Q+  + +  + P SR NF TR FA  + L LPVAA YFNSQK+ AT K
Sbjct  122  LFKQKGPIGMIDQ-PASRANFNTRLFAGISSLDLPVAATYFNSQKEPATKK  171



>ref|XP_003634198.1| PREDICTED: protein MOTHER of FT and TF 1 [Vitis vinifera]
 emb|CBI15548.3| unnamed protein product [Vitis vinifera]
Length=172

 Score =   199 bits (507),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 125/173 (72%), Gaps = 4/173 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP +  +V YG+K + NG ++ PS     P V ++G P    
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTINMSVYYGAKHVTNGCDVKPSLTVNPPKVTLSGHPDE--  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
             YTL+M DPDAPSPSEP+ REW+HW+V DIP G++A++G+E   Y+GP PP GIHRY+  
Sbjct  62   FYTLVMTDPDAPSPSEPSMREWVHWIVADIPGGTNATRGKEALPYVGPRPPVGIHRYILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LF+Q+  + + ++ P SR +F TR FA    LGLPVA +YFN+QK+ A N++R
Sbjct  122  LFQQKAPLGLVEQ-PGSRAHFSTRAFANQLDLGLPVATVYFNAQKEPA-NRRR  172



>emb|CAN80336.1| hypothetical protein VITISV_038913 [Vitis vinifera]
Length=172

 Score =   199 bits (507),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 125/173 (72%), Gaps = 4/173 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP +  +V YG+K + NG ++ PS     P V ++G P    
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTINMSVYYGAKHVTNGCDVKPSLTVNPPKVTLSGHPDE--  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
             YTL+M DPDAPSPSEP+ REW+HW+V DIP G++A++G+E   Y+GP PP GIHRY+  
Sbjct  62   FYTLVMTDPDAPSPSEPSMREWVHWIVADIPGGTNATRGKEALPYVGPRPPVGIHRYILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LF+Q+  + + ++ P SR +F TR FA    LGLPVA +YFN+QK+ A N++R
Sbjct  122  LFQQKAPLGLVEQ-PGSRAHFSTRXFANQLDLGLPVATVYFNAQKEPA-NRRR  172



>dbj|BAK78893.1| MFT [Triticum monococcum subsp. aegilopoides]
 gb|AGY34590.1| MFT-A1a [Triticum aestivum]
Length=175

 Score =   199 bits (505),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 124/175 (71%), Gaps = 3/175 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R VDPLVVG+VIG+V+DMFVP V   V YG++ ++NG  + PS AA +P V I+G     
Sbjct  3    RFVDPLVVGRVIGEVVDMFVPSVAMAVAYGARDLSNGCHVKPSLAADQPLVRISGR--RN  60

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTL+M DPDAPSPSEPT RE+LHW+V +IP G+DA+KG  V  Y+GP PP GIHRYV 
Sbjct  61   DLYTLVMTDPDAPSPSEPTMREYLHWIVVNIPGGTDATKGEVVVPYMGPRPPVGIHRYVL  120

Query  396  ALFRQREAM-QVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
             LF Q+     V    P+ R  F TR FAA + LGLPVA +YFNSQK+ + +++R
Sbjct  121  VLFEQKTRFPYVPAASPDDRAYFNTRAFAANHELGLPVAVVYFNSQKEPSGHRRR  175



>gb|ABK25607.1| unknown [Picea sitchensis]
Length=172

 Score =   198 bits (504),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 121/173 (70%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R V+PLVVG+VIGDVLDMFVP V+  V Y S+++ NG E+ PS+ A  P V I G     
Sbjct  3    RFVEPLVVGRVIGDVLDMFVPSVDLAVTYASRQVNNGCELKPSALALLPRVDIGGEDLR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            N YTL+M DPDAPSPS+PT RE+L W+VTDIP  + AS GRE+  Y  P P  GIHR++F
Sbjct  62   NFYTLVMTDPDAPSPSDPTLREYLQWIVTDIPATTSASFGRELVSYESPRPTIGIHRFIF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q     V   PP SR NF TR FA +N LGLPVAA+YFN+QK++A  ++
Sbjct  122  VLFKQMGRQTV--YPPGSRLNFNTRNFALSNSLGLPVAAVYFNAQKEAAGRRR  172



>gb|ABQ85553.1| flowering locus T-like/terminal flower1-like protein [Picea abies]
Length=173

 Score =   198 bits (504),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 122/173 (71%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R  +PLV+G+VIGDV+DMF+P V  TV YGS+++ NG EI PS+ +  P V + G     
Sbjct  3    RFREPLVLGRVIGDVVDMFMPSVNLTVAYGSRQVNNGCEIKPSAISSAPRVDVGGDDLR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
              +TLIM DPDAPSPS+PT RE+LHW+VTDIP  + AS GRE+  Y  P P  GIHRYVF
Sbjct  62   TCFTLIMTDPDAPSPSDPTLREYLHWIVTDIPATTAASFGRELMRYEAPRPTIGIHRYVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q     V   PP+SR NF TR FA  NGLGLPVAA+Y+N+QK++A  ++
Sbjct  122  TLFKQMARETV--YPPQSRVNFSTRDFAEMNGLGLPVAAVYYNAQKETAPRRR  172



>ref|XP_008443056.1| PREDICTED: protein MOTHER of FT and TF 1-like [Cucumis melo]
Length=176

 Score =   198 bits (503),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP    +V + SK + NG +I PS A   P + I+G P   +
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTATMSVYFNSKHVTNGCDIKPSLAVNPPRLVISGHPC--D  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP  REW+HW++ DIP G++ S+G+E+  Y GP PP GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPHMREWVHWIIVDIPGGANLSQGKEIVPYSGPRPPIGIHRYILL  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNK  551
            LF+Q+  + +  + P SR NF TR FA    L LPVAA YFNSQK+ AT K
Sbjct  122  LFKQKGPIGMIDQ-PASRANFNTRLFARHFNLDLPVAATYFNSQKEPATKK  171



>gb|AJD87372.1| MFT [Fragaria x ananassa]
Length=172

 Score =   198 bits (503),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 126/173 (73%), Gaps = 4/173 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFV  V  +V +GSK + NG +I PS A   P+V  +G P    
Sbjct  4    SVDPLVVGRVIGDVVDMFVLTVNMSVYFGSKHVTNGCDIKPSLAVSPPTVTFSGHPG--E  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HW++ DIP G++  +G+E+  Y+GP PP GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPSMREWVHWILADIPGGTNPIRGKEILPYVGPRPPVGIHRYILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LF+Q+  M + ++PP +R +F TR FAA   LG PV+ +YFN+QK+ A N++R
Sbjct  122  LFQQKAPMGLVEQPP-TRAHFNTRYFAAQLDLGPPVSTVYFNAQKEPA-NRRR  172



>ref|NP_001152713.1| MFT2 - Corn MFT-like protein [Zea mays]
 gb|ACG49094.1| MFT2 - Corn MFT-like protein [Zea mays]
Length=172

 Score =   198 bits (503),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 126/175 (72%), Gaps = 6/175 (3%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDY-GSKKIANGVEITPSSAAQKPSVHINGSPAS  212
            R VDPLVVG+VIG+V+D+FVP +  TV Y G K I+NG  + PS+ A  P V I+G    
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSISMTVAYDGPKDISNGCLLKPSATAAPPLVRISGR--R  60

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             +LYTLIM DPDAPSPS PT RE+LHW+V +IP G+DA+KG EV EY+GP PP GIHRYV
Sbjct  61   NDLYTLIMTDPDAPSPSNPTMREYLHWIVINIPGGTDATKGEEVVEYMGPRPPVGIHRYV  120

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
              LF Q+   +V  + P  R NF+T  FAAA+ LGLP A +YFN+QK+ A N++R
Sbjct  121  LVLFEQK--TRVHAEAPGDRANFKTHAFAAAHELGLPTAVVYFNAQKEPA-NRRR  172



>gb|ABR23052.1| terminal flower-like protein [Picea abies]
 gb|ADE77648.1| unknown [Picea sitchensis]
Length=173

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 122/173 (71%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R  +PLV+G+VIGDV+DMF+P V  TV YGS+++ NG EI PS+ +  P V + G     
Sbjct  3    RFREPLVLGRVIGDVVDMFMPSVNLTVAYGSRQVNNGCEIKPSAISSAPRVDVGGDDLR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
              +TL+M DPDAPSPS+PT RE+LHW+VTDIP  + AS GRE+  Y  P P  GIHRYVF
Sbjct  62   TCFTLVMTDPDAPSPSDPTLREYLHWIVTDIPATTAASFGRELMRYEAPRPTIGIHRYVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q     V   PP+SR NF TR FA  NGLGLPVAA+Y+N+QK++A  ++
Sbjct  122  TLFKQMARETV--YPPQSRVNFSTRDFAEMNGLGLPVAAVYYNAQKETAPRRR  172



>dbj|BAK78908.1| Mother of FT and TFL1 [Triticum aestivum]
 dbj|BAK78909.1| Mother of FT and TFL1 [Triticum aestivum]
 dbj|BAK78895.1| MFT [Triticum aestivum]
 dbj|BAK78894.1| MFT [Triticum monococcum]
 gb|AGY34591.1| MFT-A1b [Triticum aestivum]
Length=175

 Score =   197 bits (501),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 124/175 (71%), Gaps = 3/175 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R VDPLVVG+VIG+V+DMFVP V   V YG++ ++NG  + PS AA +P V I+G     
Sbjct  3    RFVDPLVVGRVIGEVVDMFVPSVAMAVAYGARDLSNGCHVKPSLAADQPLVRISGR--RN  60

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTL+M DPDAPSPSEPT +E+LHW+V +IP G+DA+KG  V  Y+GP PP GIHRYV 
Sbjct  61   DLYTLVMTDPDAPSPSEPTMKEYLHWIVVNIPGGTDATKGEVVVPYMGPRPPVGIHRYVL  120

Query  396  ALFRQREAM-QVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
             LF Q+     V    P+ R  F TR FAA + LGLPVA +YFNSQK+ + +++R
Sbjct  121  VLFEQKTRFPYVPAASPDDRAYFNTRAFAANHELGLPVAVVYFNSQKEPSGHRRR  175



>gb|ADP95116.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95117.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95118.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95119.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95120.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95121.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95122.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95123.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95124.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95125.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95126.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95127.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95128.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95129.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95130.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95131.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95132.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95133.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95134.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95135.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95136.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95137.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95138.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95139.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95140.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95141.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95142.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95143.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95144.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95145.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95146.1| flowering locus T-like protein [Picea sitchensis]
Length=193

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 123/176 (70%), Gaps = 3/176 (2%)
 Frame = +3

Query  27   ANPRSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSP  206
            A  R  +PLV+G+VIGDV+DMF+P V  TV YGS+++ NG EI PS+ +  P V + G  
Sbjct  20   AMARFREPLVLGRVIGDVVDMFMPSVNLTVAYGSRQVNNGCEIKPSAISSAPRVDVGGDD  79

Query  207  ASPNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHR  386
                 +TL+M DPDAPSPS+PT RE+LHW+VTDIP  + AS GRE+  Y  P P  GIHR
Sbjct  80   LR-TCFTLVMTDPDAPSPSDPTLREYLHWIVTDIPATTAASFGRELMRYEAPRPTIGIHR  138

Query  387  YVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            YVF LF+Q     V   PP+SR NF TR FA  NGLGLPVAA+Y+N+QK++A  ++
Sbjct  139  YVFTLFKQMARETV--YPPQSRVNFSTRDFAEMNGLGLPVAAVYYNAQKETAPRRR  192



>ref|XP_004136734.1| PREDICTED: protein MOTHER of FT and TF 1-like [Cucumis sativus]
 gb|KGN59303.1| hypothetical protein Csa_3G807330 [Cucumis sativus]
Length=176

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 120/171 (70%), Gaps = 3/171 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP    +V + SK + NG +I PS A   P + I+G P   +
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTATMSVYFNSKHVTNGCDIKPSLAVNPPRLVISGHPC--D  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP  REW+HW++ DIP G++ ++G+E+  Y GP PP GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPHMREWVHWIIVDIPGGANLTQGKEIVPYSGPRPPIGIHRYILL  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNK  551
            LF+Q+  + +  + P SR NF TR FA    L LPVAA YFNSQK+ AT K
Sbjct  122  LFKQKGPIGMIDQ-PASRANFNTRLFARHFNLDLPVAATYFNSQKEPATKK  171



>gb|AEH59567.1| flowering locus T/Terminal flower1-like protein [Picea abies]
Length=172

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 120/173 (69%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R V+PLVVG+VIGDVLDMFVP V+  V Y S+++ NG E+ PS+    P V I G     
Sbjct  3    RFVEPLVVGRVIGDVLDMFVPSVDLAVTYASRQVNNGCELKPSAITLLPRVDIGGEDLR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            N YTL+M DPDAPSPS+PT RE+L W+VTDIP  + AS GRE+  Y  P P  GIHR++F
Sbjct  62   NFYTLVMTDPDAPSPSDPTLREYLQWIVTDIPATTSASFGRELVSYESPRPTIGIHRFIF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q     V   PP SR NF TR FA +N LGLPVAA+YFN+QK++A  ++
Sbjct  122  VLFKQMGRQTV--YPPGSRLNFNTRNFALSNSLGLPVAAVYFNAQKEAAGRRR  172



>ref|NP_001057701.1| Os06g0498800 [Oryza sativa Japonica Group]
 dbj|BAD45362.1| putative terminal flower 1 [Oryza sativa Japonica Group]
 dbj|BAF19615.1| Os06g0498800 [Oryza sativa Japonica Group]
 gb|EAZ01059.1| hypothetical protein OsI_23087 [Oryza sativa Indica Group]
Length=176

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 123/175 (70%), Gaps = 7/175 (4%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            VDPLVVG+VIGDV+D+FVP    +V +G+K + NG EI PS AA  P+V I G      L
Sbjct  5    VDPLVVGRVIGDVVDLFVPTTAMSVRFGTKDLTNGCEIKPSVAAAPPAVQIAGR--VNEL  62

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            + L+M DPDAPSPSEPT REWLHW+V +IP G+D S+G  V  Y+GP PP GIHRYV  L
Sbjct  63   FALVMTDPDAPSPSEPTMREWLHWLVVNIPGGTDPSQGDVVVPYMGPRPPVGIHRYVMVL  122

Query  402  FRQREAMQVAQKPPE---SRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            F+Q+   +VA  PP+   +R  F TR FA  + LGLPVAALYFN+QK+ A  ++R
Sbjct  123  FQQKA--RVAAPPPDEDAARARFSTRAFADRHDLGLPVAALYFNAQKEPANRRRR  175



>gb|AIJ02002.1| FT/TFL1-like 2 [Pinus sylvestris]
 gb|AIJ02003.1| FT/TFL1-like 2 [Pinus sylvestris]
 gb|AIJ02004.1| FT/TFL1-like 2 [Pinus sylvestris]
 gb|AIJ02006.1| FT/TFL1-like 2 [Pinus sylvestris]
 gb|AIJ02007.1| FT/TFL1-like 2 [Pinus sylvestris]
Length=173

 Score =   196 bits (499),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 122/173 (71%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R  +PLV+G+VIGDV+DMF+P V  TV YGS+++ NG EI PS+ +  P V + G     
Sbjct  3    RFREPLVLGRVIGDVVDMFMPSVNLTVAYGSRQVNNGCEIKPSAISSPPRVDVGGDDLR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
              YTL+M DPDAPSPS+PT RE+LHW+VTDIP  + A+ GRE+  Y  P P  GIHRYVF
Sbjct  62   TCYTLVMTDPDAPSPSDPTLREYLHWIVTDIPATTAATFGRELMRYEAPRPTIGIHRYVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q     V   PP+SR NF TR FA  NGLGLPVAA+Y+N+QK++A  ++
Sbjct  122  ILFKQMARETV--YPPQSRINFSTRDFAEINGLGLPVAAVYYNAQKETAPRRR  172



>ref|XP_003563887.1| PREDICTED: protein MOTHER of FT and TF 1-like [Brachypodium distachyon]
Length=178

 Score =   196 bits (498),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 126/175 (72%), Gaps = 5/175 (3%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            +DPL +GKVIG+V+D FVP +  +V +G+K + NG EI PS A   P+V I G     +L
Sbjct  5    LDPLELGKVIGEVVDRFVPTMVLSVRFGTKVLTNGCEIKPSVAVAAPAVQIGGGVG--DL  62

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            +TL+M+DPDAPSPSEP+ REWLHW+V +IP G+D S+G+EV  Y+ P P  GIHRYV  +
Sbjct  63   FTLVMIDPDAPSPSEPSMREWLHWLVVNIPGGADPSQGKEVVPYMSPRPALGIHRYVLVV  122

Query  402  FRQRE---AMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            F+QR    A+   ++ P  R  FRTR+FA  +GLGLPVAA+YFN+QK+ A+ ++R
Sbjct  123  FQQRAPAPAVAPGEEAPGVRAGFRTREFAKEHGLGLPVAAMYFNAQKEPASRRRR  177



>gb|ACN54544.1| mother of FT and TFL1-like protein variant a [Physcomitrella 
patens]
Length=192

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 122/191 (64%), Gaps = 19/191 (10%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RS+DPLVVGKVIGDV+D FVP V+  + Y S+++ NG ++ PS+ AQ P + ++ +    
Sbjct  3    RSIDPLVVGKVIGDVIDTFVPSVDMAIHYSSRQVTNGCQMKPSATAQAPEIQLSDNSEGN  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASK------------------GRE  341
            N YTLIM DPDAPSPSEP+ REWLHW+VTDIP  S  S+                  GRE
Sbjct  63   NYYTLIMTDPDAPSPSEPSLREWLHWIVTDIPGNSGGSETTSGFSWLQEQVTHTSSSGRE  122

Query  342  VAEYIGPSPPTGIHRYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYF  521
            +  Y+GP PP GIHRY F LF+Q  +      PP  R NF TR FA+  GLGLPVAA Y 
Sbjct  123  LVPYMGPRPPIGIHRYAFILFKQ-PSTPFLISPPTVRNNFSTRNFASHYGLGLPVAATYC  181

Query  522  NSQKQSATNKK  554
            N+QK+  + ++
Sbjct  182  NAQKEPGSRRR  192



>gb|AGY34592.1| MFT-A1 [Triticum turgidum subsp. durum]
Length=175

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 123/175 (70%), Gaps = 3/175 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R VDPLVVG+VIG+V+DMFVP V   V YG++ ++NG  + PS AA +P V I+G     
Sbjct  3    RFVDPLVVGRVIGEVVDMFVPSVAMAVAYGARDLSNGCHVKPSLAADQPLVRISGR--RN  60

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTL+M DPDAPSPSEPT +E+LHW+V +IP G+DA+KG  V  Y+GP PP GIHRY  
Sbjct  61   DLYTLVMTDPDAPSPSEPTMKEYLHWIVVNIPGGTDATKGEVVVPYMGPRPPVGIHRYEL  120

Query  396  ALFRQREAM-QVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
             LF Q+     V    P+ R  F TR FAA + LGLPVA +YFNSQK+ + +++R
Sbjct  121  VLFEQKTRFPCVPAASPDDRAYFNTRAFAANHELGLPVAVVYFNSQKEPSGHRRR  175



>gb|EAY84662.1| hypothetical protein OsI_06032 [Oryza sativa Indica Group]
Length=174

 Score =   194 bits (494),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 122/174 (70%), Gaps = 3/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R VDPLVVG+VIG+V+D+FVP +  T  YG + I+NG  + PS+A   P V I+G     
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSISMTAAYGDRDISNGCLVRPSAADYPPLVRISGR--RN  60

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTLIM DPDAPSPS+P+ RE+LHW+V +IP G+DASKG E+ EY+GP P  GIHRYV 
Sbjct  61   DLYTLIMTDPDAPSPSDPSMREFLHWIVVNIPGGTDASKGEEMVEYMGPRPTVGIHRYVL  120

Query  396  ALFRQR-EAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF Q+   +  A  PP  R NF TR FAA + LGLP A +YFNSQ++ A  ++
Sbjct  121  VLFEQKARFVDGALMPPADRPNFNTRAFAAYHQLGLPTAVVYFNSQREPANRRR  174



>gb|KHN21660.1| Protein MOTHER of FT and TF 1 [Glycine soja]
Length=200

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 127/180 (71%), Gaps = 9/180 (5%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQ---KPSVHINGSPA  209
            SVDPLVVG+VIGDV+DMF+P V  +V +GSK + NG +I PS A     +PS+ I+    
Sbjct  22   SVDPLVVGRVIGDVVDMFIPSVNMSVYFGSKHVTNGCDIKPSIAISPPTRPSIAISPPKL  81

Query  210  S-----PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPT  374
            +      NLYTL+M DPDAPSPSEP+ REW+HW+V DIP G++  +G+E+  Y+GP PP 
Sbjct  82   TLTGNMDNLYTLVMTDPDAPSPSEPSMREWIHWIVVDIPGGTNPFRGKEIVSYVGPRPPI  141

Query  375  GIHRYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            GIHRY+F LF+Q+  + + ++ P +R +F TR FA    LGLPVA +YFNSQK+ A  ++
Sbjct  142  GIHRYIFVLFQQKGPLGLVEQLP-TRASFNTRYFARQLDLGLPVATVYFNSQKEPAVKRR  200



>gb|AID67173.1| MFT2-like protein, partial [Picea abies]
 gb|AID67174.1| MFT2-like protein, partial [Picea abies]
 gb|AID67175.1| MFT2-like protein, partial [Picea abies]
 gb|AID67176.1| MFT2-like protein, partial [Picea abies]
 gb|AID67178.1| MFT2-like protein, partial [Picea abies]
 gb|AID67179.1| MFT2-like protein, partial [Picea abies]
 gb|AID67180.1| MFT2-like protein, partial [Picea abies]
 gb|AID67181.1| MFT2-like protein, partial [Picea abies]
 gb|AID67183.1| MFT2-like protein, partial [Picea abies]
 gb|AID67185.1| MFT2-like protein, partial [Picea abies]
 gb|AID67186.1| MFT2-like protein, partial [Picea abies]
 gb|AID67187.1| MFT2-like protein, partial [Picea abies]
 gb|AID67189.1| MFT2-like protein, partial [Picea abies]
 gb|AID67190.1| MFT2-like protein, partial [Picea abies]
 gb|AID67191.1| MFT2-like protein, partial [Picea abies]
 gb|AID67192.1| MFT2-like protein, partial [Picea abies]
 gb|AID67193.1| MFT2-like protein, partial [Picea abies]
 gb|AID67194.1| MFT2-like protein, partial [Picea abies]
 gb|AID67197.1| MFT2-like protein, partial [Picea abies]
 gb|AID67198.1| MFT2-like protein, partial [Picea abies]
 gb|AID67199.1| MFT2-like protein, partial [Picea abies]
 gb|AID67200.1| MFT2-like protein, partial [Picea abies]
 gb|AID67201.1| MFT2-like protein, partial [Picea abies]
 gb|AID67202.1| MFT2-like protein, partial [Picea abies]
 gb|AID67203.1| MFT2-like protein, partial [Picea abies]
 gb|AID67204.1| MFT2-like protein, partial [Picea abies]
 gb|AID67205.1| MFT2-like protein, partial [Picea abies]
 gb|AID67206.1| MFT2-like protein, partial [Picea abies]
 gb|AID67207.1| MFT2-like protein, partial [Picea abies]
 gb|AID67208.1| MFT2-like protein, partial [Picea abies]
 gb|AID67209.1| MFT2-like protein, partial [Picea abies]
 gb|AID67211.1| MFT2-like protein, partial [Picea abies]
 gb|AID67212.1| MFT2-like protein, partial [Picea abies]
 gb|AID67213.1| MFT2-like protein, partial [Picea abies]
 gb|AID67214.1| MFT2-like protein, partial [Picea abies]
 gb|AID67215.1| MFT2-like protein, partial [Picea abies]
 gb|AID67216.1| MFT2-like protein, partial [Picea abies]
 gb|AID67217.1| MFT2-like protein, partial [Picea abies]
 gb|AID67218.1| MFT2-like protein, partial [Picea abies]
 gb|AID67219.1| MFT2-like protein, partial [Picea abies]
 gb|AID67221.1| MFT2-like protein, partial [Picea abies]
 gb|AID67222.1| MFT2-like protein, partial [Picea abies]
 gb|AID67223.1| MFT2-like protein, partial [Picea abies]
 gb|AID67224.1| MFT2-like protein, partial [Picea abies]
 gb|AID67225.1| MFT2-like protein, partial [Picea abies]
 gb|AID67226.1| MFT2-like protein, partial [Picea abies]
 gb|AID67227.1| MFT2-like protein, partial [Picea abies]
 gb|AID67228.1| MFT2-like protein, partial [Picea abies]
 gb|AID67230.1| MFT2-like protein, partial [Picea abies]
 gb|AID67231.1| MFT2-like protein, partial [Picea abies]
 gb|AID67232.1| MFT2-like protein, partial [Picea abies]
 gb|AID67234.1| MFT2-like protein, partial [Picea abies]
 gb|AID67235.1| MFT2-like protein, partial [Picea abies]
 gb|AID67236.1| MFT2-like protein, partial [Picea abies]
 gb|AID67238.1| MFT2-like protein, partial [Picea abies]
 gb|AID67239.1| MFT2-like protein, partial [Picea abies]
 gb|AID67240.1| MFT2-like protein, partial [Picea abies]
 gb|AID67242.1| MFT2-like protein, partial [Picea abies]
 gb|AID67245.1| MFT2-like protein, partial [Picea abies]
 gb|AID67246.1| MFT2-like protein, partial [Picea abies]
 gb|AID67247.1| MFT2-like protein, partial [Picea abies]
 gb|AID67248.1| MFT2-like protein, partial [Picea abies]
 gb|AID67249.1| MFT2-like protein, partial [Picea abies]
 gb|AID67250.1| MFT2-like protein, partial [Picea abies]
 gb|AID67251.1| MFT2-like protein, partial [Picea abies]
 gb|AID67252.1| MFT2-like protein, partial [Picea abies]
 gb|AID67253.1| MFT2-like protein, partial [Picea abies]
 gb|AID67255.1| MFT2-like protein, partial [Picea abies]
 gb|AID67256.1| MFT2-like protein, partial [Picea abies]
 gb|AID67257.1| MFT2-like protein, partial [Picea abies]
 gb|AID67258.1| MFT2-like protein, partial [Picea abies]
 gb|AID67259.1| MFT2-like protein, partial [Picea abies]
 gb|AID67260.1| MFT2-like protein, partial [Picea abies]
 gb|AID67261.1| MFT2-like protein, partial [Picea abies]
 gb|AID67262.1| MFT2-like protein, partial [Picea abies]
Length=158

 Score =   193 bits (491),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RSVDPLVVG V+GDV+D+FV   + TV YG K++ NG EI PS+   +P++ I G     
Sbjct  3    RSVDPLVVGNVVGDVIDIFVRAADMTVHYGPKQVTNGCEIKPSATVHRPNLQIAGRHFDD  62

Query  216  N-LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
            N L+TL+M DPDAPSPSEP  REWLHW+VTDIP  +DAS+GRE+  Y+GP PP GIHRYV
Sbjct  63   NKLFTLVMTDPDAPSPSEPNMREWLHWIVTDIPGAADASQGREIVPYMGPRPPIGIHRYV  122

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLP  503
            F  FRQ++ M V    P+ R NF TR FAA  GLGLP
Sbjct  123  FVAFRQQDPM-VMMMAPQVRHNFSTRAFAAQYGLGLP  158



>ref|XP_003631075.1| Protein MOTHER of FT and TF [Medicago truncatula]
 gb|ABE80135.1| PEBP [Medicago truncatula]
Length=172

 Score =   194 bits (492),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 121/172 (70%), Gaps = 3/172 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMF+P V  +V +G K + NG +I PS A   P V + G+    N
Sbjct  4    SVDPLVVGRVIGDVVDMFIPSVGMSVYFGPKHVTNGCDIKPSMAINPPKVTLTGN--MDN  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ RE +HW+V DIP G++  +G+E+  YIGP PP GIHRY+  
Sbjct  62   LYTLVMTDPDAPSPSEPSMRELIHWIVVDIPGGTNPKRGKEILPYIGPKPPVGIHRYILV  121

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LF Q+  + + ++ P SR +F TR FA+   LGLPVA +YFNSQK+    ++
Sbjct  122  LFEQKGPIGMVEQ-PTSRVSFNTRYFASQMNLGLPVATVYFNSQKEPQAKRR  172



>gb|EMT22371.1| hypothetical protein F775_09897 [Aegilops tauschii]
Length=180

 Score =   194 bits (493),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 123/178 (69%), Gaps = 9/178 (5%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            VDPLVVG+VIGDV+DMFVP +  TV +G+K + NG EI PS A   PS+ I G   + +L
Sbjct  5    VDPLVVGRVIGDVVDMFVPTMPVTVRFGTKDLTNGCEIKPSIADAAPSIQIAGR--AGDL  62

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            +TL+M DPDAPSPSEPT +EWLHW+V +IP GSD S+G EV  Y+GP PP GIHRYV  L
Sbjct  63   FTLVMTDPDAPSPSEPTMKEWLHWLVVNIPGGSDPSQGEEVVPYMGPKPPLGIHRYVLVL  122

Query  402  FRQREAMQVAQKP------PESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            F+Q+ A  +A  P         R  F  R FA  + LGLPVAA+YFN+QK+ A  ++R
Sbjct  123  FQQK-ARVLAPAPGGDTAASAMRARFGPRAFAERHDLGLPVAAMYFNAQKEPANRRRR  179



>gb|AET05551.2| mother of FT and TFL1-like protein [Medicago truncatula]
Length=173

 Score =   194 bits (492),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 121/172 (70%), Gaps = 3/172 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMF+P V  +V +G K + NG +I PS A   P V + G+    N
Sbjct  5    SVDPLVVGRVIGDVVDMFIPSVGMSVYFGPKHVTNGCDIKPSMAINPPKVTLTGN--MDN  62

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ RE +HW+V DIP G++  +G+E+  YIGP PP GIHRY+  
Sbjct  63   LYTLVMTDPDAPSPSEPSMRELIHWIVVDIPGGTNPKRGKEILPYIGPKPPVGIHRYILV  122

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LF Q+  + + ++ P SR +F TR FA+   LGLPVA +YFNSQK+    ++
Sbjct  123  LFEQKGPIGMVEQ-PTSRVSFNTRYFASQMNLGLPVATVYFNSQKEPQAKRR  173



>ref|XP_004503299.1| PREDICTED: protein MOTHER of FT and TF 1-like [Cicer arietinum]
Length=173

 Score =   193 bits (491),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 122/172 (71%), Gaps = 3/172 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMF+P V  +V +G K + NG +I PS A   P V + G+    N
Sbjct  5    SVDPLVVGRVIGDVVDMFIPSVGMSVYFGPKHVTNGCDIKPSIAINPPRVTLTGN--IDN  62

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ RE +HW+V DIP G++  +G+E+  YIGP PP GIHR++  
Sbjct  63   LYTLVMTDPDAPSPSEPSMRELIHWIVVDIPGGTNPKRGKEILPYIGPKPPVGIHRFILV  122

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LF+Q+  M + ++ P SR +F TR FA+   LGLPVA +YFNSQK+    ++
Sbjct  123  LFKQKGPMGLVEQ-PTSRVSFNTRYFASQLDLGLPVATVYFNSQKEPQAKRR  173



>gb|AID67177.1| MFT2-like protein, partial [Picea abies]
Length=158

 Score =   192 bits (489),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RSVDPLVVG V+GDV+D+FV   + TV YG K++ NG EI PS+   +P++ I G     
Sbjct  3    RSVDPLVVGNVVGDVIDIFVRAADMTVHYGPKQVTNGXEIKPSATVHRPNLQIAGRHFDD  62

Query  216  N-LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
            N L+TL+M DPDAPSPSEP  REWLHW+VTDIP  +DAS+GRE+  Y+GP PP GIHRYV
Sbjct  63   NKLFTLVMTDPDAPSPSEPNMREWLHWIVTDIPGAADASQGREIVPYMGPRPPIGIHRYV  122

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLP  503
            F  FRQ++ M V    P+ R NF TR FAA  GLGLP
Sbjct  123  FVAFRQQDPM-VMMMAPQVRHNFSTRAFAAQYGLGLP  158



>ref|XP_006643665.1| PREDICTED: protein MOTHER of FT and TF 1-like [Oryza brachyantha]
Length=174

 Score =   193 bits (491),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 120/174 (69%), Gaps = 3/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R VDPLVVG+VIG+V+D+FVP +  T  YG + I+NG    PS+A   P V I+G     
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSISMTAAYGDRDISNGCLGRPSAAXXPPLVRISGR--RN  60

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTLIM DPDAPSPS+P+ RE+LHW+V +IP G+DA KG  + EY+GP PP GIHRYV 
Sbjct  61   HLYTLIMTDPDAPSPSDPSMREYLHWIVVNIPGGTDAFKGEAMVEYMGPRPPVGIHRYVL  120

Query  396  ALFRQR-EAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF Q+   +  A  PP  R NF TR FAA + LGLP A +YFNSQ++ A  ++
Sbjct  121  VLFEQKARFVDGAMMPPAGRANFNTRAFAAHHQLGLPTAVVYFNSQREPANRRR  174



>ref|NP_001236597.1| brother of FT and TFL1 protein [Glycine max]
 gb|ABS57463.1| brother of FT and TFL1 protein [Glycine max]
 gb|ACU00125.1| terminal flowering 1-like protein 3 [Glycine max]
 gb|ACU15487.1| unknown [Glycine max]
 gb|KHN31520.1| CEN-like protein 1 [Glycine soja]
Length=172

 Score =   193 bits (490),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 122/173 (71%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R ++PLVVG+VIG+V+D+F P V+  V Y +K++ANG E+ PS+   KP V I G     
Sbjct  3    RLMEPLVVGRVIGEVVDIFSPSVKMNVTYSTKQVANGHELMPSTIMAKPRVEIGGDDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
              YTLIM DPDAPSPS+P  RE LHW+VTDIP  +D S G+E+  Y  P P  GIHRYVF
Sbjct  62   TAYTLIMTDPDAPSPSDPCLREHLHWMVTDIPGTTDVSFGKEIVGYESPKPVIGIHRYVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+QR    V  +PP SR +F TR+F+  NGLGLPVAA+YFN+Q+++A  ++
Sbjct  122  ILFKQRGRQTV--RPPSSRDHFNTRRFSEENGLGLPVAAVYFNAQRETAARRR  172



>ref|XP_008240174.1| PREDICTED: protein MOTHER of FT and TF 1 [Prunus mume]
Length=178

 Score =   193 bits (491),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 125/179 (70%), Gaps = 10/179 (6%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP V  +V +GSK + NG +I PS A   P + ++G P    
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTVNMSVYFGSKHVTNGCDIKPSMAINPPKITVSGQPG--E  61

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKG------REVAEYIGPSPPTGI  380
            LYTL+M DPDAPSPSEP+ REW+HW+V DIP G+   +G      +++  Y+GP PP GI
Sbjct  62   LYTLVMTDPDAPSPSEPSMREWVHWIVADIPGGTSPVRGKIFTLYKKILAYVGPRPPVGI  121

Query  381  HRYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            HRY+  LF+Q+  M + ++   SR +F TR FAA   LGLPV+ +YFNSQK+ A N++R
Sbjct  122  HRYILVLFQQKGPMGLVEQ-QSSRAHFNTRFFAAQLDLGLPVSTVYFNSQKEPA-NRRR  178



>gb|AID67220.1| MFT2-like protein, partial [Picea abies]
 gb|AID67237.1| MFT2-like protein, partial [Picea abies]
Length=158

 Score =   192 bits (487),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RSVDPLVVG V+GDV+D+FV   + TV YG K++ NG EI PS+   +P++ I G     
Sbjct  3    RSVDPLVVGNVVGDVIDIFVRAADMTVHYGPKQVTNGCEIKPSATVHRPNLQIAGRHFDD  62

Query  216  N-LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
            N L+TL+M DPDAPSPSEP  REWLHW+VTDIP  +DAS+GRE+  Y+GP PP GIHRYV
Sbjct  63   NKLFTLVMTDPDAPSPSEPNMREWLHWIVTDIPGAADASQGREIVPYMGPRPPIGIHRYV  122

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLP  503
            F  FRQ++ M V    P+ R NF TR F A  GLGLP
Sbjct  123  FVAFRQQDPM-VMMMAPQVRHNFSTRAFXAQYGLGLP  158



>gb|AID67210.1| MFT2-like protein, partial [Picea abies]
 gb|AID67243.1| MFT2-like protein, partial [Picea abies]
Length=157

 Score =   192 bits (487),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RSVDPLVVG V+GDV+D+FV   + TV YG K++ NG EI PS+   +P++ I G     
Sbjct  3    RSVDPLVVGNVVGDVIDIFVRAADMTVHYGPKQVTNGCEIKPSATVHRPNLQIAGRHFDD  62

Query  216  N-LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
            N L+TL+M DPDAPSPSEP  REWLHW+VTDIP  +DAS+GRE+  Y+GP PP GIHRYV
Sbjct  63   NKLFTLVMTDPDAPSPSEPNMREWLHWIVTDIPGAADASQGREIVPYMGPRPPIGIHRYV  122

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGL  500
            F  FRQ++ M V    P+ R NF TR FAA  GLGL
Sbjct  123  FVAFRQQDPM-VMMMAPQVRHNFSTRAFAAQYGLGL  157



>ref|NP_001041806.1| Os01g0111600 [Oryza sativa Japonica Group]
 dbj|BAB39886.1| putative SP2G [Oryza sativa Japonica Group]
 dbj|BAF03720.1| Os01g0111600 [Oryza sativa Japonica Group]
 dbj|BAG98997.1| unnamed protein product [Oryza sativa Japonica Group]
Length=174

 Score =   191 bits (486),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 122/174 (70%), Gaps = 3/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R VDPLVVG+VIG+V+D+FVP +  T  YG + I+NG  + PS+A   P V I+G     
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSISMTAAYGDRDISNGCLVRPSAADYPPLVRISGR--RN  60

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +LYTLIM DPDAPSPS+P+ RE+LHW+V +IP G+DASKG E+ EY+GP P  GIHRYV 
Sbjct  61   DLYTLIMTDPDAPSPSDPSMREFLHWIVVNIPGGTDASKGEEMVEYMGPRPTVGIHRYVL  120

Query  396  ALFRQR-EAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             L+ Q+   +  A  PP  R NF TR FAA + LGLP A ++FNSQ++ A  ++
Sbjct  121  VLYEQKARFVDGALMPPADRPNFNTRAFAAYHQLGLPTAVVHFNSQREPANRRR  174



>ref|XP_010274753.1| PREDICTED: protein MOTHER of FT and TF 1-like [Nelumbo nucifera]
Length=222

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 125/175 (71%), Gaps = 8/175 (5%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            +VDPLVVG+VIGDV+DMFVP V  +  +G++ I NG +I PS A   P V ++G   + +
Sbjct  51   AVDPLVVGRVIGDVVDMFVPTVTMSAYFGTEHITNGCDIKPSMAVNPPKVVVSGR--NDD  108

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPS+PT REW+HW+V DIP G++  +G+++  Y+GP P  GIHRY+  
Sbjct  109  LYTLVMTDPDAPSPSQPTMREWVHWIVVDIPGGTNPIRGKDIMPYVGPQPSVGIHRYILV  168

Query  399  LFRQ----REAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNK  551
            LF Q    ++++Q+ Q  P +R NF TR+FA  + LGLPVA +YFN+QK+ A  K
Sbjct  169  LFSQKNPVKDSIQLQQ--PATRVNFNTREFAKQHDLGLPVATVYFNAQKELANEK  221



>ref|XP_010523529.1| PREDICTED: protein BROTHER of FT and TFL 1 [Tarenaya hassleriana]
Length=175

 Score =   191 bits (485),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 119/174 (68%), Gaps = 2/174 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYG-SKKIANGVEITPSSAAQKPSVHINGSPAS  212
            R ++PLVVG+V+GDV++ F P V   V Y   K++ANG E+ PSS   KP V I G    
Sbjct  3    REIEPLVVGRVVGDVIERFNPSVTMRVTYNLDKQVANGHELMPSSFIYKPRVEIGGDDMR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + YTLIMVDPDAPSPS+P  RE+LHW+VTDIP  +DAS G+E+  Y  P P  GIHRYV
Sbjct  63   -SFYTLIMVDPDAPSPSDPYLREYLHWMVTDIPGTTDASFGKEIVSYETPKPVVGIHRYV  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LFRQ    Q  + PP SR  F TR F A  GLGLPVAA+YFN+Q+++A  ++
Sbjct  122  FVLFRQMRGRQTVKLPPPSRQCFNTRGFCAYFGLGLPVAAVYFNAQRETAPRRR  175



>gb|KDP42735.1| hypothetical protein JCGZ_23675 [Jatropha curcas]
 gb|AID51387.1| terminal flower 1b [Jatropha curcas]
 gb|AID51393.1| terminal flower 1b [Jatropha curcas]
Length=173

 Score =   191 bits (484),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 122/173 (71%), Gaps = 2/173 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            + VDPL+V +VIGDVLD+F P ++ +V Y  +K+ NG E+ PS+ A KP V + G     
Sbjct  3    KPVDPLIVERVIGDVLDLFTPTIKMSVAYTDRKVCNGHELYPSTIASKPKVAVEGDDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            + +TL+M DPD P PS+P  RE LHW+V+DIP  +DA+ G+E+  Y  P P  GIHR+VF
Sbjct  62   SFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDATFGKEIVSYEIPRPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q++  Q+ Q PP SR NF TR FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  VLFKQKKRSQI-QHPPWSRDNFNTRNFAAENELGLPVAAVYFNAQRETAARRR  173



>gb|AID67196.1| MFT2-like protein, partial [Picea abies]
Length=156

 Score =   189 bits (481),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 111/155 (72%), Gaps = 2/155 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RSVDPLVVG V+GDV+D+FV   + TV YG K++ NG EI PS+   +P++ I G     
Sbjct  3    RSVDPLVVGNVVGDVIDIFVRAADMTVHYGPKQVTNGCEIKPSATVHRPNLQIAGRHFDD  62

Query  216  N-LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
            N L+TL+M DPDAPSPSEP  REWLHW+VTDIP  +DAS+GRE+  Y+GP PP GIHRYV
Sbjct  63   NKLFTLVMTDPDAPSPSEPNMREWLHWIVTDIPGAADASQGREIVPYMGPRPPIGIHRYV  122

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLG  497
            F  FRQ++ M V    P+ R NF TR FAA  GLG
Sbjct  123  FVAFRQQDPM-VMMMAPQVRHNFSTRAFAAQYGLG  156



>gb|AEO72023.1| TFL1-like protein [Prunus yedoensis]
Length=172

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 115/173 (66%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R+ +PLVVG+VIGDVLD F P  + +V Y +K + NG E+ PS+   KP V I G     
Sbjct  3    RTSEPLVVGRVIGDVLDCFTPTTKMSVTYNTKLVCNGYELYPSAVTTKPRVEIQGGDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
              +TLIM DPD P+PS+P  RE LHW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF
Sbjct  62   TFFTLIMTDPDVPAPSDPYLREHLHWIVTDIPGTTDATFGREVMSYEMPRPDIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q+    V   PP SR +F  R FAA N LGLPVAA+YFN Q+++A  ++
Sbjct  122  VLFKQKRRQSV--NPPSSRDHFSARSFAAENDLGLPVAAVYFNCQRETAARRR  172



>ref|XP_010244607.1| PREDICTED: CEN-like protein 2 [Nelumbo nucifera]
Length=176

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 125/180 (69%), Gaps = 5/180 (3%)
 Frame = +3

Query  18   MANANPRSVDPLVVGKVIGDVLDMFVPVVEFTVDYGS-KKIANGVEITPSSAAQKPSVHI  194
            MAN N R ++PL+VG+VIGDVLD F P V+ TV Y S K++ NG E  PSS   KP V +
Sbjct  1    MAN-NARMLEPLIVGRVIGDVLDSFSPTVKMTVTYNSNKQVCNGHEFYPSSITTKPRVEV  59

Query  195  NGSPASPNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPT  374
            +G     + +T++M DPDAP PS+P  RE LHW+VTDIP  +DA+ GRE+  Y  P P  
Sbjct  60   HGGDMR-SFFTVVMTDPDAPGPSDPYLREHLHWIVTDIPGTTDATFGRELVGYEIPKPYI  118

Query  375  GIHRYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            GIHRYVF LF+Q+    V   PP SR +FRTR+FA  N LGLPVAA++FN+Q+++A  ++
Sbjct  119  GIHRYVFVLFKQKGRQTVT--PPSSRDHFRTRKFAEENNLGLPVAAVFFNAQRETAARRR  176



>gb|AFW79811.1| hypothetical protein ZEAMMB73_034486 [Zea mays]
Length=190

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 126/192 (66%), Gaps = 23/192 (12%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDY-GSKKIANGVEITPSSAAQKPSVHINGSPAS  212
            R VDPLVVG+VIG+V+D+FVP +  TV Y G K I+NG  + PS+ A  P V I+G    
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSISMTVAYDGPKDISNGCLLKPSATAAPPLVRISGR--R  60

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASK------------------GR  338
             +LYTLIM DPDAPSPS PT RE+LHW+V +IP G+DA+K                  G 
Sbjct  61   NDLYTLIMTDPDAPSPSNPTMREYLHWIVINIPGGTDATKAHAKRRHRSALTRAGVGAGE  120

Query  339  EVAEYIGPSPPTGIHRYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALY  518
            EV EY+GP PP GIHRYV  LF Q+   +V  + P  R NF+TR FAAA+ LGLP A +Y
Sbjct  121  EVVEYMGPRPPVGIHRYVLVLFEQK--TRVHAEAPGDRANFKTRAFAAAHELGLPTAVVY  178

Query  519  FNSQKQSATNKK  554
            FN+QK+ A+ ++
Sbjct  179  FNAQKEPASRRR  190



>gb|ACN54549.1| mother of FT and TFL1-like protein, partial [Selaginella erythropus]
Length=146

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 107/148 (72%), Gaps = 2/148 (1%)
 Frame = +3

Query  75   DVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNLYTLIMVDPDAP  254
            DVLDMFVP VE +V YGSK++ NG E+ PS+   +P V +  +P    LYTL+MVDPDAP
Sbjct  1    DVLDMFVPAVEMSVCYGSKQVNNGCELKPSATQARPLVQVGSAPEEGALYTLVMVDPDAP  60

Query  255  SPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFALFRQREAMQVAQ  434
            SPSEP+ REW+HW+V DIP G+DAS+GRE+ +YIGP PPTGIHRYVF +FRQ     V  
Sbjct  61   SPSEPSMREWVHWIVADIPSGADASQGREILQYIGPKPPTGIHRYVFVVFRQMGP--VLM  118

Query  435  KPPESRGNFRTRQFAAANGLGLPVAALY  518
             PP  R NF TR FA    LGLPV A+Y
Sbjct  119  LPPLMRNNFSTRWFAQEYFLGLPVGAVY  146



>ref|XP_010543489.1| PREDICTED: protein TERMINAL FLOWER 1 [Tarenaya hassleriana]
Length=199

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 122/175 (70%), Gaps = 3/175 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R+++PL+VG+VIGDVLD F P ++ TV Y  K++ NG E+ PSS +  P VHI+G+    
Sbjct  26   RAIEPLIVGRVIGDVLDFFTPSIKMTVSYSKKQVCNGHELLPSSLSSAPRVHIHGADLR-  84

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            + +TL+MVDPD P PS+P  RE LHW+VT+IP  +DA+ G+EV  Y  P P  GIHRYVF
Sbjct  85   SFFTLVMVDPDVPGPSDPYLREHLHWIVTNIPGTTDATFGKEVVSYEVPRPSIGIHRYVF  144

Query  396  ALFRQREAMQVAQKPPE--SRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+QR+   V        SR +F TR+F A + LGLPVAA+YFN+Q+++A  ++
Sbjct  145  VLFKQRQRHVVTSTTNSVPSRDHFNTRRFVAEHDLGLPVAAVYFNAQRETAARRR  199



>ref|XP_003568618.1| PREDICTED: protein MOTHER of FT and TF 1-like [Brachypodium distachyon]
Length=181

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 124/178 (70%), Gaps = 8/178 (4%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            VDPLV+G+VIG+V+D FVP +  +V +G++ + NG EI PS AA  P V I G     +L
Sbjct  5    VDPLVLGRVIGEVVDRFVPTMVLSVRFGTRDLTNGCEIKPSVAAAAPVVQIAGRVG--DL  62

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            +TL+M+DPDAPSPSEP+ REWLHW+V +IP G+D S+G+EV  Y+ P P  GIHRYV  +
Sbjct  63   FTLVMIDPDAPSPSEPSMREWLHWLVVNIPGGADPSQGQEVVSYMSPRPALGIHRYVLVV  122

Query  402  FRQREAMQV------AQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            F+QR  ++        ++ P  R  F TR FA  + LGLPV A+YFN+QK+ A++++R
Sbjct  123  FQQRAPVEAPPAVAPGEEAPGLRMGFSTRDFAKRHNLGLPVTAMYFNAQKERASHRRR  180



>ref|XP_011076204.1| PREDICTED: CEN-like protein 1 [Sesamum indicum]
Length=173

 Score =   189 bits (479),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 119/174 (68%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGS-KKIANGVEITPSSAAQKPSVHINGSPAS  212
            R +DPL VG+VIG+V+D F+P V+ TV + S K+++NG E+ PS    KP V I G    
Sbjct  3    RQLDPLSVGRVIGEVVDSFIPCVKLTVTFNSNKQVSNGHELMPSVITSKPRVEIGGEDLR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
               YTL+M DPD P PS+P  RE LHW+VTDIP  +DAS GRE+  Y  P P  GIHRYV
Sbjct  63   AA-YTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREIVSYETPKPVIGIHRYV  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LFRQ+    V  +PP SR  F TR+FA  NGLGLPVAA+YFN+Q+++A  ++
Sbjct  122  FLLFRQKARHTV--RPPASRDLFNTRRFAEENGLGLPVAAVYFNAQRETACRRR  173



>ref|XP_008241250.1| PREDICTED: CEN-like protein 2 [Prunus mume]
 dbj|BAJ14521.1| TFL1-like protein [Prunus mume]
 gb|AEO72021.1| TFL1-like protein [Prunus mume]
Length=172

 Score =   188 bits (478),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 113/173 (65%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R  +PLVVG+VIGDVLD F P  + +V Y ++ + NG E+ PS+   KP V I G     
Sbjct  3    RMSEPLVVGRVIGDVLDCFTPTTKMSVTYNTRLVCNGYELYPSAVTTKPRVEIQGGDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
              +TLIM DPD P PS+P  RE LHW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF
Sbjct  62   TFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+QR    V   PP SR +F  R FAA N LGLPVAA+YFN Q+++A  ++
Sbjct  122  VLFKQRRRQSV--NPPSSRDHFSARSFAAENDLGLPVAAVYFNCQRETAARRR  172



>ref|XP_002528731.1| phosphatidylethanolamine-binding protein, putative [Ricinus communis]
 gb|EEF33643.1| phosphatidylethanolamine-binding protein, putative [Ricinus communis]
Length=173

 Score =   188 bits (478),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 118/174 (68%), Gaps = 3/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R+V+ LVVG+VIGDV+D F P++  ++ YG++++ NG E+ PS  A KP V + G     
Sbjct  3    RAVESLVVGRVIGDVVDSFTPMLNMSISYGNRRVFNGYELHPSLVALKPKVEVQGGDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
              +TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF
Sbjct  62   TFFTLVMTDPDVPGPSDPYLREHLHWLVTDIPGTTDATFGREVVTYEIPRPTIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
             LF+Q+    +   PP SR NF TR FA  N LGLPVAA+YFN+Q+++A   +R
Sbjct  122  VLFQQKRRQTI--NPPSSRDNFSTRDFAVGNDLGLPVAAIYFNAQRETAARSRR  173



>gb|AID67184.1| MFT2-like protein, partial [Picea abies]
 gb|AID67188.1| MFT2-like protein, partial [Picea abies]
 gb|AID67195.1| MFT2-like protein, partial [Picea abies]
 gb|AID67233.1| MFT2-like protein, partial [Picea abies]
 gb|AID67241.1| MFT2-like protein, partial [Picea abies]
Length=155

 Score =   187 bits (476),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RSVDPLVVG V+GDV+D+FV   + TV YG K++ NG EI PS+   +P++ I G     
Sbjct  3    RSVDPLVVGNVVGDVIDIFVRAADMTVHYGPKQVTNGCEIKPSATVHRPNLQIAGRHFDD  62

Query  216  N-LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
            N L+TL+M DPDAPSPSEP  REWLHW+VTDIP  +DAS+GRE+  Y+GP PP GIHRYV
Sbjct  63   NKLFTLVMTDPDAPSPSEPNMREWLHWIVTDIPGAADASQGREIVPYMGPRPPIGIHRYV  122

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGL  494
            F  FRQ++ M V    P+ R NF TR FAA  GL
Sbjct  123  FVAFRQQDPM-VMMMAPQVRHNFSTRAFAAQYGL  155



>ref|XP_006587343.1| PREDICTED: CEN-like protein 1-like isoform X2 [Glycine max]
Length=173

 Score =   188 bits (477),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 116/169 (69%), Gaps = 3/169 (2%)
 Frame = +3

Query  48   PLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNLYT  227
            PLVVG+VIG+V+D+F P V   V Y +K++ANG E+ PS+   KP V I G       YT
Sbjct  8    PLVVGRVIGEVVDIFSPSVRMNVTYSTKQVANGHELMPSTIMAKPRVEIGGDDMR-TAYT  66

Query  228  LIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFALFR  407
            LIM DPDAPSPS+P  RE LHW VTDIP  +D S G+E+  Y  P P  GIHRYVF LF+
Sbjct  67   LIMTDPDAPSPSDPHLREHLHWTVTDIPGTTDVSFGKEIVGYESPKPVIGIHRYVFILFK  126

Query  408  QREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            QR    V  +PP SR +F TR+F+  NGLGLPVA +YFN+Q+++A  ++
Sbjct  127  QRGRQTV--RPPSSRDHFNTRRFSEENGLGLPVAVVYFNAQRETAARRR  173



>ref|XP_006656987.1| PREDICTED: protein MOTHER of FT and TF 1-like [Oryza brachyantha]
Length=176

 Score =   188 bits (477),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 118/172 (69%), Gaps = 3/172 (2%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            VDPLVVG+VIGDV+DMFVP    +V +G+K + NG E+ PS AA  P+V I G   +  L
Sbjct  5    VDPLVVGRVIGDVVDMFVPATAMSVRFGTKDLTNGCELKPSVAAAPPAVQIAGR--ASEL  62

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            +TL+M DPDAPSPSEP+ REWLHW+V +IP G+D S+G  V  Y+GP PP GIHRYV  L
Sbjct  63   FTLVMTDPDAPSPSEPSMREWLHWLVVNIPGGTDPSQGEVVVPYMGPKPPVGIHRYVLVL  122

Query  402  FRQREAM-QVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            FR+   +         +R  F TR FA  +GLGLPVAA YFN+QK+ A  ++
Sbjct  123  FRRGAGVAAPPPDADAARARFSTRAFADRHGLGLPVAATYFNAQKEPANRRR  174



>ref|XP_007027716.1| Centroradialis [Theobroma cacao]
 gb|EOY08218.1| Centroradialis [Theobroma cacao]
Length=172

 Score =   187 bits (476),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 117/173 (68%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R+ +PLVVG+VIGDVLD F+P +  TV + +K++ NG E  PS+ A KP V I G     
Sbjct  3    RAAEPLVVGRVIGDVLDSFIPSITMTVTFNNKRVFNGHEFYPSTVATKPRVEIEGGDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
              +TL+M DPD P PS+P  RE +HW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF
Sbjct  62   TFFTLVMTDPDVPGPSDPYLREHIHWIVTDIPGTTDATFGREVVSYEIPRPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q+    +    P SR NF TR FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  VLFKQKRRQMITS--PSSRDNFSTRGFAAENDLGLPVAAVYFNAQRETAARRR  172



>ref|NP_001276314.1| uncharacterized protein LOC100783608 [Glycine max]
 gb|ACU00126.1| terminal flowering 1-like protein 4 [Glycine max]
Length=173

 Score =   187 bits (476),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 116/169 (69%), Gaps = 3/169 (2%)
 Frame = +3

Query  48   PLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNLYT  227
            PLVVG+VIG+V+D+F P V   V Y +K++ANG E+ PS+   KP V I G       YT
Sbjct  8    PLVVGRVIGEVVDIFSPSVRMNVTYSTKQVANGHELMPSTIMAKPRVEIGGDDMR-TAYT  66

Query  228  LIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFALFR  407
            LIM DPDAPSPS+P  RE LHW VTDIP  +D S G+E+  Y  P P  GIHRYVF LF+
Sbjct  67   LIMTDPDAPSPSDPHLREHLHWTVTDIPGTTDVSFGKEIVGYESPKPVIGIHRYVFILFK  126

Query  408  QREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            QR    V  +PP SR +F TR+F+  NGLGLPVA +YFN+Q+++A  ++
Sbjct  127  QRGRQTV--RPPSSRDHFNTRRFSEENGLGLPVAVVYFNAQRETAARRR  173



>ref|XP_003635936.1| CEN-like protein [Medicago truncatula]
 gb|KEH17361.1| terminal flower 1 [Medicago truncatula]
Length=172

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 118/173 (68%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R ++PL VG+VIG+V+D+F P V   V Y +K++ANG E+ PS    KP V I G     
Sbjct  3    RPLEPLSVGRVIGEVVDIFNPSVRMNVTYSTKQVANGHELMPSIVMNKPRVDIGGEDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            + YTLIM DPDAPSPS+P  RE LHW+VTDIP  +D S G E+ EY  P P  GIHRYVF
Sbjct  62   SAYTLIMTDPDAPSPSDPHLREHLHWMVTDIPGTTDVSFGNEIVEYENPKPVIGIHRYVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+QR    V  + P SR NF TR+F+  N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  ILFKQRGRQTV--RSPSSRDNFNTRRFSQENNLGLPVAAVYFNAQRETAARRR  172



>ref|XP_010101582.1| hypothetical protein L484_015411 [Morus notabilis]
 gb|EXB88721.1| hypothetical protein L484_015411 [Morus notabilis]
Length=169

 Score =   187 bits (474),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 114/170 (67%), Gaps = 3/170 (2%)
 Frame = +3

Query  45   DPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNLY  224
            +PLV+G+VIGDVLD F P  + +V Y  K++ NG E+ PS+   KP V I G       +
Sbjct  3    EPLVIGRVIGDVLDSFTPTTKMSVSYNKKQVCNGHELFPSAVTTKPRVEIQGGDMR-CFF  61

Query  225  TLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFALF  404
            TLIM DPD P PS+P  RE LHW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF LF
Sbjct  62   TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPKPNIGIHRFVFVLF  121

Query  405  RQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            +Q+    V   PP SR +F TR FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  KQKSRQSV--NPPSSRDHFNTRNFAAENDLGLPVAAVYFNAQRETAARRR  169



>dbj|BAJ22383.1| terminal flower 1b [Vigna unguiculata]
Length=172

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 118/173 (68%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R ++PL VG+VIG+V+D+F P V   V Y +K++ANG E+ PS+   KP V I G     
Sbjct  3    RVMEPLSVGRVIGEVVDIFSPSVRMNVTYSTKEVANGHELMPSTVMAKPRVEIGGDDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
              YTLIM DPDAPSPS+P  RE LHW+VTDIP  +D S G+E+  Y  P P  GIHRYVF
Sbjct  62   TAYTLIMTDPDAPSPSDPYLREHLHWMVTDIPGTTDVSFGKEIMGYESPKPVIGIHRYVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+QR    V  + P SR  F TR+F+  NGLGLPVAA+YFN+Q+++A  ++
Sbjct  122  ILFKQRGRQTV--RAPSSRDRFNTRRFSEENGLGLPVAAVYFNAQRETAARRR  172



>ref|XP_010278585.1| PREDICTED: CEN-like protein 1 [Nelumbo nucifera]
Length=173

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 120/174 (69%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGS-KKIANGVEITPSSAAQKPSVHINGSPAS  212
            R ++PL VG+V+G+V+D F P V+ TV Y S K++ NG E+ PS    +P V I G    
Sbjct  3    RILEPLTVGRVVGEVVDFFTPSVKMTVTYYSNKQVCNGHELMPSVITSRPRVEIGGEDLR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
               YTLIM DPDAPSPS P  RE LHW+VTDIP  +D+S GRE+ EY  P P  GIHR+V
Sbjct  63   AA-YTLIMTDPDAPSPSGPYLREHLHWIVTDIPGTTDSSFGREIVEYETPKPVIGIHRFV  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+QR    V  KPP SR +F TR+F+  NGLGLPVAA+YFN+Q+++A  ++
Sbjct  122  FILFKQRGRQTV--KPPASRDHFNTRKFSEENGLGLPVAAVYFNAQRETAARRR  173



>dbj|BAD10971.1| TFL1-like protein [Pseudocydonia sinensis]
Length=172

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 114/173 (66%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R  +PLVVG+VIGDVLD F P    +V Y +K + NG+E+ PS    KP V I G     
Sbjct  3    RVPEPLVVGRVIGDVLDSFTPTTHMSVTYNTKLVCNGLELFPSVVTAKPRVEIQGGELR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            + +TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF
Sbjct  62   SFFTLVMTDPDCPGPSDPYLREHLHWIVTDIPGTTDAAFGREVLSYEMPRPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q+    +   PP SR  F TR FAA N LGLPVAALYFN+Q+++A  ++
Sbjct  122  VLFKQKRRQSI--NPPSSRDCFSTRSFAAENDLGLPVAALYFNAQRENAARRR  172



>ref|XP_008784004.1| PREDICTED: CEN-like protein 2 [Phoenix dactylifera]
Length=173

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 120/174 (69%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKK-IANGVEITPSSAAQKPSVHINGSPAS  212
            R ++PL+VG+VIG+VLD F P V+  V Y S K + NG E  PS+ A KP V + G+   
Sbjct  3    RILEPLIVGRVIGEVLDPFNPSVKMVVTYNSNKLVCNGHEFYPSAVASKPRVEVQGADMR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TL+M DPD P PS+P  RE LHW+VTDIP  +DAS GREV  Y  P P  GIHR+V
Sbjct  63   -SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPRPNIGIHRFV  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q+    VA  PP+SR NF TR+FA  N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  FVLFKQKRRQAVA--PPDSRDNFNTRRFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_004515713.1| PREDICTED: CEN-like protein 1-like [Cicer arietinum]
Length=172

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 117/173 (68%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RS++PL +G+VIG+V+D+F P V   V Y +K++ANG E+ PS    KP V I G     
Sbjct  3    RSLEPLSMGRVIGEVVDIFNPSVRMNVTYSTKQVANGHELLPSIVMNKPRVEIGGDDLR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
              YTLIM DPDAPSPS+P  RE LHW+VTDIP  +D S G+E+ EY  P P  GIHRYVF
Sbjct  62   TAYTLIMTDPDAPSPSDPYLREHLHWMVTDIPGTTDVSFGKEIVEYENPKPVIGIHRYVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+QR    V  + P  R NF TR F+  N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  ILFKQRGRQTV--RSPTFRDNFNTRSFSQQNSLGLPVAAVYFNAQRETAARRR  172



>gb|ABY62770.1| terminal flower 1b [Gossypium hirsutum]
Length=172

 Score =   185 bits (470),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 119/173 (69%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R V+PL+VG+VIGDV+D F+P ++ +V + +K++ NG E  PS+   KP V + G     
Sbjct  3    REVEPLMVGRVIGDVMDSFIPSIKMSVTFNNKQVFNGHEFYPSTVVTKPRVEVVGGDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
              +TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF
Sbjct  62   TFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYENPKPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q+    +  K P SR NF TR+FA+ N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  VLFKQKRRQII--KSPCSRDNFNTRRFASENDLGLPVAAVYFNAQRETAARRR  172



>gb|AID67182.1| MFT2-like protein, partial [Picea abies]
Length=152

 Score =   184 bits (468),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RSVDPLVVG V+GDV+D+FV   + TV YG K++ NG EI PS+   +P++ I G     
Sbjct  3    RSVDPLVVGNVVGDVIDIFVRAADMTVHYGPKQVTNGCEIKPSATVHRPNLQIAGRHFDD  62

Query  216  N-LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
            N L+TL+M DPDAPSPSEP  REWLHW+VTDIP  +DAS+GRE+  Y+GP PP GIHRYV
Sbjct  63   NKLFTLVMTDPDAPSPSEPNMREWLHWIVTDIPGAADASQGREIVPYMGPRPPIGIHRYV  122

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAA  482
            F  FRQ++ M V    P+ R NF TR FAA
Sbjct  123  FVAFRQQDPM-VMMMAPQVRHNFSTRAFAA  151



>dbj|BAD10970.1| TFL1-like protein [Cydonia oblonga]
Length=172

 Score =   185 bits (469),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 113/170 (66%), Gaps = 3/170 (2%)
 Frame = +3

Query  45   DPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNLY  224
            +PLVVG+VIGDVLD F P    +V Y +K + NG+E+ PS    KP V I G     + +
Sbjct  6    EPLVVGRVIGDVLDSFTPTTHMSVTYNTKLVCNGLELFPSVVTAKPRVEIQGGELR-SFF  64

Query  225  TLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFALF  404
            TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF LF
Sbjct  65   TLVMTDPDCPGPSDPYLREHLHWIVTDIPGTTDAAFGREVLSYEMPRPNIGIHRFVFVLF  124

Query  405  RQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            +Q+    +   PP SR  F TR FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  125  KQKRRQSI--NPPSSRDCFSTRSFAAENDLGLPVAAVYFNAQRENAARRR  172



>gb|ABW24964.1| terminal flower 1b [Gossypium hirsutum]
Length=172

 Score =   185 bits (469),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 118/173 (68%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R V+PL+VG+VIGDV+D F+P ++  V + +K++ NG E  PS+   KP V + G     
Sbjct  3    REVEPLMVGRVIGDVMDSFIPSIKMLVTFNNKQVFNGHEFYPSTVVTKPRVEVAGGDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
              +TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF
Sbjct  62   TFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYENPKPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q+    +  K P SR NF TR+FA+ N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  VLFKQKRRQII--KSPCSRDNFNTRRFASENDLGLPVAAVYFNAQRETAARRR  172



>ref|XP_007152319.1| hypothetical protein PHAVU_004G119700g [Phaseolus vulgaris]
 gb|AGV54466.1| terminal flowering 1-like protein [Phaseolus vulgaris]
 gb|ESW24313.1| hypothetical protein PHAVU_004G119700g [Phaseolus vulgaris]
Length=168

 Score =   185 bits (469),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 117/171 (68%), Gaps = 3/171 (2%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            ++PL VG+VIG+V+D+F P V   V Y +K++ANG E+ PS+   KP V I G       
Sbjct  1    MEPLSVGRVIGEVVDIFSPSVRMNVTYSTKEVANGHELMPSTIMAKPRVEIGGDDMR-TA  59

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            YTLIM DPDAPSPS+P  RE LHW+VTDIP  +D S G+EV  Y  P P  GIHRYVF L
Sbjct  60   YTLIMTDPDAPSPSDPYLREHLHWMVTDIPGTTDVSFGKEVMGYESPKPVIGIHRYVFIL  119

Query  402  FRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             +QR    V  +PP SR  F TR+F+  NGLGLPVAA+YFN+Q+++A  ++
Sbjct  120  LKQRGRQTV--RPPSSRDLFNTRRFSEENGLGLPVAAVYFNAQRETAARRR  168



>dbj|BAD10972.1| TFL1-like protein [Eriobotrya japonica]
Length=172

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 113/170 (66%), Gaps = 3/170 (2%)
 Frame = +3

Query  45   DPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNLY  224
            +PLVVG+VIGDVLD F P    +V Y +K + NG+E+ PS    KP V I G     + +
Sbjct  6    EPLVVGRVIGDVLDSFTPTTHMSVTYNAKLVCNGLELFPSVVTAKPRVEIQGGELR-SFF  64

Query  225  TLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFALF  404
            TL+M+DPD P PS+P  RE LHW+VTDIP  +DA+ GRE   Y  P P  GIHR+VF LF
Sbjct  65   TLVMIDPDCPGPSDPYLREHLHWIVTDIPGTADAAFGREALSYEMPRPNIGIHRFVFVLF  124

Query  405  RQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            +Q+    +   PP SR  F TR FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  125  KQKRRQSI--NPPSSRDCFSTRSFAAENDLGLPVAAVYFNAQRETAARRR  172



>ref|NP_001267931.1| TFL1B protein [Vitis vinifera]
 gb|ABI99467.1| TFL1B protein [Vitis vinifera]
 emb|CAN61194.1| hypothetical protein VITISV_028345 [Vitis vinifera]
 emb|CBI30285.3| unnamed protein product [Vitis vinifera]
Length=172

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 118/173 (68%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R ++PL+VG+VIGDVLD F P ++ TV Y +K+I NG E+ PSS   KP V + G     
Sbjct  3    RILEPLIVGRVIGDVLDPFPPTIKMTVTYHNKQICNGYELYPSSITVKPRVEVQGGDLR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            + +TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF
Sbjct  62   SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVLSYEIPKPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q+    V    P SR +F TR FAA N LGLPVAA++FN+Q+++A  ++
Sbjct  122  VLFKQKRRQTV--NTPTSRDHFNTRSFAAENDLGLPVAAVFFNAQRETAARRR  172



>gb|AHZ46122.1| TFL1-like flowering time protein [Saccharum hybrid cultivar]
Length=173

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 116/174 (67%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIA-NGVEITPSSAAQKPSVHINGSPAS  212
            RSV+ LVVG+VIG+VLD F P V   V Y S K+  NG EI PS+   KP V + G    
Sbjct  3    RSVESLVVGRVIGEVLDFFSPCVNMVVTYNSNKLVFNGHEIYPSAVVSKPRVEVQGGDLR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TL+M DPD P PS+P  RE LHW+VTDIP  +DAS GREV  Y  P P  GIHR++
Sbjct  63   -SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPRPSIGIHRFI  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q+    VA   P SR +F TRQFA  N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  FVLFKQKRRQTVAV--PSSRDHFVTRQFAXENDLGLPVAAVYFNAQRETAARRR  173



>gb|ABW24962.1| terminal flower 1b [Gossypium arboreum]
 gb|ABW24969.1| terminal flower 1b [Gossypium arboreum]
Length=172

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 118/173 (68%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R V+PL+VG+VIGDV+D F+P ++ +V + +K++ NG E  PS+   KP V + G     
Sbjct  3    REVEPLMVGRVIGDVMDSFIPSIKMSVTFNNKQVFNGHEFYPSTVVTKPRVEVVGGDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
              +TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF
Sbjct  62   TFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYENPKPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q+    +  K P SR NF TR+FA  N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  VLFKQKRRQII--KSPCSRDNFNTRRFAFENDLGLPVAAVYFNAQRETAARRR  172



>ref|NP_001240029.1| CEN-like protein 2-like [Glycine max]
 gb|ACU00128.1| CENTRORADIALIS-like protein 2 [Glycine max]
 gb|KHN13508.1| CEN-like protein 2 [Glycine soja]
Length=174

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 116/172 (67%), Gaps = 2/172 (1%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            S DPL++G+VIGDVL  F P ++ TV Y  K++ NG E  PS+   +P V I G     +
Sbjct  5    STDPLIIGRVIGDVLGSFTPTIKMTVTYNKKQVYNGYEFFPSTITTRPRVEIGGGDMR-S  63

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
             YTLIM DPD P PS+P  RE LHW+VTDIP  ++AS G+ +  Y  P+P  GIHRYVF 
Sbjct  64   FYTLIMTDPDVPGPSDPYLREHLHWMVTDIPGTTNASFGKVLVSYEMPNPNIGIHRYVFV  123

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            L +Q+   Q   +PP SR +F TR+F+A N LGLPVAA+YFN+Q+++A  ++
Sbjct  124  LLKQKRR-QCVTRPPSSRDHFNTRKFSAENDLGLPVAAVYFNAQRETAARRR  174



>ref|XP_002450283.1| hypothetical protein SORBIDRAFT_05g003200 [Sorghum bicolor]
 gb|EES09271.1| hypothetical protein SORBIDRAFT_05g003200 [Sorghum bicolor]
Length=173

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 117/174 (67%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIA-NGVEITPSSAAQKPSVHINGSPAS  212
            RSV+ L+VG+VIG+VLD F P V+  V Y S K+  NG EI PS+   KP V + G    
Sbjct  3    RSVESLIVGRVIGEVLDSFSPCVKMVVTYNSNKLVFNGHEIYPSAVVSKPRVEVQGGDLR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TL+M DPD P PS+P  RE LHW+VTDIP  +DAS GREV  Y  P P  GIHR++
Sbjct  63   -SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPRPSIGIHRFI  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q+    VA   P SR +F TRQFA  N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  FVLFKQKRRQTVAM--PSSRDHFITRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>gb|AGX25254.1| MCN5 [Musa AAB Group]
 gb|AGX25259.1| MCN5 [Musa AAB Group]
Length=173

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 119/174 (68%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIA-NGVEITPSSAAQKPSVHINGSPAS  212
            R +DPLVVG+VIG+VLD F P V+  V Y S K+  NG E+ PS+ A KP V + G    
Sbjct  3    RLIDPLVVGRVIGEVLDSFNPSVKMLVTYNSNKLVFNGHELYPSAVASKPRVEVQGGDMR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TL+M DPDAP PS+P  RE LHW+VTDIP  +DAS GRE+  Y  P P  GIHR+V
Sbjct  63   -SFFTLVMTDPDAPGPSDPYLREHLHWIVTDIPGTTDASFGREMVSYESPRPNIGIHRFV  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q+    V+  PP SR  F TR+FA  N LGLPVAA++FNSQ+++A  ++
Sbjct  122  FVLFKQQRRQAVS--PPSSRDYFSTRRFAEENDLGLPVAAVFFNSQRETAARRR  173



>gb|ABX11008.1| ZCN6 [Zea mays]
 gb|ACG45277.1| RCN1 - Corn Centroradialis/TFL1-like protein [Zea mays]
 gb|AFW64821.1| RCN1-Corn Centroradialis/TFL1-like proteinZCN6 [Zea mays]
Length=177

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 118/176 (67%), Gaps = 4/176 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIA-NGVEITPSSAAQKPSVHINGSPAS  212
            RSV+ LVVG+VIG+VLD F P V+  V Y S ++  NG EI PS+   KP V + G    
Sbjct  3    RSVESLVVGRVIGEVLDCFSPCVKMVVTYNSNRLVFNGHEIYPSAVVSKPRVEVQGGDLR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TL+M DPD P PS+P  RE LHW+VTDIP  +DAS GREV  Y  P P  GIHR++
Sbjct  63   -SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPRPGIGIHRFI  121

Query  393  FALFRQREAMQ--VAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q+   Q  VA  P  SR +F TRQFAA N LG PVAA+YFN+Q+++A  ++
Sbjct  122  FVLFKQKRRQQQTVAAVPSSSRDHFITRQFAAENDLGHPVAAVYFNAQRETAARRR  177



>ref|XP_010271687.1| PREDICTED: protein SELF-PRUNING-like [Nelumbo nucifera]
Length=176

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 120/180 (67%), Gaps = 5/180 (3%)
 Frame = +3

Query  18   MANANPRSVDPLVVGKVIGDVLDMFVPVVEFTVDYGS-KKIANGVEITPSSAAQKPSVHI  194
            MAN N + ++PL VGKVIGDVLD F P V+ TV Y S K++ NG E  PSS   KP V +
Sbjct  1    MAN-NAKLLEPLTVGKVIGDVLDSFSPTVKMTVTYNSNKQVYNGHEFYPSSVTTKPRVEV  59

Query  195  NGSPASPNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPT  374
             G       +TL+M DPDAP PS+P   E LHW+VTDIP  +DA+ GREV  Y  P P  
Sbjct  60   QGGDMR-TFFTLVMTDPDAPGPSDPYLMEHLHWIVTDIPGTTDATFGREVVSYEIPRPTI  118

Query  375  GIHRYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            GIHR+VF LF+Q+    +   PP SR +F TR+FA  N LGLPVAA++FN+Q+++A  ++
Sbjct  119  GIHRFVFVLFKQKRRQTIT--PPASRDHFSTRKFAEENDLGLPVAAVFFNAQRETAARRR  176



>gb|AGN29206.1| TFL1 [Cardamine flexuosa]
Length=177

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 122/179 (68%), Gaps = 2/179 (1%)
 Frame = +3

Query  18   MANANPRSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHIN  197
            M N   R V+PL+VG+V+GDVLD F+P  +  V Y  K+++NG E+ PSS + KP V I+
Sbjct  1    MENMGTRVVEPLIVGRVVGDVLDYFIPTTKMHVSYNKKQVSNGHELFPSSVSSKPRVEIH  60

Query  198  GSPASPNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTG  377
            G     + +TL+M+DPD P PS+P  +E LHW+VT+IP  +DA+ G+EV  Y  P P  G
Sbjct  61   GGDLR-SFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTTDATFGKEVVSYELPRPSIG  119

Query  378  IHRYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            IHRYVF LF+Q++   +    P SR +F TR+FA    LGLPVAA++FN+Q+++A  K+
Sbjct  120  IHRYVFVLFKQKQRRVIFPNIP-SRDHFNTRKFAVEYDLGLPVAAVFFNAQRETAARKR  177



>ref|XP_006365770.1| PREDICTED: CEN-like protein 1-like [Solanum tuberosum]
Length=175

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 118/174 (68%), Gaps = 3/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDY-GSKKIANGVEITPSSAAQKPSVHINGSPAS  212
            R ++PLVV +VIG+V+D F P V+  V Y GSK++ NG E+ P   A KP V I G    
Sbjct  4    RDIEPLVVARVIGEVVDSFNPSVKMNVIYNGSKQVFNGHELMPLVIASKPRVEIGGEDMR  63

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + YTLIM DPD P PS+P  RE LHW+VTDIP  +DAS GRE+  Y  P P  GIHRYV
Sbjct  64   -SAYTLIMTDPDVPGPSDPYLREHLHWIVTDIPGSTDASFGREIVSYDSPKPVIGIHRYV  122

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F L++Q    Q   KPP +R +F TR+FAA NGLG PVAA+YFN+Q+++A  ++
Sbjct  123  FVLYKQNRGRQTV-KPPVTRDHFNTRKFAAENGLGSPVAAVYFNAQRETAARRR  175



>gb|EMS48180.1| hypothetical protein TRIUR3_17327 [Triticum urartu]
Length=173

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 116/174 (67%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIA-NGVEITPSSAAQKPSVHINGSPAS  212
            RSV+PL+VG+VIG+VLD F P V+    Y S K+  NG E+ PS+   KP V + G    
Sbjct  3    RSVEPLIVGRVIGEVLDTFNPCVKMVTTYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             +L+TL+M DPD P PS+P  RE LHW+VTDIP  +DAS GREV  Y  P P  GIHR++
Sbjct  63   -SLFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPKPNIGIHRFI  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q+    V    P  R +F TRQFAA N LGLPVAA+YFN Q+++A  ++
Sbjct  122  FVLFKQKRRQTVTV--PSFRDHFNTRQFAAENDLGLPVAAVYFNCQRETAARRR  173



>ref|XP_010049502.1| PREDICTED: protein TERMINAL FLOWER 1-like [Eucalyptus grandis]
 ref|XP_010049507.1| PREDICTED: protein TERMINAL FLOWER 1-like [Eucalyptus grandis]
 gb|KCW89194.1| hypothetical protein EUGRSUZ_A01505 [Eucalyptus grandis]
Length=172

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 119/173 (69%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R+++PL VG+VIGDV+D F   +  +V Y  K++ NG E+ PSS A +P V I+G     
Sbjct  3    RALEPLTVGRVIGDVIDPFTASIRMSVKYNGKQVNNGHELYPSSVAARPRVEIHGGDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            + +TL+M DPDAP PS+P  RE LHW+VT+IP  +DA+ GREV  Y  P P  GIHR+VF
Sbjct  62   SFFTLVMTDPDAPGPSDPYLREHLHWIVTNIPGTTDATFGREVMSYEIPRPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LFRQ+   Q++Q  P SR  F TR FAA N L LPVAA+YFN+Q+++A  ++
Sbjct  122  ILFRQKRRQQISQ--PSSRDCFSTRNFAAENDLDLPVAAVYFNAQRETAARRR  172



>gb|ABW24968.1| terminal flower 1b [Gossypium hirsutum]
Length=172

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 118/173 (68%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R V+PL+VG+VIGDV+D F+P ++ +V + +K++ NG E  PS+   KP V + G     
Sbjct  3    REVEPLMVGRVIGDVMDSFIPSIKMSVTFNNKQVFNGHEFYPSTVVTKPRVEVVGGDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
              +TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF
Sbjct  62   TFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYENPKPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q+    +  K P SR NF TR+F + N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  VLFKQKRRQII--KSPCSRDNFNTRRFVSENDLGLPVAAVYFNAQRETAARRR  172



>ref|XP_010693475.1| PREDICTED: CEN-like protein 1 [Beta vulgaris subsp. vulgaris]
 gb|ADM92613.1| brother of FT AND TFL1-like protein BFT1 [Beta vulgaris]
 gb|ADM92614.1| brother of FT AND TFL1-like protein BFT1 [Beta vulgaris]
Length=174

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 117/174 (67%), Gaps = 3/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGS-KKIANGVEITPSSAAQKPSVHINGSPAS  212
            R V+PL++G+VIG+V+D+F P V   V Y S K++ NG E+ P+    KP V I G    
Sbjct  3    RGVEPLIIGRVIGEVIDIFNPSVTLNVTYNSSKQVCNGHELMPAVVVSKPRVEIGGEDMR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + YTLIMVDPDAPSPS+P  RE LHW+VTDIP  +D S G+E+  Y  P P  GIHRY+
Sbjct  63   -SAYTLIMVDPDAPSPSDPYLREHLHWIVTDIPGTTDISFGKEIVCYETPKPVVGIHRYI  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF Q    Q   + P SR  F TR+FAA NGLGLPVA +YFN+Q+++A  ++
Sbjct  122  FILFNQIRGRQTV-RSPTSRECFNTRRFAAENGLGLPVAVVYFNAQRETAARRR  174



>ref|XP_004228452.1| PREDICTED: CEN-like protein 1 [Solanum lycopersicum]
Length=175

 Score =   183 bits (465),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 118/174 (68%), Gaps = 3/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDY-GSKKIANGVEITPSSAAQKPSVHINGSPAS  212
            R ++PL+V KVIG+V+D F P V+  V Y G+K++ NG E+ P   A KP V I G    
Sbjct  4    RDIEPLIVAKVIGEVVDSFNPSVKMNVTYNGTKQVFNGHELMPLVIASKPRVEIGGEDMR  63

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + YTL+M+DPD P PS+P  RE LHW+VTDIP  +DAS GRE+  Y+ P P  GIHRYV
Sbjct  64   -SAYTLVMIDPDVPGPSDPYLREHLHWIVTDIPGSTDASFGREIISYVNPKPVIGIHRYV  122

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F L++Q    Q   KP  SR +F TR+FA  NGLG PVAA+YFN+Q+++A  ++
Sbjct  123  FVLYKQNRGRQTV-KPSVSRDHFNTRKFAVENGLGSPVAAVYFNAQRETAARRR  175



>ref|XP_009356062.1| PREDICTED: protein MOTHER of FT and TF 1-like [Pyrus x bretschneideri]
Length=192

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 119/173 (69%), Gaps = 4/173 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP +  +V +GSK + NG +I PS A   P +   G P    
Sbjct  24   SVDPLVVGRVIGDVVDMFVPTLSMSVYFGSKHVTNGCDIKPSMAINPPKITFTGHPGE--  81

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+M DPDAPSPSEP+ REW+HW+V+DIP G++  +G          PP GIHRY+  
Sbjct  82   LYTLVMTDPDAPSPSEPSMREWVHWIVSDIPGGTNPLRGNLQIPREKIFPPVGIHRYILV  141

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LF+Q+  + + ++PP SR +F TR FAA   LGLPV+ +YFN QK+ A N++R
Sbjct  142  LFQQKAPVGLVEQPP-SRAHFNTRFFAAQLDLGLPVSTVYFNCQKEPA-NRRR  192



>gb|AAM27952.1|AF466812_1 terminal flower 1 [Arabidopsis thaliana]
 gb|ABY79192.1| At5g03840 [Arabidopsis thaliana]
Length=177

 Score =   183 bits (465),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 122/179 (68%), Gaps = 2/179 (1%)
 Frame = +3

Query  18   MANANPRSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHIN  197
            M N   R ++PL++G+V+GDVLD F P  +  V Y  K+++NG E+ PSS + KP V I+
Sbjct  1    MENMGTRVIEPLIIGRVVGDVLDFFTPTTKMNVSYNKKQVSNGHELFPSSVSSKPRVEIH  60

Query  198  GSPASPNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTG  377
            G     + +TL+M+DPD P PS+P  +E LHW+VT+IP  +DA+ G+EV  Y  P P  G
Sbjct  61   GGDLR-SFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTTDATFGKEVVSYELPRPSIG  119

Query  378  IHRYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            IHR+VF LFRQ++   +    P SR +F TR+FA    LGLPVAA++FN+Q+++A +K+
Sbjct  120  IHRFVFVLFRQKQRRVIFPNIP-SRDHFNTRKFAVEYDLGLPVAAVFFNAQRETAAHKR  177



>ref|XP_009390100.1| PREDICTED: protein FLOWERING LOCUS T-like [Musa acuminata subsp. 
malaccensis]
Length=179

 Score =   183 bits (465),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 115/173 (66%), Gaps = 3/173 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            S DPLVVG V+GDVLD FV      V YG+K++ NG E+ PS  A +P V I G   S  
Sbjct  2    SRDPLVVGNVVGDVLDPFVRSATMRVSYGNKELTNGCELKPSMVAVEPRVEIKGR-NSRI  60

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
            LYTL+MVDPDAPSPS PT RE+LHW+VTDIPE S+AS G E+  Y  P P  GIHR+VF 
Sbjct  61   LYTLVMVDPDAPSPSNPTKREYLHWLVTDIPETSNASYGNEIVSYESPRPTAGIHRFVFI  120

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            LFRQ  ++      P  R NF TR FAAA  LG PVAA++FN Q+++    +R
Sbjct  121  LFRQ--SVCQTMYAPGWRQNFNTRDFAAAFNLGDPVAAMFFNCQRENGCGGRR  171



>ref|XP_002442808.1| hypothetical protein SORBIDRAFT_08g003210 [Sorghum bicolor]
 gb|EES16646.1| hypothetical protein SORBIDRAFT_08g003210 [Sorghum bicolor]
Length=173

 Score =   183 bits (464),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 117/174 (67%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIA-NGVEITPSSAAQKPSVHINGSPAS  212
            RSV+PL+VG+VIG+VLD F P V+  V Y S K+  NG EI PS+   KP V + G    
Sbjct  3    RSVEPLIVGRVIGEVLDSFNPCVKMIVTYNSNKLVFNGHEIYPSAVVSKPRVEVQGGDLR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TL+M DPD P PS+P  RE LHW+VTDIP  +DAS GREV  Y  P P  GIHR++
Sbjct  63   -SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPRPNIGIHRFI  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q+    V    P SR +F TRQFA  N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  FVLFKQKGRQTVTV--PSSRDHFNTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|NP_001289244.1| protein TERMINAL FLOWER 1-like [Pyrus x bretschneideri]
 dbj|BAD10968.1| TFL1-like protein [Pyrus pyrifolia]
 dbj|BAD10969.1| TFL1-like protein [Pyrus communis]
 dbj|BAK74839.1| terminal flowering 1 [Pyrus pyrifolia]
 dbj|BAI99732.4| terminal flower1 [Pyrus pyrifolia var. culta]
 gb|AGW22130.1| terminal flower 1 protein [Pyrus x bretschneideri]
Length=172

 Score =   183 bits (464),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 112/173 (65%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R  +PLVVG+VIGDVLD F P    +V Y +K + NG+E+ PS    KP V I G     
Sbjct  3    RVPEPLVVGRVIGDVLDSFTPTTHMSVTYNTKLVCNGLELFPSVVTAKPRVEIQGGELR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            + +TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GRE   Y  P P  GIHR+VF
Sbjct  62   SFFTLVMTDPDCPGPSDPYLREHLHWIVTDIPGTTDAAFGREALSYEMPRPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q+    +   PP SR  F TR FAA N LGLPVAA+YFN+Q++ A  ++
Sbjct  122  VLFKQKRRQSI--NPPSSRDCFSTRSFAAENDLGLPVAAVYFNAQREGAARRR  172



>gb|EMT24999.1| hypothetical protein F775_30083 [Aegilops tauschii]
Length=173

 Score =   183 bits (464),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 116/174 (67%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIA-NGVEITPSSAAQKPSVHINGSPAS  212
            RSV+PL+VG+VIG+VLD F P V+    Y S K+  NG E+ PS+   KP V + G    
Sbjct  3    RSVEPLIVGRVIGEVLDTFNPCVKMVTTYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             +++TL+M DPD P PS+P  RE LHW+VTDIP  +DAS GREV  Y  P P  GIHR++
Sbjct  63   -SMFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPKPNIGIHRFI  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q+    V    P  R +F TRQFAA N LGLPVAA+YFN Q+++A  ++
Sbjct  122  FVLFKQKRRQTVTV--PSFRDHFNTRQFAAENDLGLPVAAVYFNCQRETAARRR  173



>ref|XP_009592311.1| PREDICTED: protein SELF-PRUNING-like isoform X2 [Nicotiana tomentosiformis]
Length=172

 Score =   183 bits (464),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 115/173 (66%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RS++PL+VG+V+GDVLD F P+V+ T+ Y +K + NG E  PS    +P V + G     
Sbjct  3    RSLEPLIVGRVVGDVLDSFSPIVKMTITYNNKLVCNGHEFFPSIVTSRPKVEVQGGDLR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
              +TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GRE+  Y  P P  GIHR+VF
Sbjct  62   TFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPRPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+QR    V+  PP SR NF TR FA  N L  PVAA++FN+Q+++A  ++
Sbjct  122  VLFKQRRRQSVS--PPTSRDNFNTRNFAEENDLSQPVAAVFFNAQRETAARRR  172



>ref|XP_007036755.1| PEBP (phosphatidylethanolamine-binding protein) family protein 
isoform 2 [Theobroma cacao]
 gb|EOY21256.1| PEBP (phosphatidylethanolamine-binding protein) family protein 
isoform 2 [Theobroma cacao]
Length=159

 Score =   182 bits (462),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 115/172 (67%), Gaps = 16/172 (9%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            SVDPLVVG+VIGDV+DMFVP V  +V YGS+ + NG +I PS+    P V          
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTVTMSVYYGSRHVTNGCDIKPSTTINPPKV----------  53

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
                 M DPDAPSPSEP+ REW+HW+V+DIP G++ ++G+E+  Y+GP PP GIHRY+  
Sbjct  54   -----MTDPDAPSPSEPSMREWVHWIVSDIPGGTNPTRGKEILVYMGPRPPVGIHRYILV  108

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LF+Q+  +   Q+ P SR NF TR FA    LG PVA +YFN+QK+  + ++
Sbjct  109  LFQQKGPLGQVQQ-PASRANFSTRLFAQHLNLGQPVATVYFNAQKEPVSRRR  159



>ref|XP_004952639.1| PREDICTED: protein SELF-PRUNING-like [Setaria italica]
Length=173

 Score =   182 bits (463),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 116/174 (67%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGS-KKIANGVEITPSSAAQKPSVHINGSPAS  212
            R ++PL+VGKVIG+VLD F P V+  V Y S K++ NG E  PS  A KP V + G    
Sbjct  3    RVLEPLIVGKVIGEVLDHFNPTVKMMVTYNSNKQVFNGHEFFPSVVANKPRVEVQGGDLR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TL+M DPD P PS+P  RE LHW+VTDIP  +DAS GRE+  Y  P P  GIHR++
Sbjct  63   -SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGRELVSYENPRPNIGIHRFI  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LFRQ     V+  PP SR  F TRQFA  N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  FVLFRQSRRQAVS--PPSSRDRFSTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>dbj|BAD10966.1| TFL1-like protein [Eriobotrya japonica]
 gb|ADB92194.1| TFL1-like protein [Eriobotrya japonica]
Length=172

 Score =   182 bits (463),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 115/173 (66%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R+++PLVVG+VIGDVLD F    + +V Y +K + NG+E+ PS    KP V I G     
Sbjct  3    RALEPLVVGRVIGDVLDSFTATTKMSVTYNTKLVCNGLELFPSVVTAKPRVEIQGGDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            + +TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF
Sbjct  62   SFFTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q     +    P SR +F TR FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  VLFKQNRRQSI--NTPSSRDHFSTRSFAAENDLGLPVAAVYFNAQRETAARRR  172



>ref|XP_002436981.1| hypothetical protein SORBIDRAFT_10g013070 [Sorghum bicolor]
 gb|EER88348.1| hypothetical protein SORBIDRAFT_10g013070 [Sorghum bicolor]
Length=182

 Score =   183 bits (464),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 120/181 (66%), Gaps = 15/181 (8%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            VDPLVVG+VIGDV+D+FVP V  +V +G+K + NG EI PS  A  P V I G   + +L
Sbjct  5    VDPLVVGRVIGDVVDLFVPTVAMSVRFGTKDVTNGCEIKPSLTAAAPVVQIAGR--ANDL  62

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGRE-VAEYIGPSPPTGIHRYVFA  398
            +TL+M DPDAPSPSEPT RE +HW+V +IP G+D S+G E V  Y+GP PP GIHRYV  
Sbjct  63   FTLVMTDPDAPSPSEPTMRELIHWLVVNIPGGADPSQGSETVMPYLGPCPPVGIHRYVLV  122

Query  399  LFRQREAMQVAQKPP---------ESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNK  551
            +++Q+      + PP          SR  FR R FA  + LGLPVAA+YFN+QK+ A   
Sbjct  123  VYQQKARF---RAPPVLAPGAEVEASRARFRNRAFADRHDLGLPVAAMYFNAQKEPANRH  179

Query  552  K  554
            +
Sbjct  180  R  180



>ref|XP_006430226.1| hypothetical protein CICLE_v10013475mg [Citrus clementina]
 gb|ABY91242.1| CTRSTFL-like protein [Citrus trifoliata]
 gb|ESR43466.1| hypothetical protein CICLE_v10013475mg [Citrus clementina]
Length=173

 Score =   182 bits (463),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 117/173 (68%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R ++PL VG+VIGDV++ F P ++ +V Y +K++ NG E+ PS+   KP V I G     
Sbjct  4    RMLEPLAVGRVIGDVIESFTPSIKMSVTYNNKQVCNGHELFPSTVVSKPRVEIQGGDMR-  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            + +TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GRE+  Y  P P  GIHR+VF
Sbjct  63   SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPRPNIGIHRFVF  122

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q     V   PP SR +F TR FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  123  VLFKQTRRQTV--NPPSSRDHFNTRAFAAENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_006647339.1| PREDICTED: protein SELF-PRUNING-like [Oryza brachyantha]
Length=173

 Score =   182 bits (463),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 118/174 (68%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGS-KKIANGVEITPSSAAQKPSVHINGSPAS  212
            R ++PL+VGKVIG+VLD F P V+    YG+ K++ NG E  PS+ A KP V + G    
Sbjct  3    RVLEPLIVGKVIGEVLDNFNPTVKMMATYGANKQVFNGHEFFPSAVAGKPRVEVQGGDLR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TL+M DPD P PS+P  RE LHW+VTDIP  +DAS GREV  Y  P P  GIHR++
Sbjct  63   -SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPRPNIGIHRFI  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LFRQ+    V+  PP SR  F TRQFA  N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  FVLFRQKRRQAVS--PPPSRDRFSTRQFAEDNDLGLPVAAVYFNAQRETAARRR  173



>gb|ADF30920.1| Dt1 [Glycine max]
 gb|ADF30923.1| Dt1 [Glycine max]
 gb|ADF30935.1| Dt1 [Glycine max]
 gb|ADF30942.1| Dt1 [Glycine max]
 gb|ADF31035.1| Dt1 [Glycine max]
 gb|ADF31036.1| Dt1 [Glycine max]
 gb|ADF31042.1| Dt1 [Glycine max]
 gb|ADF31044.1| Dt1 [Glycine max]
 gb|ADF31048.1| Dt1 [Glycine max]
 gb|ADF31049.1| Dt1 [Glycine max]
 gb|ADF31061.1| Dt1 [Glycine max]
 gb|ADF31072.1| Dt1 [Glycine max]
 gb|ADF31075.1| Dt1 [Glycine max]
 gb|ADF31080.1| Dt1 [Glycine max]
 gb|ADF31084.1| Dt1 [Glycine max]
 gb|ADF31091.1| Dt1 [Glycine max]
 gb|ADF31097.1| Dt1 [Glycine max]
 gb|ADF31099.1| Dt1 [Glycine max]
 gb|ADF31122.1| Dt1 [Glycine max]
 gb|ADF31143.1| Dt1 [Glycine max]
 gb|ADF31145.1| Dt1 [Glycine max]
 gb|ADF31155.1| Dt1 [Glycine max]
 gb|ADF31160.1| Dt1 [Glycine max]
 gb|ADF31162.1| Dt1 [Glycine max]
 gb|ADF31190.1| Dt1 [Glycine max]
Length=173

 Score =   182 bits (463),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 117/171 (68%), Gaps = 3/171 (2%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            ++PL+VG+VIG+VLD F    + TV Y  K++ NG E+ PS+   KP V I G   S + 
Sbjct  6    LEPLIVGRVIGEVLDSFTTSTKMTVSYNKKQVYNGHELFPSTVNTKPKVEIEGGDMS-SF  64

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            +TLIM DPD P PS+P  RE LHW+VTDIP  +DA+ G+E+  Y  P P  GIHR+VF L
Sbjct  65   FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEVPKPNIGIHRFVFVL  124

Query  402  FRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F+Q+    V   PP SR +F TR+FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  125  FKQKRRQCVT--PPTSRDHFNTRKFAAENDLGLPVAAVYFNAQRETAARRR  173



>gb|AAM27947.1|AF466807_1 terminal flower 1 [Arabidopsis thaliana]
 gb|ABY79191.1| At5g03840 [Arabidopsis thaliana]
Length=177

 Score =   182 bits (463),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 121/179 (68%), Gaps = 2/179 (1%)
 Frame = +3

Query  18   MANANPRSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHIN  197
            M N   R ++PL++G+V+GDVLD F P  +  V Y  K+++NG E+ PSS + KP V I+
Sbjct  1    MENMGTRVIEPLIIGRVVGDVLDFFTPTTKMNVSYNKKQVSNGHELFPSSVSSKPRVEIH  60

Query  198  GSPASPNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTG  377
            G     + +TL+M+DPD P PS+P  +E LHW+VT+IP  +DA+ G+EV  Y  P P  G
Sbjct  61   GGDLR-SFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTTDATFGKEVVSYELPRPSIG  119

Query  378  IHRYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            IHR+VF LFRQ++   +    P SR +F TR+FA    LGLPVAA++FN+Q+++A  K+
Sbjct  120  IHRFVFVLFRQKQRRVIFPNIP-SRDHFNTRKFAVEYDLGLPVAAVFFNAQRETAARKR  177



>gb|ADC32542.1| terminal flower 1-like protein [Leavenworthia crassa]
Length=177

 Score =   182 bits (463),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 119/179 (66%), Gaps = 2/179 (1%)
 Frame = +3

Query  18   MANANPRSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHIN  197
            M N   R  DPL+VG+VIGDVLD F P ++  V Y  K+++NG E+ PSS + KP V I+
Sbjct  1    MENMRSRVADPLIVGRVIGDVLDFFTPTIKMHVTYNKKQVSNGHELFPSSVSSKPRVEIH  60

Query  198  GSPASPNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTG  377
            G     + +TL+MVDPD P PS+P  +E LHW+VT+IP  +D + G+EV  Y  P P  G
Sbjct  61   GGDLR-SFFTLVMVDPDVPGPSDPFLKEHLHWIVTNIPGTTDVTFGKEVVSYDLPRPSIG  119

Query  378  IHRYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            IHR+VF LFRQ++   +      SR +F TR+FA    LGLPVAA++FN+Q+++A  K+
Sbjct  120  IHRFVFVLFRQKQRCVILPN-ITSRDHFNTRKFATEYDLGLPVAAVFFNAQRETAARKR  177



>ref|XP_004308107.1| PREDICTED: CEN-like protein 1-like [Fragaria vesca subsp. vesca]
 dbj|BAP18902.1| terminal flower 1 [Fragaria x ananassa]
Length=175

 Score =   182 bits (463),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 117/175 (67%), Gaps = 4/175 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGS--KKIANGVEITPSSAAQKPSVHINGSPA  209
            R ++ L +G+V+G+V+DMF P V+  V Y S  K+++NG EI PS  A KP V I G   
Sbjct  3    RIMETLTLGRVVGEVVDMFTPSVKMNVVYSSCNKQVSNGHEIMPSVIAAKPRVDIGGEDM  62

Query  210  SPNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRY  389
                YTLIM DPD PSPS+P  RE LHW+VTDIP  +D S GREV EY  P P  GIHRY
Sbjct  63   RA-AYTLIMTDPDYPSPSDPCLREHLHWMVTDIPGTTDVSFGREVVEYETPKPVVGIHRY  121

Query  390  VFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            VF LF+Q    Q   + P SR NF TR+F+  N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  VFLLFQQTRGRQTV-RVPASRDNFNTRKFSQENSLGLPVAAVYFNAQRETAARRR  175



>ref|XP_004978696.1| PREDICTED: CEN-like protein 2-like [Setaria italica]
Length=173

 Score =   182 bits (462),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 116/174 (67%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIA-NGVEITPSSAAQKPSVHINGSPAS  212
            RSV+PL+VG+VIG+VLD F P V+  V Y S K+  NG EI PS+   KP V + G    
Sbjct  3    RSVEPLIVGRVIGEVLDSFNPCVKMIVTYNSNKLVFNGHEIYPSAVVSKPRVEVQGGDLR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TL+M DPD P PS+P  RE LHW+VTDIP  +DAS GREV  Y  P P  GIHR++
Sbjct  63   -SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVINYESPRPSIGIHRFI  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q+    V    P  R +F TRQFA  N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  FVLFKQKRRQTVTV--PSVRDHFNTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|NP_001173006.1| Os02g0531600 [Oryza sativa Japonica Group]
 dbj|BAD28412.1| putative Cen-like protein [Oryza sativa Japonica Group]
 gb|EAY86144.1| hypothetical protein OsI_07517 [Oryza sativa Indica Group]
 gb|EAZ23305.1| hypothetical protein OsJ_07001 [Oryza sativa Japonica Group]
 dbj|BAH01422.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH91735.1| Os02g0531600 [Oryza sativa Japonica Group]
Length=173

 Score =   182 bits (462),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 118/174 (68%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGS-KKIANGVEITPSSAAQKPSVHINGSPAS  212
            R ++PL+VGKVIG+VLD F P V+ T  YG+ K++ NG E  PS+ A KP V + G    
Sbjct  3    RVLEPLIVGKVIGEVLDNFNPTVKMTATYGANKQVFNGHEFFPSAVAGKPRVEVQGGDLR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TL+M DPD P PS+P  RE LHW+VTDIP  +DAS GREV  Y  P P  GIHR++
Sbjct  63   -SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPRPNIGIHRFI  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
              LFRQ+    V+  PP SR  F TRQFA  N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  LVLFRQKRRQAVS--PPPSRDRFSTRQFAEDNDLGLPVAAVYFNAQRETAARRR  173



>gb|ABR53775.2| TFL1y [Phaseolus vulgaris]
 gb|ABR53776.2| TFL1y [Phaseolus vulgaris]
 gb|ABR53777.2| TFL1y [Phaseolus vulgaris]
 gb|AFI47666.1| TFLly [Phaseolus vulgaris]
 gb|AFI47667.1| TFLly [Phaseolus vulgaris]
 gb|AFI47668.1| TFLly [Phaseolus vulgaris]
 gb|AFI47669.1| TFLly [Phaseolus vulgaris]
 gb|AFI47670.1| TFLly [Phaseolus vulgaris]
 gb|AFI47671.1| TFLly [Phaseolus vulgaris]
 gb|AFI47672.1| TFLly [Phaseolus vulgaris]
 gb|AFI47673.1| TFLly [Phaseolus vulgaris]
 gb|AFI47674.1| TFLly [Phaseolus vulgaris]
 gb|AFI47675.1| TFLly [Phaseolus vulgaris]
 gb|AFI47676.1| TFLly [Phaseolus vulgaris]
 gb|AFI47677.1| TFLly [Phaseolus vulgaris]
 gb|AFI47678.1| TFLly [Phaseolus vulgaris]
 gb|AFI47679.1| TFLly [Phaseolus vulgaris]
 gb|AFI47680.1| TFLly [Phaseolus vulgaris]
 gb|AFI47681.1| TFLly [Phaseolus vulgaris]
 gb|AFI47682.1| TFLly [Phaseolus vulgaris]
 gb|AFI47683.1| TFLly [Phaseolus vulgaris]
 gb|AFI47684.1| TFLly [Phaseolus vulgaris]
Length=173

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 117/171 (68%), Gaps = 3/171 (2%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            ++PL+VG+VIG+VLD F   ++ TV Y  K++ NG E+ PSS   KP V I G+    + 
Sbjct  6    LEPLIVGRVIGEVLDSFTTSMKMTVSYNKKQVYNGHELFPSSVNTKPKVQIEGADMR-SF  64

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            +TLIM DPD P PS+P  RE LHW+VTDIP  +DA+ G+E+  Y  P P  GIHR+VF L
Sbjct  65   FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPKPNIGIHRFVFVL  124

Query  402  FRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F+Q+    V   PP SR +F TR FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  125  FKQKRRQCVT--PPTSRDHFNTRNFAAQNDLGLPVAAVYFNAQRETAARRR  173



>ref|NP_001280887.1| protein TERMINAL FLOWER 1-like [Malus domestica]
 dbj|BAD06418.1| TFL1-like protein [Malus domestica]
 dbj|BAD10961.1| TFL1-like protein [Malus domestica]
 gb|ABF84011.1| terminal flower 1 [Malus domestica]
 dbj|BAG31955.1| TFL1 like protein [Malus domestica]
Length=172

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 115/173 (66%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R+ +PLVVG+VIGDVLD F    + +V Y +K + NG+E+ PS    KP V I G     
Sbjct  3    RASEPLVVGRVIGDVLDSFTATTKMSVTYNTKLVCNGLELFPSVVTAKPRVEIQGGDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            + +TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF
Sbjct  62   SFFTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPKPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q +   +    P SR +F TR FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  VLFKQNQRQSI--NTPSSRDHFSTRSFAAENDLGLPVAAVYFNAQRETAARRR  172



>gb|AGX25242.1| MCN3 [Musa acuminata AAA Group]
 gb|AGX25247.1| MCN3 [Musa acuminata AAA Group]
Length=174

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 121/174 (70%), Gaps = 3/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYG-SKKIANGVEITPSSAAQKPSVHINGSPAS  212
            +++ PL VG+VIGDVLD FVP ++  V YG +K++ NG E+ PS+   +P V I G    
Sbjct  3    KTLGPLAVGRVIGDVLDSFVPGMKLEVAYGHNKQVYNGHELMPSAVCARPRVEIGGDDMR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + YTL++ DPDAPSPS+P  RE LHW+VTDIP  ++AS GRE+  Y  P P  GIHRYV
Sbjct  63   -SFYTLVLTDPDAPSPSDPHSREHLHWIVTDIPGTTNASFGREIVSYEAPKPSIGIHRYV  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q+    V   PP SR +F TR F+  +GLGLPVAA+YFN+Q+++A  ++
Sbjct  122  FVLFKQKGRRTVCV-PPASRDHFNTRSFSEESGLGLPVAAVYFNAQRETAARRR  174



>gb|AFA25738.1| hypothetical protein [Phaseolus vulgaris]
Length=170

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 117/171 (68%), Gaps = 3/171 (2%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            ++PL+VG+VIG+VLD F   ++ TV Y  K++ NG E+ PSS   KP V I G+    + 
Sbjct  3    LEPLIVGRVIGEVLDSFTTSMKMTVSYNKKQVYNGHELFPSSVNTKPKVQIEGADMR-SF  61

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            +TLIM DPD P PS+P  RE LHW+VTDIP  +DA+ G+E+  Y  P P  GIHR+VF L
Sbjct  62   FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPKPNIGIHRFVFVL  121

Query  402  FRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F+Q+    V   PP SR +F TR FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  FKQKRRQCVT--PPTSRDHFNTRNFAAQNDLGLPVAAVYFNAQRETAARRR  170



>dbj|BAK18560.1| flowering locus T-like protein [Eustoma exaltatum subsp. russellianum]
 dbj|BAK18561.1| flowering locus T-like protein [Eustoma exaltatum subsp. russellianum]
Length=176

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 113/171 (66%), Gaps = 3/171 (2%)
 Frame = +3

Query  45   DPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNLY  224
            DPL VG+VIGDVLD F   V+FTV YG ++++NG E+ PS    +P V + G       Y
Sbjct  7    DPLAVGRVIGDVLDPFTRSVDFTVAYGQREVSNGCELRPSQVVNQPRVEVGGHDLR-TFY  65

Query  225  TLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFALF  404
            TL+MVDPDAPSPS+P  RE+LHW+VTDIP  + AS G+E+  Y  P P  GIHR+VFALF
Sbjct  66   TLVMVDPDAPSPSDPNLREYLHWLVTDIPGSTSASFGQEIVWYESPRPSLGIHRFVFALF  125

Query  405  RQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            RQ     V    P  R NF TR FA    LGLPVAA+YFN Q++S +  +R
Sbjct  126  RQLGRQTVYA--PGWRQNFNTRDFAELYNLGLPVAAVYFNCQRESGSGGRR  174



>ref|XP_003578901.1| PREDICTED: CEN-like protein 2 [Brachypodium distachyon]
Length=173

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 116/174 (67%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIA-NGVEITPSSAAQKPSVHINGSPAS  212
            RSV+PL+VG+VIG+VLD F P V+    Y S K+  NG E+ PS+ A KP V + G    
Sbjct  3    RSVEPLIVGRVIGEVLDTFNPCVKMVTTYNSNKLVFNGHELYPSAVASKPRVEVQGGDLR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             +L+TL+M DPD P PS+P  RE LHW+VTDIP  +DAS GREV  Y  P P  GIHR++
Sbjct  63   -SLFTLVMTDPDVPGPSDPYQREHLHWIVTDIPGTTDASFGREVISYESPKPNIGIHRFI  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q+    V    P  R +F TRQFA  N LGLPVAA+YFN Q+++A  ++
Sbjct  122  FVLFKQKRRQTVTA--PSFRDHFNTRQFAEQNDLGLPVAAVYFNCQRETAARRR  173



>gb|AAM27957.1|AF466817_1 terminal flower 1 [Arabidopsis lyrata]
Length=177

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 122/179 (68%), Gaps = 2/179 (1%)
 Frame = +3

Query  18   MANANPRSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHIN  197
            M N   R ++PL++G+V+GDVLD F P ++  V Y  K+++NG E+ PSS + KP V I+
Sbjct  1    MENMGTRVIEPLIMGRVVGDVLDFFTPTIKMNVSYNKKQVSNGHELFPSSVSSKPRVEIH  60

Query  198  GSPASPNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTG  377
            G     + +TL+M+DPD P PS+P  +E LHW+VT+IP  +DA+ G+EV  Y  P P  G
Sbjct  61   GGDLR-SFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTTDATFGKEVVSYELPRPSIG  119

Query  378  IHRYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            IHR+VF LF+Q++   +    P SR +F TR+FA    LGLPVAA++FN+Q+++A  K+
Sbjct  120  IHRFVFVLFKQKQRRVIFPNIP-SRDHFNTRKFAVEYDLGLPVAAVFFNTQRETAARKR  177



>ref|XP_009384535.1| PREDICTED: CEN-like protein 1 [Musa acuminata subsp. malaccensis]
Length=173

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 117/174 (67%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYG-SKKIANGVEITPSSAAQKPSVHINGSPAS  212
            R +DPL VG+VIGDVLD F P V+  V YG +K++ NG E  PS+   KP V I G    
Sbjct  3    RMLDPLTVGRVIGDVLDSFNPSVKLEVVYGPNKRVYNGHEFMPSAVCAKPRVEIGGDDMR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + YTLI+ DPDAPSPS+P  RE LHW+VTDIP  ++ S GRE+  Y  P P  GIHRYV
Sbjct  63   -SFYTLILTDPDAPSPSDPHLREHLHWIVTDIPGTTNVSFGREIVGYEAPKPFIGIHRYV  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q+    V    P SR +F TR F+  NGLGLPVAA+YFN+Q+++A  ++
Sbjct  122  FVLFKQKGRQTVYA--PASRDHFSTRDFSEENGLGLPVAAVYFNAQRETAARRR  173



>gb|AID67229.1| MFT2-like protein, partial [Picea abies]
 gb|AID67254.1| MFT2-like protein, partial [Picea abies]
Length=149

 Score =   181 bits (459),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 106/148 (72%), Gaps = 2/148 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            RSVDPLVVG V+GDV+D+FV   + TV YG K++ NG EI PS+   +P++ I G     
Sbjct  3    RSVDPLVVGNVVGDVIDIFVRAADMTVHYGPKQVTNGCEIKPSATVHRPNLQIAGRHFDD  62

Query  216  N-LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
            N L+TL+M DPDAPSPSEP  REWLHW+VTDIP  +DAS+GRE+  Y+GP PP GIHRYV
Sbjct  63   NKLFTLVMTDPDAPSPSEPNMREWLHWIVTDIPGAADASQGREIVPYMGPRPPIGIHRYV  122

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQF  476
            F  FRQ++ M V    P+ R NF TR F
Sbjct  123  FVAFRQQDPM-VMMMAPQVRHNFSTRAF  149



>dbj|BAI60052.1| flowering locus T-like protein [Ficus carica]
Length=174

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 113/175 (65%), Gaps = 3/175 (2%)
 Frame = +3

Query  33   PRSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPAS  212
            PR  DPLVVG+VIGDVLD F   +   V YG+K++ NG E+ PS    +P V I G    
Sbjct  2    PRERDPLVVGRVIGDVLDQFTRSISLRVTYGNKEVNNGCELKPSQVVSQPRVDIGGDDLR  61

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
               YTL+MVDPDAPSPS+P+ RE+LHW+VTDIP  + AS G+EV  Y  P P  GIHR+V
Sbjct  62   -TFYTLVMVDPDAPSPSDPSLREYLHWLVTDIPATTGASFGQEVVCYESPRPTVGIHRFV  120

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            F LFRQ     V    P  R NF T+ FA    LGLPVAA+Y+N Q++S +  +R
Sbjct  121  FVLFRQLGRQTVY--APGWRQNFNTKDFAELYNLGLPVAAVYYNCQRESGSGGRR  173



>gb|ABW24966.1| terminal flower 1b [Gossypium raimondii]
Length=172

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 117/173 (68%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R V+PL+ G+VIGDV+D F+P ++  V + +K++ NG E  PS+   KP V + G     
Sbjct  3    REVEPLMGGRVIGDVMDSFIPSIKMLVTFNNKQVFNGHEFYPSTVVTKPRVEVAGGDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
              +TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF
Sbjct  62   TFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYENPKPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q+    +  K P SR NF TR+FA+ N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  VLFKQKRRQII--KSPCSRDNFNTRRFASENDLGLPVAAVYFNAQRETAARRR  172



>ref|XP_002453931.1| hypothetical protein SORBIDRAFT_04g021650 [Sorghum bicolor]
 gb|EES06907.1| hypothetical protein SORBIDRAFT_04g021650 [Sorghum bicolor]
Length=173

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 116/174 (67%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGS-KKIANGVEITPSSAAQKPSVHINGSPAS  212
            R ++PL+VGKVIG+VLD F P V+  V Y S K++ NG E  PS+   KP V + G    
Sbjct  3    RVLEPLIVGKVIGEVLDHFNPTVKMVVTYNSNKQVFNGHEFFPSAVTAKPRVEVQGGDLR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TL+M DPD P PS+P  RE LHW+VTDIP  +DAS GREV  Y  P P  GIHR++
Sbjct  63   -SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYETPKPNIGIHRFI  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LFRQ+    V   PP S+  F TRQFA  N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  FVLFRQKRRQAV--NPPSSKDRFSTRQFAEDNDLGLPVAAVYFNAQRETAARRR  173



>ref|NP_001280770.1| CEN-like protein 1 [Malus domestica]
 gb|AGX15186.1| BFTb [Malus domestica]
Length=173

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 119/174 (68%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYG-SKKIANGVEITPSSAAQKPSVHINGSPAS  212
            R+ +PL VG+VIG+V+D+F P V+  V Y  +K++ANG E+ PS  A+KP V I G    
Sbjct  3    RTTEPLTVGRVIGEVVDIFTPSVKLNVVYNPNKQVANGHELMPSVIAEKPRVDIGGDDMR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
               YTLIM DPD P PS+P  +E LHW+VTDIP  +D S G+E  EY  P P  GIHRYV
Sbjct  63   I-AYTLIMTDPDYPGPSDPYLKEHLHWMVTDIPGTTDVSFGKETVEYETPKPVVGIHRYV  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+QR    V  + P SR NF TR+F+  NGLGLPVAA+YFN+Q+++A  ++
Sbjct  122  FLLFKQRGRQTV--RAPASRDNFNTRKFSQENGLGLPVAAVYFNAQRETAARRR  173



>ref|XP_011094363.1| PREDICTED: CEN-like protein 2 isoform X2 [Sesamum indicum]
Length=173

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 114/173 (66%), Gaps = 2/173 (1%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R  DPL+VG+VIGDVLD F P  +  V Y +K++ NG E  PS+   KP V I G     
Sbjct  3    RMSDPLIVGRVIGDVLDSFSPTTKMFVTYANKQVFNGHEFYPSAVVMKPRVEIQGGDLR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
              YTL+M DPD P PS+P  RE LHW+VTDIP  +DA+ G+E+A Y  P P  GIHR+VF
Sbjct  62   TFYTLVMTDPDVPGPSDPYLREHLHWLVTDIPGTTDATFGKELASYEIPKPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q    Q  +  P +R  F TR+FA  NGLGLPVAA++FN+Q+++A  ++
Sbjct  122  VLFKQ-TGRQTVKNLPTTRDCFNTRRFAVENGLGLPVAAVFFNAQRETAARRR  173



>ref|NP_196004.1| protein TERMINAL FLOWER 1 [Arabidopsis thaliana]
 sp|P93003.1|TFL1_ARATH RecName: Full=Protein TERMINAL FLOWER 1 [Arabidopsis thaliana]
 gb|AAM27943.1|AF466803_1 terminal flower 1 [Arabidopsis thaliana]
 gb|AAM27944.1|AF466804_1 terminal flower 1 [Arabidopsis thaliana]
 gb|AAM27945.1|AF466805_1 terminal flower 1 [Arabidopsis thaliana]
 gb|AAM27946.1|AF466806_1 terminal flower 1 [Arabidopsis thaliana]
 gb|AAM27948.1|AF466808_1 terminal flower 1 [Arabidopsis thaliana]
 gb|AAM27949.1|AF466809_1 terminal flower 1 [Arabidopsis thaliana]
 gb|AAM27950.1|AF466810_1 terminal flower 1 [Arabidopsis thaliana]
 gb|AAM27951.1|AF466811_1 terminal flower 1 [Arabidopsis thaliana]
 gb|AAM27954.1|AF466814_1 terminal flower 1 [Arabidopsis thaliana]
 gb|AAM27955.1|AF466815_1 terminal flower 1 [Arabidopsis thaliana]
 gb|AAM27956.1|AF466816_1 terminal flower 1 [Arabidopsis thaliana]
 gb|AAB41624.1| terminal flower 1 [Arabidopsis thaliana]
 dbj|BAA20483.1| terminal flower1 [Arabidopsis thaliana]
 dbj|BAA20484.1| terminal flower1 [Arabidopsis thaliana]
 dbj|BAA20485.1| terminal flower1 [Arabidopsis thaliana]
 emb|CAB85504.1| Terminal flower1 (TFL1) [Arabidopsis thaliana]
 dbj|BAB08610.1| terminal flower 1 [Arabidopsis thaliana]
 gb|ABD60711.1| At5g03840 [Arabidopsis thaliana]
 gb|ABY79172.1| At5g03840 [Arabidopsis thaliana]
 gb|ABY79173.1| At5g03840 [Arabidopsis thaliana]
 gb|ABY79177.1| At5g03840 [Arabidopsis thaliana]
 gb|ABY79186.1| At5g03840 [Arabidopsis thaliana]
 gb|ABY79187.1| At5g03840 [Arabidopsis thaliana]
 gb|ABY79188.1| At5g03840 [Arabidopsis thaliana]
 gb|ABY79189.1| At5g03840 [Arabidopsis thaliana]
 gb|ABY79190.1| At5g03840 [Arabidopsis thaliana]
 gb|ABY79193.1| At5g03840 [Arabidopsis thaliana]
 gb|ABY79194.1| At5g03840 [Arabidopsis thaliana]
 gb|AED90661.1| protein TERMINAL FLOWER 1 [Arabidopsis thaliana]
Length=177

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 121/179 (68%), Gaps = 2/179 (1%)
 Frame = +3

Query  18   MANANPRSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHIN  197
            M N   R ++PL++G+V+GDVLD F P  +  V Y  K+++NG E+ PSS + KP V I+
Sbjct  1    MENMGTRVIEPLIMGRVVGDVLDFFTPTTKMNVSYNKKQVSNGHELFPSSVSSKPRVEIH  60

Query  198  GSPASPNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTG  377
            G     + +TL+M+DPD P PS+P  +E LHW+VT+IP  +DA+ G+EV  Y  P P  G
Sbjct  61   GGDLR-SFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTTDATFGKEVVSYELPRPSIG  119

Query  378  IHRYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            IHR+VF LFRQ++   +    P SR +F TR+FA    LGLPVAA++FN+Q+++A  K+
Sbjct  120  IHRFVFVLFRQKQRRVIFPNIP-SRDHFNTRKFAVEYDLGLPVAAVFFNAQRETAARKR  177



>ref|NP_001267006.1| protein TERMINAL FLOWER 1-like [Fragaria vesca]
 gb|ADO64258.1| TFL1-like protein [Fragaria vesca]
 gb|AEP23097.1| terminal flower 1 [Fragaria vesca]
 dbj|BAO93909.1| terminal flower 1 [Fragaria x ananassa]
Length=172

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 113/173 (65%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R  +PL VG+VIGDVLD F P  +  V Y SK + NG E+ PS+   KP V I G     
Sbjct  3    RMSEPLAVGRVIGDVLDSFTPTTKMIVSYNSKLVCNGHELFPSAVTAKPRVEIQGGDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            + +TL+M DPD P PS+P  +E LHW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF
Sbjct  62   SFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF Q+    V   PP SR +F TR FAA N LG+PVAA+YFN+Q+++A  ++
Sbjct  122  VLFMQKRRQSV--NPPSSRDHFNTRTFAAENDLGVPVAAVYFNAQRETAARRR  172



>ref|XP_002447782.1| hypothetical protein SORBIDRAFT_06g015490 [Sorghum bicolor]
 gb|EES12110.1| hypothetical protein SORBIDRAFT_06g015490 [Sorghum bicolor]
Length=173

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 119/174 (68%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSK-KIANGVEITPSSAAQKPSVHINGSPAS  212
            R ++PLVVGKVIG+V+D F P V+ TV YGS  ++ NG E  PS+   KP V + G    
Sbjct  3    RVLEPLVVGKVIGEVIDNFNPTVKMTVTYGSNNQVFNGHEFFPSAVLSKPRVEVQGDDMR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TL+M DPD P PS+P  RE LHW+VTDIP  +DAS G E+A Y  P P  GIHR+V
Sbjct  63   -SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGTELAMYESPKPYIGIHRFV  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q+    V  +PP SR  F TR+FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  FVLFKQKSRQSV--RPPSSRDYFSTRRFAADNDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_002873117.1| hypothetical protein ARALYDRAFT_487163 [Arabidopsis lyrata subsp. 
lyrata]
 gb|ABY79195.1| At5g03840-like protein [Arabidopsis lyrata]
 gb|EFH49376.1| hypothetical protein ARALYDRAFT_487163 [Arabidopsis lyrata subsp. 
lyrata]
Length=177

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 122/179 (68%), Gaps = 2/179 (1%)
 Frame = +3

Query  18   MANANPRSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHIN  197
            M N   R ++PL++G+V+GDVLD F P ++  V Y  K+++NG E+ PSS + KP V I+
Sbjct  1    MENMGTRVIEPLIMGRVVGDVLDFFTPTIKMNVSYNKKQVSNGHELFPSSVSSKPRVEIH  60

Query  198  GSPASPNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTG  377
            G     + +TL+M+DPD P PS+P  +E LHW+VT+IP  +DA+ G+EV  Y  P P  G
Sbjct  61   GGDLR-SFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTTDATFGKEVVSYELPRPSIG  119

Query  378  IHRYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            IHR+VF LF+Q++   +    P SR +F TR+FA    LGLPVAA++FN+Q+++A  K+
Sbjct  120  IHRFVFVLFKQKQRRVIFPNIP-SRDHFNTRKFAVEYDLGLPVAAVFFNAQRETAARKR  177



>ref|NP_001106244.1| ZCN5 protein [Zea mays]
 gb|ABW96228.1| ZCN5 [Zea mays]
Length=173

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 117/174 (67%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGS-KKIANGVEITPSSAAQKPSVHINGSPAS  212
            R+++PLVVGKVIG+V+D F P V+ TV YGS K++ NG E  PS+   KP V + G    
Sbjct  3    RALEPLVVGKVIGEVIDNFNPTVKMTVTYGSDKQVFNGHEFLPSAVLSKPRVQVQGDDMR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TL+M DPD P PS+P  RE LHW+VTDIP  +DAS GRE   Y  P P  G HR+V
Sbjct  63   -SFFTLVMTDPDVPGPSDPYLREHLHWMVTDIPGTTDASFGREQVMYESPKPYIGFHRFV  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q     V   PP SR  F TR+FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  FVLFKQSSRQSVC--PPSSRDYFNTRRFAADNNLGLPVAAVYFNAQRETAARRR  173



>ref|XP_007162890.1| hypothetical protein PHAVU_001G189200g [Phaseolus vulgaris]
 gb|ESW34884.1| hypothetical protein PHAVU_001G189200g [Phaseolus vulgaris]
Length=220

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 121/181 (67%), Gaps = 4/181 (2%)
 Frame = +3

Query  12   HTMANANPRSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVH  191
            HT+  A    ++PL+VG+VIG+VLD F   ++ TV Y  K++ NG E+ PSS   KP V 
Sbjct  44   HTLVMAR-MPLEPLIVGRVIGEVLDSFTTSMKMTVSYNKKQVYNGHELFPSSVNTKPKVQ  102

Query  192  INGSPASPNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPP  371
            I G+    + +TLIM DPD P PS+P  RE LHW+VTDIP  +DA+ G+E+  Y  P P 
Sbjct  103  IEGADMR-SFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPKPN  161

Query  372  TGIHRYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNK  551
             GIHR+VF LF+Q+    V   PP SR +F TR FAA N LGLPVAA+YFN+Q+++A  +
Sbjct  162  IGIHRFVFVLFKQKRRQCVT--PPTSRDHFNTRNFAAQNDLGLPVAAVYFNAQRETAARR  219

Query  552  K  554
            +
Sbjct  220  R  220



>pdb|1WKO|A Chain A, Terminal Flower 1 (Tfl1) From Arabidopsis Thaliana
 pdb|1WKO|B Chain B, Terminal Flower 1 (Tfl1) From Arabidopsis Thaliana
Length=180

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 121/179 (68%), Gaps = 2/179 (1%)
 Frame = +3

Query  18   MANANPRSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHIN  197
            M N   R ++PL++G+V+GDVLD F P  +  V Y  K+++NG E+ PSS + KP V I+
Sbjct  4    MENMGTRVIEPLIMGRVVGDVLDFFTPTTKMNVSYNKKQVSNGHELFPSSVSSKPRVEIH  63

Query  198  GSPASPNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTG  377
            G     + +TL+M+DPD P PS+P  +E LHW+VT+IP  +DA+ G+EV  Y  P P  G
Sbjct  64   GGDLR-SFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTTDATFGKEVVSYELPRPSIG  122

Query  378  IHRYVFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            IHR+VF LFRQ++   +    P SR +F TR+FA    LGLPVAA++FN+Q+++A  K+
Sbjct  123  IHRFVFVLFRQKQRRVIFPNIP-SRDHFNTRKFAVEYDLGLPVAAVFFNAQRETAARKR  180



>ref|XP_007202664.1| hypothetical protein PRUPE_ppa012369mg [Prunus persica]
 gb|ADL62867.1| terminal flower 1 [Prunus persica]
 gb|EMJ03863.1| hypothetical protein PRUPE_ppa012369mg [Prunus persica]
Length=172

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 111/173 (64%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R  +PLVVG+VIGDVLD F P  + +V Y ++ + NG E+ PS+   KP V I G     
Sbjct  3    RISEPLVVGRVIGDVLDCFTPTTKMSVTYNTRLVCNGYELYPSAVTTKPRVEIQGGDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
              +TLIM DPD P PS+P  RE LHW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF
Sbjct  62   TFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q     V   PP SR +F  R FAA N LG PVAA+YFN Q+++A  ++
Sbjct  122  VLFKQTRRQSV--NPPSSRDHFSARSFAAENDLGPPVAAVYFNCQRETAARRR  172



>ref|XP_009374732.1| PREDICTED: protein TERMINAL FLOWER 1-like [Pyrus x bretschneideri]
 dbj|BAD10963.1| TFL1-like protein [Pyrus communis]
 dbj|BAJ33557.1| terminal flower 1 [Pyrus pyrifolia var. culta]
 dbj|BAK74838.1| terminal flowering 1 [Pyrus pyrifolia]
Length=172

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 114/173 (66%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R+ +PLVVG+VIGDVLD F    + +V Y +K + NG+E+ PS    KP V I G     
Sbjct  3    RASEPLVVGRVIGDVLDSFTATTKMSVTYNTKLVCNGLELFPSVVTAKPRVEIQGGDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            + +TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF
Sbjct  62   SFFTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPKPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q     +    P SR +F TR FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  VLFKQNRRQSI--NTPSSRDHFSTRSFAAENDLGLPVAAVYFNAQRETAARRR  172



>gb|EYU25074.1| hypothetical protein MIMGU_mgv1a022196mg [Erythranthe guttata]
Length=174

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 116/175 (66%), Gaps = 5/175 (3%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEF--TVDYGSKKIANGVEITPSSAAQKPSVHINGSPA  209
            R V+PL VG+VIG+V+D F P V+   T  YG+K+++NG E+ P+    KP V I G   
Sbjct  3    RLVEPLSVGRVIGEVVDSFTPCVKLNITYSYGNKQVSNGHELMPAVLTSKPRVEIGGEDL  62

Query  210  SPNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRY  389
                YTL+M DPD P PS+P  RE LHW+VTDIP  +DAS GRE+  Y  P P  GIHRY
Sbjct  63   RA-AYTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREIVSYETPKPVIGIHRY  121

Query  390  VFALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            VF LF+QR    V   PP SR +F TR FA  NGLG PVAA+YFN+Q+++A  ++
Sbjct  122  VFVLFKQRGRHTV--NPPSSRNHFNTRTFAEDNGLGPPVAAVYFNAQRETACRRR  174



>gb|ABX11007.1| ZCN5 [Zea mays]
 gb|AFW58184.1| hypothetical protein ZEAMMB73_478740 [Zea mays]
Length=173

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 117/174 (67%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGS-KKIANGVEITPSSAAQKPSVHINGSPAS  212
            R+++PLVVGKVIG+V+D F P V+ TV YGS K++ NG E  PS+   KP V + G    
Sbjct  3    RALEPLVVGKVIGEVIDNFNPTVKMTVTYGSDKQVFNGHEFFPSAVLSKPRVQVQGDDMR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TL+M DPD P PS+P  RE LHW+VTDIP  +DAS GRE   Y  P P  G HR+V
Sbjct  63   -SFFTLVMTDPDVPGPSDPYLREHLHWMVTDIPGTTDASFGREQVMYESPKPYIGFHRFV  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q     V   PP SR  F TR+FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  FVLFKQSSRQSVC--PPSSRDYFNTRRFAADNNLGLPVAAVYFNAQRETAARRR  173



>ref|NP_001106241.1| ZCN2 protein [Zea mays]
 gb|ABW96225.1| ZCN2 [Zea mays]
 gb|ABX11004.1| ZCN2 [Zea mays]
 gb|AFW62511.1| ZCN2 [Zea mays]
Length=173

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 117/174 (67%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGS-KKIANGVEITPSSAAQKPSVHINGSPAS  212
            R ++PL+VGKVIG+VLD F P V+  V Y S K++ NG E  PS+ A KP V + G    
Sbjct  3    RVLEPLIVGKVIGEVLDHFNPTVKMVVTYNSNKQVFNGHEFFPSAVAAKPRVEVQGGDLR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TL+M DPD P PS+P  RE LHW+VTDIP  +DAS G+EV  Y  P P  GIHR++
Sbjct  63   -SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGKEVVSYEIPKPNIGIHRFI  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LFRQ+    V   PP S+  F TRQFA  N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  FVLFRQKSRQAV--NPPSSKDRFSTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>gb|AFK32780.1| TFL1-like protein [Eriobotrya japonica]
Length=172

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 114/173 (66%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R+++PLVVG+VIGDVLD F    + +V Y +K + NG+E+ PS    KP V I G     
Sbjct  3    RALEPLVVGRVIGDVLDSFTATTKMSVTYNTKLVCNGLEVFPSVVTAKPRVEIQGGDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            +  TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF
Sbjct  62   SFLTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q     +    P SR +F TR FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  VLFKQNRRQSI--NTPSSRDHFSTRSFAAENDLGLPVAAVYFNAQRETAARRR  172



>gb|AGX25244.1| MCN5 [Musa acuminata AAA Group]
 gb|AGX25249.1| MCN5 [Musa acuminata AAA Group]
Length=173

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 118/174 (68%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIA-NGVEITPSSAAQKPSVHINGSPAS  212
            R +DPLVVG+VIG+VLD F P V+  V Y S K+  NG E+ PS+ A KP V + G    
Sbjct  3    RLIDPLVVGRVIGEVLDSFNPSVKMLVTYNSNKLVFNGHELYPSAVASKPRVEVQGGDMR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TL+M DPDAP PS+P  RE LHW+VTDIP  +DAS GRE+  Y  P P  GIHR+V
Sbjct  63   -SFFTLVMTDPDAPGPSDPYLREHLHWIVTDIPGTTDASFGREMVSYESPRPNIGIHRFV  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q+    V+  PP S   F TR+FA  N LGLPVAA++FNSQ+++A  ++
Sbjct  122  FVLFKQQRRQAVS--PPSSTDYFSTRRFAEENDLGLPVAAVFFNSQRETAARRR  173



>gb|ABY91243.1| CTRSTFL-like protein [Citrus trifoliata]
Length=173

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 117/173 (68%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R ++PL VG+VIGDV++ F P ++ +V Y +K++ NG E+ PS+   KP V I G     
Sbjct  4    RMLEPLAVGRVIGDVIESFTPSIKKSVTYNNKQVCNGHELFPSTVVSKPRVEIQGGDMR-  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            + +TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GRE+  Y  P P  GIHR+VF
Sbjct  63   SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPRPNIGIHRFVF  122

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q     V   PP SR +F TR FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  123  VLFKQTRRQTV--NPPSSRDHFNTRAFAAENDLGLPVAAVYFNAQRETAARRR  173



>dbj|BAH24197.1| homologous protein to TFL1 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95559.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99487.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=173

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 114/174 (66%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIA-NGVEITPSSAAQKPSVHINGSPAS  212
            RSV+PL+VG+VIG+VLD F P V+    Y S K+  NG E+ PS+   KP V + G    
Sbjct  3    RSVEPLIVGRVIGEVLDTFNPCVKMVTTYNSNKLVFNGHELYPSAVVSKPRVEVQGDGLR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             +L+TL+M DPD P PS+P  RE LHW+VTDIP  +DAS GREV  Y  P P  GIHR++
Sbjct  63   -SLFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPKPNIGIHRFI  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q+    V    P  R  F TRQFA  N LGLPVAA+YFN Q+++A  ++
Sbjct  122  FVLFKQKRRQTVTV--PSFRDQFNTRQFAEENDLGLPVAAVYFNCQRETAARRR  173



>ref|XP_011077877.1| PREDICTED: CEN-like protein 2 [Sesamum indicum]
Length=172

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 114/171 (67%), Gaps = 2/171 (1%)
 Frame = +3

Query  45   DPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIA-NGVEITPSSAAQKPSVHINGSPASPNL  221
            + L+VG+VI DV+D F P V+  V YG+K++  NG E  PS+ A  P VHI G     + 
Sbjct  3    EALIVGRVIDDVVDFFTPTVKMCVVYGNKQVCINGYEFYPSAVASTPRVHIQGGDLRTS-  61

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            YTL+M DPD P PS+P  RE LHW+VTDIP  +D + G+EV  Y  P P  GIHR+VF L
Sbjct  62   YTLVMTDPDVPGPSDPYLREHLHWLVTDIPGTTDTTFGKEVVSYEKPRPNIGIHRFVFLL  121

Query  402  FRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F+QR    V   P  SR  F TR+FAA NGLGLPVAA++FN+Q+++A  ++
Sbjct  122  FQQRGRQTVVNLPAASRDYFNTRRFAAENGLGLPVAAVFFNAQRETAARRR  172



>gb|ADF30943.1| Dt1 [Glycine max]
 gb|ADF30951.1| Dt1 [Glycine max]
 gb|ADF30952.1| Dt1 [Glycine max]
 gb|ADF31012.1| Dt1 [Glycine max]
 gb|ADF31015.1| Dt1 [Glycine max]
 gb|ADF31018.1| Dt1 [Glycine max]
 gb|ADF31024.1| Dt1 [Glycine max]
 gb|ADF31029.1| Dt1 [Glycine max]
 gb|ADF31030.1| Dt1 [Glycine max]
 gb|ADF31059.1| Dt1 [Glycine max]
 gb|ADF31071.1| Dt1 [Glycine max]
 gb|ADF31074.1| Dt1 [Glycine max]
 gb|ADF31079.1| Dt1 [Glycine max]
 gb|ADF31108.1| Dt1 [Glycine max]
 gb|ADF31131.1| Dt1 [Glycine max]
 gb|ADF31147.1| Dt1 [Glycine max]
 gb|ADF31166.1| Dt1 [Glycine max]
 gb|ADF31189.1| Dt1 [Glycine max]
Length=173

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 116/171 (68%), Gaps = 3/171 (2%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            ++PL+VG+VIG+VLD F    + TV Y  K++ NG E+ PS+   KP V I G     + 
Sbjct  6    LEPLIVGRVIGEVLDSFTTSTKMTVSYNKKQVYNGHELFPSTVNTKPKVEIEGGDMR-SF  64

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            +TLIM DPD P PS+P  RE LHW+VTDIP  +DA+ G+E+  Y  P P  GIHR+VF L
Sbjct  65   FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEVPKPNIGIHRFVFVL  124

Query  402  FRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F+Q+    V   PP SR +F TR+FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  125  FKQKRKQCVT--PPTSRDHFNTRKFAAENDLGLPVAAVYFNAQRETAARRR  173



>gb|AEO72027.1| TFL1-like protein [Fragaria vesca]
Length=172

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 114/173 (66%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R  +PL VG+VIGDVLD F P  +  V Y SK + NG E+ PS+   KP V I G     
Sbjct  3    RMSEPLAVGRVIGDVLDSFTPTTKMIVSYNSKLVCNGHELFPSAVTAKPRVEIQGGDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            + +TL+M DPD P PS+P  +E LHW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF
Sbjct  62   SFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF Q+   + +  PP SR +F TR FAA N LG+PVAA+YFN+Q+++A  ++
Sbjct  122  VLFMQKR--RQSMNPPSSRDHFNTRTFAAENDLGVPVAAVYFNAQRETAARRR  172



>ref|NP_001280794.1| protein TERMINAL FLOWER 1-like [Malus domestica]
 dbj|BAD10967.1| TFL1-like protein [Malus domestica]
 dbj|BAG31956.1| TFL1 like protein [Malus domestica]
 dbj|BAG31959.1| TFL1 like protein [Malus domestica]
 gb|ACD69429.1| terminal flower 1 [Malus domestica]
 gb|ACF18114.1| terminal flower 1 [Malus domestica]
Length=172

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 111/170 (65%), Gaps = 3/170 (2%)
 Frame = +3

Query  45   DPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNLY  224
            +PLVVG+VIGDVLD F P    +V Y +K + NG+E+ PS    KP V I G     + +
Sbjct  6    EPLVVGRVIGDVLDSFTPTTHMSVTYNAKLVCNGLELFPSVVTAKPRVEIQGGELR-SFF  64

Query  225  TLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFALF  404
            TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GRE   Y  P P  GIHR+VF LF
Sbjct  65   TLVMTDPDCPGPSDPYLREHLHWIVTDIPGTTDAAFGREALSYEMPRPNIGIHRFVFVLF  124

Query  405  RQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            +Q+    +    P SR  F TR FAA N LGLPVAA+YFN+Q++SA  ++
Sbjct  125  KQKRRQSI--NIPSSRDCFSTRSFAAENDLGLPVAAVYFNAQRESAARRR  172



>gb|ADK95113.1| flowering locus T-like protein [Gossypium hirsutum]
 gb|AEW24444.1| flowering locus T-like protein 1 [Gossypium barbadense]
Length=174

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 112/175 (64%), Gaps = 3/175 (2%)
 Frame = +3

Query  33   PRSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPAS  212
            PR  DPLVVG+VIGDVLD F   +   V Y ++ ++NGVE+ PS    +P V I G    
Sbjct  2    PRDRDPLVVGRVIGDVLDPFTRSISLRVTYATRDVSNGVELKPSQVVNQPRVDIGGDDLR  61

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
               YTL+MVDPDAPSPS+P  RE+LHW+VTDIP  + AS G+EV  Y  P P  GIHR+V
Sbjct  62   -TFYTLVMVDPDAPSPSDPNLREYLHWLVTDIPATTGASFGQEVVCYESPRPTVGIHRFV  120

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKKR  557
            F LFRQ     V    P  R NF TR FA    LGLPVAA+YFN Q++S +  +R
Sbjct  121  FVLFRQLGRQTVYA--PGWRQNFNTRDFAELYNLGLPVAAVYFNCQRESGSGGRR  173



>gb|KDP22308.1| hypothetical protein JCGZ_26139 [Jatropha curcas]
 gb|AID51388.1| terminal flower 1c [Jatropha curcas]
 gb|AID51394.1| terminal flower 1c [Jatropha curcas]
Length=175

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 118/170 (69%), Gaps = 4/170 (2%)
 Frame = +3

Query  48   PLVVGKVIGDVLDMFVPVVEFTVDYG-SKKIANGVEITPSSAAQKPSVHINGSPASPNLY  224
            PL VG++IG+V+D F P V+ +V Y  ++++ANG E+ PS  A KP V I G     + Y
Sbjct  9    PLTVGRIIGEVVDAFTPSVKMSVTYNPNRQVANGHELMPSVIAAKPRVEIGGQDLRTS-Y  67

Query  225  TLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFALF  404
            TLIM DPDAPSPS+P  RE +HW+VTDIP  +D S G+E+  Y  P P  GIHRYVF LF
Sbjct  68   TLIMTDPDAPSPSDPHLREHIHWMVTDIPGTTDVSFGKEIVSYESPKPVVGIHRYVFLLF  127

Query  405  RQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            +QR    V  +PP SR  F TR+FA  NGLGLPVAA+YFN+Q+++A  ++
Sbjct  128  KQRGRQTV--RPPISRDYFNTRRFAEENGLGLPVAAVYFNAQRETAARRR  175



>gb|AGX25243.1| MCN4 [Musa acuminata AAA Group]
 gb|AGX25248.1| MCN4 [Musa acuminata AAA Group]
 gb|AGX25253.1| MCN4 [Musa AAB Group]
 gb|AGX25258.1| MCN4 [Musa AAB Group]
Length=173

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 115/174 (66%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIA-NGVEITPSSAAQKPSVHINGSPAS  212
            R V+PLVVG+VIG+VLD F P V   V Y S K+  NG E  PS+   +P V + G    
Sbjct  3    RPVEPLVVGRVIGEVLDSFRPSVRILVTYSSNKLVFNGHEFYPSTVTSRPRVEVQGGDMR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TL+M DPD P PS+P  RE LHW+VTDIP  +DAS GREV  Y  P P  GIHR+V
Sbjct  63   -SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPRPNIGIHRFV  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q+    V+  PP SR  F TR+FA  NGL LPVAA+YFNSQ+++A  ++
Sbjct  122  FVLFKQKRRQAVS--PPASRDRFSTRRFAEENGLDLPVAAVYFNSQRETAARRR  173



>gb|ACJ61501.1| terminal flower [Glycine max]
 gb|ACU00123.1| terminal flowering 1-like protein 1 [Glycine max]
 gb|ADF30893.1| Dt1 [Glycine max]
 gb|ADF30894.1| Dt1 [Glycine max]
 gb|ADF30897.1| Dt1 [Glycine max]
 gb|ADF30898.1| Dt1 [Glycine max]
 gb|ADF30900.1| Dt1 [Glycine max]
 gb|ADF30901.1| Dt1 [Glycine max]
 gb|ADF30903.1| Dt1 [Glycine max]
 gb|ADF30906.1| Dt1 [Glycine max]
 gb|ADF30907.1| Dt1 [Glycine max]
 gb|ADF30908.1| Dt1 [Glycine max]
 gb|ADF30911.1| Dt1 [Glycine max]
 gb|ADF30912.1| Dt1 [Glycine max]
 gb|ADF30913.1| Dt1 [Glycine max]
 gb|ADF30915.1| Dt1 [Glycine max]
 gb|ADF30916.1| Dt1 [Glycine max]
 gb|ADF30917.1| Dt1 [Glycine max]
 gb|ADF30919.1| Dt1 [Glycine max]
 gb|ADF30922.1| Dt1 [Glycine max]
 gb|ADF30926.1| Dt1 [Glycine max]
 gb|ADF30928.1| Dt1 [Glycine max]
 gb|ADF30931.1| Dt1 [Glycine max]
 gb|ADF30937.1| Dt1 [Glycine max]
 gb|ADF30939.1| Dt1 [Glycine max]
 gb|ADF30940.1| Dt1 [Glycine max]
 gb|ADF30941.1| Dt1 [Glycine max]
 gb|ADF30946.1| Dt1 [Glycine max]
 gb|ADF30947.1| Dt1 [Glycine max]
 gb|ADF30954.1| Dt1 [Glycine max]
 gb|ADF30956.1| Dt1 [Glycine max]
 gb|ADF30957.1| Dt1 [Glycine max]
 gb|ADF30964.1| Dt1 [Glycine max]
 gb|ADF30966.1| Dt1 [Glycine max]
 gb|ADF30967.1| Dt1 [Glycine max]
 gb|ADF30969.1| Dt1 [Glycine max]
 gb|ADF30971.1| Dt1 [Glycine max]
 gb|ADF30973.1| Dt1 [Glycine max]
 gb|ADF30974.1| Dt1 [Glycine max]
 gb|ADF30976.1| Dt1 [Glycine max]
 gb|ADF30978.1| Dt1 [Glycine max]
 gb|ADF30979.1| Dt1 [Glycine max]
 gb|ADF30980.1| Dt1 [Glycine max]
 gb|ADF30981.1| Dt1 [Glycine soja]
 gb|ADF30982.1| Dt1 [Glycine soja]
 gb|ADF30983.1| Dt1 [Glycine soja]
 gb|ADF30984.1| Dt1 [Glycine soja]
 gb|ADF30985.1| Dt1 [Glycine soja]
 gb|ADF30986.1| Dt1 [Glycine soja]
 gb|ADF30987.1| Dt1 [Glycine soja]
 gb|ADF30988.1| Dt1 [Glycine soja]
 gb|ADF30989.1| Dt1 [Glycine soja]
 gb|ADF30990.1| Dt1 [Glycine soja]
 gb|ADF30991.1| Dt1 [Glycine soja]
 gb|ADF30992.1| Dt1 [Glycine soja]
 gb|ADF30993.1| Dt1 [Glycine soja]
 gb|ADF30994.1| Dt1 [Glycine soja]
 gb|ADF30995.1| Dt1 [Glycine soja]
 gb|ADF30996.1| Dt1 [Glycine soja]
 gb|ADF30997.1| Dt1 [Glycine soja]
 gb|ADF30998.1| Dt1 [Glycine soja]
 gb|ADF30999.1| Dt1 [Glycine soja]
 gb|ADF31000.1| Dt1 [Glycine soja]
 gb|ADF31002.1| Dt1 [Glycine max]
 gb|ADF31003.1| Dt1 [Glycine max]
 gb|ADF31004.1| Dt1 [Glycine max]
 gb|ADF31005.1| Dt1 [Glycine max]
 gb|ADF31008.1| Dt1 [Glycine max]
 gb|ADF31009.1| Dt1 [Glycine max]
 gb|ADF31010.1| Dt1 [Glycine max]
 gb|ADF31011.1| Dt1 [Glycine max]
 gb|ADF31013.1| Dt1 [Glycine max]
 gb|ADF31014.1| Dt1 [Glycine max]
 gb|ADF31016.1| Dt1 [Glycine max]
 gb|ADF31017.1| Dt1 [Glycine max]
 gb|ADF31020.1| Dt1 [Glycine max]
 gb|ADF31021.1| Dt1 [Glycine max]
 gb|ADF31025.1| Dt1 [Glycine max]
 gb|ADF31026.1| Dt1 [Glycine max]
 gb|ADF31027.1| Dt1 [Glycine max]
 gb|ADF31031.1| Dt1 [Glycine max]
 gb|ADF31034.1| Dt1 [Glycine max]
 gb|ADF31039.1| Dt1 [Glycine max]
 gb|ADF31040.1| Dt1 [Glycine max]
 gb|ADF31041.1| Dt1 [Glycine max]
 gb|ADF31045.1| Dt1 [Glycine max]
 gb|ADF31050.1| Dt1 [Glycine max]
 gb|ADF31051.1| Dt1 [Glycine max]
 gb|ADF31052.1| Dt1 [Glycine max]
 gb|ADF31053.1| Dt1 [Glycine max]
 gb|ADF31054.1| Dt1 [Glycine max]
 gb|ADF31055.1| Dt1 [Glycine max]
 gb|ADF31056.1| Dt1 [Glycine max]
 gb|ADF31058.1| Dt1 [Glycine max]
 gb|ADF31060.1| Dt1 [Glycine max]
 gb|ADF31062.1| Dt1 [Glycine max]
 gb|ADF31063.1| Dt1 [Glycine max]
 gb|ADF31064.1| Dt1 [Glycine max]
 gb|ADF31065.1| Dt1 [Glycine max]
 gb|ADF31066.1| Dt1 [Glycine max]
 gb|ADF31067.1| Dt1 [Glycine max]
 gb|ADF31069.1| Dt1 [Glycine max]
 gb|ADF31070.1| Dt1 [Glycine max]
 gb|ADF31073.1| Dt1 [Glycine max]
 gb|ADF31078.1| Dt1 [Glycine max]
 gb|ADF31083.1| Dt1 [Glycine max]
 gb|ADF31095.1| Dt1 [Glycine max]
 gb|ADF31102.1| Dt1 [Glycine max]
 gb|ADF31110.1| Dt1 [Glycine max]
 gb|ADF31111.1| Dt1 [Glycine max]
 gb|ADF31112.1| Dt1 [Glycine max]
 gb|ADF31113.1| Dt1 [Glycine max]
 gb|ADF31114.1| Dt1 [Glycine max]
 gb|ADF31115.1| Dt1 [Glycine max]
 gb|ADF31117.1| Dt1 [Glycine max]
 gb|ADF31118.1| Dt1 [Glycine max]
 gb|ADF31121.1| Dt1 [Glycine max]
 gb|ADF31124.1| Dt1 [Glycine max]
 gb|ADF31125.1| Dt1 [Glycine max]
 gb|ADF31127.1| Dt1 [Glycine max]
 gb|ADF31129.1| Dt1 [Glycine max]
 gb|ADF31130.1| Dt1 [Glycine max]
 gb|ADF31132.1| Dt1 [Glycine max]
 gb|ADF31137.1| Dt1 [Glycine max]
 gb|ADF31138.1| Dt1 [Glycine max]
 gb|ADF31139.1| Dt1 [Glycine max]
 gb|ADF31140.1| Dt1 [Glycine max]
 gb|ADF31141.1| Dt1 [Glycine max]
 gb|ADF31142.1| Dt1 [Glycine max]
 gb|ADF31146.1| Dt1 [Glycine max]
 gb|ADF31148.1| Dt1 [Glycine max]
 gb|ADF31149.1| Dt1 [Glycine max]
 gb|ADF31150.1| Dt1 [Glycine max]
 gb|ADF31153.1| Dt1 [Glycine max]
 gb|ADF31154.1| Dt1 [Glycine max]
 gb|ADF31156.1| Dt1 [Glycine max]
 gb|ADF31157.1| Dt1 [Glycine max]
 gb|ADF31161.1| Dt1 [Glycine max]
 gb|ADF31163.1| Dt1 [Glycine max]
 gb|ADF31164.1| Dt1 [Glycine max]
 gb|ADF31169.1| Dt1 [Glycine max]
 gb|ADF31173.1| Dt1 [Glycine max]
 gb|ADF31177.1| Dt1 [Glycine max]
 gb|ADF31178.1| Dt1 [Glycine max]
 gb|ADF31180.1| Dt1 [Glycine max]
 gb|ADF31181.1| Dt1 [Glycine max]
 gb|ADF31183.1| Dt1 [Glycine max]
 gb|ADF31187.1| Dt1 [Glycine max]
 gb|ADF31188.1| Dt1 [Glycine max]
 gb|ADF31192.1| Dt1 [Glycine max]
 gb|ADF31193.1| Dt1 [Glycine max]
 gb|ADF31194.1| Dt1 [Glycine max]
 gb|ADF31195.1| Dt1 [Glycine max]
Length=173

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 116/171 (68%), Gaps = 3/171 (2%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            ++PL+VG+VIG+VLD F    + TV Y  K++ NG E+ PS+   KP V I G     + 
Sbjct  6    LEPLIVGRVIGEVLDSFTTSTKMTVSYNKKQVYNGHELFPSTVNTKPKVEIEGGDMR-SF  64

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            +TLIM DPD P PS+P  RE LHW+VTDIP  +DA+ G+E+  Y  P P  GIHR+VF L
Sbjct  65   FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEVPKPNIGIHRFVFVL  124

Query  402  FRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F+Q+    V   PP SR +F TR+FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  125  FKQKRRQCVT--PPTSRDHFNTRKFAAENDLGLPVAAVYFNAQRETAARRR  173



>gb|AFA42328.1| TFL1-like protein [Fragaria x ananassa]
 gb|AFA52237.1| TFL1-like protein [Fragaria x ananassa]
Length=172

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 113/173 (65%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R  +PL VG+VIGDVLD F P  +  V Y +K + NG E+ PS+   KP V I G     
Sbjct  3    RMSEPLAVGRVIGDVLDSFTPTTKMIVTYNTKLVCNGHELFPSAVTAKPRVEIQGGDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            + +TL+M DPD P PS+P  +E LHW+VTDIP  +DA+ GREV  Y  P P  GIHR+VF
Sbjct  62   SFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF Q+    V   PP SR +F TR FAA N LG+PVAA+YFN+Q+++A  ++
Sbjct  122  VLFMQKRRQSV--NPPSSRDHFNTRTFAAENDLGVPVAAVYFNAQRETAARRR  172



>ref|XP_006481791.1| PREDICTED: protein TERMINAL FLOWER 1 isoform X1 [Citrus sinensis]
Length=173

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 116/173 (67%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R ++PL VG VIGDV++ F P ++ +V Y +K++ NG E+ PS+   KP V I G     
Sbjct  4    RMLEPLAVGGVIGDVIESFTPSIKMSVTYNNKQVCNGHELFPSTVVSKPRVEIQGGDMR-  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            + +TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GRE+  Y  P P  GIHR+VF
Sbjct  63   SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPRPNIGIHRFVF  122

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q     V   PP SR +F TR FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  123  VLFKQTRRQTV--NPPSSRDHFNTRAFAAENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_009379789.1| PREDICTED: protein SELF-PRUNING-like [Musa acuminata subsp. malaccensis]
Length=173

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 115/174 (66%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIA-NGVEITPSSAAQKPSVHINGSPAS  212
            R V+PLVVG+VIG+VLD F P V   + Y S K+  NG E  PS+   +P V + G    
Sbjct  3    RPVEPLVVGRVIGEVLDSFRPSVRILITYSSNKLVFNGHEFYPSTVTSRPRVEVQGGDMR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TL+M DPD P PS+P  RE LHW+VTDIP  +DAS GREV  Y  P P  GIHR+V
Sbjct  63   -SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPRPNIGIHRFV  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q+    V+  PP SR  F TR+FA  NGL LPVAA+YFNSQ+++A  ++
Sbjct  122  FVLFKQKRRQAVS--PPASRDRFSTRRFAEENGLDLPVAAVYFNSQRETAARRR  173



>ref|XP_002864769.1| brother of FT and TFL1 protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41028.1| brother of FT and TFL1 protein [Arabidopsis lyrata subsp. lyrata]
Length=177

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 119/174 (68%), Gaps = 3/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKI-ANGVEITPSSAAQKPSVHINGSPAS  212
            R ++PL+VG+V+GDVL+MF P V   V + S  I +NG E+ PS    KP V I G    
Sbjct  3    REIEPLIVGRVVGDVLEMFNPSVTMRVTFNSNTIVSNGHELAPSLLLSKPRVEIGGQDLR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TLIM+DPDAPSPS P  RE+LHW+VTDIP  +DAS GRE+  Y  P P  GIHRYV
Sbjct  63   -SFFTLIMMDPDAPSPSNPYMREYLHWMVTDIPGTTDASFGREIVRYETPKPVAGIHRYV  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            FALF+QR   Q  +  PE+R  F T+ F++  GL LPVAA+YFN+Q+++A  ++
Sbjct  122  FALFKQR-GRQTVKAGPETRECFNTKAFSSYFGLSLPVAAVYFNAQRETAPRRR  174



>ref|XP_009390747.1| PREDICTED: CEN-like protein 2 [Musa acuminata subsp. malaccensis]
Length=173

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 118/174 (68%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIA-NGVEITPSSAAQKPSVHINGSPAS  212
            R +DPLVVG+VIG+VLD F P V+  V Y S K+  NG E+ PS+   KP V + G    
Sbjct  3    RLIDPLVVGRVIGEVLDSFNPSVKMLVTYNSNKLVFNGHELYPSAVTSKPRVEVQGGDMR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TL+M DPDAP PS+P  RE LHW+VT+IP  +DAS GRE+  Y  P P  GIHR+V
Sbjct  63   -SFFTLVMTDPDAPGPSDPYLREHLHWIVTNIPGTTDASFGREMVSYESPRPNIGIHRFV  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q+    V+  PP SR  F TR+FA  N LGLPVAA++FNSQ+++A  ++
Sbjct  122  FVLFKQQRRQAVS--PPSSRDYFSTRRFAEENDLGLPVAAVFFNSQRETAARRR  173



>ref|XP_010919262.1| PREDICTED: CEN-like protein 1 [Elaeis guineensis]
Length=173

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 114/171 (67%), Gaps = 4/171 (2%)
 Frame = +3

Query  45   DPLVVGKVIGDVLDMFVPVVEFTVDYGS-KKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            +PL VG+VIGDVLD F P V+F V Y + K++ NG E  PS+   KP V I G       
Sbjct  6    EPLAVGRVIGDVLDAFNPSVKFQVIYSTNKQVYNGHEFMPSAILAKPRVEIGGDDMRA-C  64

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            YTLIM DPDAPSPS P  RE LHW+VTDIP  ++AS GRE+  Y  P P  GIHRYVF L
Sbjct  65   YTLIMTDPDAPSPSNPHLREHLHWIVTDIPGTTNASFGRELISYEAPKPFMGIHRYVFVL  124

Query  402  FRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F+Q+    V    P SR +F TR FA  NGLGLPVAA+YFN+Q+++A  ++
Sbjct  125  FKQKGRQTV--HTPSSRDHFNTRNFAEENGLGLPVAAVYFNAQRETAARRR  173



>ref|NP_001239629.1| protein TERMINAL FLOWER 1-like [Glycine max]
 gb|ACM45957.1| TFL1-like protein [Glycine max]
 gb|KHN02232.1| Protein TERMINAL FLOWER 1 [Glycine soja]
Length=170

 Score =   180 bits (457),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 116/171 (68%), Gaps = 3/171 (2%)
 Frame = +3

Query  42   VDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNL  221
            ++PL+VG+VIG+VLD F    + TV Y  K++ NG E+ PS+   KP V I G     + 
Sbjct  3    LEPLIVGRVIGEVLDSFTTSTKMTVSYNKKQVYNGHELFPSTVNTKPKVEIEGGDMR-SF  61

Query  222  YTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFAL  401
            +TLIM DPD P PS+P  RE LHW+VTDIP  +DA+ G+E+  Y  P P  GIHR+VF L
Sbjct  62   FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEVPKPNIGIHRFVFVL  121

Query  402  FRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F+Q+    V   PP SR +F TR+FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  FKQKRRQCVT--PPTSRDHFNTRKFAAENDLGLPVAAVYFNAQRETAARRR  170



>ref|XP_010907126.1| PREDICTED: protein SELF-PRUNING-like [Elaeis guineensis]
Length=173

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 117/174 (67%), Gaps = 4/174 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYG-SKKIANGVEITPSSAAQKPSVHINGSPAS  212
            R+++PL+VG+VIG+VLD F P V+  V Y  +K + NG E  PS+   KP V + G    
Sbjct  3    RALEPLIVGRVIGEVLDSFNPSVKMVVTYNFNKLVCNGHEFYPSAVTSKPRVEVQGDDMR  62

Query  213  PNLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYV  392
             + +TL+M DPD P PS+P  RE LHW+V+DIP  +DAS GREV  Y  P P  GIHR+V
Sbjct  63   -SFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPRPSIGIHRFV  121

Query  393  FALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            F LF+Q+    V   PP SR NF TR+FA  N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  FVLFKQKRRQVVT--PPASRDNFSTRRFAEENDLGLPVAAVYFNAQRETAARRR  173



>gb|ACF18111.1| terminal flower 1 [Malus baccata]
 gb|ACF18117.1| terminal flower 1 [Malus prattii]
 gb|ACF18121.1| terminal flower 1 [Malus yunnanensis]
Length=164

 Score =   180 bits (457),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 109/167 (65%), Gaps = 3/167 (2%)
 Frame = +3

Query  54   VVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPNLYTLI  233
            VVG+VIGDVLD F P    +V Y +K + NG+E+ PS    KP V I G     + +TL+
Sbjct  1    VVGRVIGDVLDSFTPTTHMSVTYNAKLVCNGLELFPSVVTAKPRVEIQGGELR-SFFTLV  59

Query  234  MVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFALFRQR  413
            M DPD P PS+P  RE LHW+VTDIP  +DA+ GRE   Y  P P  GIHR+VF LF+Q+
Sbjct  60   MTDPDCPGPSDPYLREHLHWIVTDIPGTTDAAFGREALSYEMPKPNIGIHRFVFVLFKQK  119

Query  414  EAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
                +   PP SR  F TR FAA N LGLPVAA+YFN+Q++SA  ++
Sbjct  120  RRQSI--NPPSSRDCFSTRSFAAENDLGLPVAAVYFNAQRESAARRR  164



>ref|NP_001275848.1| terminal flower [Citrus sinensis]
 gb|AAR04683.1| terminal flower [Citrus sinensis]
 gb|AAR04684.1| terminal flower [Citrus sinensis]
Length=173

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 116/173 (67%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R ++PL VG VIGDV++ F P ++ +V Y +K++ NG E+ PS+   KP V I G     
Sbjct  4    RMLEPLAVGGVIGDVIESFTPSIKMSVTYDNKQVCNGHELFPSTVVSKPRVEIQGGDMR-  62

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            + +TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GRE+  Y  P P  GIHR+VF
Sbjct  63   SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPRPNIGIHRFVF  122

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             LF+Q     V   PP SR +F TR FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  123  VLFKQTRRQTV--NPPSSRDHFNTRAFAAENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_006353340.1| PREDICTED: CEN-like protein 1-like [Solanum tuberosum]
Length=175

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 118/173 (68%), Gaps = 4/173 (2%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDY-GSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            + +PL VG+VIG+V+D F P V+  V Y GSK+++NG EI P+  A +P V I G     
Sbjct  6    TCEPLAVGRVIGEVVDSFSPSVKMKVIYNGSKQVSNGHEIMPAVVATQPRVEIGGEDMR-  64

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            + YTLIM DPDAPSPS+P  RE LHW+VTDIP  +D S GRE+  Y  P P  GIHRYVF
Sbjct  65   SAYTLIMTDPDAPSPSDPYLREHLHWIVTDIPGTTDISFGREIVCYETPKPVIGIHRYVF  124

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             L++QR    V  K P +R  F TR F+A NGLG PVAA+YFN+Q+++A  ++
Sbjct  125  LLYKQRGRQTV--KAPSTRDQFNTRSFSAENGLGSPVAAVYFNAQRETAARRR  175



>gb|EPS71350.1| hypothetical protein M569_03409, partial [Genlisea aurea]
Length=175

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 116/172 (67%), Gaps = 2/172 (1%)
 Frame = +3

Query  39   SVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASPN  218
            S D L++G+VIGDVLD FV   +  V YG+K++ NG E  PS+ A +P V ING      
Sbjct  6    SYDSLIIGRVIGDVLDPFVITTKMCVSYGNKQLFNGHEFCPSAVALRPRVQINGGDLR-T  64

Query  219  LYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVFA  398
             YTL++ DPD P PS+P  +E LHW+VTDIP  +DA+ G+ V  Y  P P  GIHRYVFA
Sbjct  65   FYTLVLTDPDVPGPSDPYLKEHLHWLVTDIPGTTDATFGKIVVNYENPRPSIGIHRYVFA  124

Query  399  LFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
            LF+Q+ + Q  +  P +R +F TR FA  N LGLPVAA++FN+Q+++A  K+
Sbjct  125  LFQQK-SRQTVRNLPTARDSFNTRHFAGDNDLGLPVAAVFFNAQRETAARKR  175



>gb|AEO72025.1| TFL1-like protein [Spiraea cantoniensis]
Length=172

 Score =   180 bits (457),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 115/173 (66%), Gaps = 3/173 (2%)
 Frame = +3

Query  36   RSVDPLVVGKVIGDVLDMFVPVVEFTVDYGSKKIANGVEITPSSAAQKPSVHINGSPASP  215
            R  +PLVVG+VIGDVLD F+P  + TV + ++ + NG E+ PS+   KP V I G     
Sbjct  3    RMSEPLVVGRVIGDVLDFFIPTTKMTVTFSNRLVRNGHELLPSAVTVKPRVEIQGGDMR-  61

Query  216  NLYTLIMVDPDAPSPSEPTFREWLHWVVTDIPEGSDASKGREVAEYIGPSPPTGIHRYVF  395
            + +TL+M DPD P PS+P  RE LHW+VTDIP  +DA+ GRE   Y  P P  GIHR+VF
Sbjct  62   SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREAVSYEKPRPNIGIHRFVF  121

Query  396  ALFRQREAMQVAQKPPESRGNFRTRQFAAANGLGLPVAALYFNSQKQSATNKK  554
             L++Q+    +   PP SR +F  R FAA N LGLPVAA+YFN+Q+++A  ++
Sbjct  122  ILYKQQRRQSI--NPPSSRDHFCARTFAAENDLGLPVAAVYFNAQRETAARRR  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1213808523552