BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1824_g1_i1 len=6031 path=[1:0-3350 3352:3351-6030]

Length=6031
                                                                      Score     E

ref|XP_006349572.1|  PREDICTED: thyroid adenoma-associated protei...   2533   0.0      
ref|XP_010317892.1|  PREDICTED: thyroid adenoma-associated protei...   2450   0.0      
ref|XP_002277958.2|  PREDICTED: thyroid adenoma-associated protei...   2388   0.0      Vitis vinifera
ref|XP_011098614.1|  PREDICTED: thyroid adenoma-associated protei...   2378   0.0      
emb|CAN72934.1|  hypothetical protein VITISV_020616                    2356   0.0      Vitis vinifera
gb|EYU34083.1|  hypothetical protein MIMGU_mgv1a000040mg               2313   0.0      
emb|CDP02224.1|  unnamed protein product                               2294   0.0      
ref|XP_007032508.1|  Uncharacterized protein TCM_018498                2290   0.0      
ref|XP_006482571.1|  PREDICTED: thyroid adenoma-associated protei...   2285   0.0      
gb|KDO72545.1|  hypothetical protein CISIN_1g000103mg                  2280   0.0      
ref|XP_010108975.1|  hypothetical protein L484_027170                  2251   0.0      
ref|XP_010258389.1|  PREDICTED: thyroid adenoma-associated protei...   2249   0.0      
ref|XP_009376313.1|  PREDICTED: thyroid adenoma-associated protei...   2248   0.0      
ref|XP_002517489.1|  conserved hypothetical protein                    2247   0.0      Ricinus communis
ref|XP_007214847.1|  hypothetical protein PRUPE_ppa000039mg            2242   0.0      
ref|XP_008230981.1|  PREDICTED: LOW QUALITY PROTEIN: thyroid aden...   2229   0.0      
ref|XP_011014311.1|  PREDICTED: thyroid adenoma-associated protei...   2227   0.0      
ref|XP_009341002.1|  PREDICTED: uncharacterized protein LOC103933073   2217   0.0      
ref|XP_008353419.1|  PREDICTED: uncharacterized protein LOC103416988   2215   0.0      
ref|XP_008348069.1|  PREDICTED: uncharacterized protein LOC103411...   2212   0.0      
ref|XP_008379831.1|  PREDICTED: uncharacterized protein LOC103442807   2164   0.0      
ref|XP_008443417.1|  PREDICTED: uncharacterized protein LOC103487009   2135   0.0      
ref|XP_010032511.1|  PREDICTED: thyroid adenoma-associated protei...   2126   0.0      
ref|XP_004147469.1|  PREDICTED: uncharacterized protein LOC101204483   2115   0.0      
ref|XP_003554883.1|  PREDICTED: thyroid adenoma-associated protei...   2113   0.0      
ref|XP_004489387.1|  PREDICTED: thyroid adenoma-associated protei...   2112   0.0      
ref|XP_007151222.1|  hypothetical protein PHAVU_004G028000g            2110   0.0      
ref|XP_004163531.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   2108   0.0      
gb|KEH24998.1|  death receptor interacting protein, putative           2106   0.0      
ref|XP_008348070.1|  PREDICTED: thyroid adenoma-associated protei...   2100   0.0      
ref|XP_010693228.1|  PREDICTED: thyroid adenoma-associated protei...   2080   0.0      
ref|XP_010552926.1|  PREDICTED: thyroid adenoma-associated protei...   2077   0.0      
ref|XP_010552920.1|  PREDICTED: thyroid adenoma-associated protei...   2076   0.0      
ref|XP_002305983.2|  hypothetical protein POPTR_0004s13360g            2003   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010032512.1|  PREDICTED: thyroid adenoma-associated protei...   1999   0.0      
ref|XP_006395331.1|  hypothetical protein EUTSA_v10003503mg            1961   0.0      
ref|XP_010937104.1|  PREDICTED: thyroid adenoma-associated protei...   1953   0.0      
gb|EPS68931.1|  hypothetical protein M569_05834                        1944   0.0      
ref|XP_008784315.1|  PREDICTED: thyroid adenoma-associated protei...   1938   0.0      
ref|XP_009151835.1|  PREDICTED: thyroid adenoma-associated protei...   1937   0.0      
ref|NP_191076.2|  uncharacterized protein                              1927   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009393702.1|  PREDICTED: thyroid adenoma-associated protei...   1924   0.0      
ref|XP_010427277.1|  PREDICTED: thyroid adenoma-associated protei...   1910   0.0      
ref|XP_010427275.1|  PREDICTED: thyroid adenoma-associated protei...   1910   0.0      
ref|XP_010516077.1|  PREDICTED: thyroid adenoma-associated protei...   1899   0.0      
ref|XP_010516074.1|  PREDICTED: thyroid adenoma-associated protei...   1899   0.0      
emb|CDX85226.1|  BnaC07g25370D                                         1896   0.0      
emb|CDX86407.1|  BnaA06g31240D                                         1892   0.0      
emb|CAB75750.1|  putative protein                                      1865   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878022.1|  hypothetical protein ARALYDRAFT_324042            1857   0.0      
ref|XP_006827201.1|  hypothetical protein AMTR_s00010p00258470         1856   0.0      
ref|XP_004972741.1|  PREDICTED: thyroid adenoma-associated protei...   1816   0.0      
gb|EEC82967.1|  hypothetical protein OsI_27972                         1779   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_008662801.1|  PREDICTED: thyroid adenoma-associated protei...   1774   0.0      
ref|XP_006290484.1|  hypothetical protein CARUB_v10016558mg            1769   0.0      
ref|XP_010234347.1|  PREDICTED: thyroid adenoma-associated protei...   1767   0.0      
ref|XP_004972742.1|  PREDICTED: thyroid adenoma-associated protei...   1764   0.0      
gb|AFW57164.1|  hypothetical protein ZEAMMB73_924221                   1752   0.0      
gb|EEE68119.1|  hypothetical protein OsJ_26194                         1739   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001061088.1|  Os08g0169700                                      1734   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EMT08978.1|  hypothetical protein F775_05570                        1722   0.0      
gb|EMS47786.1|  Thyroid adenoma-associated protein-like protein        1722   0.0      
ref|XP_002445127.1|  hypothetical protein SORBIDRAFT_07g004530         1718   0.0      Sorghum bicolor [broomcorn]
ref|XP_006659168.1|  PREDICTED: thyroid adenoma-associated protei...   1715   0.0      
emb|CBI22195.3|  unnamed protein product                               1702   0.0      
dbj|BAC99561.1|  putative death receptor interacting protein           1696   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AAO72654.1|  unknown                                                1691   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KHG16676.1|  Thyroid adenoma-associated protein                     1673   0.0      
gb|KHG16677.1|  Thyroid adenoma-associated protein                     1632   0.0      
gb|KDP45495.1|  hypothetical protein JCGZ_09744                        1518   0.0      
ref|XP_009589639.1|  PREDICTED: thyroid adenoma-associated protei...   1497   0.0      
ref|XP_009771866.1|  PREDICTED: uncharacterized protein LOC104222334   1469   0.0      
ref|XP_006431125.1|  hypothetical protein CICLE_v100108892mg           1435   0.0      
ref|XP_001769710.1|  predicted protein                                 1314   0.0      
ref|XP_010507456.1|  PREDICTED: uncharacterized protein LOC104784082   1208   0.0      
ref|XP_002967388.1|  hypothetical protein SELMODRAFT_86703             1177   0.0      
gb|KGN59577.1|  hypothetical protein Csa_3G827200                      1163   0.0      
ref|XP_002960324.1|  hypothetical protein SELMODRAFT_74297             1153   0.0      
ref|XP_009758417.1|  PREDICTED: uncharacterized protein LOC104211113   1043   0.0      
ref|XP_006431126.1|  hypothetical protein CICLE_v100108891mg            678   0.0      
ref|XP_005644776.1|  hypothetical protein COCSUDRAFT_48657              533   6e-152   
ref|XP_001418331.1|  predicted protein                                  426   3e-118   Ostreococcus lucimarinus CCE9901
emb|CEF98528.1|  Armadillo-type fold                                    419   6e-116   
ref|XP_003289307.1|  hypothetical protein DICPUDRAFT_153668             408   6e-112   
gb|EXX78916.1|  Trm732p                                                 372   8e-101   
gb|ESA02798.1|  hypothetical protein GLOINDRAFT_248231                  358   2e-97    
gb|EXX78917.1|  Trm732p                                                 360   3e-97    
ref|XP_002675266.1|  predicted protein                                  331   4e-88    Naegleria gruberi strain NEG-M
gb|EIE91343.1|  hypothetical protein RO3G_16054                         323   1e-85    
emb|CEG75233.1|  hypothetical protein RMATCC62417_10309                 323   1e-85    
gb|EPB85887.1|  hypothetical protein HMPREF1544_07303                   320   1e-84    
emb|CEI96536.1|  hypothetical protein RMCBS344292_10695                 320   1e-84    
emb|CEG71050.1|  hypothetical protein RMATCC62417_06844                 319   2e-84    
emb|CDH51745.1|  thyroid adenoma-associated protein homolog             312   4e-82    
emb|CDS03199.1|  hypothetical protein LRAMOSA00601                      311   5e-82    
ref|XP_002955504.1|  hypothetical protein VOLCADRAFT_96436              309   4e-81    
emb|CEI94382.1|  hypothetical protein RMCBS344292_08593                 304   9e-80    
ref|XP_004353093.1|  HEAT repeat domain containing protein              301   6e-79    
gb|KFH73676.1|  hypothetical protein MVEG_00890                         284   1e-73    
ref|XP_003061897.1|  predicted protein                                  275   4e-71    
ref|XP_002903897.1|  conserved hypothetical protein                     227   3e-56    
ref|XP_005105742.1|  PREDICTED: thyroid adenoma-associated protei...    226   5e-56    
ref|XP_010730915.1|  PREDICTED: thyroid adenoma-associated protei...    216   4e-53    
ref|XP_009524859.1|  hypothetical protein PHYSODRAFT_557895             217   5e-53    
dbj|GAM25031.1|  hypothetical protein SAMD00019534_082060               216   1e-52    
ref|XP_002590488.1|  hypothetical protein BRAFLDRAFT_124496             214   4e-52    Branchiostoma floridae
ref|XP_001631173.1|  predicted protein                                  210   4e-52    Nematostella vectensis
gb|ETM43301.1|  hypothetical protein L914_11195                         210   6e-51    
ref|XP_004366355.1|  hypothetical protein DFA_03945                     210   7e-51    
gb|ETO72018.1|  hypothetical protein F444_11746                         209   7e-51    
gb|ETL90017.1|  hypothetical protein L917_11156                         209   9e-51    
ref|XP_008907822.1|  hypothetical protein PPTG_12866                    209   1e-50    
gb|ETI43354.1|  hypothetical protein F443_11673                         209   1e-50    
gb|ETK83427.1|  hypothetical protein L915_11356                         209   1e-50    
gb|ETP13148.1|  hypothetical protein F441_11597                         209   2e-50    
gb|ETP41224.1|  hypothetical protein F442_11564                         206   6e-50    
ref|XP_006811596.1|  PREDICTED: thyroid adenoma-associated protei...    205   2e-49    
ref|XP_797130.3|  PREDICTED: thyroid adenoma-associated protein h...    205   2e-49    Strongylocentrotus purpuratus [purple urchin]
ref|XP_643661.1|  hypothetical protein DDB_G0275399                     204   5e-49    Dictyostelium discoideum AX4
ref|XP_009049392.1|  hypothetical protein LOTGIDRAFT_112768             201   6e-49    
ref|XP_005845847.1|  hypothetical protein CHLNCDRAFT_136334             202   1e-48    
ref|XP_008614831.1|  hypothetical protein SDRG_10612                    194   4e-46    
gb|KDO22162.1|  hypothetical protein SPRG_12660                         191   4e-45    
gb|KDR11632.1|  Thyroid adenoma-associated protein-like protein         188   2e-44    
ref|XP_010903174.1|  PREDICTED: thyroid adenoma-associated protei...    187   3e-44    
ref|XP_006638855.1|  PREDICTED: thyroid adenoma-associated protei...    188   3e-44    
ref|XP_010903173.1|  PREDICTED: thyroid adenoma-associated protei...    187   3e-44    
ref|XP_010497607.1|  PREDICTED: thyroid adenoma-associated protei...    169   4e-44    
gb|EJY71466.1|  DUF2428 domain containing protein                       187   5e-44    
ref|XP_008868929.1|  hypothetical protein H310_05867                    185   2e-43    
ref|XP_003080090.1|  putative death receptor interacting protein ...    184   2e-43    
ref|XP_003758369.1|  PREDICTED: thyroid adenoma-associated protein      183   5e-43    
ref|XP_002932440.2|  PREDICTED: thyroid adenoma-associated protei...    183   9e-43    
ref|XP_008428609.1|  PREDICTED: thyroid adenoma-associated protein      182   1e-42    
ref|XP_010705062.1|  PREDICTED: thyroid adenoma-associated protei...    182   1e-42    
ref|XP_009931189.1|  PREDICTED: thyroid adenoma-associated protein      181   3e-42    
ref|NP_001103529.1|  thyroid adenoma-associated protein homolog         181   3e-42    Gallus gallus [bantam]
gb|KFR09124.1|  Thyroid adenoma-associated protein                      181   3e-42    
ref|XP_010705063.1|  PREDICTED: thyroid adenoma-associated protei...    181   4e-42    
ref|XP_010003267.1|  PREDICTED: thyroid adenoma-associated protein      180   9e-42    
gb|KFU95163.1|  Thyroid adenoma-associated protein                      180   9e-42    
ref|XP_009827032.1|  hypothetical protein H257_04299                    179   2e-41    
ref|XP_007577228.1|  PREDICTED: thyroid adenoma-associated protein      179   2e-41    
ref|XP_010737964.1|  PREDICTED: thyroid adenoma-associated protein      179   2e-41    
emb|CDW77950.1|  heat repeat domain containing protein                  178   3e-41    
gb|EFA85521.1|  hypothetical protein PPL_01478                          178   3e-41    Heterostelium album PN500
ref|XP_010391975.1|  PREDICTED: thyroid adenoma-associated protei...    177   6e-41    
ref|XP_010391973.1|  PREDICTED: thyroid adenoma-associated protei...    177   8e-41    
gb|KFO65193.1|  Thyroid adenoma-associated protein                      177   8e-41    
ref|XP_008639925.1|  PREDICTED: thyroid adenoma-associated protein      176   9e-41    
ref|XP_007890628.1|  PREDICTED: thyroid adenoma-associated protein      176   9e-41    
ref|XP_006022909.1|  PREDICTED: thyroid adenoma-associated protei...    176   1e-40    
gb|ETE69063.1|  Thyroid adenoma-associated protein-like protein         175   1e-40    
ref|XP_005523492.1|  PREDICTED: thyroid adenoma-associated protei...    176   1e-40    
gb|KFZ62726.1|  Thyroid adenoma-associated protein                      176   2e-40    
ref|XP_007435523.1|  PREDICTED: thyroid adenoma-associated protei...    176   2e-40    
ref|XP_010170834.1|  PREDICTED: thyroid adenoma-associated protein      175   2e-40    
gb|KFP18322.1|  Thyroid adenoma-associated protein                      175   2e-40    
gb|KGL89686.1|  Thyroid adenoma-associated protein                      175   2e-40    
ref|XP_009639866.1|  PREDICTED: thyroid adenoma-associated protein      175   3e-40    
ref|XP_009878958.1|  PREDICTED: thyroid adenoma-associated protein      175   3e-40    
ref|XP_010705064.1|  PREDICTED: thyroid adenoma-associated protei...    174   3e-40    
ref|XP_006267535.1|  PREDICTED: thyroid adenoma-associated protei...    174   3e-40    
ref|XP_008319543.1|  PREDICTED: thyroid adenoma-associated protein      174   4e-40    
ref|XP_008494761.1|  PREDICTED: thyroid adenoma-associated protein      174   6e-40    
gb|ELT95832.1|  hypothetical protein CAPTEDRAFT_225364                  174   7e-40    
ref|XP_010574766.1|  PREDICTED: LOW QUALITY PROTEIN: thyroid aden...    173   7e-40    
gb|KFW89043.1|  Thyroid adenoma-associated protein                      173   7e-40    
ref|XP_002196030.1|  PREDICTED: thyroid adenoma-associated protei...    173   8e-40    Taeniopygia guttata
ref|XP_004554638.1|  PREDICTED: thyroid adenoma-associated protei...    173   8e-40    
ref|XP_005998346.1|  PREDICTED: thyroid adenoma-associated protei...    173   1e-39    
ref|XP_008931206.1|  PREDICTED: thyroid adenoma-associated protein      173   1e-39    
ref|XP_008252690.1|  PREDICTED: LOW QUALITY PROTEIN: thyroid aden...    173   1e-39    
ref|XP_005416361.1|  PREDICTED: LOW QUALITY PROTEIN: thyroid aden...    172   2e-39    
gb|KFV78242.1|  Thyroid adenoma-associated protein                      172   3e-39    
ref|XP_006990565.1|  PREDICTED: thyroid adenoma-associated protei...    172   3e-39    
ref|XP_005936925.1|  PREDICTED: thyroid adenoma-associated protei...    171   3e-39    
ref|XP_009667198.1|  PREDICTED: thyroid adenoma-associated protei...    171   3e-39    
gb|KFP61699.1|  Thyroid adenoma-associated protein                      171   5e-39    
ref|XP_008113916.1|  PREDICTED: LOW QUALITY PROTEIN: thyroid aden...    171   5e-39    
ref|XP_009707772.1|  PREDICTED: thyroid adenoma-associated protein      171   6e-39    
ref|XP_004910634.1|  PREDICTED: thyroid adenoma-associated protei...    170   6e-39    
ref|XP_005795299.1|  PREDICTED: thyroid adenoma-associated protei...    170   7e-39    
ref|XP_005457136.1|  PREDICTED: thyroid adenoma-associated protei...    170   9e-39    
ref|XP_005296159.1|  PREDICTED: thyroid adenoma-associated protei...    170   1e-38    
gb|KFW67999.1|  Thyroid adenoma-associated protein                      170   1e-38    
ref|XP_008169026.1|  PREDICTED: thyroid adenoma-associated protei...    169   1e-38    
ref|XP_009323596.1|  PREDICTED: thyroid adenoma-associated protein      169   1e-38    
ref|XP_009667197.1|  PREDICTED: thyroid adenoma-associated protei...    169   1e-38    
ref|XP_005483134.1|  PREDICTED: thyroid adenoma-associated protei...    169   1e-38    
ref|XP_005296158.1|  PREDICTED: thyroid adenoma-associated protei...    169   1e-38    
gb|KFW06066.1|  Thyroid adenoma-associated protein                      169   2e-38    
ref|XP_005715500.1|  unnamed protein product                            169   2e-38    
ref|XP_007439912.1|  PREDICTED: thyroid adenoma-associated protei...    166   2e-38    
ref|XP_009577448.1|  PREDICTED: thyroid adenoma-associated protein      169   2e-38    
ref|XP_006882382.1|  PREDICTED: thyroid adenoma-associated protein      169   2e-38    
ref|XP_009471306.1|  PREDICTED: thyroid adenoma-associated protein      169   2e-38    
gb|KFR06202.1|  Thyroid adenoma-associated protein                      169   2e-38    
gb|EMC80961.1|  Thyroid adenoma-associated protein like protein         167   4e-38    
ref|XP_004686305.1|  PREDICTED: thyroid adenoma-associated protei...    167   4e-38    
ref|XP_005511783.1|  PREDICTED: LOW QUALITY PROTEIN: thyroid aden...    167   6e-38    
ref|XP_004077006.1|  PREDICTED: thyroid adenoma-associated protei...    167   7e-38    
ref|XP_005015343.1|  PREDICTED: thyroid adenoma-associated protei...    167   8e-38    
ref|XP_005015344.1|  PREDICTED: thyroid adenoma-associated protei...    167   8e-38    
ref|XP_005015345.1|  PREDICTED: thyroid adenoma-associated protei...    167   8e-38    
ref|XP_007255861.1|  PREDICTED: thyroid adenoma-associated protei...    167   9e-38    
gb|EOB04479.1|  Thyroid adenoma-associated protein-like protein         167   9e-38    
ref|XP_005015346.1|  PREDICTED: thyroid adenoma-associated protei...    166   9e-38    
ref|XP_009894935.1|  PREDICTED: thyroid adenoma-associated protei...    165   1e-37    
ref|XP_005015342.1|  PREDICTED: thyroid adenoma-associated protei...    166   1e-37    
ref|XP_009089388.1|  PREDICTED: thyroid adenoma-associated protein      166   1e-37    
gb|KFW95500.1|  Thyroid adenoma-associated protein                      166   1e-37    
ref|XP_009511378.1|  PREDICTED: thyroid adenoma-associated protein      166   1e-37    
ref|XP_008068138.1|  PREDICTED: thyroid adenoma-associated protein      166   1e-37    
gb|KFP27547.1|  Thyroid adenoma-associated protein                      166   2e-37    
ref|XP_010619820.1|  PREDICTED: thyroid adenoma-associated protei...    164   2e-37    
ref|XP_007942606.1|  PREDICTED: thyroid adenoma-associated protein      166   2e-37    
ref|XP_009276682.1|  PREDICTED: thyroid adenoma-associated protein      165   2e-37    
ref|XP_006839467.1|  PREDICTED: thyroid adenoma-associated protein      165   2e-37    
gb|KFP89513.1|  Thyroid adenoma-associated protein                      165   2e-37    
emb|CDQ80379.1|  unnamed protein product                                165   2e-37    
ref|XP_006524341.1|  PREDICTED: thyroid adenoma-associated protei...    165   2e-37    
ref|XP_006524337.1|  PREDICTED: thyroid adenoma-associated protei...    165   3e-37    
ref|XP_005043197.1|  PREDICTED: thyroid adenoma-associated protei...    165   4e-37    
ref|NP_898842.2|  thyroid adenoma-associated protein homolog            164   4e-37    Mus musculus [mouse]
ref|XP_007646318.1|  PREDICTED: thyroid adenoma-associated protei...    164   6e-37    
gb|KFV64400.1|  Thyroid adenoma-associated protein                      164   6e-37    
emb|CCA19706.1|  conserved hypothetical protein                         164   6e-37    
gb|EDL38574.1|  mCG15592                                                163   7e-37    
emb|CCI49632.1|  unnamed protein product                                164   7e-37    
ref|XP_003496264.1|  PREDICTED: thyroid adenoma-associated protei...    164   7e-37    
ref|XP_005238827.1|  PREDICTED: thyroid adenoma-associated protei...    164   7e-37    
ref|XP_009182370.1|  PREDICTED: thyroid adenoma-associated protei...    163   7e-37    
ref|XP_005436376.1|  PREDICTED: thyroid adenoma-associated protei...    163   9e-37    
ref|XP_010215969.1|  PREDICTED: thyroid adenoma-associated protei...    161   1e-36    
ref|XP_008169027.1|  PREDICTED: thyroid adenoma-associated protei...    162   1e-36    
ref|XP_007052723.1|  PREDICTED: thyroid adenoma-associated protei...    163   1e-36    
ref|XP_005864822.1|  PREDICTED: thyroid adenoma-associated protei...    163   1e-36    
ref|XP_003908617.2|  PREDICTED: thyroid adenoma-associated protei...    163   1e-36    
ref|XP_009182365.1|  PREDICTED: thyroid adenoma-associated protei...    162   1e-36    
ref|XP_009182366.1|  PREDICTED: thyroid adenoma-associated protei...    162   1e-36    
ref|XP_005864821.1|  PREDICTED: thyroid adenoma-associated protei...    163   1e-36    
ref|XP_010705065.1|  PREDICTED: thyroid adenoma-associated protei...    162   1e-36    
ref|XP_002500296.1|  predicted protein                                  163   2e-36    Micromonas commoda
ref|XP_004369572.1|  PREDICTED: thyroid adenoma-associated protein      162   2e-36    
ref|XP_006083479.1|  PREDICTED: thyroid adenoma-associated protei...    162   2e-36    
ref|XP_007968997.1|  PREDICTED: thyroid adenoma-associated protei...    162   2e-36    
ref|XP_007968998.1|  PREDICTED: thyroid adenoma-associated protei...    162   2e-36    
ref|XP_003963695.1|  PREDICTED: thyroid adenoma-associated protei...    162   2e-36    
ref|XP_005324580.1|  PREDICTED: thyroid adenoma-associated protei...    162   2e-36    
ref|XP_005324579.1|  PREDICTED: thyroid adenoma-associated protei...    162   2e-36    
ref|XP_007968995.1|  PREDICTED: thyroid adenoma-associated protei...    162   2e-36    
ref|XP_004839417.1|  PREDICTED: thyroid adenoma-associated protein      162   3e-36    
ref|XP_006812214.1|  PREDICTED: thyroid adenoma-associated protei...    159   3e-36    
ref|XP_004876606.1|  PREDICTED: LOW QUALITY PROTEIN: thyroid aden...    161   3e-36    
ref|XP_007968994.1|  PREDICTED: thyroid adenoma-associated protei...    161   3e-36    
ref|XP_007968988.1|  PREDICTED: thyroid adenoma-associated protei...    161   3e-36    
dbj|BAD32536.1|  mKIAA1767 protein                                      158   4e-36    Mus musculus [mouse]
ref|XP_004436767.1|  PREDICTED: thyroid adenoma-associated protei...    161   4e-36    
ref|XP_004436768.1|  PREDICTED: thyroid adenoma-associated protei...    161   4e-36    
gb|EKC26336.1|  Thyroid adenoma-associated-like protein                 161   5e-36    
gb|EAR90828.2|  death-receptor fusion protein, putative                 160   6e-36    
ref|XP_002912445.1|  PREDICTED: thyroid adenoma-associated protei...    160   7e-36    
ref|XP_001011073.1|  hypothetical protein TTHERM_00142350               160   7e-36    Tetrahymena thermophila
ref|XP_005600082.1|  PREDICTED: thyroid adenoma-associated protei...    160   8e-36    
gb|EFB28200.1|  hypothetical protein PANDA_000189                       160   8e-36    Ailuropoda melanoleuca
ref|XP_005576060.1|  PREDICTED: thyroid adenoma-associated protei...    160   8e-36    
ref|XP_005600081.1|  PREDICTED: thyroid adenoma-associated protei...    160   8e-36    
ref|XP_001499013.2|  PREDICTED: thyroid adenoma-associated protei...    160   9e-36    Equus caballus [domestic horse]
ref|XP_005576064.1|  PREDICTED: thyroid adenoma-associated protei...    160   9e-36    
gb|EDM02701.1|  rCG61319                                                159   9e-36    
gb|EHH22085.1|  hypothetical protein EGK_05281                          160   9e-36    
ref|XP_002799291.1|  PREDICTED: thyroid adenoma-associated protei...    160   1e-35    
sp|A8C752.1|THADA_CHLAE  RecName: Full=Thyroid adenoma-associated...    160   1e-35    Chlorocebus aethiops [African green monkey]
gb|EHH55532.1|  hypothetical protein EGM_04760                          160   1e-35    
ref|XP_005576065.1|  PREDICTED: thyroid adenoma-associated protei...    160   1e-35    
ref|XP_003472971.1|  PREDICTED: LOW QUALITY PROTEIN: thyroid aden...    159   1e-35    
ref|XP_010380886.1|  PREDICTED: thyroid adenoma-associated protei...    159   1e-35    
ref|NP_001178698.1|  thyroid adenoma-associated protein                 159   2e-35    
ref|XP_008979018.1|  PREDICTED: thyroid adenoma-associated protei...    159   2e-35    
ref|XP_008979017.1|  PREDICTED: thyroid adenoma-associated protei...    159   2e-35    
ref|XP_007512944.1|  predicted protein                                  158   2e-35    
ref|XP_004753022.1|  PREDICTED: thyroid adenoma-associated protei...    159   2e-35    
ref|XP_008979020.1|  PREDICTED: thyroid adenoma-associated protei...    159   2e-35    
ref|XP_008834095.1|  PREDICTED: thyroid adenoma-associated protei...    159   2e-35    
ref|XP_008834096.1|  PREDICTED: thyroid adenoma-associated protei...    159   2e-35    
ref|XP_004792683.1|  PREDICTED: thyroid adenoma-associated protei...    159   3e-35    
ref|XP_004753020.1|  PREDICTED: thyroid adenoma-associated protei...    159   3e-35    
ref|XP_010380887.1|  PREDICTED: thyroid adenoma-associated protei...    159   3e-35    
ref|XP_006778754.1|  PREDICTED: thyroid adenoma-associated protei...    158   3e-35    
ref|XP_008979019.1|  PREDICTED: thyroid adenoma-associated protei...    158   3e-35    
gb|KFO75082.1|  Thyroid adenoma-associated protein                      158   4e-35    
ref|XP_006524342.1|  PREDICTED: thyroid adenoma-associated protei...    157   5e-35    
ref|XP_006930131.1|  PREDICTED: thyroid adenoma-associated protei...    157   5e-35    
ref|XP_008160416.1|  PREDICTED: thyroid adenoma-associated protein      157   5e-35    
ref|NP_001103429.1|  thyroid adenoma-associated protein homolog         157   6e-35    
emb|CCG80987.1|  Putative uncharacterized protein                       157   6e-35    
ref|XP_004447348.1|  PREDICTED: LOW QUALITY PROTEIN: thyroid aden...    157   6e-35    
ref|XP_006712132.1|  PREDICTED: thyroid adenoma-associated protei...    156   7e-35    
gb|EAX00301.1|  hCG16399, isoform CRA_b                                 156   7e-35    
ref|XP_010335771.1|  PREDICTED: thyroid adenoma-associated protei...    157   8e-35    
ref|XP_007129044.1|  PREDICTED: thyroid adenoma-associated protei...    157   9e-35    
ref|XP_007055076.1|  PREDICTED: thyroid adenoma-associated protei...    157   9e-35    
ref|XP_007129045.1|  PREDICTED: thyroid adenoma-associated protei...    157   9e-35    
ref|XP_007129043.1|  PREDICTED: thyroid adenoma-associated protei...    156   1e-34    
ref|XP_007129042.1|  PREDICTED: thyroid adenoma-associated protei...    156   1e-34    
ref|XP_003788017.1|  PREDICTED: thyroid adenoma-associated protein      156   1e-34    
ref|XP_010335772.1|  PREDICTED: thyroid adenoma-associated protei...    156   1e-34    
ref|XP_006138250.1|  PREDICTED: thyroid adenoma-associated protei...    156   1e-34    
ref|XP_004753021.1|  PREDICTED: thyroid adenoma-associated protei...    156   1e-34    
ref|XP_006712125.1|  PREDICTED: thyroid adenoma-associated protei...    156   2e-34    
ref|NP_071348.3|  thyroid adenoma-associated protein isoform a          156   2e-34    
ref|XP_006712127.1|  PREDICTED: thyroid adenoma-associated protei...    156   2e-34    
ref|XP_006712126.1|  PREDICTED: thyroid adenoma-associated protei...    156   2e-34    
ref|XP_004753017.1|  PREDICTED: thyroid adenoma-associated protei...    156   2e-34    
ref|XP_006712130.1|  PREDICTED: thyroid adenoma-associated protei...    155   2e-34    
dbj|BAF82712.1|  unnamed protein product                                156   2e-34    
gb|KDE05615.1|  hypothetical protein MVLG_03987                         155   2e-34    
ref|XP_006712129.1|  PREDICTED: thyroid adenoma-associated protei...    155   2e-34    
dbj|BAB21858.2|  KIAA1767 protein                                       155   2e-34    
ref|XP_003809174.1|  PREDICTED: thyroid adenoma-associated protei...    155   2e-34    
gb|EPQ06840.1|  Thyroid adenoma-associated protein like protein         155   2e-34    
ref|XP_005686601.1|  PREDICTED: thyroid adenoma-associated protei...    155   3e-34    
ref|XP_008959549.1|  PREDICTED: thyroid adenoma-associated protei...    155   3e-34    
ref|XP_009440673.1|  PREDICTED: thyroid adenoma-associated protei...    155   3e-34    
ref|XP_009440675.1|  PREDICTED: thyroid adenoma-associated protei...    155   3e-34    
ref|XP_001141732.1|  PREDICTED: thyroid adenoma-associated protei...    155   3e-34    
ref|XP_004400216.1|  PREDICTED: LOW QUALITY PROTEIN: thyroid aden...    155   3e-34    
ref|XP_010814043.1|  PREDICTED: thyroid adenoma-associated protei...    155   3e-34    
gb|EMS19606.1|  thyroid adenoma-associated protein-like protein         155   3e-34    
ref|XP_009182367.1|  PREDICTED: thyroid adenoma-associated protei...    154   4e-34    
ref|XP_007537324.1|  PREDICTED: thyroid adenoma-associated protein      154   5e-34    
ref|XP_008698031.1|  PREDICTED: thyroid adenoma-associated protein      154   5e-34    
ref|XP_006909701.1|  PREDICTED: LOW QUALITY PROTEIN: thyroid aden...    154   5e-34    
ref|XP_004006042.1|  PREDICTED: thyroid adenoma-associated protei...    154   6e-34    
ref|XP_005981886.1|  PREDICTED: thyroid adenoma-associated protei...    154   6e-34    
ref|XP_005281130.1|  PREDICTED: thyroid adenoma-associated protei...    154   6e-34    
ref|XP_010966015.1|  PREDICTED: LOW QUALITY PROTEIN: thyroid aden...    154   7e-34    
ref|XP_007129046.1|  PREDICTED: thyroid adenoma-associated protei...    152   2e-33    
gb|EHA97799.1|  Thyroid adenoma-associated protein                      152   2e-33    
ref|XP_010139567.1|  PREDICTED: thyroid adenoma-associated protein      152   2e-33    
gb|KFO92910.1|  Thyroid adenoma-associated protein                      152   2e-33    
ref|XP_010594221.1|  PREDICTED: thyroid adenoma-associated protein      152   3e-33    
ref|XP_010995450.1|  PREDICTED: thyroid adenoma-associated protein      152   3e-33    
ref|XP_005902613.1|  PREDICTED: LOW QUALITY PROTEIN: thyroid aden...    151   4e-33    
gb|EGU11259.1|  Proteophosphoglycan ppg4                                150   6e-33    
ref|XP_004265059.1|  PREDICTED: LOW QUALITY PROTEIN: thyroid aden...    151   6e-33    
ref|XP_006712131.1|  PREDICTED: thyroid adenoma-associated protei...    150   7e-33    
ref|XP_006056863.1|  PREDICTED: LOW QUALITY PROTEIN: thyroid aden...    150   1e-32    
ref|XP_007097900.1|  PREDICTED: thyroid adenoma-associated protei...    150   1e-32    
dbj|GAC93031.1|  hypothetical protein PHSY_000592                       149   3e-32    
ref|XP_010814034.1|  PREDICTED: thyroid adenoma-associated protei...    147   6e-32    
ref|XP_007559187.1|  PREDICTED: thyroid adenoma-associated protei...    147   9e-32    
ref|XP_007559186.1|  PREDICTED: thyroid adenoma-associated protei...    147   1e-31    
ref|XP_007559185.1|  PREDICTED: thyroid adenoma-associated protei...    147   1e-31    
ref|XP_005625721.1|  PREDICTED: thyroid adenoma-associated protei...    147   1e-31    
ref|XP_005662641.1|  PREDICTED: thyroid adenoma-associated protei...    140   1e-31    
ref|XP_007908284.1|  PREDICTED: thyroid adenoma-associated protei...    145   2e-31    
ref|XP_005837129.1|  hypothetical protein GUITHDRAFT_135333             145   2e-31    
ref|XP_005055295.1|  PREDICTED: thyroid adenoma-associated protei...    145   2e-31    
gb|EMD85694.1|  hypothetical protein COCHEDRAFT_1148089                 145   3e-31    
ref|XP_006784331.1|  PREDICTED: thyroid adenoma-associated protei...    145   4e-31    
ref|XP_002108400.1|  hypothetical protein TRIADDRAFT_52840              144   5e-31    
ref|XP_010191365.1|  PREDICTED: thyroid adenoma-associated protein      144   6e-31    
ref|XP_005390979.1|  PREDICTED: LOW QUALITY PROTEIN: thyroid aden...    144   6e-31    
gb|KFQ26004.1|  Thyroid adenoma-associated protein                      144   6e-31    
ref|XP_005916398.1|  PREDICTED: thyroid adenoma-associated protei...    144   7e-31    
ref|XP_008416876.1|  PREDICTED: thyroid adenoma-associated protei...    144   7e-31    
ref|XP_005735226.1|  PREDICTED: thyroid adenoma-associated protei...    142   2e-30    
ref|XP_005916399.1|  PREDICTED: thyroid adenoma-associated protei...    142   2e-30    
ref|XP_006784330.1|  PREDICTED: thyroid adenoma-associated protei...    143   2e-30    
ref|XP_010814047.1|  PREDICTED: thyroid adenoma-associated protei...    142   2e-30    
ref|XP_005191417.1|  PREDICTED: thyroid adenoma-associated protei...    142   2e-30    
ref|XP_005916397.1|  PREDICTED: thyroid adenoma-associated protei...    142   2e-30    
ref|XP_009076195.1|  PREDICTED: thyroid adenoma-associated protei...    141   2e-30    
ref|XP_009176457.1|  hypothetical protein T265_15456                    142   2e-30    
ref|XP_001648778.1|  hypothetical protein AaeL_AAEL014444               142   2e-30    
ref|XP_010705066.1|  PREDICTED: thyroid adenoma-associated protei...    142   3e-30    
ref|XP_007513082.1|  predicted protein                                  133   3e-30    
ref|XP_005722458.1|  PREDICTED: thyroid adenoma-associated protei...    142   3e-30    
ref|XP_004536382.1|  PREDICTED: thyroid adenoma-associated protei...    141   4e-30    
ref|XP_004544649.1|  PREDICTED: thyroid adenoma-associated protei...    141   5e-30    
emb|CBQ72438.1|  conserved hypothetical protein                         141   5e-30    
ref|XP_008028882.1|  hypothetical protein SETTUDRAFT_43369              141   6e-30    
ref|XP_005473404.1|  PREDICTED: thyroid adenoma-associated protei...    140   8e-30    
gb|EST08420.1|  hypothetical protein PSEUBRA_SCAF16g05268               140   8e-30    
ref|XP_010774960.1|  PREDICTED: thyroid adenoma-associated protei...    140   8e-30    
gb|KFM23829.1|  Uncharacterized protein F751_6797                       140   1e-29    
emb|CAG10188.1|  unnamed protein product                                134   1e-29    
ref|XP_761381.1|  hypothetical protein UM05234.1                        139   3e-29    
ref|XP_007714257.1|  hypothetical protein COCCADRAFT_6679               139   3e-29    
ref|XP_008274785.1|  PREDICTED: thyroid adenoma-associated protei...    139   3e-29    
ref|XP_010279997.1|  PREDICTED: LOW QUALITY PROTEIN: thyroid aden...    138   3e-29    
ref|XP_004544650.1|  PREDICTED: thyroid adenoma-associated protei...    138   3e-29    
ref|XP_004544651.1|  PREDICTED: thyroid adenoma-associated protei...    138   3e-29    
gb|KFQ69170.1|  Thyroid adenoma-associated protein                      138   4e-29    
ref|XP_004544648.1|  PREDICTED: thyroid adenoma-associated protei...    138   4e-29    
gb|ETN66386.1|  hypothetical protein AND_001826                         138   4e-29    
gb|EUN21237.1|  hypothetical protein COCVIDRAFT_31542                   138   5e-29    
emb|CCF48488.1|  uncharacterized protein UHOR_03241                     138   5e-29    
ref|XP_002840808.1|  hypothetical protein                               137   6e-29    
ref|XP_001963564.1|  GF20221                                            137   7e-29    
ref|XP_010894706.1|  PREDICTED: thyroid adenoma-associated protei...    137   7e-29    
ref|XP_005473403.1|  PREDICTED: thyroid adenoma-associated protei...    137   8e-29    
ref|XP_008115551.1|  PREDICTED: thyroid adenoma-associated protei...    137   8e-29    
ref|XP_008115552.1|  PREDICTED: thyroid adenoma-associated protei...    137   9e-29    
ref|XP_003744909.1|  PREDICTED: thyroid adenoma-associated protei...    135   2e-28    
gb|KFB45501.1|  hypothetical protein ZHAS_00013439                      136   2e-28    
ref|XP_007700517.1|  hypothetical protein COCSADRAFT_327280             135   2e-28    
emb|CDQ62787.1|  unnamed protein product                                134   5e-28    
ref|XP_010121325.1|  PREDICTED: thyroid adenoma-associated protei...    133   6e-28    
dbj|GAK63907.1|  phosphatidylinositol N-acetylglucosaminyltransfe...    134   7e-28    
dbj|GAC71365.1|  N-acetylglucosaminyltransferase complex, subunit...    134   9e-28    
ref|XP_003305635.1|  hypothetical protein PTT_18542                     133   2e-27    
ref|XP_008577142.1|  PREDICTED: thyroid adenoma-associated protein      132   2e-27    
ref|XP_009061602.1|  hypothetical protein LOTGIDRAFT_234949             133   2e-27    
ref|XP_002423918.1|  conserved hypothetical protein                     132   3e-27    
dbj|BAC86709.1|  unnamed protein product                                127   5e-27    
ref|XP_008274756.1|  PREDICTED: thyroid adenoma-associated protein      124   8e-27    
ref|XP_009920282.1|  PREDICTED: thyroid adenoma-associated protei...    123   9e-27    
ref|XP_002055662.1|  GJ18663                                            130   1e-26    
ref|XP_001939650.1|  conserved hypothetical protein                     130   1e-26    
ref|XP_010840622.1|  PREDICTED: thyroid adenoma-associated protein      130   1e-26    
ref|XP_001977836.1|  GG18019                                            129   2e-26    
gb|AAO46788.1|  death receptor interacting/7p fusion protein            128   3e-26    
gb|AAO46787.1|  death receptor interacting/3p fusion protein spli...    128   3e-26    
gb|AAO46786.1|  death receptor interacting/3p fusion protein            128   4e-26    
ref|XP_008169028.1|  PREDICTED: thyroid adenoma-associated protei...    128   4e-26    
ref|XP_007129048.1|  PREDICTED: thyroid adenoma-associated protei...    128   5e-26    
ref|XP_007129047.1|  PREDICTED: thyroid adenoma-associated protei...    128   5e-26    
emb|CDI53026.1|  related to SPT14-N-acetylglucosaminyltransferase       127   8e-26    
ref|XP_002010215.1|  GI15808                                            127   1e-25    
ref|XP_001607287.1|  PREDICTED: thyroid adenoma-associated protei...    126   2e-25    
gb|AAM75097.1|  SD06922p                                                126   2e-25    
gb|ELK14748.1|  Thyroid adenoma-associated protein like protein         126   2e-25    
ref|NP_608361.3|  CG15618, isoform B                                    126   2e-25    
ref|XP_007448218.1|  PREDICTED: thyroid adenoma-associated protei...    125   3e-25    
gb|KFO34443.1|  Thyroid adenoma-associated protein                      124   4e-25    
ref|XP_008185245.1|  PREDICTED: thyroid adenoma-associated protei...    123   1e-24    
gb|EHJ78306.1|  hypothetical protein KGM_22701                          123   1e-24    
gb|EFX77127.1|  hypothetical protein DAPPUDRAFT_321739                  123   2e-24    
ref|XP_007692262.1|  hypothetical protein COCMIDRAFT_9044               123   2e-24    
ref|XP_002039485.1|  GM22702                                            123   2e-24    
ref|XP_003706841.1|  PREDICTED: thyroid adenoma-associated protei...    122   2e-24    
ref|XP_002070835.1|  GK25461                                            121   7e-24    
ref|XP_011063479.1|  PREDICTED: thyroid adenoma-associated protei...    120   1e-23    
ref|XP_011063478.1|  PREDICTED: thyroid adenoma-associated protei...    120   1e-23    
ref|XP_003388046.1|  PREDICTED: thyroid adenoma-associated protei...    119   2e-23    
ref|XP_007661819.1|  PREDICTED: thyroid adenoma-associated protei...    118   2e-23    
gb|AAI05977.1|  THADA protein                                           118   3e-23    
ref|XP_002113665.1|  hypothetical protein TRIADDRAFT_26169              112   1e-22    
ref|XP_005165257.1|  PREDICTED: thyroid adenoma-associated protei...    117   1e-22    
gb|EZA60973.1|  Thyroid adenoma-associated protein-like protein         116   1e-22    
ref|XP_006524343.1|  PREDICTED: thyroid adenoma-associated protei...    115   3e-22    
ref|XP_003727522.1|  PREDICTED: uncharacterized protein LOC100889845    115   4e-22    
gb|EPY50107.1|  THADA protein                                           115   5e-22    
ref|XP_007873215.1|  hypothetical protein PNEG_01291                    115   5e-22    
ref|XP_003398276.1|  PREDICTED: thyroid adenoma-associated protei...    114   7e-22    
gb|EKC23172.1|  Thyroid adenoma-associated protein                      114   8e-22    
ref|XP_003486001.1|  PREDICTED: thyroid adenoma-associated protei...    114   1e-21    
ref|XP_008335496.1|  PREDICTED: LOW QUALITY PROTEIN: thyroid aden...    113   2e-21    
gb|KFP47829.1|  Thyroid adenoma-associated protein                      112   2e-21    
emb|CBJ32757.1|  conserved unknown protein                              113   2e-21    
ref|XP_003840885.1|  similar to HEAT repeat protein                     112   3e-21    
ref|XP_003398277.1|  PREDICTED: thyroid adenoma-associated protei...    112   3e-21    
ref|XP_003486002.1|  PREDICTED: thyroid adenoma-associated protei...    112   4e-21    
ref|XP_002159347.2|  PREDICTED: thyroid adenoma-associated protei...    111   5e-21    
ref|XP_008545190.1|  PREDICTED: thyroid adenoma-associated protei...    111   5e-21    
gb|EFZ12697.1|  hypothetical protein SINV_16182                         110   5e-21    
emb|CDK25785.1|  unnamed protein product                                111   6e-21    
ref|XP_460639.2|  DEHA2F06468p                                          111   8e-21    
gb|EAX00300.1|  hCG16399, isoform CRA_a                                 110   8e-21    
ref|XP_006619122.1|  PREDICTED: thyroid adenoma-associated protei...    110   1e-20    
gb|KFV39751.1|  Thyroid adenoma-associated protein                      110   1e-20    
gb|EEZ97178.1|  hypothetical protein TcasGA2_TC004365                   110   1e-20    
ref|XP_001354954.2|  GA13852                                            110   1e-20    
ref|XP_010083101.1|  PREDICTED: thyroid adenoma-associated protein      110   1e-20    
ref|XP_009965552.1|  PREDICTED: thyroid adenoma-associated protein      110   2e-20    
emb|CCX34535.1|  Similar to Uncharacterized protein C1494.07; acc...    110   2e-20    
gb|KFV16440.1|  Thyroid adenoma-associated protein                      110   2e-20    
ref|XP_008200323.1|  PREDICTED: thyroid adenoma-associated protei...    110   2e-20    
ref|XP_001988713.1|  GH11312                                            109   3e-20    
gb|KGK40164.1|  hypothetical protein JL09_g576                          108   5e-20    
ref|XP_003080089.1|  Cell cycle-associated protein (ISS)                104   5e-20    
ref|XP_006524338.1|  PREDICTED: thyroid adenoma-associated protei...    108   7e-20    
ref|XP_007925147.1|  hypothetical protein MYCFIDRAFT_214770             107   1e-19    
ref|XP_002022503.1|  GL13068                                            107   1e-19    
emb|CDS26712.1|  thyroid adenoma associated protein                     106   2e-19    
ref|XP_006134853.1|  PREDICTED: thyroid adenoma-associated protei...    105   4e-19    
ref|XP_009182369.1|  PREDICTED: thyroid adenoma-associated protei...    105   4e-19    
gb|KFO07791.1|  Thyroid adenoma-associated protein                      104   6e-19    
ref|XP_006211547.1|  PREDICTED: LOW QUALITY PROTEIN: thyroid aden...    105   6e-19    
ref|NP_588532.1|  hypothetical protein SPCC1494.07                      104   7e-19    
gb|KFQ14598.1|  Thyroid adenoma-associated protein                      104   7e-19    
ref|XP_007968996.1|  PREDICTED: thyroid adenoma-associated protei...    104   7e-19    
ref|XP_009954657.1|  PREDICTED: thyroid adenoma-associated protein      104   7e-19    
gb|ERE74247.1|  putative thyroid adenoma-associated protein isofo...    104   8e-19    
ref|XP_007613230.1|  PREDICTED: thyroid adenoma-associated protei...    104   9e-19    
ref|XP_006239769.1|  PREDICTED: thyroid adenoma-associated protei...    104   1e-18    
ref|XP_001428684.1|  hypothetical protein                               104   1e-18    



>ref|XP_006349572.1| PREDICTED: thyroid adenoma-associated protein homolog [Solanum 
tuberosum]
Length=2187

 Score =  2533 bits (6564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1299/1898 (68%), Positives = 1517/1898 (80%), Gaps = 43/1898 (2%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSRTVLN  FVVSND +  + + G+N  S+K ILYD IL ELCNFCE+P DSHF+
Sbjct  310   GILTAVSRTVLNTGFVVSNDSFGSVRDSGDNKKSIKMILYDAILPELCNFCENPIDSHFS  369

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQ+KTSM   +G +E  YDPISE++GTR+L+IVWNNLEDPL+QTVKQVH
Sbjct  370   FHALTVMQICLQQVKTSMLDKNGSLEVNYDPISEDIGTRLLQIVWNNLEDPLNQTVKQVH  429

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDIQ +LHWAEGS+ F  F RK+A DLL LGPRCKGRY+PLASLTKRLGA+++L
Sbjct  430   LIFDLFLDIQASLHWAEGSDTFNLFTRKVAFDLLRLGPRCKGRYVPLASLTKRLGARTLL  489

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              MSP LLF+T KAY+DDDVC A+TTFLKCFLECLRDEYWS+DG+E GY  +R HCL P+L
Sbjct  490   SMSPDLLFETIKAYIDDDVCCASTTFLKCFLECLRDEYWSSDGIENGYNSFRGHCLPPLL  549

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
             SGL+SG ++LRSNLNTYALPVLLELDVD+IF ML FIGI C  ++ E+F  ELD R +  
Sbjct  550   SGLASGHSRLRSNLNTYALPVLLELDVDAIFLMLAFIGIRCGLDNGEVFLTELDFRGVSP  609

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              +E+RVAVLVSL KVSR LAL+EGDIDWC+ S ++LE  D+  +    D++V +KGIE+K
Sbjct  610   VLEERVAVLVSLFKVSRFLALLEGDIDWCKDSLLSLE--DVKQNLENKDAIVCIKGIEIK  667

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +P  YL+LALTHID+SLRIDAAESLFINPKTASLPSSLELSLM+ AVPLNMRCCSTAFQM
Sbjct  668   VPEKYLVLALTHIDESLRIDAAESLFINPKTASLPSSLELSLMKVAVPLNMRCCSTAFQM  727

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSRVRTALER +KQG+W P   K  S + +          RA+ LFNFMKW
Sbjct  728   KWTSLFRKFFSRVRTALERQVKQGSWQPLARKDTSRNSVAKRTGDMFVDRADELFNFMKW  787

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHM-LPPQGKSDSYSSEISLYPYSKGLIL  1617
             LSCFLFFSCYPSAPYERKIMAMEL+LIMLNVW + LP +G  D+ S + SLYPYSKGL+L
Sbjct  788   LSCFLFFSCYPSAPYERKIMAMELLLIMLNVWSIVLPSEGTVDAVSPQFSLYPYSKGLLL  847

Query  1618  PESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRE  1797
             PESTLLLVGSI+DSWDRLR SSFRILLHFPTP+PGI S ++V EAI+WAKKLV SPRVRE
Sbjct  848   PESTLLLVGSIVDSWDRLRVSSFRILLHFPTPLPGIHSEDMVSEAIVWAKKLVYSPRVRE  907

Query  1798  SDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSP-SGLSNGENLEFTPSSPVIEYITSLI  1974
             SDAGALT RLIFRKYVLELGWVV  S N V+  P S L + EN     + P IEY+ SLI
Sbjct  908   SDAGALTLRLIFRKYVLELGWVVNASSNDVSAQPLSKLPSEENKVCKFAPPAIEYLRSLI  967

Query  1975  DWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekila  2154
             DWL A V++GEKDLSEACK SFVHGVLLTLRYTFEE+DWDS A+  +IS +K +LEKIL 
Sbjct  968   DWLDAVVQDGEKDLSEACKNSFVHGVLLTLRYTFEELDWDSDAIVCSISEMKGVLEKILE  1027

Query  2155  lVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQD  2334
             LVMRITSLALWVVSADAWYLPD+M+EM  D     E P EMD      D E    +  Q+
Sbjct  1028  LVMRITSLALWVVSADAWYLPDDMDEMGDDALLLEEVPHEMD----EADKEQNTTEV-QE  1082

Query  2335  DGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGT--DQLSSDIVLD  2508
                 +QIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDV +S SQ+   T     +SD +LD
Sbjct  1083  GRQTEQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVSESGSQVVHETVLSNTTSDTMLD  1142

Query  2509  LRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMER  2688
             ++QLE+IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSND RLCKLTESWMEQLMER
Sbjct  1143  VKQLEVIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDARLCKLTESWMEQLMER  1202

Query  2689  TVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknken  2868
             T++KGQTVDDLLRRSAGIPAAF AFFLSEP+G PK+LLP+ALRWL++VA K LTD  + N
Sbjct  1203  TIAKGQTVDDLLRRSAGIPAAFIAFFLSEPQGTPKKLLPRALRWLVDVANKYLTDHTEAN  1262

Query  2869  sscs-------esssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLAT  3027
             S  +       E+  A  S +  D+   E ISK RDEGVVPTVHAFNVLKAAFND NLAT
Sbjct  1263  SFSADTCNGFVEAGPATFSIIASDIYDAERISKIRDEGVVPTVHAFNVLKAAFNDTNLAT  1322

Query  3028  DTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEF  3207
             DTSGFSAEALI+SIR FSS +WEVRNSACLAYTALVRRMIGFLNV KR SARRA+TG+EF
Sbjct  1323  DTSGFSAEALIISIRCFSSPHWEVRNSACLAYTALVRRMIGFLNVHKRASARRAITGIEF  1382

Query  3208  FHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSE  3387
             FHRYP LH+FLFNELKIATE  L+GSSE+L SNLAKVVHPSLCP+LILLSRLKPSPI SE
Sbjct  1383  FHRYPPLHSFLFNELKIATESLLDGSSEHLRSNLAKVVHPSLCPVLILLSRLKPSPIASE  1442

Query  3388  TGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHS  3567
              GDP DPFLFMPFIRKCS+Q+NLRIR+LASRALTG+VSNEKLP V+LNIASELP      
Sbjct  1443  AGDPLDPFLFMPFIRKCSVQSNLRIRVLASRALTGLVSNEKLPLVLLNIASELPGTGERV  1502

Query  3568  MTSDLSGLSN-LNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWI  3744
             + SDL   SN +N SFNS+HGMLLQLSSLLDTNCR+L D S+K++IL++LIH+L   SWI
Sbjct  1503  VNSDLPIPSNRVNCSFNSLHGMLLQLSSLLDTNCRDLPDVSQKDNILAELIHILASRSWI  1562

Query  3745  GSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAY  3924
             GSP++CPCPI+N  FLKVLDNML +ARTC+MSK I VIW LLW  SS CLDL     PAY
Sbjct  1563  GSPEQCPCPIINSCFLKVLDNMLGVARTCQMSKNIDVIWELLWRSSSVCLDLGVVCAPAY  1622

Query  3925  FDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQER  4104
             FDPT +ELRKQAA SYFNC YQTSK+  EE L+     PP S L   S  ++S +RF+ER
Sbjct  1623  FDPTTSELRKQAACSYFNCVYQTSKEAAEEYLLVPSKGPPGSNLSMISVNEISFSRFKER  1682

Query  4105  LIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLL  4284
             LIRSLSD  YEVRIATLKW LLFL +PE           SEIK   L++I LQ  +M+LL
Sbjct  1683  LIRSLSDTSYEVRIATLKWFLLFLKTPE----------YSEIKRSCLTSIDLQTTVMKLL  1732

Query  4285  AVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPTFVGNMDSDSVLQFWDKVVSLYKVTR  4464
              ++ NHKC+NYILKIIY++++Q+Y  N G+   P F G+MDS+SVLQFWDKVVSLYKV+R
Sbjct  1733  TLDNNHKCLNYILKIIYSWSLQKYQNN-GEEYYPKFFGDMDSESVLQFWDKVVSLYKVSR  1791

Query  4465  HAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVV---NPSDPSKLSVFSECIDYFV  4635
              +KTREML+CCM VCIK+ A   +SS+  L + KV  V   +PSD SK SVF ECI Y+V
Sbjct  1792  RSKTREMLLCCMGVCIKQFAGSLSSSVVGLQDVKVGEVSHHDPSDMSKSSVFYECISYYV  1851

Query  4636  EVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGN-----KQKDALH  4800
             ++I+ HSDASEP+N R+AAA+S++ASGLLDQA+ + P V N+Q+PDGN     KQ+  ++
Sbjct  1852  DLIERHSDASEPVNTRRAAAESMIASGLLDQAEVIGPLVYNNQIPDGNLCSCFKQEMVVN  1911

Query  4801  LYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIEM  4980
             +YAHK+LDLWF+C++LLEDED+ LRK+L+L+VQ C TS  S   F +GVVP QVE+VIE 
Sbjct  1912  IYAHKVLDLWFSCIRLLEDEDESLRKKLALDVQNCFTSKSSERSFLTGVVPSQVEQVIEK  1971

Query  4981  SFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNHHEEKLLISQI  5160
             SF HLSS FGH LDYLDFLC  V  + N AC +S  D ++RVFDKEIDNHHEEKLLI QI
Sbjct  1972  SFNHLSSIFGHCLDYLDFLCRRVLDSANHACVISEGDLIKRVFDKEIDNHHEEKLLICQI  2031

Query  5161  CCSHLEKLPVSKLTT-EFRD-NNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVG  5334
             CCSHLEKLP SK ++ E  D +++   LQ+WRR+F Q+L+ F   Y+  QGG DWIGGVG
Sbjct  2032  CCSHLEKLPTSKFSSGECGDIHDVRDFLQNWRRQFAQKLVLFAKDYVAAQGGFDWIGGVG  2091

Query  5335  NHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEAIQPFLRNPLISNLFVL  5514
             NHKDAFLP+Y NLLAF+ALSNC+  G+ ED KSM+PE+ E+GEAIQPFL NPLISNL +L
Sbjct  2092  NHKDAFLPLYANLLAFYALSNCVFNGKPEDRKSMLPEVEEIGEAIQPFLTNPLISNLLLL  2151

Query  5515  VVKSHEK-IAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             VVK H K I+ G+ +  ++E +   SAWDAFDPYFL R
Sbjct  2152  VVKLHNKMISEGSCD--LIENTTDESAWDAFDPYFLLR  2187



>ref|XP_010317892.1| PREDICTED: thyroid adenoma-associated protein homolog [Solanum 
lycopersicum]
Length=2174

 Score =  2450 bits (6349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1263/1895 (67%), Positives = 1494/1895 (79%), Gaps = 50/1895 (3%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSRTVLN  FVVSND +  + + G+N  S+K ILYD IL ELCNFCE+P DSHF+
Sbjct  310   GILTAVSRTVLNTGFVVSNDSFGSVRDSGDNKKSIKMILYDAILPELCNFCENPIDSHFS  369

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQ+KTSM   +G +E  YD ISE++GTR+L+IVWNNLEDPL+QTVKQV 
Sbjct  370   FHALTVMQICLQQVKTSMLDKNGSLEVNYDLISEDIGTRLLQIVWNNLEDPLNQTVKQVQ  429

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDIQ  LHWAEGS+ F  F RK+A DLL LGPRCKGRYIPLASLTKRLGA+++L
Sbjct  430   LIFDLFLDIQANLHWAEGSDTFNLFTRKVAFDLLRLGPRCKGRYIPLASLTKRLGARTLL  489

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              MSP LLF+T KAY+DDDVC A+TTFLKCFL+CLRDEYWS+DG+E GY ++R HCL P+L
Sbjct  490   SMSPDLLFETIKAYIDDDVCCASTTFLKCFLQCLRDEYWSSDGIENGYNRFRGHCLPPLL  549

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
             SGL+SG ++LRSNLNTYALPVLLELDVD+IF ML FIGI C  ++ E+F  ELD R +  
Sbjct  550   SGLASGHSRLRSNLNTYALPVLLELDVDAIFLMLAFIGIRCGLDNGEVFLTELDFRGVSP  609

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              +E+RVAVLVSL KVSR LAL+EGDIDWC+ S ++ E  D+  +    D+ V +KGIE+K
Sbjct  610   VLEERVAVLVSLFKVSRFLALLEGDIDWCKDSLLSPE--DVKQNLEKKDATVCIKGIEIK  667

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +P  YL+LALTHID++LRIDAAESLFINPKTASLPSSLELSLM+ AVPLNMRCCST+FQM
Sbjct  668   VPEKYLVLALTHIDETLRIDAAESLFINPKTASLPSSLELSLMKVAVPLNMRCCSTSFQM  727

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSRVRTALER +KQG+W P      S + +        + RA+ LFNFMKW
Sbjct  728   KWTSLFRKFFSRVRTALERQVKQGSWQPLARNDTSRNSVAKRTGDMFEDRADELFNFMKW  787

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHML-PPQGKSDSYSSEISLYPYSKGLIL  1617
             LSCFLFFSCYPSAPYERKIMAMEL+LIMLNVW ++ P +G  D+ S + SLYPYSKGL+L
Sbjct  788   LSCFLFFSCYPSAPYERKIMAMELLLIMLNVWSIVFPSEGTVDAVSPQFSLYPYSKGLLL  847

Query  1618  PESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRE  1797
             PESTLLLVGSI+DSWDRLR SSFRILLHFP+P+PGI S ++V E I+WAKKLV SPRVRE
Sbjct  848   PESTLLLVGSIVDSWDRLRVSSFRILLHFPSPLPGIHSEDMVSETIVWAKKLVYSPRVRE  907

Query  1798  SDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSP-SGLSNGENLEFTPSSPVIEYITSLI  1974
             SDAGALT RLIFRKYVLELGWVV  S N V+  P S L + EN     + P IEY+ SLI
Sbjct  908   SDAGALTLRLIFRKYVLELGWVVNASSNDVSAQPLSKLPSKENKACKFAPPAIEYLRSLI  967

Query  1975  DWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekila  2154
             DWL A V++GEKDLSEACK SFVHGVLLTLRYTFEE+DWDS A+  +IS +K +LEKIL 
Sbjct  968   DWLDAVVQDGEKDLSEACKNSFVHGVLLTLRYTFEELDWDSDAIVCSISEMKGVLEKILE  1027

Query  2155  lVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQD  2334
             LV RITS+ALWVVSADAWYLPD+M+EM  +     E P +MD      D E    +  Q+
Sbjct  1028  LVRRITSVALWVVSADAWYLPDDMDEMGDEALLLEEVPHKMD----EADKEQNTTEV-QE  1082

Query  2335  DGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGT--DQLSSDIVLD  2508
                 +QIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDV +S SQ    T    ++S  +LD
Sbjct  1083  GRQTEQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVSESGSQDVHETVLSNMTSGTMLD  1142

Query  2509  LRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMER  2688
             L+QLE+IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSND R CKLTESWMEQLMER
Sbjct  1143  LKQLEVIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDARFCKLTESWMEQLMER  1202

Query  2689  TVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknken  2868
             T++KGQTVDDLLRRSAGIPAAF AFFLSEP+G PK+LLP+ALRWL++VA K LTD  + N
Sbjct  1203  TIAKGQTVDDLLRRSAGIPAAFIAFFLSEPQGTPKKLLPRALRWLVDVANKYLTDHTEAN  1262

Query  2869  sscsesss-------AIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLAT  3027
             S  +++S+       A  S +  DV   E ISK RDEGVVPTVHAFNVLKAAFND NLAT
Sbjct  1263  SFSADTSNGFVETGPATFSIIASDVYDAERISKIRDEGVVPTVHAFNVLKAAFNDTNLAT  1322

Query  3028  DTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEF  3207
             D SGFSAEA+I+SIR FSS +WEVRNSACLAYTALVRRMIGFLNV KR SARRA+TG+EF
Sbjct  1323  DISGFSAEAMIISIRCFSSPHWEVRNSACLAYTALVRRMIGFLNVHKRASARRAITGIEF  1382

Query  3208  FHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSE  3387
             FHRYP LH+FLFNELKIATE  L+GSSE+L SNLAKVVHPSLCP+LILLSRLKPSPI SE
Sbjct  1383  FHRYPPLHSFLFNELKIATESLLDGSSEHLRSNLAKVVHPSLCPVLILLSRLKPSPIASE  1442

Query  3388  TGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHS  3567
              GDP DPFLFMPFIRKCS+Q+NLRIR+LASRALTG+VSNEKLP V+LNIASELP      
Sbjct  1443  AGDPLDPFLFMPFIRKCSVQSNLRIRVLASRALTGLVSNEKLPLVLLNIASELPGTGERF  1502

Query  3568  MTSDLSGLSN-LNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWI  3744
             + S+LS  SN +N+SFNS+HGML QLSSLL+TNCR+LAD S+K+ IL++LI +L   SWI
Sbjct  1503  VNSELSMPSNRVNSSFNSLHGMLSQLSSLLETNCRDLADVSQKDKILAELIRILASRSWI  1562

Query  3745  GSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAY  3924
             GSP++CPC I+N  FLKVLDNML +ARTC+ SK I VIW LLW  SS CLDL     PAY
Sbjct  1563  GSPERCPCSIINSCFLKVLDNMLGVARTCQTSKNIYVIWELLWRSSSVCLDLGVVCAPAY  1622

Query  3925  FDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQER  4104
             FDPT + LRKQAA SYFNC YQTSK+  EE L+      P S L   S  ++S +RF+ER
Sbjct  1623  FDPTTSNLRKQAACSYFNCVYQTSKEAAEEYLLVPSKGLPGSNLSMISVNEISFSRFKER  1682

Query  4105  LIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLL  4284
             LIRS SD  YEVRIATLKW LLFL +PE           SEIK   L+++ LQ  +++LL
Sbjct  1683  LIRSFSDTSYEVRIATLKWFLLFLKTPE----------YSEIKRSCLTSMDLQTTMVKLL  1732

Query  4285  AVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPTFVGNMDSDSVLQFWDKVVSLYKVTR  4464
              ++ NHKC+NYILKIIY++++Q+Y  N G+   P F G+MD +SVLQFW+KVVSLYKVTR
Sbjct  1733  TLDNNHKCLNYILKIIYSWSLQEYQNN-GEEYYPKFFGDMDIESVLQFWNKVVSLYKVTR  1791

Query  4465  HAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVV---NPSDPSKLSVFSECIDYFV  4635
              +KTREML+CCM VCIK+ A   +SS+ SL + KV  V   +PSD SKLS F ECI Y+V
Sbjct  1792  QSKTREMLLCCMGVCIKQFAGSLSSSVVSLQDVKVGEVSHHDPSDMSKLSAFYECISYYV  1851

Query  4636  EVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGN-----KQKDALH  4800
             ++I++HSDASEP+NMR+AAA+S++ASGLLDQA+ ++P V N+Q+PDGN     K +  ++
Sbjct  1852  DLIEQHSDASEPVNMRRAAAESMIASGLLDQAEVIAPFVYNNQIPDGNLCSYFKHEMVVN  1911

Query  4801  LYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIEM  4980
             +YAHK+LDLWF+C++LLEDED+ LRK+L+L+VQ C    +  S   +G VP QVE+VIE 
Sbjct  1912  IYAHKVLDLWFSCIRLLEDEDESLRKKLALDVQNCF---RCKSSERTGAVPSQVEQVIEK  1968

Query  4981  SFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNHHEEKLLISQI  5160
             SF HLSS FG  LDYLDFLC  V  + + AC +S  D ++RVFDKEIDNHHEEKLLI QI
Sbjct  1969  SFNHLSSIFGRCLDYLDFLCRRVVDSASHACVISEGDLIKRVFDKEIDNHHEEKLLICQI  2028

Query  5161  CCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNH  5340
             CC HLEKLP S    + RD     +LQ WRR+F Q+L+ F   Y+  QGG+DWIGGVGNH
Sbjct  2029  CCYHLEKLPTSGEGGDVRD-----ILQKWRRQFGQKLVLFAKDYVAAQGGLDWIGGVGNH  2083

Query  5341  KDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEAIQPFLRNPLISNLFVLVV  5520
             KDAFLP+Y NLLAF++LSNCI  G+AED KSM+ E+ E+GEAIQPFL NPLISNL +LVV
Sbjct  2084  KDAFLPLYANLLAFYSLSNCIFNGKAEDRKSMLREVEEIGEAIQPFLTNPLISNLLLLVV  2143

Query  5521  KSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
               H K+    +   +++ +   SAWDAFDPYFL R
Sbjct  2144  TLHNKM----ISQDLIKKTTDESAWDAFDPYFLLR  2174



>ref|XP_002277958.2| PREDICTED: thyroid adenoma-associated protein homolog [Vitis 
vinifera]
Length=2223

 Score =  2388 bits (6188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1221/1909 (64%), Positives = 1468/1909 (77%), Gaps = 40/1909 (2%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSRTVL   F+VS +  +G    G ++SSV+TILYDGIL ELCN+CE+PTDSHFN
Sbjct  321   GILTAVSRTVLTSQFIVSRNDLNGFDPQGISNSSVQTILYDGILPELCNYCENPTDSHFN  380

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIKTSM      + E YD I E++GTR+L+I+WNNLEDPLSQTVKQVH
Sbjct  381   FHALTVMQICLQQIKTSMSANLASVSENYDLIPEDMGTRILRIIWNNLEDPLSQTVKQVH  440

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDIQ +LHWAE +E+   FL +IA+DLL +GPRCKGRY+PLASLTKRLGAK++L
Sbjct  441   LIFDLFLDIQSSLHWAEDNERIKPFLCRIATDLLRMGPRCKGRYVPLASLTKRLGAKTLL  500

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              MSP LLF+T  AY+DDDVC AAT+FLKCF E LRDE WS+DG+EGGY  YR HCL P+L
Sbjct  501   GMSPDLLFETVHAYIDDDVCCAATSFLKCFFEHLRDECWSSDGIEGGYAIYRGHCLSPLL  560

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLR+NLNTYALPVLLE+DVDSIFPML F+ +G S E   + YPEL S ++ L
Sbjct  561   CGLASGVSKLRTNLNTYALPVLLEIDVDSIFPMLAFVSVGQSEEEARMVYPELSSTNMAL  620

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
             GVEQ+VAVLVSLLKVSR LALIEGDIDW    S+  E   + T++    ++V +KG++VK
Sbjct  621   GVEQQVAVLVSLLKVSRSLALIEGDIDWWNNYSICEEDDGMETESIDLYALVCIKGMKVK  680

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             + V +L LALTH+D+SLRIDAAESLF+NPKT+SLPS LELSL+++AVPLNMR CSTAFQM
Sbjct  681   VQVEWLTLALTHVDESLRIDAAESLFLNPKTSSLPSHLELSLLKEAVPLNMRSCSTAFQM  740

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGS--PLNGEADQSLKHRAENLFNFM  1434
             KWASLFRKFF+RVRTALER  KQG+W P +  C      P  G  ++++  RAE+LF+FM
Sbjct  741   KWASLFRKFFARVRTALERQFKQGSWQP-ISHCNKNGVFPYKG-TEEAVVSRAEDLFHFM  798

Query  1435  KWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPP-QGKSDSYSSEISLYPYSKGL  1611
             KWLS FLFFSCYPSAPYERKIMAMEL+LIMLNVW ++PP QGK  + S E  +YPY+KG 
Sbjct  799   KWLSSFLFFSCYPSAPYERKIMAMELILIMLNVWTVIPPSQGKCGAISPESCVYPYNKGF  858

Query  1612  ILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRV  1791
              LP+STLLLVGSIIDSWDRLRE+SFRILLHFPTP+PGISS E+V E IIWAKKL+CSPRV
Sbjct  859   TLPDSTLLLVGSIIDSWDRLRENSFRILLHFPTPLPGISSEEMVKEVIIWAKKLICSPRV  918

Query  1792  RESDAGALTFRLIFRKYVLELGWVVRVSCNVVT-QSPSGLSNGENLEFTPSSPVIEYITS  1968
             RESDAGAL  RLIFRKYVLELGW V+ S NVV+  S S L NG +  +    PVIEYI S
Sbjct  919   RESDAGALALRLIFRKYVLELGWNVQASVNVVSFYSESELINGNHQIYEYRFPVIEYIKS  978

Query  1969  LIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissikllleki  2148
             LIDWL  AVEEGEKDLSEAC+ SFVHG+LLTLRYTFEE+DW+S  V  +IS ++ +LEK+
Sbjct  979   LIDWLHVAVEEGEKDLSEACRNSFVHGILLTLRYTFEELDWNSNVVLFSISEMRHVLEKL  1038

Query  2149  lalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAE  2328
             L LV+RITSLALWVVSADAWYLP++M++M  D    +E P +MDV  S+ + + K +K  
Sbjct  1039  LELVVRITSLALWVVSADAWYLPEDMDDMVDDDTFLVEVPTDMDVPTSSSEHDAKTSKLV  1098

Query  2329  QDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPT---SDVPKSCSQITDGTD---QLS  2490
             QD  P +QIVMVGCWLAMKEVSLLLGTIIRK+PLP+   SD  K+     D +D     +
Sbjct  1099  QDIRPPEQIVMVGCWLAMKEVSLLLGTIIRKIPLPSNIPSDKSKAGDHFADASDVPSMTT  1158

Query  2491  SDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWM  2670
             SD++LDL+QLE IG HFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLC+LTE+WM
Sbjct  1159  SDVMLDLKQLETIGKHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCRLTENWM  1218

Query  2671  EQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLT  2850
             EQLME+T +KGQ VDDLLRRSAGIPAAF A FLSEPEG PK+LLP +LRWLI+VA +SL 
Sbjct  1219  EQLMEKTTAKGQIVDDLLRRSAGIPAAFMALFLSEPEGTPKKLLPHSLRWLIDVASQSLL  1278

Query  2851  DknkensscsesssAIDSTMVPDVAA---IEM-----ISKTRDEGVVPTVHAFNVLKAAF  3006
             D  + NS+ S+   ++ +      AA   +EM      SKTRDEGV+PTVHAFNVL+AAF
Sbjct  1279  DPTEANSTTSDLCKSLSTKSTQATAAALQLEMDVSQKASKTRDEGVIPTVHAFNVLRAAF  1338

Query  3007  NDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARR  3186
             ND NLATDTSGFSAEALI+SIRSFSS YWEVRNSACLAYTALVRRMIGFLNVQKRESARR
Sbjct  1339  NDTNLATDTSGFSAEALIISIRSFSSPYWEVRNSACLAYTALVRRMIGFLNVQKRESARR  1398

Query  3187  ALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLK  3366
             ALTGLEFFHRYP+LH FLFNELK+AT+L  + SSE+  SNLAKVVHPSLCPMLILLSRLK
Sbjct  1399  ALTGLEFFHRYPSLHPFLFNELKVATDLLTDVSSEHSESNLAKVVHPSLCPMLILLSRLK  1458

Query  3367  PSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASEL  3546
             PS ITSETGD  DPFLFMPFIR+CS Q+NLR+++LASRALTG+VSNEKLP V+L IASEL
Sbjct  1459  PSTITSETGDALDPFLFMPFIRRCSTQSNLRVQVLASRALTGLVSNEKLPVVLLAIASEL  1518

Query  3547  PAIDNHSMTSDLSGLSNLN----ASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDL  3714
             P        +  S  +  N    +SFNSIHGMLLQLSSLLDTNCRNLADFSKK+ IL DL
Sbjct  1519  PCTKEQMKDTRSSSFNTSNGTHLSSFNSIHGMLLQLSSLLDTNCRNLADFSKKDQILGDL  1578

Query  3715  IHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECL  3894
             I +L   SWIGSP+ CPCPILN SFL+VLD MLSIAR C+M K   +I N LW LSSECL
Sbjct  1579  IQILVMCSWIGSPRLCPCPILNGSFLRVLDQMLSIARICQMGKNFGIICNFLWELSSECL  1638

Query  3895  DLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDL-IYLRGPPPDSELFKESE  4071
             D+ +S +P+Y+DPT  EL KQAA SYF C  Q SK+  EE   I  R  PP S L +  +
Sbjct  1639  DIESSHKPSYYDPTAVELYKQAAVSYFGCVLQASKEEGEEVFQISHRFSPPTSNLVQTPK  1698

Query  4072  TQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLL--WL  4245
                +  +  ERL+ S+S   YEVR AT+KWLL FL S  S   ES+++S   + ++  W 
Sbjct  1699  MDSTFAKLPERLVLSMSSPSYEVRHATMKWLLQFLKSTGS-VRESNDQSSDGVMIIHKW-  1756

Query  4246  SNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPTF-VGNMDSDSVL  4422
             +   LQA LM+LL VE +HKC NYIL+I++T+N+ Q+ K   Q    T  +G M+ DSV 
Sbjct  1757  AKTNLQATLMKLLTVENHHKCTNYILRILFTWNLLQFQKLSDQKCPETINIGGMNCDSVF  1816

Query  4423  QFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVV-VNPSDPSK  4599
             QFW+K+VSLY++ RH KTRE L+CCM +C+KR A LFTS + S   +K  +    ++  K
Sbjct  1817  QFWNKLVSLYELARHTKTREALICCMGICVKRFAGLFTSYVLSEVEKKNAIDCKTNELEK  1876

Query  4600  LSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGN  4779
              +   ECI+YFV +I++ S ASEP+NMRKAAA+S+V SGLL+QA+ +  SV  + +P  +
Sbjct  1877  WTHLYECINYFVSLIKQLSAASEPVNMRKAAAESMVVSGLLEQAELIGSSVVCNYMPSES  1936

Query  4780  KQ-----KDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSG  4944
              +      +A++++A +ILD+WFTC++LLEDED GLR+ LS++VQKC  S + G  F + 
Sbjct  1937  PRSCFEPNEAINMFADEILDIWFTCIRLLEDEDVGLRQSLSMDVQKCFASNRFGKGFLAC  1996

Query  4945  VVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEID  5124
             VVP QVEKVIE  FE LS  FGHW+ Y D+L  WV SA    C VS  D VR VFDKEID
Sbjct  1997  VVPSQVEKVIESCFEFLSLVFGHWIGYFDYLMRWVYSA--GTCVVSGGDLVRHVFDKEID  2054

Query  5125  NHHEEKLLISQICCSHLEKLPVSKLTTEFRDNN-ICSVLQSWRRRFCQQLISFGNAYIGT  5301
             NHHEEKLLI QICCSHLEKL VSK      D   +   LQ WR RFCQQL+SF N ++  
Sbjct  2055  NHHEEKLLICQICCSHLEKLLVSKPLVNLYDKAWLNEFLQHWRMRFCQQLVSFANDHVRK  2114

Query  5302  QGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCI-LRGEAEDSKSMVPELLELGEAIQPF  5478
             Q GV W+GGVGNHKDAFLP+Y N+L FHALSNC+ +RG   D  S++ +++++GE I PF
Sbjct  2115  QRGVSWVGGVGNHKDAFLPLYANMLGFHALSNCVFIRGGITDGGSLLSDVVKVGETIDPF  2174

Query  5479  LRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             LRNPLI NL++LVVKSHE++   + +HL+ + SG  S W+ FDPYFL R
Sbjct  2175  LRNPLIQNLYLLVVKSHERMVSASTDHLIPKSSGDDSIWEGFDPYFLIR  2223



>ref|XP_011098614.1| PREDICTED: thyroid adenoma-associated protein homolog [Sesamum 
indicum]
Length=2223

 Score =  2378 bits (6164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1244/1900 (65%), Positives = 1473/1900 (78%), Gaps = 27/1900 (1%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSRTVL+  +VVS+DG  G+        SVKTILYD IL ELC++ E+PTDSH N
Sbjct  326   GILTAVSRTVLDTHYVVSSDGLGGVTASSGGGYSVKTILYDAILPELCSYAENPTDSHSN  385

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV+QICLQQIKT +QG      + YDPI EE+G R+LKIVWNNLEDPLSQTVKQVH
Sbjct  386   FHALTVIQICLQQIKTLLQGNTDGSADNYDPIPEEMGARILKIVWNNLEDPLSQTVKQVH  445

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDL+LDIQ +L WAEGSE    FLRKIASDLL LGPRCKGRY+PLASLT+RLGAK+IL
Sbjct  446   LIFDLYLDIQSSLQWAEGSENIKLFLRKIASDLLCLGPRCKGRYVPLASLTRRLGAKTIL  505

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              M+PGLLF+T KAY+DDDVC AATTFLKCFLECLRDEYWS+DGV+ GY KYR HCL P L
Sbjct  506   GMNPGLLFETIKAYIDDDVCCAATTFLKCFLECLRDEYWSSDGVDNGYAKYRGHCLPPFL  565

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+ G AKLRSNLNTYALPVLLELDVD IF ML  IGIG   E     + E+   D+VL
Sbjct  566   HGLAFGLAKLRSNLNTYALPVLLELDVDCIFSMLASIGIGWD-EDPLFTFTEISCTDMVL  624

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
             GVEQ+ AVLVSLLKVSR+LAL+EGDIDW E SSV+ E T    +    D VV +KGIEVK
Sbjct  625   GVEQQSAVLVSLLKVSRVLALMEGDIDWYESSSVSPEGTAPDLENSNLDCVVGIKGIEVK  684

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +PV +L+LAL+HID+SLR+DAAE+LF+NPKTASLPSSLELSLMR AVPLNMRCCSTAFQM
Sbjct  685   VPVKWLILALSHIDESLRLDAAETLFLNPKTASLPSSLELSLMRTAVPLNMRCCSTAFQM  744

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSRVRTALER IK GTW P +    +G  L    +++++HRAE LF+F KW
Sbjct  745   KWNSLFRKFFSRVRTALERQIKLGTWKPLVSGDENGFFLYEGTEKTVRHRAETLFDFTKW  804

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPP-QGKSDSYSSEISLYPYSKGLIL  1617
             LSCFLFFSCYPSAPYERKIMAMEL+LIMLN+W ++P   G  D++ SE +LYPYSK L L
Sbjct  805   LSCFLFFSCYPSAPYERKIMAMELILIMLNIWPLVPTLPGNEDAFVSEANLYPYSKSLTL  864

Query  1618  PESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRE  1797
             P+STLLLVGSIIDSWDRLRESSFRILL+FPTP+PGI SP+LV EAIIWAKKLVCSPRVRE
Sbjct  865   PDSTLLLVGSIIDSWDRLRESSFRILLYFPTPLPGICSPDLVREAIIWAKKLVCSPRVRE  924

Query  1798  SDAGALTFRLIFRKYVLELGWVVRVSCNVVT-QSPSGLSNGENLEFTPSSPVIEYITSLI  1974
             +DAGALT RL+FRKYV+EL W+VR SCN V+  S S L NGE      S P + Y+ SLI
Sbjct  925   TDAGALTLRLLFRKYVMELSWIVRPSCNGVSFDSESELPNGEYQSCRSSPPAVTYLISLI  984

Query  1975  DWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekila  2154
             DWL AAVE+ E++LSEACK SFVHG+LLTLRYTFEEMDW+S     +I+ +K +LE++L 
Sbjct  985   DWLLAAVEDAERNLSEACKNSFVHGILLTLRYTFEEMDWNSNVFLHSIAEMKRVLERLLG  1044

Query  2155  lVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQD  2334
             LVMRITSLALWVVSADAWYLPD+MEEM  D A  LE   E++ S     DE+K+ K  ++
Sbjct  1045  LVMRITSLALWVVSADAWYLPDDMEEMVDDEAFLLEIQDEIESSGPKSQDEVKVTKVVEE  1104

Query  2335  DGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLR  2514
               P +Q+VMVGCWLAMKEVSLLLGTIIRKVPLPTSD  +     T      +S+ +LDL+
Sbjct  1105  VRPSEQVVMVGCWLAMKEVSLLLGTIIRKVPLPTSDEMREVMGSTADNSVGASNAMLDLK  1164

Query  2515  QLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTV  2694
             QLE IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLM+RTV
Sbjct  1165  QLETIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMQRTV  1224

Query  2695  SKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkenss  2874
             +KGQTVDDLLRRSAGIPAAF AFFLSEPEG PKRLLP+ALRWLI++AKKSLTD+   N+S
Sbjct  1225  AKGQTVDDLLRRSAGIPAAFIAFFLSEPEGTPKRLLPRALRWLIDIAKKSLTDQPHANNS  1284

Query  2875  csesssAIDS--------TMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATD  3030
              S   S   S        T  P +   + ISK RDEGVVPTVHAFNVL+AAFND NLATD
Sbjct  1285  NSNLCSGFLSNLNQETGCTPPPGMNGNKEISKVRDEGVVPTVHAFNVLRAAFNDTNLATD  1344

Query  3031  TSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFF  3210
             TSGFSAEALI+SIRSFSSSYWEVRNSACLAYTALVRRM+GFLN+QKRESARRALTGLEFF
Sbjct  1345  TSGFSAEALIISIRSFSSSYWEVRNSACLAYTALVRRMLGFLNIQKRESARRALTGLEFF  1404

Query  3211  HRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSET  3390
             HRYP+LH+FLFNELK+ATEL L+GSSE L SNL  +VHPSLCPMLILLSRLKPSPI+SET
Sbjct  1405  HRYPSLHSFLFNELKVATELLLDGSSEQLGSNLKNIVHPSLCPMLILLSRLKPSPISSET  1464

Query  3391  GDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELP----AID  3558
             GD FDPFLFMPFIR+CS Q+N RIR+LAS ALTG+V+NEKL  VILNIASELP    +I 
Sbjct  1465  GDAFDPFLFMPFIRRCSTQSNFRIRVLASGALTGLVANEKLKVVILNIASELPTEKSSIA  1524

Query  3559  NHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHS  3738
                  S L   +    SFNSIHGMLLQL+SL+D NCRNLAD SKK++IL +L+ +L K +
Sbjct  1525  TPGSPSTLDSTNETFCSFNSIHGMLLQLNSLVDINCRNLADSSKKDNILHELVQILAKRT  1584

Query  3739  WIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRP  3918
             WIG PQ+C CPILN   LKVLDNMLSIARTCE S+    IWNLLW LSSECLDL  +  P
Sbjct  1585  WIGRPQQCTCPILNGCILKVLDNMLSIARTCEASRSACDIWNLLWELSSECLDLEPADGP  1644

Query  3919  AYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRG-PPPDSELFKESETQMSVTRF  4095
              YFDPTI ELRKQAA+SYFNC +QTSK+V E+DL+       P +   +    ++  + F
Sbjct  1645  RYFDPTIQELRKQAATSYFNCVFQTSKEVVEDDLLMRSNFHSPATSSLRVVGVEVIFSGF  1704

Query  4096  QERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLM  4275
             QERLIRS+SD  YEVRIATLKWLLLFL   ES    ++++  SE   +  + + LQ  + 
Sbjct  1705  QERLIRSMSDTSYEVRIATLKWLLLFLKRRESLGNNNADQFYSEAMKICSTIVDLQDTVT  1764

Query  4276  QLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPTFVGNMDSDSVLQFWDKVVSLYK  4455
             +LL  EK+HKCM+Y+LKI YT+N   Y  N      P +V NMD  S+ Q W+ +VSL+K
Sbjct  1765  KLLVSEKHHKCMHYLLKIFYTWNSLGYPDN-QLGVGPRYVCNMDCHSIFQLWNMLVSLFK  1823

Query  4456  VTRHAKTREMLVCCMAVCIKRLADLFTSSI-CSLGNEKVVVVNPSDPSKL-SVFSECIDY  4629
             +TRHAKTR+ L+CC+ +C K++++L    + C +   K+  +  +DPSK+ S F + + Y
Sbjct  1824  ITRHAKTRQTLICCLGICAKQISNLCMRFLSCEVDKIKIAELIQTDPSKMFSDFYDSLSY  1883

Query  4630  FVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGN-----KQKDA  4794
             FV++I++ SDASEP+NMRKAAA+S++ASGLL  A+AL   V ++ V DG+     K ++A
Sbjct  1884  FVDLIEQSSDASEPVNMRKAAAESMIASGLLAHAEALGSLVFSYPVSDGSLCSNFKPEEA  1943

Query  4795  LHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVI  4974
             + L+A K+LDLW TC+KLLEDED GLRK+L+L+VQ C TS     HF +     QVEKVI
Sbjct  1944  IRLFARKVLDLWLTCIKLLEDEDVGLRKRLALDVQMCFTSRDPRKHFPATTASSQVEKVI  2003

Query  4975  EMSFEHLSSTFGHWLDYLDFLCHWVQSATNSA-CAVSIADPVRRVFDKEIDNHHEEKLLI  5151
             E+ FEHLS+ FGHWLDYLD+LC WV +A NS+   VS  D VRRVFDKEIDNHHEEKLLI
Sbjct  2004  ELCFEHLSTIFGHWLDYLDYLCCWVLNAANSSNYTVSGGDLVRRVFDKEIDNHHEEKLLI  2063

Query  5152  SQICCSHLEKLPVSK--LTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIG  5325
              QICCSHLE + +SK      + ++ +  +L+ WR RF +Q+I+F N ++G +G +DWIG
Sbjct  2064  CQICCSHLEGILISKSWAGDSWINSGVRDLLRKWRTRFLEQMIAFTNDHMGKRGSIDWIG  2123

Query  5326  GVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEAIQPFLRNPLISNL  5505
             GVGNHKDAFLP+Y NLLAF+ LSNCIL+ E ++   ++ E+  LGEAI PFL N LISNL
Sbjct  2124  GVGNHKDAFLPLYSNLLAFYVLSNCILKEEHDNCGHLLSEVSRLGEAINPFLGNSLISNL  2183

Query  5506  FVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             F++VV SHEK  G    +L  + S   S WD F+PYFL R
Sbjct  2184  FLIVVNSHEKYLGATAGNLPHKWSINDSTWDEFNPYFLLR  2223



>emb|CAN72934.1| hypothetical protein VITISV_020616 [Vitis vinifera]
Length=2161

 Score =  2356 bits (6106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1211/1909 (63%), Positives = 1457/1909 (76%), Gaps = 52/1909 (3%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSRTVL   FVVS +  +G    G ++SSV+TILYDGIL ELCN+CE+PTDSHFN
Sbjct  271   GILTAVSRTVLTSQFVVSRNDLNGFDPQGFSNSSVQTILYDGILPELCNYCENPTDSHFN  330

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIKTSM      + E YD I E++GTR+L+I+WNNLEDPLSQTVKQVH
Sbjct  331   FHALTVMQICLQQIKTSMSANLASVSENYDLIPEDMGTRILRIIWNNLEDPLSQTVKQVH  390

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDIQ +LHWAE +E+   FL +IA+DLL +GPRCKGRY+PLASLTKRLGAK++L
Sbjct  391   LIFDLFLDIQSSLHWAEDNERIKPFLCRIATDLLRMGPRCKGRYVPLASLTKRLGAKTLL  450

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              MSP LLF+T  AY+DDDVC AAT+FLKCF E LRDE WS+DG+EGGY  YR HCL P+L
Sbjct  451   GMSPDLLFETVHAYIDDDVCCAATSFLKCFFEHLRDECWSSDGIEGGYAIYRGHCLSPLL  510

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLR+NLNTYALPVLLE+D            +G S E   + YPEL S ++ L
Sbjct  511   CGLASGVSKLRTNLNTYALPVLLEID------------LGQSEEEARMVYPELSSTNMAL  558

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
             GVEQ+VAVLVSLLKVSR LALIEGDIDW    S+  E   + T++    ++V +KG++VK
Sbjct  559   GVEQQVAVLVSLLKVSRSLALIEGDIDWWNNYSICEEDDGMETESIDLYALVCIKGMKVK  618

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             + V +L LALTH+D+SLRIDAAESLF+NPKT+SLPS LELSL+++A PLNMR CSTAFQM
Sbjct  619   VQVEWLTLALTHVDESLRIDAAESLFLNPKTSSLPSHLELSLLKEAXPLNMRSCSTAFQM  678

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGS--PLNGEADQSLKHRAENLFNFM  1434
             KWASLFRKFF+RVRTALER  KQG+W P +  C      P  G  ++++  RAE+LF+FM
Sbjct  679   KWASLFRKFFARVRTALERQFKQGSWQP-ISHCNKNGVFPYKG-TEEAVVSRAEDLFHFM  736

Query  1435  KWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPP-QGKSDSYSSEISLYPYSKGL  1611
             KWLS FLFFSCYPSAPYERKIMAMEL+LIMLNVW ++PP QGK  + S E  +YPY+KG 
Sbjct  737   KWLSSFLFFSCYPSAPYERKIMAMELILIMLNVWTVIPPSQGKXGAISPESCVYPYNKGF  796

Query  1612  ILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRV  1791
              LP+STLLLVGSIIDSWDRLRE+SFRILLHFPTP+PGISS E+V E IIWAKKL+CSPRV
Sbjct  797   TLPDSTLLLVGSIIDSWDRLRENSFRILLHFPTPLPGISSEEMVKEVIIWAKKLICSPRV  856

Query  1792  RESDAGALTFRLIFRKYVLELGWVVRVSCNVVT-QSPSGLSNGENLEFTPSSPVIEYITS  1968
             RESDAGAL  RLIFRKYVLELGW V+ S NVV+  S S L NG +  +    PVIEYI S
Sbjct  857   RESDAGALALRLIFRKYVLELGWNVQASVNVVSFYSESELINGNHQIYEYRFPVIEYIKS  916

Query  1969  LIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissikllleki  2148
             LIDWL  AVEEGEKDLSEAC+ SFVHG+LLTLRYTFEE+DW+S  V  +IS ++ +LEK+
Sbjct  917   LIDWLHVAVEEGEKDLSEACRNSFVHGILLTLRYTFEELDWNSNVVLFSISEMRHVLEKL  976

Query  2149  lalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAE  2328
             L LV+RITSLALWVVSADAWYLP++M++M  D    +E P +MDV  S+ + + K +K  
Sbjct  977   LELVVRITSLALWVVSADAWYLPEDMDDMVDDDTFLVEVPTDMDVPXSSSEHDAKTSKLV  1036

Query  2329  QDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPT---SDVPKSCSQITDGTD---QLS  2490
             QD  P +QIVMVGCWLAMKEVSLLLGTIIRK+PLP+   SD  K+     D +D     +
Sbjct  1037  QDIRPPEQIVMVGCWLAMKEVSLLLGTIIRKIPLPSNIPSDKSKAGDHFADASDVPSMTT  1096

Query  2491  SDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWM  2670
             SD++LDL+QLE IG HFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLC+LTE+WM
Sbjct  1097  SDVMLDLKQLETIGKHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCRLTENWM  1156

Query  2671  EQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLT  2850
             EQLME+T +KGQ VDDLLRRSAGIPAAF A FLSEPEG PK+LLP +LRWLI+VA +SL 
Sbjct  1157  EQLMEKTTAKGQIVDDLLRRSAGIPAAFMALFLSEPEGTPKKLLPHSLRWLIDVASQSLL  1216

Query  2851  DknkensscsesssAIDSTMVPDVAA---IEM-----ISKTRDEGVVPTVHAFNVLKAAF  3006
             D  + NS+ S+   ++ +      AA   +EM      SKTRDEGV+PTVHAFNVL+AAF
Sbjct  1217  DPTEANSTTSDLCKSLSTKSTQATAAALQLEMDVSQKASKTRDEGVIPTVHAFNVLRAAF  1276

Query  3007  NDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARR  3186
             ND NLATDTSGFSAEALI+SIRSFSS YWEVRNSACLAYTALVRRMIGFLNVQKRESARR
Sbjct  1277  NDTNLATDTSGFSAEALIISIRSFSSPYWEVRNSACLAYTALVRRMIGFLNVQKRESARR  1336

Query  3187  ALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLK  3366
             ALTGLEFFHRYP+LH FLFNELK+ T+L  + SSE+  SNLAKVVHPSLCPMLILLSRLK
Sbjct  1337  ALTGLEFFHRYPSLHPFLFNELKVVTDLLTDVSSEHSESNLAKVVHPSLCPMLILLSRLK  1396

Query  3367  PSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASEL  3546
             PS ITSETGD  DPFLFMPFIR+CS Q+NLR+R+LASRALTG+VSNEKLP V+L IASEL
Sbjct  1397  PSTITSETGDALDPFLFMPFIRRCSTQSNLRVRVLASRALTGLVSNEKLPVVLLAIASEL  1456

Query  3547  PAIDNHSMTSDLSGLSNLN----ASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDL  3714
             P        +  S  +  N    +SFNSIHGMLLQLSSLLDTNCRNLADFSKK+ IL DL
Sbjct  1457  PCTKEQMKDTRSSSFNTSNGTHLSSFNSIHGMLLQLSSLLDTNCRNLADFSKKDQILGDL  1516

Query  3715  IHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECL  3894
             I +L   SWIGSP+ CPCPILN SFL+VLD MLSIAR C+M K   +I N LW LSSECL
Sbjct  1517  IQILVMCSWIGSPRLCPCPILNGSFLRVLDQMLSIARICQMGKNFGIICNFLWELSSECL  1576

Query  3895  DLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDL-IYLRGPPPDSELFKESE  4071
             D+ +S +P+Y+DPT  EL KQAA SYF C +Q SK+  EE   I  R  PP S L +  +
Sbjct  1577  DIESSHKPSYYDPTAVELYKQAAVSYFGCVFQASKEEGEEVFQISHRFSPPTSNLVQTPK  1636

Query  4072  TQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLL--WL  4245
                +  +  ERL+ S+S   YEVR AT+KWLL FL S  S   ES+++S   + ++  W 
Sbjct  1637  MDSTFAKLPERLVLSMSSXSYEVRHATMKWLLQFLKSTGS-VRESNDQSSDGVMIIHKW-  1694

Query  4246  SNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPTF-VGNMDSDSVL  4422
             +   LQA LM+LL VE +HKC NYIL+I++T+N+ Q+ K   Q    T  +G M+ DSV 
Sbjct  1695  AKTNLQATLMKLLTVENHHKCTNYILRILFTWNLLQFQKLSDQKCPETIXIGGMNCDSVF  1754

Query  4423  QFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDP-SK  4599
             QFW+K+VSLY++ RH KTRE L+CCM +C+KR A LFTS + S   +K  +   +D   K
Sbjct  1755  QFWBKLVSLYELARHTKTREALICCMGICVKRFAGLFTSYVLSEVEKKNAIDCKTDELEK  1814

Query  4600  LSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGN  4779
              +   ECI+YFV +I++ S ASEP+NMRKAAA+S+V SGLL+QA+ +  SV  + +P  +
Sbjct  1815  WTHLYECINYFVSLIKQLSAASEPVNMRKAAAESMVVSGLLEQAELIGSSVVCNYMPSES  1874

Query  4780  KQ-----KDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSG  4944
              +      +A++++A +ILD+WFTC++LLEDED GLR++L+++VQKC  S + G  F + 
Sbjct  1875  PRSCFEPNEAINMFADEILDIWFTCIRLLEDEDVGLRQRLAMDVQKCFASNRFGKGFLAC  1934

Query  4945  VVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEID  5124
              VP QVEKVIE  FE LS  FGHW+ Y D+L  WV SA    C VS  D VR VFDKEID
Sbjct  1935  XVPSQVEKVIESCFEFLSLVFGHWIGYFDYLMRWVYSA--GTCVVSGGDLVRHVFDKEID  1992

Query  5125  NHHEEKLLISQICCSHLEKLPVSKLTTEFRDNN-ICSVLQSWRRRFCQQLISFGNAYIGT  5301
             NHHEEKLLI QICCSHLEKL VSK      D   +   LQ WR RFCQQL+SF N ++  
Sbjct  1993  NHHEEKLLICQICCSHLEKLLVSKPLVNLYDKAWLNEFLQHWRMRFCQQLVSFANDHVRK  2052

Query  5302  QGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCI-LRGEAEDSKSMVPELLELGEAIQPF  5478
             Q GV W+GGVGNHKDAFLP+Y N+L FHALSNC+ +RG   D  S++ +++++GE I PF
Sbjct  2053  QRGVSWVGGVGNHKDAFLPLYANMLGFHALSNCVFIRGGITDGGSLLSDVVKVGETIDPF  2112

Query  5479  LRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             LRNPLI NL++LVVKSHE++   + +HL+ + SG  S W+ FDPYFL R
Sbjct  2113  LRNPLIQNLYLLVVKSHERMVSASTDHLIPKSSGDDSIWEGFDPYFLIR  2161



>gb|EYU34083.1| hypothetical protein MIMGU_mgv1a000040mg [Erythranthe guttata]
Length=2172

 Score =  2313 bits (5995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1212/1892 (64%), Positives = 1451/1892 (77%), Gaps = 62/1892 (3%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSRTVL+  + VSND  D      N   SV+TILYD IL ELC + E+P+DSH N
Sbjct  326   GILTAVSRTVLDTHYFVSNDDLDDSKEFRNGGYSVRTILYDAILPELCGYAENPSDSHSN  385

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIKT +Q  +G     YDPI EE+G R+LKIVW NLEDPLSQTVKQVH
Sbjct  386   FHALTVMQICLQQIKTLLQVDNGGFTNNYDPIPEEMGARILKIVWQNLEDPLSQTVKQVH  445

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDL+LDIQ +L+WAEGSEK    +RKIASDLL LGPRCKGRY PLASLT+RLG+K+IL
Sbjct  446   LIFDLYLDIQASLYWAEGSEKIKLSMRKIASDLLSLGPRCKGRYAPLASLTRRLGSKAIL  505

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DM+P LL +TT+AY+DDDVC AAT+FLKCFLECLRDEYW++DGV+GGY KYR HCLLPIL
Sbjct  506   DMNPDLLVETTRAYIDDDVCCAATSFLKCFLECLRDEYWTSDGVDGGYAKYRGHCLLPIL  565

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGI----GCSAESTEIFYPELDSR  888
              GL+ G AKLR+NLNTYALPVLLELD DSIF ML  IGI    G    STEI +      
Sbjct  566   RGLAFGLAKLRTNLNTYALPVLLELDEDSIFYMLALIGIERVDGPFFASTEISFT-----  620

Query  889   DIVLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALE--VTDLSTDAGVCDSVVHV  1062
             D+ LG+EQ+ AVLVS+LKVSR+LAL+EGDIDW E SS + E  V DL      C  VV +
Sbjct  621   DLALGLEQQSAVLVSILKVSRVLALMEGDIDWYESSSESPEGAVLDLENSNLFC--VVGI  678

Query  1063  KGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCC  1242
             KG++VK+PV +L+LALTHID+SLR++AAE+LF+NPKTASLPSSLELSLMR+AVPLNMRC 
Sbjct  679   KGVQVKVPVKWLILALTHIDESLRMNAAETLFLNPKTASLPSSLELSLMRRAVPLNMRCS  738

Query  1243  STAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENL  1422
             STAFQMKW SLFRKFF+RVRTALER +K G+W P+   CL     NG A+++LK RAENL
Sbjct  739   STAFQMKWNSLFRKFFARVRTALERQLKLGSWKPNE-ACL----YNG-AEETLKQRAENL  792

Query  1423  FNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYS  1602
             F+F KWLSC L+FSCYPSAPYERK MAMEL+LIMLNVW +    G  D++ S+ +LYPYS
Sbjct  793   FDFAKWLSCLLYFSCYPSAPYERKTMAMELILIMLNVWPV--ASGNEDTFCSDTNLYPYS  850

Query  1603  KGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCS  1782
             K    P+STLLLVGSI+DSWDRLRESS RILL+FPTP+PG+ SP+LV EAIIWAKKL+CS
Sbjct  851   KSFTSPDSTLLLVGSIVDSWDRLRESSLRILLYFPTPLPGLGSPDLVREAIIWAKKLICS  910

Query  1783  PRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQ-SPSGLSNGENLEFTPSSPVIEY  1959
             PRVRESDAGALT RL+FRKYVLEL W+++ SCNVV+  S S + NG  L    +SPV+ Y
Sbjct  911   PRVRESDAGALTLRLLFRKYVLELSWILKPSCNVVSLCSESEMPNGSWLNCMTTSPVVSY  970

Query  1960  ITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklll  2139
             + SL+DWL AAVE+ EK+LSEACK SFVHG+LL LRYTFEEMDW++     + S +K +L
Sbjct  971   VMSLLDWLLAAVEDAEKNLSEACKNSFVHGILLALRYTFEEMDWNADVFPHSKSEMKHIL  1030

Query  2140  ekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIA  2319
             +++L LVMRITS+ALWVVSADA YLPD+MEEM  D A  +E   E+D+S    + E+K  
Sbjct  1031  QRLLELVMRITSVALWVVSADALYLPDDMEEMVDDEAFPIEILDEIDLSGPKSEVEVKNT  1090

Query  2320  KAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSD-VPKSCSQITDGTDQLSSD  2496
             K  ++  P +QIVMVGCWLAMKEVSLLLGT+IRKVPLPTSD V KS + I+D +D L+SD
Sbjct  1091  KVVEEIAPPEQIVMVGCWLAMKEVSLLLGTVIRKVPLPTSDEVRKSVTNISDDSD-LASD  1149

Query  2497  IVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQ  2676
             ++LDL+QLE IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWM+Q
Sbjct  1150  VMLDLQQLETIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMDQ  1209

Query  2677  LMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDk  2856
             LMERTV+KGQTVDDLLRRSAGIPAAF AFFLSEPEG PKRLLPKAL WLI+V K+SL D+
Sbjct  1210  LMERTVAKGQTVDDLLRRSAGIPAAFIAFFLSEPEGTPKRLLPKALSWLIDVVKESLIDQ  1269

Query  2857  nkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTS  3036
              K N S S+  S  +          + +SK RDEGVVPTVHAFNVLKAAFND NLATDTS
Sbjct  1270  PKSNISNSDLCSGNN----------DEVSKFRDEGVVPTVHAFNVLKAAFNDTNLATDTS  1319

Query  3037  GFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHR  3216
             GF A+A+++SIRSFSS YWE+RNSACLAYTAL+RRM+GFLN+QKRESARRALTGLEFFHR
Sbjct  1320  GFCADAIVISIRSFSSPYWEIRNSACLAYTALLRRMVGFLNIQKRESARRALTGLEFFHR  1379

Query  3217  YPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGD  3396
             YPTLH+FL NEL++ATEL L+GSSE+L  NL  VVHPSLCPMLILLSRLKPSPI+SETGD
Sbjct  1380  YPTLHSFLLNELRVATELLLKGSSEHLGFNLKNVVHPSLCPMLILLSRLKPSPISSETGD  1439

Query  3397  PFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTS  3576
               DPFLFMPFIR+CS+Q+NLRIR+LASRAL G+V+NEKL  V+LNIASELP   NH  T 
Sbjct  1440  SLDPFLFMPFIRRCSIQSNLRIRVLASRALMGLVANEKLQVVLLNIASELPCEKNHITTP  1499

Query  3577  D----LSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWI  3744
             D    L   +  + S+NSIHGMLLQL++L+DTNCRNL D  KK+ IL++LI +L   SWI
Sbjct  1500  DSSSTLISTNRTSCSYNSIHGMLLQLNALIDTNCRNLIDSFKKDTILNELIQILATRSWI  1559

Query  3745  GSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAY  3924
             G PQ CPCPILN   +KVLDNMLSIARTCE S+   VIWNLLW LSSE LDL  +   +Y
Sbjct  1560  GRPQYCPCPILNGCMIKVLDNMLSIARTCEASRGARVIWNLLWELSSESLDLEPTDCLSY  1619

Query  3925  FDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLR--GPPPDSELFKESETQMSVTRFQ  4098
             FDPTI ELRKQAA+SYFNC + T K+  E++L   R    P  S L    +T+++ T+FQ
Sbjct  1620  FDPTIQELRKQAATSYFNCVFPTCKEATEDELQMRRILSSPATSSLRVVGQTEVAFTKFQ  1679

Query  4099  ERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQ  4278
             ERLIRS+SDA YE+RIATLKWLLLFL + ES       +   +     L+NI LQ  LM+
Sbjct  1680  ERLIRSMSDASYEIRIATLKWLLLFLKNKESLGDNGDEQFHYDAIKTCLTNINLQETLMK  1739

Query  4279  LLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPTFVGNMDSDSVLQFWDKVVSLYKV  4458
             LL  EK+HKC++Y+LK+ YT+N  ++ ++     + T+V NMD +SV Q W+K+VSL+++
Sbjct  1740  LLVTEKHHKCIHYLLKVFYTWNSLEFQEDNQPSSETTYVCNMDRNSVFQLWNKLVSLFEI  1799

Query  4459  TRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKL-SVFSECIDYFV  4635
             TRHAKTR+ L+CCM VCIKR++ L  S I S   +K      + PSKL S F + + YF+
Sbjct  1800  TRHAKTRQTLICCMGVCIKRISILCMSFISSKVEKK-----ETTPSKLFSDFYDALTYFM  1854

Query  4636  EVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGNKQKDALHLYAHK  4815
             ++I+++SDASEPINMRKAAA+S++AS LL  A+AL   VS+    D N    ++ LYA K
Sbjct  1855  DMIEQNSDASEPINMRKAAAESMIASDLLGNAEALGSLVSSSTNSDENL---SIKLYARK  1911

Query  4816  ILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEHL  4995
             +LDLWF C+KLLEDED GLRK L+L+VQKC+   K  S F+  +   QVEKVIE+ FEHL
Sbjct  1912  VLDLWFICVKLLEDEDVGLRKTLALDVQKCL---KKNSPFA--MASSQVEKVIELCFEHL  1966

Query  4996  SSTFGHWLDYLDFLCHWVQSATNSACA-VSIADPVRRVFDKEIDNHHEEKLLISQICCSH  5172
             +  FG W DYLD LC WV +  N     VS  D VRRVFDKEIDNH+EEKLLI QICC  
Sbjct  1967  TEVFGQWHDYLDCLCSWVSNIANGGSYFVSGGDLVRRVFDKEIDNHYEEKLLICQICCLQ  2026

Query  5173  LEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAF  5352
             LE +P S             +L  WR RF ++LI F   YIG +G VDWIGGVGNHKDAF
Sbjct  2027  LEVIPSSN------SGGARGILGKWRTRFYEELIGFSREYIGKRGSVDWIGGVGNHKDAF  2080

Query  5353  LPVYVNLLAFHALSNCILRGEAEDSKSM-VPELLELGEAIQPFLRNPLISNLFVLVVKSH  5529
             LPVY NL+AF+ALS C+L+ E E S +M + E+  +GEAI+ FL NPLI NL+ ++VKSH
Sbjct  2081  LPVYANLVAFYALSKCLLKEEPESSGAMLLSEVDAIGEAIKLFLGNPLIYNLYSVLVKSH  2140

Query  5530  EKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             EK  G   ++L        S W  F+PYFL R
Sbjct  2141  EKCFGRNGDNLGGNWRRGDSDWVEFNPYFLLR  2172



>emb|CDP02224.1| unnamed protein product [Coffea canephora]
Length=2203

 Score =  2294 bits (5944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1207/1903 (63%), Positives = 1451/1903 (76%), Gaps = 44/1903 (2%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSRTVL+  FVVS   ++     G++ + +KTILYD IL ELC +CE+PTDSHFN
Sbjct  318   GILTAVSRTVLSSNFVVSTCDFENDSASGDS-TLIKTILYDSILPELCYYCENPTDSHFN  376

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQIC QQIKTSMQ   G   E Y+P+SE++G R+L+ VWNNLEDPLSQTVKQVH
Sbjct  377   FHALTVMQICFQQIKTSMQSNIGDFAESYNPLSEQMGRRILRTVWNNLEDPLSQTVKQVH  436

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDIQ +L WAEG EK   FLR+IASDLL LGPRCKGRY+PLASLTKRLGAK+IL
Sbjct  437   LIFDLFLDIQASLLWAEGGEKIKLFLREIASDLLCLGPRCKGRYVPLASLTKRLGAKTIL  496

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              MSP LLF+TTKAYVDDDVC AATTFLKCFLECLR E W++DG+E GY KYR  CL P L
Sbjct  497   AMSPDLLFETTKAYVDDDVCCAATTFLKCFLECLRKECWTSDGIENGYAKYRGDCLPPFL  556

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG AKLRSN+NTYALP++LELDVD +FPML  IG+    + TEI YPEL   ++ L
Sbjct  557   YGLASGVAKLRSNVNTYALPIVLELDVDGLFPMLASIGVKLVEDDTEIVYPELHYTEMSL  616

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
             G+EQRVA+LVSLL+VSR +ALIEGDID   Y S + EV + S    +  S V V+GI+VK
Sbjct  617   GLEQRVAILVSLLRVSRSIALIEGDID---YVSESFEVAENSRKYDM-HSFVCVRGIKVK  672

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             IPV +L+LAL+H D+SLR DAAE LF+NPKTASLPSSLELSL+++AVPLNMRCCSTAFQM
Sbjct  673   IPVKWLVLALSHTDESLRTDAAEFLFLNPKTASLPSSLELSLLKEAVPLNMRCCSTAFQM  732

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW S+FRKFFSRVRTALER  KQG W+P   +   G        + +   A++LFN MKW
Sbjct  733   KWTSMFRKFFSRVRTALERQYKQGNWYPYGSEANVGVASRNGTREIVVEMADDLFNLMKW  792

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSD-SYSSEISLYPYSKGLIL  1617
             LS F FFSCYPSAPYERKIMAMEL+L+MLNVW ++PP  ++  + SS+ SLYPYSKG IL
Sbjct  793   LSYFFFFSCYPSAPYERKIMAMELILVMLNVWSVMPPSKENHCALSSDTSLYPYSKGFIL  852

Query  1618  PESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRE  1797
              +S LLLVGSIIDSWDRLRE+SFRILLHFPTP+PGI SP+ + EAIIWAKKLVCSPRVRE
Sbjct  853   ADSALLLVGSIIDSWDRLRENSFRILLHFPTPLPGICSPDEIREAIIWAKKLVCSPRVRE  912

Query  1798  SDAGALTFRLIFRKYVLELGWVVRVSCNVVT-QSPSGLSNGENLEFTPSSPVIEYITSLI  1974
              DAGALT RLIFRKYVLEL W V++S + V+      L NG+    T  SP +EY+ SL+
Sbjct  913   CDAGALTLRLIFRKYVLELNWSVQLSLDFVSCHGQVELPNGKLEILTHRSPAVEYVRSLV  972

Query  1975  DWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekila  2154
             DWL   VE+GEKDLSEACKKSFVHGVLLTLRYTFEE+DW+S AV   I+ +KL+LEK+L 
Sbjct  973   DWLLITVEDGEKDLSEACKKSFVHGVLLTLRYTFEELDWNSTAVLCCIAEMKLVLEKLLE  1032

Query  2155  lVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQD  2334
             L+MRITSLALWVVSADAW+LP++ME+M  D     ++ +   V+    ++ M+  K  QD
Sbjct  1033  LIMRITSLALWVVSADAWHLPEDMEDMVDDDG--FDKEVMSKVAV---ENVMENVKLVQD  1087

Query  2335  DGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLR  2514
                 +QIVMVGCWLAMKEVSLLLGTIIRK+PLP     KS +   +G     SD VLD++
Sbjct  1088  ARSSEQIVMVGCWLAMKEVSLLLGTIIRKIPLPIVGASKSNASDGNGDSVSVSDGVLDMK  1147

Query  2515  QLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTV  2694
             QLE IG+HFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSN+PRLCKLTESWMEQLMERTV
Sbjct  1148  QLETIGSHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNNPRLCKLTESWMEQLMERTV  1207

Query  2695  SKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkenss  2874
             +KGQTVDDLLRRSAGIPAAFTA FL+EPEG+PKRLLP+ALRWL++VA KSL ++ K ++ 
Sbjct  1208  TKGQTVDDLLRRSAGIPAAFTAIFLAEPEGSPKRLLPRALRWLLDVANKSLLEQTKASNC  1267

Query  2875  csesssAIDST--------MVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATD  3030
              ++S+ A+ +         M   + A E ISK RDEGVVPTVH FNVL+AAFND+NLATD
Sbjct  1268  TNDSADALLTNSSQAGQFVMPLGMDAKEKISKIRDEGVVPTVHVFNVLRAAFNDSNLATD  1327

Query  3031  TSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFF  3210
             TSGFSAEALI SIRSFSS YWEVRNSACLAY+AL+RRMIGFLNVQKRESARRALTGLEFF
Sbjct  1328  TSGFSAEALIYSIRSFSSPYWEVRNSACLAYSALIRRMIGFLNVQKRESARRALTGLEFF  1387

Query  3211  HRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSET  3390
             HRYPTLH+FLF+ELKIATE  L+GSS    SNLAK+VHPSLCP+LILLSRLKPS +TSE 
Sbjct  1388  HRYPTLHSFLFHELKIATESLLDGSSGQQGSNLAKLVHPSLCPILILLSRLKPSAVTSEA  1447

Query  3391  GDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSM  3570
             GD  DPF+F+PFIRKCS+Q+N RIRILASRALTG++SNEKLP V+LNIASELP   N  +
Sbjct  1448  GDSLDPFIFLPFIRKCSVQSNFRIRILASRALTGLISNEKLPIVLLNIASELPCTRN--V  1505

Query  3571  TSDLSG-LSNLNA---SFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHS  3738
             +SD S  +   N    +FNS+HGMLLQL++LLD NCR LAD SKK+ IL DLI +L   S
Sbjct  1506  SSDASNSIDTQNGTCHTFNSLHGMLLQLNTLLDNNCRCLADSSKKDAILKDLIEILAIRS  1565

Query  3739  WIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRP  3918
             WIG  Q CPCPILN  FL VLDNMLSIA TC+MSK I+ IWNL+W LSSE LDL   ++ 
Sbjct  1566  WIGKFQLCPCPILNSCFLGVLDNMLSIATTCQMSKSIAAIWNLVWELSSEFLDLEEPQKS  1625

Query  3919  AYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIY--LRGPPPDSELFKESETQMSVTR  4092
             +Y DPTI ELRKQAA SYFNC Y+TSK++ EED++          S L + S+   +++R
Sbjct  1626  SYHDPTIVELRKQAAVSYFNCLYKTSKEIAEEDILMPGTCSSTTASSLLRVSDLDSALSR  1685

Query  4093  FQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAML  4272
             FQERL   +SD  YEVR+AT KWL+LF+ S   +  E  N S  EIK   L NI LQ  L
Sbjct  1686  FQERLRGCMSDTSYEVRLATFKWLVLFVKSAGLKI-EGGNSSSHEIKTYLLYNIDLQKKL  1744

Query  4273  MQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPTFVGNMDSDSVLQFWDKVVSLY  4452
             ++LLA E NHKC  YILKIIY +NM +  +  G+ +       +D  S+  FWDK+VS+Y
Sbjct  1745  VELLATENNHKCTYYILKIIYMWNMLECEEK-GELDVSLGSIGVDRSSLWWFWDKLVSMY  1803

Query  4453  KVTRHAKTREMLVCCMAVCIKRLADLFTSSICS-LGNEKVVVVNPSD-PSKLSVFSECID  4626
             KVTRH+K R++L+CCM +C+K+ A +F+S +CS +  E++ + +  D   +LS F +CI+
Sbjct  1804  KVTRHSKNRQVLICCMGICVKQFASIFSSFVCSNMKKEEIAISSRYDIDGRLSKFCDCIN  1863

Query  4627  YFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGN-----KQKD  4791
             YFVE+IQ HS ASEP+NMR AAA+SI ASGLLD A+       ++ +P  N     K ++
Sbjct  1864  YFVELIQLHSSASEPVNMRNAAAESIAASGLLDHAKIAGSLPFSNSIPGENPSSDFKVEE  1923

Query  4792  ALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKV  4971
              +++Y HKIL+LW TC++LLEDED  LR++L+L+VQK +TS       +  +VP QVEKV
Sbjct  1924  VVNMYGHKILNLWLTCIRLLEDEDVELRRKLALDVQKSVTSTTCQ---NVELVPSQVEKV  1980

Query  4972  IEMSFEHLSSTFGHWLDYLDFLCHWV-QSATNSACAVSIADPVRRVFDKEIDNHHEEKLL  5148
             IEMSF+HLSS FGHW+DY D LC++V  +  +    V   D VRRVFDKEIDNHHEEKLL
Sbjct  1981  IEMSFDHLSSIFGHWIDYFDSLCNYVFNAVNSVVSVVPNGDLVRRVFDKEIDNHHEEKLL  2040

Query  5149  ISQICCSHLEKLPVSKLTTEFRDNN--ICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWI  5322
             I QICCSHLEKLP+SK       +N  +  +L+ WRRRFC  L SF N YIG +  VDWI
Sbjct  2041  ICQICCSHLEKLPISKSWAANSSDNHKVRDLLRGWRRRFCHHLTSFANDYIGRR-EVDWI  2099

Query  5323  GGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEAIQPFLRNPLISN  5502
             GG GNHKDAFLP+Y NLLAF ALSNCI  GE E SKSM+ E+  LG  ++PFLRNP+ISN
Sbjct  2100  GGAGNHKDAFLPLYGNLLAFFALSNCIFEGEKESSKSMLDEVSVLGRTLRPFLRNPMISN  2159

Query  5503  LFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR*E  5631
             L++LV+ SHEK+ G     +   + G  S W+ F+PYFL R E
Sbjct  2160  LYLLVIDSHEKMVGATASDMNKSLIGNSSDWEGFNPYFLLRCE  2202



>ref|XP_007032508.1| Uncharacterized protein TCM_018498 [Theobroma cacao]
 gb|EOY03434.1| Uncharacterized protein TCM_018498 [Theobroma cacao]
Length=2221

 Score =  2290 bits (5935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1194/1905 (63%), Positives = 1439/1905 (76%), Gaps = 40/1905 (2%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAV R VLN  FVVS + ++   + GN  SS+KTILYDGIL ELCN+CE+PTDSHFN
Sbjct  325   GILTAVPRMVLNTNFVVSREIFNDFESVGNIVSSLKTILYDGILPELCNYCENPTDSHFN  384

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIKTSM        E Y+P+ E++GTR+L+I+WNNLEDPLSQTVKQVH
Sbjct  385   FHALTVMQICLQQIKTSMLANLTNASEEYNPLPEDMGTRMLRIIWNNLEDPLSQTVKQVH  444

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDIQ  L   EGSEK  SFLR IASDLLHLG RCKGRY+PLA LTKR GAK++L
Sbjct  445   LIFDLFLDIQSLLCGTEGSEKIKSFLRMIASDLLHLGSRCKGRYVPLALLTKRFGAKTML  504

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSP LLF+  +AY DDDVC AAT+FLKCFLE LRDE WS+DGVE GY  YR H L P L
Sbjct  505   DMSPDLLFEIVQAYTDDDVCCAATSFLKCFLEYLRDECWSSDGVERGYALYRGHYLPPFL  564

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYALPVLLE+DVD IFP+L  I IG S    E  Y ELD  ++ L
Sbjct  565   HGLASGISKLRSNLNTYALPVLLEVDVDGIFPLLACISIGPSGVENERLYSELDCTNVEL  624

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              VEQ+VAVLVSLLKVSR LALIEGDID+C+ S  +     L + +    +++ +KGI+V+
Sbjct  625   QVEQKVAVLVSLLKVSRSLALIEGDIDFCDDSKTSDTDDMLESKSFNLYALICIKGIKVR  684

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             I V +L+LALTHID+SLR+DAAESLF+NPKT+SLPS LELSLM+KAVPLNMR  ST FQM
Sbjct  685   ILVGWLVLALTHIDESLRVDAAESLFLNPKTSSLPSHLELSLMKKAVPLNMRSSSTGFQM  744

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW+SLFRKFFSRVRTALER +KQG+W P +    +   L+   ++S+  RA+ LFNFM+W
Sbjct  745   KWSSLFRKFFSRVRTALERQVKQGSWQPRVNHENNELCLSKGTEESVVSRAQELFNFMRW  804

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSS-EISLYPYSKGLIL  1617
             LSCFLFFSCYPSAPY+RK+MAMEL+LIM+N+W ++P   +S +  S E  LYPYS G+  
Sbjct  805   LSCFLFFSCYPSAPYKRKLMAMELILIMINIWSVIPSSQESSASISPESCLYPYSVGITS  864

Query  1618  PESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRE  1797
             P+ST LLVGSIIDSWDRLRESSFRILLHFPTP+PGIS+  +V + I WAKKLVCSPRVRE
Sbjct  865   PDSTFLLVGSIIDSWDRLRESSFRILLHFPTPLPGISNEGMVQKVITWAKKLVCSPRVRE  924

Query  1798  SDAGALTFRLIFRKYVLELGWVVRVSCNVV-TQSPSGLSNGENLEFTPSSPVIEYITSLI  1974
             SDAGALT RLIFRKYVL+LGW VR S NVV   S   L NG+ L+   + PVIEY+ SLI
Sbjct  925   SDAGALTLRLIFRKYVLDLGWRVRASANVVCCHSQYTLLNGDFLQCASAHPVIEYVQSLI  984

Query  1975  DWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekila  2154
              WL  AVEEGEKDL+EACK SFVHGVLLTLRYTFEE+DW+S AV S  S ++L LEK+L 
Sbjct  985   HWLDVAVEEGEKDLAEACKNSFVHGVLLTLRYTFEELDWNSDAVLSGTSEMRLALEKLLE  1044

Query  2155  lVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQD  2334
             LV+RITSLALWVVSADAW+LP++M+EM    A  L+ P EMDV   + + E K +K+ +D
Sbjct  1045  LVVRITSLALWVVSADAWHLPEDMDEMADGDAFLLDGPDEMDVPVPSTEQEDKSSKSIRD  1104

Query  2335  DGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKS------CSQITDGTDQLSSD  2496
               P DQIVMVGCWLAMKE+SLLLGTIIRK+PLP+     S      CS   D +   +  
Sbjct  1105  ARPSDQIVMVGCWLAMKELSLLLGTIIRKIPLPSHSCSGSLECGHPCSDSIDASVTATGG  1164

Query  2497  IVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQ  2676
             + LDL QLE IGNHF+EVLLKMKHNGAIDKTRAGFTALCNRLLCSNDP LCKLTESWMEQ
Sbjct  1165  M-LDLNQLEKIGNHFMEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPMLCKLTESWMEQ  1223

Query  2677  LMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDk  2856
             LMERT++KGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPK+LLP+ALRWLI+VA  SL   
Sbjct  1224  LMERTIAKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKKLLPRALRWLIDVANGSLLSP  1283

Query  2857  nkensscsesssA-------IDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDA  3015
             ++ N++      +        DS ++P++ A +  SK RDEGVV TVH FN+L+AAFND 
Sbjct  1284  SEANATSILCQISSTKSGQETDSALLPEMIATDKTSKIRDEGVVATVHTFNILRAAFNDT  1343

Query  3016  NLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALT  3195
             NLA+DTSGF+AEAL+VSIRSFSS YWEVRNSACLAYT+LVRRMIGFLNV KRESARRALT
Sbjct  1344  NLASDTSGFAAEALVVSIRSFSSPYWEVRNSACLAYTSLVRRMIGFLNVHKRESARRALT  1403

Query  3196  GLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSP  3375
             GLEFFHRYP+LH FL NELK+ATE F +  S    SNLAKVVHPSLCPMLILLSRLKPS 
Sbjct  1404  GLEFFHRYPSLHPFLSNELKVATEFFGDALSGQSESNLAKVVHPSLCPMLILLSRLKPST  1463

Query  3376  ITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAI  3555
             I SETGD  DPFLFMPFIRKCS Q+NL++R+LASRALTG+VSNEKLPTV+L+I+ EL  +
Sbjct  1464  IASETGDDLDPFLFMPFIRKCSTQSNLQVRVLASRALTGLVSNEKLPTVLLDISVELSHL  1523

Query  3556  DNHSMTSDLSGLS------NLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLI  3717
             +        + +S        +ASFN IHG+LLQLSSLLD NCRNLADFS+K+ IL DL+
Sbjct  1524  EKQITAGSAAPISLHPANGAHHASFNLIHGLLLQLSSLLDINCRNLADFSRKDQILDDLM  1583

Query  3718  HVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLD  3897
              VL   SWI SP+KCPCPILN SFL+VLD MLS+A +C MS  +  I NLL  LS+ECLD
Sbjct  1584  KVLAMRSWIASPKKCPCPILNYSFLQVLDRMLSVASSCHMSTNLFAIRNLLLELSTECLD  1643

Query  3898  LYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQ  4077
             +  S    ++DPTIAELR+QAA+SYF C +QTS +V EE     +  PPDS L +  E +
Sbjct  1644  VEASYGLPFYDPTIAELRQQAAASYFCCLFQTSDEVGEEVFQIPQRSPPDSMLLQIPEVE  1703

Query  4078  MSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESS-NKSQSEIKLLWLSNI  4254
                  F ERL+RSLSD  YEVR+ TLKWLL FL S ES +  +  + SQ+ I   W +  
Sbjct  1704  N--FGFLERLVRSLSDLSYEVRLVTLKWLLKFLKSRESGSEINYLSSSQTRIIKNW-NKA  1760

Query  4255  GLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPT-FVGNMDSDSVLQFW  4431
              LQA LM+LL VEKNH+C  YILKII+T+N  ++ + C +    T +VG +D DSV Q W
Sbjct  1761  NLQATLMKLLEVEKNHRCTYYILKIIFTWNFLKFQELCQEKSDETLYVGALDCDSVFQLW  1820

Query  4432  DKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSV-  4608
             D+++S+YK+TRHAKTRE LVCC+A+C+K  A LF+S I +   +K    + SD +  S  
Sbjct  1821  DRLISMYKLTRHAKTRETLVCCLAICVKHFARLFSSFILTDKGQKTTKCDESDQTDRSAC  1880

Query  4609  FSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGN---  4779
             F ECI +F++VI++HS +SEP+NMR+AA +SI+ASGLL+QA+ ++ SV N QV   N   
Sbjct  1881  FCECITFFLKVIKQHSSSSEPVNMRRAATESILASGLLEQAEVIASSVFNQQVSSKNSFS  1940

Query  4780  --KQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVP  4953
               + ++A+  YAH+IL++WF C+KLLEDEDDG+R +L+ ++QKC++   SG+   +   P
Sbjct  1941  YFELQNAVDKYAHQILEMWFACIKLLEDEDDGIRLRLATDIQKCLSPRSSGTKSDTCGAP  2000

Query  4954  IQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNHH  5133
              QVEKVIE+SF+HLSS FGHW+ Y D+L  WV  A N    +S  D VRRVFDKEIDNHH
Sbjct  2001  TQVEKVIELSFDHLSSIFGHWIVYFDYLLRWVLDAANY--VISKGDLVRRVFDKEIDNHH  2058

Query  5134  EEKLLISQICCSHLEKLPVSK--LTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQG  5307
             EEKLLISQICCSHLEKLP++K           + + L  WR RF  QL+SF   +IG + 
Sbjct  2059  EEKLLISQICCSHLEKLPITKSWAGELLNKEEVMNYLLDWRMRFYHQLMSFAKDHIG-KL  2117

Query  5308  GVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEAIQPFLRN  5487
             GVDWIGGVGNHKDAFLP+Y NLL F+ LSNCI   EA+D   ++ +++ELG AI PFLRN
Sbjct  2118  GVDWIGGVGNHKDAFLPIYANLLGFYVLSNCIFNLEAKDGMPLLSDIVELGNAIDPFLRN  2177

Query  5488  PLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLF  5622
             PLISNL++L+V+SHEK      + L         +W  FDPYFL 
Sbjct  2178  PLISNLYLLIVRSHEKKFSATTDCLNTRFRD--DSWYDFDPYFLL  2220



>ref|XP_006482571.1| PREDICTED: thyroid adenoma-associated protein homolog [Citrus 
sinensis]
Length=2224

 Score =  2285 bits (5922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1182/1901 (62%), Positives = 1428/1901 (75%), Gaps = 37/1901 (2%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSR VLN  F VS +  D      N D S KTILY+GIL ELC++CE+PTDSHFN
Sbjct  335   GILTAVSRNVLNALFFVSKE--DLSNGSENGDDSAKTILYNGILPELCSYCENPTDSHFN  392

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV+QICLQQIKTS+      +   YDPI E++GTR+L+I+WNNLEDPLSQTVKQVH
Sbjct  393   FHALTVLQICLQQIKTSILANLTNVSFDYDPIPEDMGTRILRIIWNNLEDPLSQTVKQVH  452

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             L+FDLFLDI+ +L W  GSE+  SFL+KIASDLL LGPRCKGRY+PLA LTKRLGAK++L
Sbjct  453   LVFDLFLDIESSLRWDVGSERIKSFLQKIASDLLCLGPRCKGRYVPLALLTKRLGAKTLL  512

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              MSP LL +   AY+DDDVCSAAT+FLKCFLECLRDE WS++G+  GY  YR HCL P L
Sbjct  513   GMSPDLLSEIVNAYIDDDVCSAATSFLKCFLECLRDECWSSNGISRGYAVYRGHCLPPFL  572

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYALPVLL++DVD IFPML F+ +  S E   + YPELD   I L
Sbjct  573   YGLASGVSKLRSNLNTYALPVLLDMDVDGIFPMLAFVSVVPSEEENGLSYPELDCSSIEL  632

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              VEQ+VAV VSLLKVSR LAL EGDID  + SSV    +   T+     ++V +KGI  K
Sbjct  633   KVEQQVAVFVSLLKVSRSLALAEGDIDLWKNSSVLRTGSKFVTEGSNLYALVCIKGINFK  692

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             + V++L+LALTH D+ LR+DAAESLF+NPKTASLPS LEL+LM++AVPLNMR CSTAFQM
Sbjct  693   VLVDWLVLALTHADELLRVDAAESLFLNPKTASLPSHLELTLMKEAVPLNMRSCSTAFQM  752

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSRVRTALER  KQG+W P ++ C +          ++  +AENLF FM+W
Sbjct  753   KWTSLFRKFFSRVRTALERQFKQGSWRP-VVSCENSDRTLINGTDTVISKAENLFKFMRW  811

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LSCFLFFSCYPSAPY+RKIMAMEL+L M+N+W + PPQ K DS S E SLYPY+KG+  P
Sbjct  812   LSCFLFFSCYPSAPYKRKIMAMELILTMMNIWSIAPPQEKLDSVSLESSLYPYNKGITAP  871

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
              STLLLVGSIIDSWDRLRESSFRILLHFP+P+PGISS  +V + I W+KKLVCSPRVRES
Sbjct  872   NSTLLLVGSIIDSWDRLRESSFRILLHFPSPLPGISSEGMVQKVITWSKKLVCSPRVRES  931

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLS-NGENLEFTPSSPVIEYITSLID  1977
             DAGAL  RLIFRKYVL+LGW+VR S NVV   P      GE      S+PV+EYI SLID
Sbjct  932   DAGALALRLIFRKYVLDLGWIVRASVNVVCLHPQPQQLKGEGQICKSSAPVVEYIKSLID  991

Query  1978  WLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilal  2157
             WL  AV+EGE+DLSE+C+ SFVHG+LL LRYTFEE+DW+S AV S  S +K  LEK+L L
Sbjct  992   WLEVAVKEGERDLSESCENSFVHGILLALRYTFEELDWNSNAVLSGYSEMKCALEKLLEL  1051

Query  2158  VMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQDD  2337
             VMRITSLALWVVSADAW LP++M++M +D    L+ P EMD    + +DE K +K  QD 
Sbjct  1052  VMRITSLALWVVSADAWCLPEDMDDMIIDDNLLLDVPEEMDEPLRSLEDEEKNSKPAQDV  1111

Query  2338  GPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLP---TSDVPKSCSQITDGTDQL---SSDI  2499
                +Q+VMVGCWLAMKEVSLLLGTIIRK+PLP   +SD   S S  +D  D L    SD 
Sbjct  1112  RTSEQVVMVGCWLAMKEVSLLLGTIIRKIPLPINSSSDTVDSGSGTSDAADDLLMTMSDA  1171

Query  2500  VLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQL  2679
             +LDL+QLE IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSND RLC+LTESWMEQL
Sbjct  1172  MLDLKQLEKIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDLRLCRLTESWMEQL  1231

Query  2680  MERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDkn  2859
             MERTV+KGQ VDDLLRRSAGIPAAF A FL+EPEGAPK+LLP+ALRWLI+VA +SL D  
Sbjct  1232  MERTVAKGQIVDDLLRRSAGIPAAFIALFLAEPEGAPKKLLPQALRWLIDVANRSLLDLI  1291

Query  2860  kensscse------sssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANL  3021
             +   + +       S+   +S + PD+ A    SK RDEGVVPTVHAFN+L+AAFND NL
Sbjct  1292  ENKGAKTTMCEFSHSNQETESAVPPDIYATWNSSKIRDEGVVPTVHAFNILRAAFNDTNL  1351

Query  3022  ATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGL  3201
             A DTS FSAEALI+SIRSFSS YWE+RNSACLAYTAL+RRM+GFLNVQKRESARRALTGL
Sbjct  1352  AADTSAFSAEALIISIRSFSSPYWEIRNSACLAYTALIRRMLGFLNVQKRESARRALTGL  1411

Query  3202  EFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPIT  3381
             EFFHRYP+LH F+FNEL++ TEL    SS    SNLA VVHPSLCPMLILL RLKPS + 
Sbjct  1412  EFFHRYPSLHPFIFNELRVITELLGNASSGQSASNLANVVHPSLCPMLILLCRLKPSALA  1471

Query  3382  SETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDN  3561
              E+GD  DPFLFMPFIR+CS Q+NL++R+LASRALTG+V NEKLP V+LNIASEL  +++
Sbjct  1472  GESGDDLDPFLFMPFIRRCSTQSNLKVRVLASRALTGLVPNEKLPDVLLNIASELLCVED  1531

Query  3562  HSMTSDLSGLSNLN-ASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHS  3738
              +  + +S L   + ASFN IHG+LLQL SLLD NCRNL DFSKK+ IL DLI +LG  S
Sbjct  1532  QNEAAPVSSLRGTHRASFNLIHGILLQLGSLLDANCRNLVDFSKKDQILGDLIKILGNCS  1591

Query  3739  WIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRP  3918
             WI +P+ CPCPILN SFLKVLD++LSIARTC  SK  S + NLL  LS++CLD+  S   
Sbjct  1592  WIANPKMCPCPILNASFLKVLDHVLSIARTCHTSKSFSTVRNLLLELSTDCLDVDASYGL  1651

Query  3919  AYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDL-IYLRGPPPDSELFKESETQMSVTRF  4095
              Y+DPTI ELRK+AA+SYF+C +Q S++  EE L +  R  P DS   K  + + + +  
Sbjct  1652  TYYDPTITELRKKAANSYFSCVFQASEESGEEVLQLPQRCSPVDSTSSKIPDMENTFSGL  1711

Query  4096  QERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLL--WLSNIGLQAM  4269
              ERL+RSLSD+ YEVR++TLKWLL FL S ES   E    S  EIK +  W  N  LQA 
Sbjct  1712  LERLVRSLSDSSYEVRLSTLKWLLKFLKSTES-DREVCELSSYEIKSIQNWTKN-NLQAT  1769

Query  4270  LMQLLAVEKNHKCMNYILKIIYTYNMQQYNK-NCGQHEKPTFVGNMDSDSVLQFWDKVVS  4446
             LM  L +EKN +C NY+L++++T+N+ Q+ K       +  FVG++D DSV QFWD+++S
Sbjct  1770  LMSRLELEKNPRCTNYVLRLLFTWNLLQFQKLGSNVCTETIFVGSVDCDSVFQFWDRLMS  1829

Query  4447  LYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDP-SKLSVFSECI  4623
              Y++TRHAK +E L+ CMA+CI+R A+LFTSSI     +K + ++ SD   + +    CI
Sbjct  1830  SYELTRHAKIKESLINCMAICIRRFANLFTSSILVDARKKTIEISESDHLGRSAHLFACI  1889

Query  4624  DYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGN-----KQK  4788
               FV +I  HS +SEP+NMRKAA  SIVASGLL+QA  +   VSNHQ+P  N     + +
Sbjct  1890  TAFVNIINRHSSSSEPVNMRKAATGSIVASGLLEQADLIGSYVSNHQIPSENSSLHFEPQ  1949

Query  4789  DALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEK  4968
             +A ++YAH++L +WFTC+KLLEDEDDG+R++L+++VQKC +  + GS  SS  VP QVEK
Sbjct  1950  EAGNMYAHQVLVIWFTCIKLLEDEDDGIRQRLAIDVQKCFSLKRFGS--SSHGVPNQVEK  2007

Query  4969  VIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNHHEEKLL  5148
             VIE+SFEHLSS FG W++Y D+LC WV  A +    VS  D VRRVFDKEIDNHHEEKLL
Sbjct  2008  VIELSFEHLSSIFGCWIEYFDYLCQWVLVAASH--VVSGGDLVRRVFDKEIDNHHEEKLL  2065

Query  5149  ISQICCSHLEKLPVSK--LTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWI  5322
             ISQICCS LEK+P+ K  +      ++  + L  WR+RF  QL+SF   +     GVDWI
Sbjct  2066  ISQICCSQLEKIPILKSWVADSLNKDHARNYLLGWRQRFSHQLMSFAKDHGRKYEGVDWI  2125

Query  5323  GGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEAIQPFLRNPLISN  5502
             GGVGNHKDAFLP+Y NLL F+ALS CI + EAED   ++ +++ELG  I PFLRNPL+ N
Sbjct  2126  GGVGNHKDAFLPLYANLLGFYALSICIFKVEAEDEMHLLSDVVELGRIISPFLRNPLVGN  2185

Query  5503  LFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             L++LVVK HEK  G   +H V E   A   WD FDPYFL R
Sbjct  2186  LYLLVVKLHEKQTGATADHTV-EFR-ADMIWDGFDPYFLLR  2224



>gb|KDO72545.1| hypothetical protein CISIN_1g000103mg [Citrus sinensis]
Length=2224

 Score =  2280 bits (5909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1179/1901 (62%), Positives = 1428/1901 (75%), Gaps = 37/1901 (2%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSR VLN  F VS +  D      N D S KTILY+GIL ELC++CE+PTDSHFN
Sbjct  335   GILTAVSRNVLNALFFVSKE--DLSNGSENGDDSAKTILYNGILPELCSYCENPTDSHFN  392

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV+QICLQQIKTS+      +   YDPI E++GTR+L+I+WNNLEDPLSQTVKQVH
Sbjct  393   FHALTVLQICLQQIKTSILANLTNVSFDYDPIPEDMGTRILRIIWNNLEDPLSQTVKQVH  452

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             L+FDLFLDI+ +L W  GSE+  SFL+KIASDLL LGPRCKGRY+PLA LTKRLGAK++L
Sbjct  453   LVFDLFLDIESSLRWDVGSERIKSFLQKIASDLLCLGPRCKGRYVPLALLTKRLGAKTLL  512

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              MSP LL +   AY+DDDVCSAAT+FLKCFLECLRDE WS++G+  GY  YR HCL P L
Sbjct  513   GMSPDLLSEIVNAYIDDDVCSAATSFLKCFLECLRDECWSSNGISRGYAVYRGHCLPPFL  572

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYALPVLL++DVDSIFPML F+ +  S E   + YPELD     L
Sbjct  573   YGLASGVSKLRSNLNTYALPVLLDMDVDSIFPMLAFVSVVPSEEENGLSYPELDCSSFEL  632

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              VEQ+VAV VSLLKVSR LAL EGDID  + SSV    +   T+     ++V +KGI  K
Sbjct  633   KVEQQVAVFVSLLKVSRSLALAEGDIDLWKNSSVLRTGSKFVTEGSNLYALVCIKGISFK  692

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             + V++L+LALTH D+ LR+DAAESLF+NPKTASLPS LEL+LM++AVPLNMR CSTAFQM
Sbjct  693   VLVDWLVLALTHADELLRVDAAESLFLNPKTASLPSHLELTLMKEAVPLNMRSCSTAFQM  752

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSRVRTALER  KQG+W P ++ C +          ++  +AENLF FM+W
Sbjct  753   KWTSLFRKFFSRVRTALERQFKQGSWRP-VVSCENSDRTLINGTDTVISKAENLFKFMRW  811

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LSCFLFFSCYPSAPY+RKIMAMEL+L M+N+W + PPQ K DS S E SLYPY+KG+  P
Sbjct  812   LSCFLFFSCYPSAPYKRKIMAMELILTMMNIWSIAPPQEKLDSVSLESSLYPYNKGITAP  871

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
              STLLLVGSIIDSWDRLRESSFRILLHFP+P+PGISS ++V + I W+KKLVCSPRVRES
Sbjct  872   NSTLLLVGSIIDSWDRLRESSFRILLHFPSPLPGISSEDMVQKVITWSKKLVCSPRVRES  931

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLS-NGENLEFTPSSPVIEYITSLID  1977
             DAGAL  RLIFRKYVL+LGW+VR S NVV   P      G       S+PV+EYI SLID
Sbjct  932   DAGALALRLIFRKYVLDLGWIVRASVNVVCLHPQPQQLKGVGQICKSSAPVVEYIKSLID  991

Query  1978  WLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilal  2157
             WL  AV+EGE+DLSE+C+ SFVHG+LL LRYTFEE+DW+S AV S  S +K  LEK+L L
Sbjct  992   WLEVAVKEGERDLSESCENSFVHGILLALRYTFEELDWNSNAVLSGYSEMKCALEKLLEL  1051

Query  2158  VMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQDD  2337
             VMRITSLALWVVSADAW LP++M++M +D    L+ P EMD    + +DE + +K  QD 
Sbjct  1052  VMRITSLALWVVSADAWCLPEDMDDMIIDDNLLLDVPEEMDEPLRSLEDEEQNSKPAQDV  1111

Query  2338  GPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLP---TSDVPKSCSQITDGTDQL---SSDI  2499
                +Q+VMVGCWLAMKEVSLLLGTIIRK+PLP   +SD   S S  +D  D L    SD 
Sbjct  1112  RTSEQVVMVGCWLAMKEVSLLLGTIIRKIPLPINSSSDTVDSGSGTSDAADDLLMTMSDA  1171

Query  2500  VLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQL  2679
             +LDL+QLE IG+HFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSND RLC+LTESWMEQL
Sbjct  1172  MLDLKQLEKIGSHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDLRLCRLTESWMEQL  1231

Query  2680  MERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDkn  2859
             MERTV+KGQ VDDLLRRSAGIPAAF A FL+EPEGAPK+LLP+ALRWLI+VA +SL D  
Sbjct  1232  MERTVAKGQIVDDLLRRSAGIPAAFIALFLAEPEGAPKKLLPQALRWLIDVANRSLLDLI  1291

Query  2860  kensscse------sssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANL  3021
             +   + +       S+   +S + PD+ A    SK RDEGVVPTVHAFN+L+AAFND NL
Sbjct  1292  ENKGAKTTMCEFSHSNQETESAVPPDIYATWNSSKIRDEGVVPTVHAFNILRAAFNDTNL  1351

Query  3022  ATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGL  3201
             A DTS FSAEALI+SIRSFSS YWE+RNSACLAYTAL+RRM+GFLNVQKRESARRALTGL
Sbjct  1352  AADTSAFSAEALIISIRSFSSPYWEIRNSACLAYTALIRRMLGFLNVQKRESARRALTGL  1411

Query  3202  EFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPIT  3381
             EFFHRYP+LH F+FNEL++ TEL    SS    SNLA VVHPSLCPMLILL RLKPS + 
Sbjct  1412  EFFHRYPSLHPFIFNELRVITELLGNASSGQSASNLANVVHPSLCPMLILLCRLKPSALA  1471

Query  3382  SETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDN  3561
              E+GD  DPFLFMPFIR+CS Q+NL++R+LASRALTG+V NEKLP V+LNIASEL  ++ 
Sbjct  1472  GESGDDLDPFLFMPFIRRCSTQSNLKVRVLASRALTGLVPNEKLPDVLLNIASELLCVEG  1531

Query  3562  HSMTSDLSGLSNLN-ASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHS  3738
              +  + +S L   + ASFN IHG+LLQL SLLD NCRNL DFSKK+ IL DLI VLG  S
Sbjct  1532  QNEAAPVSSLRGTHRASFNLIHGILLQLGSLLDANCRNLVDFSKKDQILGDLIKVLGNCS  1591

Query  3739  WIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRP  3918
             WI +P++CPCPILN SFLKVLD+MLSIAR C  SK  S + NLL  LS++CLD+  S   
Sbjct  1592  WIANPKRCPCPILNASFLKVLDHMLSIARACHTSKSFSTVRNLLLELSTDCLDVDASYGL  1651

Query  3919  AYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDL-IYLRGPPPDSELFKESETQMSVTRF  4095
              Y+DPTI ELRK+AA+SYF+C +Q S++  EE L +  R  P DS L K  + + + +  
Sbjct  1652  TYYDPTITELRKKAANSYFSCVFQASEESGEEVLQMPQRCSPVDSTLSKIPDMENTFSGL  1711

Query  4096  QERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLL--WLSNIGLQAM  4269
              ERL+RSLSD+ YEVR++TLKWLL FL S ES   E    S  EIK +  W  N  LQA 
Sbjct  1712  LERLVRSLSDSSYEVRLSTLKWLLKFLKSTES-DREVCELSSYEIKSIQNWTKN-NLQAT  1769

Query  4270  LMQLLAVEKNHKCMNYILKIIYTYNMQQYNK-NCGQHEKPTFVGNMDSDSVLQFWDKVVS  4446
             LM  L +EKN +C NY+L++++T+N+ Q+ K       +  FVG++D DSV+QFWD+++S
Sbjct  1770  LMSRLELEKNPRCTNYVLRLLFTWNLLQFQKLGSNVCTETIFVGSVDCDSVVQFWDRLMS  1829

Query  4447  LYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDP-SKLSVFSECI  4623
              Y++TRHAK +E L+ CMA+CI+R A+LFTSSI     +K + ++ SD   + +    CI
Sbjct  1830  SYELTRHAKIKESLINCMAICIRRFANLFTSSILVDARKKTIEISESDHLGRSAHLFACI  1889

Query  4624  DYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGN-----KQK  4788
               FV +I  HS +SEP+NMRKAA  SIVASGLL+QA  +   VSNHQ+P  N     + +
Sbjct  1890  TAFVNIINRHSSSSEPVNMRKAATGSIVASGLLEQADLIGSYVSNHQIPSENSSLHFEPQ  1949

Query  4789  DALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEK  4968
             +A ++YAH++L +WFTC+KLLEDEDDG+R++L+++VQKC +  + GS  SS  VP QVEK
Sbjct  1950  EAGNMYAHQVLVIWFTCIKLLEDEDDGIRQRLAIDVQKCFSLRRFGS--SSHGVPNQVEK  2007

Query  4969  VIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNHHEEKLL  5148
             VIE+SFEHLSS FG W++Y D+LC WV  A +    VS  D VRRVFDKEIDNHHEEKLL
Sbjct  2008  VIELSFEHLSSIFGCWIEYFDYLCQWVLVAASH--VVSGGDLVRRVFDKEIDNHHEEKLL  2065

Query  5149  ISQICCSHLEKLPVSK--LTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWI  5322
             ISQICC  LEK+P+ K  +      ++  + +  WR+RF  QL+SF   +     GVDWI
Sbjct  2066  ISQICCCQLEKIPILKSWVADSLNKDHARNYILGWRQRFSHQLMSFAKDHGRKYEGVDWI  2125

Query  5323  GGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEAIQPFLRNPLISN  5502
             GGVGNHKDAFLP+Y NLL F+ALS CI + EAED   ++ +++ELG  I PFLRNPL+ N
Sbjct  2126  GGVGNHKDAFLPLYANLLGFYALSICIFKVEAEDGMHLLSDVVELGRIISPFLRNPLVGN  2185

Query  5503  LFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             L++LVVK HEK  G   +H V E   A   WD FDPYFL R
Sbjct  2186  LYLLVVKLHEKQTGATADHTV-EFR-ADMIWDGFDPYFLLR  2224



>ref|XP_010108975.1| hypothetical protein L484_027170 [Morus notabilis]
 gb|EXC20615.1| hypothetical protein L484_027170 [Morus notabilis]
Length=2199

 Score =  2251 bits (5833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1170/1912 (61%), Positives = 1434/1912 (75%), Gaps = 66/1912 (3%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAV R VLN  F VS D             S +TILYDG+L ELCN+CE+PTDSHFN
Sbjct  317   GILTAVPRAVLNTCFTVSGD-------------SSRTILYDGVLPELCNYCENPTDSHFN  363

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV+QICLQQIKTSM        + YDPI EE+GTRVL+I+WNNLEDPLSQTVKQVH
Sbjct  364   FHALTVLQICLQQIKTSMLANLTIQSDNYDPIPEEMGTRVLRIIWNNLEDPLSQTVKQVH  423

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             L+F+LFLDIQ +LHW+EGSE+  SFL+KIASDLL LGPRCKGRY+PLASLTKRLG +++L
Sbjct  424   LVFNLFLDIQSSLHWSEGSERIKSFLQKIASDLLRLGPRCKGRYVPLASLTKRLGVRTML  483

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSP LL +T  AY+DDDVC AAT+FLKCFLE LRDE W+++G+EGGY  +R HCL P+L
Sbjct  484   DMSPHLLSETVHAYMDDDVCCAATSFLKCFLEYLRDECWASEGIEGGYALFRGHCLSPVL  543

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYALPVLLE+DVDSIF ML FI I  + +   + YPEL   ++ L
Sbjct  544   CGLASGVSKLRSNLNTYALPVLLEIDVDSIFSMLAFISIVPTGDGNRLLYPELGGTNMEL  603

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              V+Q+VA+LVSLLKVSR+LALIEGDIDWC+ SSV      L T      ++V VKGIEV+
Sbjct  604   RVQQKVAILVSLLKVSRLLALIEGDIDWCKDSSVNQIELGLDTKCIGQKALVCVKGIEVE  663

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             + V +L+LALTH+D+SLR+DAAESLFINPKT+S+ S LEL+L+++AVPLNMR  STAFQM
Sbjct  664   VLVEWLVLALTHVDESLRVDAAESLFINPKTSSMLSHLELTLLKEAVPLNMRSSSTAFQM  723

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KWASLFRKFF+RVRTALER  KQG W P      +   L   ++++  +RA NLF FM+W
Sbjct  724   KWASLFRKFFARVRTALERQFKQGNWQPHDHCSNNEKQLINGSEETEANRANNLFCFMRW  783

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPP--QGKSDSYSSEISLYPYSKGLI  1614
             LSCFLFFSCYPSAPY+RKIMAM+L+L+MLNVW +LP   Q K DS+SSE  L PY++G+I
Sbjct  784   LSCFLFFSCYPSAPYKRKIMAMDLILVMLNVWSILPSATQEKCDSFSSERGLNPYNEGII  843

Query  1615  LPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVR  1794
             LP+STLLLVGS+IDSWDRLRESSFRILLH+PTP+PGIS   +V   I WAKKLVCSPRVR
Sbjct  844   LPDSTLLLVGSVIDSWDRLRESSFRILLHYPTPLPGISDGNMVQNMITWAKKLVCSPRVR  903

Query  1795  ESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPS-GLSNGENLEFTPSSPVIEYITSL  1971
             ES+AGAL FRLIFRKYVL LGW+V  S NV    P   L+N        + PVIEYI SL
Sbjct  904   ESEAGALIFRLIFRKYVLNLGWIVNTSVNVACSQPKLELANRPYQVLNSTHPVIEYIKSL  963

Query  1972  IDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekil  2151
             IDWL AAV+EGE DLSEACK SFVHGVLLTLRYTFEE+D++  AV S+IS+++ LL K+L
Sbjct  964   IDWLDAAVKEGEMDLSEACKNSFVHGVLLTLRYTFEELDFNLDAVLSSISAMRHLLAKLL  1023

Query  2152  alVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQ  2331
              LV+RITSLALWVVSADAWYLP++M+EM  D +   E P E+D+   +  DE K++K  Q
Sbjct  1024  ELVLRITSLALWVVSADAWYLPEDMDEMVGDDSFLAEVPDEVDLHTPSDKDEEKVSKLVQ  1083

Query  2332  DDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLP----TSDVPKSCSQITDGTDQLSSDI  2499
             +    DQ+VMVGCWLAMKEVSLLLGTI RKVPLP    + D   S S   + + + S+  
Sbjct  1084  NSRSSDQVVMVGCWLAMKEVSLLLGTITRKVPLPYDAESLDTEGSSSSDVELSVRTSA-A  1142

Query  2500  VLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQL  2679
             +L+++QLE IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLC+LTESWMEQL
Sbjct  1143  MLEVKQLETIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCQLTESWMEQL  1202

Query  2680  MERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDkn  2859
             M+RTV+KGQTVD+LLRRSAGIPAAF A FLSEPEGAPK+LLP ALRWLI+VAK+ L D+ 
Sbjct  1203  MDRTVAKGQTVDNLLRRSAGIPAAFIALFLSEPEGAPKKLLPWALRWLIDVAKQPLLDQA  1262

Query  2860  kenss--------csesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDA  3015
             + NSS          +++        PD+   +M+SK RDEGV+PTVHAFNVL+AAFND 
Sbjct  1263  EINSSNDDLCMLSSMQTNQDFKCKRSPDMNISDMVSKIRDEGVIPTVHAFNVLRAAFNDT  1322

Query  3016  NLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALT  3195
             NLATDTSGF+AE+LI+SIRSFSS YWEVRNSACLAYTALVRRMIGFLNV KR+S+RRALT
Sbjct  1323  NLATDTSGFAAESLILSIRSFSSPYWEVRNSACLAYTALVRRMIGFLNVHKRDSSRRALT  1382

Query  3196  GLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSP  3375
             GLEFFHRYP+LH FL +ELK+AT+L   GSS +  SN+A VVHPSLCPMLI L+RLKPS 
Sbjct  1383  GLEFFHRYPSLHPFLLSELKVATQLLGNGSSGDSKSNMANVVHPSLCPMLIFLTRLKPST  1442

Query  3376  ITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAI  3555
             I SETGD  DPFL MP IR+CS Q+NL++R+LASRALTG+VSNEKL TV+LNIASELP++
Sbjct  1443  IASETGDELDPFLLMPLIRRCSTQSNLKVRLLASRALTGLVSNEKLQTVLLNIASELPSV  1502

Query  3556  DNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKH  3735
             DN  +T+  +G  + +ASFN IHG+LLQL SLLDTNCRNLADFSKK+ ILSDLI VL + 
Sbjct  1503  DNR-LTNQTNG--SQHASFNWIHGILLQLGSLLDTNCRNLADFSKKDQILSDLIQVLFRC  1559

Query  3736  SWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKR  3915
             SWI SP+ C CPILN SFLKVLD+MLSI+RTC  ++  + I NLL  LS+ECLD+  S  
Sbjct  1560  SWIASPRLCSCPILNASFLKVLDHMLSISRTCNTNRSFNAIRNLLLELSTECLDVEASYG  1619

Query  3916  PAYFDPTIAELRKQAASSYFNCAYQTSKDVNEE-DLIYLRGPPPDSELFKESETQMSVTR  4092
               Y+DPT AELR+QAA SYF+C +Q  ++  E+  L+     P +S      E + +   
Sbjct  1620  LPYYDPTTAELRQQAAVSYFSCVFQVFEEGTEDILLLPQLSSPLNSSFSNVPEKENTFAG  1679

Query  4093  FQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLL--WLSNIGLQA  4266
              +ER +RSLSD+ YEVR+A LKWL  FL S ES+ AE  ++  +EI ++  W S   LQ 
Sbjct  1680  LEERFVRSLSDSAYEVRLAALKWLFKFLQSTESK-AECHDQYSNEIMIIQHWAST-NLQP  1737

Query  4267  MLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPT---FVGNMDSDSVLQFWDK  4437
                +LL  EKNH+C  YIL+I++T+N  Q+ K   ++++ T   ++G MD DSV   WDK
Sbjct  1738  TFFKLLDSEKNHRCSYYILRILFTWNSLQFRK--AENKRSTEAIYIGGMDCDSVSLIWDK  1795

Query  4438  VVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVV--VNPSDPSKLSVF  4611
              +SLYK+ RHAKTRE LVCCM VC+KR+A LF   I     +K ++  V      KL+  
Sbjct  1796  FISLYKIARHAKTRETLVCCMGVCVKRIARLFAGYILIYVEQKKLIEHVESEQLEKLAQM  1855

Query  4612  SECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGNKQ--  4785
                I YF  +I++HS +SEP++MRKAAA+SIVASGLL+QA  +  S+S  + P  N +  
Sbjct  1856  YNRISYFTNLIKKHSASSEPVSMRKAAAESIVASGLLEQAALVGSSISASEFPPNNPRSA  1915

Query  4786  ---KDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPI  4956
                 + +++YA +ILD+WFTC+KLLEDEDDG+R +L+++VQ C +   S     S VVP 
Sbjct  1916  FELNEGVNMYARQILDIWFTCIKLLEDEDDGIRLRLAIDVQACFSCKSSVRSSQSEVVPT  1975

Query  4957  QVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSA--CAVSIADPVRRVFDKEIDNH  5130
             QV+KVI +SFEHLSS FG+W++Y D L   +QS  N+A    VS  D VRRVFDKEIDNH
Sbjct  1976  QVDKVIGLSFEHLSSIFGYWIEYFDRL---LQSILNAAENYEVSNGDLVRRVFDKEIDNH  2032

Query  5131  HEEKLLISQICCSHLEKLPVSKL-------TTEFRDNNICSVLQSWRRRFCQQLISFGNA  5289
             HEEKLLISQICCSHLEKLP+ K          +FR       L +WR RF   L+SF   
Sbjct  2033  HEEKLLISQICCSHLEKLPIFKYWAVDLLDKQQFR-----KYLLNWRWRFSHGLMSFTKD  2087

Query  5290  YIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEAI  5469
             +   QG ++W GGVGNHKDAFLP+Y NLL F+ LSNCI  G+ E+   ++  ++ELG  +
Sbjct  2088  HGEKQGELNWFGGVGNHKDAFLPLYSNLLGFYVLSNCIFNGKVENGAGLLSHVVELGGNL  2147

Query  5470  QPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             +PFL NPLISNL++LVVKSHEK+ G  ++ L+       + WD FDPYFL R
Sbjct  2148  KPFLGNPLISNLYLLVVKSHEKVVGETIKDLIPGSREDNAIWDGFDPYFLLR  2199



>ref|XP_010258389.1| PREDICTED: thyroid adenoma-associated protein homolog [Nelumbo 
nucifera]
 ref|XP_010258390.1| PREDICTED: thyroid adenoma-associated protein homolog [Nelumbo 
nucifera]
Length=2217

 Score =  2249 bits (5829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1161/1913 (61%), Positives = 1423/1913 (74%), Gaps = 60/1913 (3%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTA+ RTVLN  F  S D  D     G++ S + TIL+DGIL ELCN+CE P DSHFN
Sbjct  327   GILTAIPRTVLNTLFTYSRD-LDAFNVNGSSSSLIWTILFDGILLELCNYCEDPIDSHFN  385

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FH LTVMQICLQQIKTS+      + E YDPISE+VG R+L+I+WNNLEDPL+QTVKQVH
Sbjct  386   FHVLTVMQICLQQIKTSILADLVTLSENYDPISEDVGARILRIIWNNLEDPLNQTVKQVH  445

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDL LDIQ TL  A+GSE+  +FL+K ASDLL LG RCKGRY+PLASLTKRLGAK+IL
Sbjct  446   LIFDLLLDIQSTLKLAKGSERKRTFLQKTASDLLRLGARCKGRYVPLASLTKRLGAKTIL  505

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DM P LLF+T  AYVDDDVC A T+FLKCFLECLRDE WS+DG+E GY+ +R HCL P+L
Sbjct  506   DMRPNLLFETVYAYVDDDVCCAVTSFLKCFLECLRDECWSSDGIESGYVIFRGHCLPPVL  565

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL SG ++LRSNLNTYALPV+LE+DVDSIFPML FI +G   E +E+ YPEL   ++VL
Sbjct  566   YGLVSGVSRLRSNLNTYALPVVLEVDVDSIFPMLAFISVGQIVEDSEVIYPELSGANMVL  625

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              ++Q+VA LVSLLKVSR LALIEGDIDW   S +  E   L T+     ++V VKGI+VK
Sbjct  626   RIDQKVAALVSLLKVSRFLALIEGDIDWYHNSLMLQEECGLKTEDAAIFALVCVKGIKVK  685

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +PV +L+LALTH+D++LRIDAAESLF+NPKT+SLPS LELSLM++A+PLNMRCCSTAFQM
Sbjct  686   VPVEWLVLALTHVDETLRIDAAESLFLNPKTSSLPSPLELSLMKEAIPLNMRCCSTAFQM  745

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGE--ADQSLKHRAENLFNFM  1434
             KW SLFRKFFSRVRTALER +KQ  W P  + C   + +       +++ HRAE+LF+FM
Sbjct  746   KWTSLFRKFFSRVRTALERQLKQERWQP--LGCSDNNKVGQHKGGKETVAHRAEDLFHFM  803

Query  1435  KWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLP-PQGKSDSYSSEISLYPYSKGL  1611
             KWLSCFLFFSCYPSAPYERKIMAMELMLIM+NVW ++P  Q K DS     SL PYS+G 
Sbjct  804   KWLSCFLFFSCYPSAPYERKIMAMELMLIMINVWPVVPYSQNKCDSTLPSNSLCPYSEGF  863

Query  1612  ILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRV  1791
              LP+STLLLVGSIIDSWDRLRES+FRILLHFPTP+PGISS   V E I WAK+LVCSPRV
Sbjct  864   TLPDSTLLLVGSIIDSWDRLRESAFRILLHFPTPLPGISSQNAVKEVIAWAKRLVCSPRV  923

Query  1792  RESDAGALTFRLIFRKYVLELGWVVRVSCNVVT-QSPSGLSNGENLEFTPSSPVIEYITS  1968
             RESDAGALT RL FRKYVLELGW V  S N+V  +SPS  S+G++ E     PV+EYI S
Sbjct  924   RESDAGALTLRLTFRKYVLELGWTVGASVNIVCFKSPSNQSSGDS-EICERRPVLEYILS  982

Query  1969  LIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissikllleki  2148
             L++WL  AVEEGEKDLSEACK SFVHGVLLTLRYTFEE+DW+S  V S+ S ++ +LE +
Sbjct  983   LVNWLRIAVEEGEKDLSEACKNSFVHGVLLTLRYTFEELDWNSDVVLSSSSEMRHVLENL  1042

Query  2149  lalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAE  2328
             L LVMRITSLALWVVSADAWYLP++M++M  D     + P+EM+   S+ + ++K ++  
Sbjct  1043  LELVMRITSLALWVVSADAWYLPEDMDDMVDDDGFLSDAPVEMNGVESSSEHQVKSSRHM  1102

Query  2329  QDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQL--SSDIV  2502
                 P +Q+VMVGCWLAMKEVSLLLGTIIRK+PLP S    +C  ++   + L  ++D++
Sbjct  1103  TGARPSEQVVMVGCWLAMKEVSLLLGTIIRKIPLPRS----TCLDLSKPGELLCEATDVI  1158

Query  2503  LDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLM  2682
             LD++QLE IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCK+TESWMEQLM
Sbjct  1159  LDVKQLETIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKMTESWMEQLM  1218

Query  2683  ERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknk  2862
             ERTV+KGQTVDDLLRRSAGIPAAF A FLSEPEG PK+LLP+ALRWLI+VA  S     +
Sbjct  1219  ERTVAKGQTVDDLLRRSAGIPAAFIALFLSEPEGTPKKLLPRALRWLIDVANMSFPIPTQ  1278

Query  2863  ensscsesssAIDSTMVPDVAAI-------EMISKTRDEGVVPTVHAFNVLKAAFNDANL  3021
              N+   +  + +       + A        +  SK RDEGV+PTVHAFNVL+A+FND NL
Sbjct  1279  PNNQNGDLYTHLSQENQEPLCAQPTHVDLNQKNSKIRDEGVIPTVHAFNVLRASFNDTNL  1338

Query  3022  ATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGL  3201
             ATDTSGF AEALI++IRSFSS YWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGL
Sbjct  1339  ATDTSGFCAEALIIAIRSFSSPYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGL  1398

Query  3202  EFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPIT  3381
             EFFHRYP LH F F+ELK+ATE   +GS     SN+AKVVHPSLCPMLILLSRLKPS I+
Sbjct  1399  EFFHRYPILHPFFFSELKVATEFLGDGSCSE--SNMAKVVHPSLCPMLILLSRLKPSTIS  1456

Query  3382  SETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDN  3561
             SET D  DPFLFMPFIRKCS Q+NLR+R+LASRALTG+VSNEKLP+V++NIA ELP   N
Sbjct  1457  SETEDGLDPFLFMPFIRKCSTQSNLRVRVLASRALTGLVSNEKLPSVLINIAHELPHNRN  1516

Query  3562  HSMTSDL------SGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHV  3723
              + +          G      SFNSIHGMLLQL SLLD NCRNL D SKKE+IL DLI +
Sbjct  1517  GTSSRSASSSSTNGGYHTHVTSFNSIHGMLLQLGSLLDNNCRNLTDVSKKEEILGDLIEL  1576

Query  3724  LGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLY  3903
             L   SWIGSP+ CPCPILN S+L+ LD+MLSIAR C + K    I N L  LS  CL+  
Sbjct  1577  LKTSSWIGSPKLCPCPILNSSYLQALDHMLSIARRCGIRKHEGSICNTLLELSLICLNAD  1636

Query  3904  TSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDL----IYLRGPPPDSELFKESE  4071
              S+   ++DPT  EL KQA++SYFNC +Q S +  EED     I+     P  +LFK  E
Sbjct  1637  VSQMVPFYDPTKTELHKQASTSYFNCVFQASNEAPEEDFQMPHIFSH---PALDLFKVPE  1693

Query  4072  TQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSN  4251
             T+ ++   QERLI S+SDALYEVR+A+LKWLLLFL S  S      + S   I   W + 
Sbjct  1694  TEPAIAELQERLILSISDALYEVRLASLKWLLLFLKSTASSGDNDLSGSGIHIIYHW-AK  1752

Query  4252  IGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHE--KPTFVGNMDSDSVLQ  4425
               LQ  +MQLL  E+N +C  Y+L+I++ +N+ Q+ K+ G+H+  +  +VG MD  S+ +
Sbjct  1753  TSLQPTMMQLLDREENPRCTCYLLRILFLWNLIQFEKS-GKHQYVESVYVGVMDFASLFE  1811

Query  4426  FWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICS-LGNEKVVVVNPSDPSKL  4602
             FW+K++ L KV  H KTRE L+ CM +C KR + LF +S+ S LG +K+      DPS L
Sbjct  1812  FWNKLILLNKVATHTKTREALMRCMGICAKRFSCLFMTSVFSDLGGKKIF-----DPSNL  1866

Query  4603  ------SVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQ  4764
                   +    CI +F+++I+++S +SEP+NMRKAAA+SIVASGLL++A  +S  +SN Q
Sbjct  1867  DQSDSWNHIYRCIRFFIDLIKQYSASSEPVNMRKAAAESIVASGLLEEASCISSFISNTQ  1926

Query  4765  VPDGNKQ-----KDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGS  4929
             +P           +A++ Y   +LDLWFTC++LLEDED GLR++L+ +VQKC T  +SG 
Sbjct  1927  IPSEENHACFDPSEAVNTYGRTLLDLWFTCIRLLEDEDVGLRQRLAFDVQKCFTPKESGK  1986

Query  4930  HFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVF  5109
                +G VP QVEKVIE SF+ LSS FGHW  Y D+L  WV      +C V+  D VRR+F
Sbjct  1987  SHQTGFVPTQVEKVIESSFDFLSSAFGHWFQYFDYLSRWVMDI--GSCTVARGDLVRRIF  2044

Query  5110  DKEIDNHHEEKLLISQICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNA  5289
             DKEIDNHHEEKLLI Q+CC HLEKLPV  +      + + + LQ+WR RF  QLIS  + 
Sbjct  2045  DKEIDNHHEEKLLICQLCCFHLEKLPVFMVGDPSYKHEVRNFLQNWRMRFYHQLISCSSD  2104

Query  5290  YIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEAI  5469
             Y+  +GG+DWIGGVGNHKD+F+P+Y N+L F+ALS C+  GE E    ++P L+ELGE I
Sbjct  2105  YLPIEGGIDWIGGVGNHKDSFIPIYANMLGFYALSWCLYGGEFEVGDPLLPNLVELGEKI  2164

Query  5470  QPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYS-AWDAFDPYFLFR  5625
             +PFLRNPLISNL++ +++SHEK+ G A+ +   +    ++  W+ F+PYFL +
Sbjct  2165  RPFLRNPLISNLYLFLIQSHEKMLGVAMGNSGPKSYSEFTFTWEGFNPYFLLK  2217



>ref|XP_009376313.1| PREDICTED: thyroid adenoma-associated protein homolog, partial 
[Pyrus x bretschneideri]
Length=2167

 Score =  2248 bits (5826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1158/1907 (61%), Positives = 1417/1907 (74%), Gaps = 47/1907 (2%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSR VLN  F VS    +G  +  N  + VKTILYDGIL ELCN+CE+PTDSHFN
Sbjct  276   GILTAVSRAVLNTHFDVSKSSSNGYESHTNGGNCVKTILYDGILPELCNYCENPTDSHFN  335

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV+QICLQQIKTSM        E YDP+  E+GTR+L+IVWNNLEDPLSQTVKQVH
Sbjct  336   FHALTVLQICLQQIKTSMLANLTITSEDYDPVPVEMGTRILRIVWNNLEDPLSQTVKQVH  395

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDI+ TLHW+EGSE+  SFL+ IASDLL LGPRCKGRY+PL SLTKRLGAK++L
Sbjct  396   LIFDLFLDIRSTLHWSEGSERIRSFLQSIASDLLRLGPRCKGRYVPLGSLTKRLGAKTML  455

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSPGLLFDT  AY+DDDVC A T+FLK  LE LR+E WS+DG+EGGY  YR HCL PIL
Sbjct  456   DMSPGLLFDTIHAYIDDDVCCALTSFLKILLEDLRNECWSSDGIEGGYALYRGHCLPPIL  515

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
             SGL+SG +KLRSNLNTYALP+LLE+D DSIF ML FI +G S   +++ YPEL   ++  
Sbjct  516   SGLASGVSKLRSNLNTYALPILLEVDEDSIFAMLAFISVGPSKGESQLSYPELCCGNMEP  575

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              V+Q+VA+LVSLLKVSR+LAL+EGDID+    +V  ++  L T+     ++V +KGI+V+
Sbjct  576   RVQQKVAILVSLLKVSRLLALLEGDIDY----AVCEKIGGLETNFPERHALVSIKGIKVE  631

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             + V +L+LALTH+DDSLR+DAAE+LF+NPKTASLPS LEL L+++AVPLNMRCCSTAFQM
Sbjct  632   VRVEWLVLALTHVDDSLRVDAAETLFLNPKTASLPSHLELMLLKEAVPLNMRCCSTAFQM  691

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW+SLFRKFF+RVRTALER  KQG W P      +G  L+  ++    +RA +LF+FM+W
Sbjct  692   KWSSLFRKFFARVRTALERQFKQGRWEPLEHSNSNGMHLSIGSEHPEANRASDLFHFMRW  751

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPP-QGKSDSYSSEISLYPYSKGLIL  1617
             LS FLFFSCYPSAPY+RKIMAMEL+LIMLNVW ++P  Q K+ S   E  LYPY+KG+ L
Sbjct  752   LSSFLFFSCYPSAPYKRKIMAMELILIMLNVWSIVPATQEKNGSLCVEDRLYPYNKGMTL  811

Query  1618  PESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRE  1797
             P+STLLLVGSIIDSW+RLRE+SFRILLHFPTP+PGIS   +V   I+WAKKLVCSPRVRE
Sbjct  812   PDSTLLLVGSIIDSWERLRENSFRILLHFPTPLPGISDQVMVQNVILWAKKLVCSPRVRE  871

Query  1798  SDAGALTFRLIFRKYVLELGWVVRVSCNVVT-QSPSGLSNGENLEFTPSSPVIEYITSLI  1974
             +DAGALT RLIFRKYVL+LGW VR S NV    + SGL +G+N  +    PV+EYI SLI
Sbjct  872   TDAGALTLRLIFRKYVLQLGWTVRASVNVACLNTQSGLKSGDNQTYNSGYPVMEYIRSLI  931

Query  1975  DWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekila  2154
             +WL  ++EEGEKDLSEAC+ SFVHGVLLTLRY FEE+D++S    S+IS ++  LEK+L 
Sbjct  932   EWLDVSIEEGEKDLSEACQNSFVHGVLLTLRYAFEELDFNSDIAQSSISEMRHSLEKLLE  991

Query  2155  lVMRITSLALWVVSADAWYLPDEMEEMTVDGACFL-ERPIEMDVSASTPDDEMKIAKAEQ  2331
             LVMRITSLALWVVSADAW+LP++M+E+  D   FL E P E+ V  S  +DE K  K  Q
Sbjct  992   LVMRITSLALWVVSADAWHLPEDMDEVVDDNDSFLSEVPDEVGVKTSLLEDEDKNYKFVQ  1051

Query  2332  DDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTS------DVPKSCSQITDGTDQLSS  2493
             ++   +Q VMVGCWLAMKEVSLLLGTI RK+PLP++      D   + S  +D +  ++S
Sbjct  1052  NNRRSEQSVMVGCWLAMKEVSLLLGTITRKIPLPSTPSSESLDSEATYSCASDASVMMAS  1111

Query  2494  DIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWME  2673
             D +LD++QLE IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWME
Sbjct  1112  DAMLDVKQLERIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWME  1171

Query  2674  QLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSL--  2847
             QLM+RTV+KGQTVDDLLRRSAGIPAAF A FLSEPEGAPK+LLP+ALRWLI+VA  S   
Sbjct  1172  QLMDRTVAKGQTVDDLLRRSAGIPAAFIALFLSEPEGAPKKLLPRALRWLIDVANASSVG  1231

Query  2848  ------TDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFN  3009
                   ++ +       +S    +S +  D+   + +S+ RDEGV+PTVHAFNVL+AAFN
Sbjct  1232  PVETNNSNGDMGKFPSIKSDKVFESVVSSDIDISDKVSRIRDEGVIPTVHAFNVLRAAFN  1291

Query  3010  DANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRA  3189
             D NLA DTSGFSAEA+IVS+RSFSS +WEVRNSACLAYTALVRRMIGFLNVQKRES+RRA
Sbjct  1292  DTNLAADTSGFSAEAMIVSVRSFSSPHWEVRNSACLAYTALVRRMIGFLNVQKRESSRRA  1351

Query  3190  LTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKP  3369
             LTG+EFFHRYP LH FL  ELK AT L  +G S    SNL   VHPSLCP+LILLSRLKP
Sbjct  1352  LTGVEFFHRYPLLHPFLIKELKAATVLLGDGISGQSESNLENAVHPSLCPVLILLSRLKP  1411

Query  3370  SPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELP  3549
             S I SETGD  DPFL MPFIRKCS Q+NLR+R+LASRAL G+VSNEKLP+V+LNI SELP
Sbjct  1412  STIASETGDDVDPFLLMPFIRKCSTQSNLRVRVLASRALAGLVSNEKLPSVLLNIVSELP  1471

Query  3550  AIDNHSMTSDLSGL------SNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSD  3711
               D+ +  +  S L          +S+N IHG+LLQLSSLLDTNCRNLAD SKK+ IL D
Sbjct  1472  RRDDQATWTPESSLLFDKTERRQQSSYNWIHGILLQLSSLLDTNCRNLADSSKKDQILGD  1531

Query  3712  LIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSEC  3891
             L   L  HSWIG P+ CPCPILN SFL +LD+MLSIARTC  SK +  + NL+  LS+EC
Sbjct  1532  LFQALLAHSWIGKPRLCPCPILNASFLNLLDHMLSIARTCHTSKNVYALRNLVLELSTEC  1591

Query  3892  LDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDL-IYLRGPPPDSELFKES  4068
             LD+  S   +Y+DPT+AELR+QAA SYF+C +Q S  + EE      R    +S   +  
Sbjct  1592  LDVKASNGRSYYDPTMAELRQQAAVSYFSCVFQASDKMAEEVFQTPQRYSQSNSRFVEIP  1651

Query  4069  ETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLS  4248
             E +      QERL+RSLSD+ YEVR+ATLKWLL F+ S ES      N S+  +   W+ 
Sbjct  1652  EMENPFAGLQERLVRSLSDSEYEVRLATLKWLLKFITSTESGHESHDNSSEIRVIQHWV-  1710

Query  4249  NIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNK-NCGQHEKPTFVGNMDSDSVLQ  4425
                LQ  L+ LL VEK H+C  YIL+I++T+N  Q+ K    +  +  +V +M+ DSV  
Sbjct  1711  RTNLQTTLVNLLDVEKYHRCSYYILRILFTWNTLQFQKLGDAKCTETIYVASMECDSVFL  1770

Query  4426  FWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLS  4605
              WDK++SLYK TRHAK R+ L+CC  +CIKR A L T+S+ S  ++   +       KL+
Sbjct  1771  LWDKLISLYKFTRHAKARQTLICCFGICIKRFAGLLTTSVLSDNSDSDRL------EKLT  1824

Query  4606  VFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGN--  4779
                  I +F  VI +HS +SEPINMR AAA+SI+ASGLL+QA+ +  +V N+++P  N  
Sbjct  1825  RLYGIISFFTNVIMKHSASSEPINMRMAAAESIIASGLLEQAELIGYTVFNNRIPSENPC  1884

Query  4780  ---KQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVV  4950
                + K+A++ YAH+ILD+WFTC++LLEDEDD +R++L++ +Q C TS +SGS    GVV
Sbjct  1885  STFEPKEAVNFYAHQILDIWFTCIQLLEDEDDEIRERLAMGIQGCFTSKRSGSSH-DGVV  1943

Query  4951  PIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNH  5130
             P QVEKVI   FEHLSS FGHW+ Y D L  WV +A+N    V   D VR+VFDKEIDNH
Sbjct  1944  PTQVEKVIGSCFEHLSSVFGHWIGYFDSLLRWVLNASNR--EVPKGDLVRQVFDKEIDNH  2001

Query  5131  HEEKLLISQICCSHLEKLPVSK-LTTEFRD-NNICSVLQSWRRRFCQQLISFGNAYIGTQ  5304
             HEEKL I Q+CCS L+KL +SK    +F++       L  WR RF  QL SF    I   
Sbjct  2002  HEEKLFICQLCCSQLDKLRISKSWVADFQNKQQFSEYLHDWRLRFSCQLTSFAKDRIAKL  2061

Query  5305  GGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEAIQPFLR  5484
              G DWIGG GNHKDAFLP+Y NLLAF+ALS CI  G+  D+K +  ++ ELG+AI PFLR
Sbjct  2062  CGADWIGGAGNHKDAFLPLYANLLAFYALSKCIFNGKTGDNKHLQSDVAELGKAINPFLR  2121

Query  5485  NPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             NPLISNL++LVVKSHE   G   + L+ ++ G  + W+ F+P+FL R
Sbjct  2122  NPLISNLYLLVVKSHEDAVGSNGDDLIPKL-GEGAIWEGFNPHFLLR  2167



>ref|XP_002517489.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45031.1| conserved hypothetical protein [Ricinus communis]
Length=2190

 Score =  2247 bits (5822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1187/1906 (62%), Positives = 1422/1906 (75%), Gaps = 48/1906 (3%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSRTVLN+ FV S+   +G    G   SSVKTILYDGIL ELCN+CE+P DSHFN
Sbjct  302   GILTAVSRTVLNLQFVESSSKLNGHEGNGTCASSVKTILYDGILPELCNYCENPIDSHFN  361

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FH LTVMQICLQQ+KTS+      + + YDP+ EE+G+R+L+I+WNNLEDPLSQTVKQVH
Sbjct  362   FHTLTVMQICLQQMKTSLLANLIDLSDNYDPMPEEMGSRILRIIWNNLEDPLSQTVKQVH  421

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
              +FDLFLDIQ TL    GS+K  SFL KIASDLL LG RCKGRYIPLA LTKRLG KS+L
Sbjct  422   QVFDLFLDIQSTLRLGVGSQKIKSFLEKIASDLLPLGSRCKGRYIPLALLTKRLGPKSML  481

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             +M P LLF+T +AY+DDDVC AATTFLKCFLECLRDE W+ +GVE GY  YR  CL P L
Sbjct  482   EMCPDLLFETVQAYIDDDVCCAATTFLKCFLECLRDECWNNNGVEEGYAVYRGLCLPPFL  541

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYALP+LLE+DVDSIFPML FI +G   E   + +P+L + D+ L
Sbjct  542   YGLTSGVSKLRSNLNTYALPILLEVDVDSIFPMLSFISVGPIGEENGLSFPKLSATDVEL  601

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTD-LSTDAGVCDSVVHVKGIEV  1077
             GV Q+VAVLVSL KV R LALIEGDID  E ++ ALE    L  +     ++V +KGI+V
Sbjct  602   GVGQQVAVLVSLFKVCRSLALIEGDIDLYE-NAAALEAEGVLEAEVKNLYALVCIKGIKV  660

Query  1078  KIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQ  1257
             K+PV +L LAL H D+ LR+DAAESLF+NPKTASLPS LEL+L++KAVPLNMR CST FQ
Sbjct  661   KVPVEWLALALMHSDELLRVDAAESLFLNPKTASLPSHLELTLLKKAVPLNMRSCSTGFQ  720

Query  1258  MKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMK  1437
             MKW SLFRKFFSRVRTALER  K G+W P L      S      +++L +RA +LFNFM+
Sbjct  721   MKWTSLFRKFFSRVRTALERQFKHGSWQP-LANYQKESQSAKGTEEALVNRAGDLFNFMR  779

Query  1438  WLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPP-QGKSDSYSSEISLYPYSKGLI  1614
             WLS FLFFSCYPSAPY+RKIMAMEL+LIMLNVW ++PP + +  S + E SL PYS G+ 
Sbjct  780   WLSSFLFFSCYPSAPYKRKIMAMELILIMLNVWPIVPPSEDRCPSIAPECSLCPYSIGIT  839

Query  1615  LPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVR  1794
              PES LLLVGSIIDSWDRLRESSFRILL FPTP+PGISS E+V   I WAK LV SPRVR
Sbjct  840   SPESALLLVGSIIDSWDRLRESSFRILLCFPTPLPGISSEEMVQRVIAWAKNLVSSPRVR  899

Query  1795  ESDAGALTFRLIFRKYVLELGWVVRVSCN-VVTQSPSGLSNGENLEFTPSSPVIEYITSL  1971
             ESDAGALT +LIFRKYVLELGW+VR S + V  Q    L N ++    P  PV+EYI SL
Sbjct  900   ESDAGALTLKLIFRKYVLELGWIVRPSIDGVCFQYQCELVNEDSHIIEPRHPVVEYIKSL  959

Query  1972  IDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekil  2151
             I WL  AV EGE+DLSEACK SFVHGVLLTLRYTF+E+DW+S AV S+I  ++  L K+L
Sbjct  960   IGWLNVAVVEGERDLSEACKNSFVHGVLLTLRYTFDELDWNSDAVMSSILEMREALAKLL  1019

Query  2152  alVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQ  2331
              LVMRITSLALWVVSADAWYLPD  +    D   +L   ++M   +   + +   +K  Q
Sbjct  1020  GLVMRITSLALWVVSADAWYLPDMDDMGDDDN--YLMDELDMVGPSEHVNGD---SKHGQ  1074

Query  2332  DDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSC----SQITDGTDQLSSDI  2499
             D+ P +QIVMVGCWLAMKEVSLLLGTIIRKVPLP++   +S     S   D ++  +S  
Sbjct  1075  DNRP-EQIVMVGCWLAMKEVSLLLGTIIRKVPLPSNSCSRSLEVSMSNAGDSSEMSTSIA  1133

Query  2500  VLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQL  2679
             VLDL+QLE IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWM+QL
Sbjct  1134  VLDLKQLEEIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMDQL  1193

Query  2680  MERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSL---T  2850
             M+RTVSKGQTVDDLLRRSAGIPAAFTA FLSEPEGAPK+LLP+AL+WLINVA  SL    
Sbjct  1194  MQRTVSKGQTVDDLLRRSAGIPAAFTALFLSEPEGAPKKLLPRALKWLINVANSSLLGPV  1253

Query  2851  DknkensscsesssAI-----DSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDA  3015
             D     +   + S A+     DS    ++  +E  SK RDEGV+PTVHAFNVL+AAFND 
Sbjct  1254  DTKGIIADSCKFSLAVSDKKLDSAKSSEMHVMEKTSKIRDEGVIPTVHAFNVLRAAFNDT  1313

Query  3016  NLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALT  3195
             NLATDTSGFSA+ALIV+IRSFSS YWEVRNSACLAYTAL+RRMIGFLNVQKRESARRALT
Sbjct  1314  NLATDTSGFSADALIVAIRSFSSPYWEVRNSACLAYTALLRRMIGFLNVQKRESARRALT  1373

Query  3196  GLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSP  3375
             GLEFFHRYPTLH F +NELK+AT++ ++ +S +  SNLAKVVHPSLCPMLILLSRLKPS 
Sbjct  1374  GLEFFHRYPTLHAFFYNELKVATDMLMDATSGHSESNLAKVVHPSLCPMLILLSRLKPST  1433

Query  3376  ITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAI  3555
             I SE+GD  DPFLFMPFIR+CS Q+NLRIR+LAS+AL G+VSNEKLP V+LNIASELP +
Sbjct  1434  IASESGDDLDPFLFMPFIRRCSTQSNLRIRVLASKALMGLVSNEKLPVVLLNIASELPCM  1493

Query  3556  DNHSMTSDLSGLSN-----LNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIH  3720
              N   +S  S + N      NASFNSIHGMLLQL SLLD NCRNLAD +KKE IL DLI 
Sbjct  1494  KNPVTSSISSMIVNPNVGIYNASFNSIHGMLLQLGSLLDANCRNLADVAKKEKILGDLIE  1553

Query  3721  VLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDL  3900
             VL   SWI SP+ CPCPILN SF++ LD MLSIART   SK    I NLL  LS+  LD+
Sbjct  1554  VLTTCSWIASPKWCPCPILNTSFVRALDRMLSIARTGYTSKHFYAIRNLLLELSTVSLDV  1613

Query  3901  YTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQM  4080
               S   +Y+DPTI+ELR+QAA SYF+C +Q SK V E   +      PD +L   SET  
Sbjct  1614  EDSYGLSYYDPTISELREQAAISYFSCVFQASK-VEEILQMPQMHLSPDVKLLNLSETN-  1671

Query  4081  SVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGL  4260
             S T   ERLIRSLSD+ YEVR+ATLKWLL FL S ES+       S     +   +N  L
Sbjct  1672  SFTGLPERLIRSLSDSSYEVRLATLKWLLKFLKSTESKIEVHGIFSSGVRSIQQWNNANL  1731

Query  4261  QAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQH-EKPTFVGNMDSDSVLQFWDK  4437
             QA +++LL  E+NH+CMNYIL+I+  +N+ Q+ K  G+     ++VGN+  DS+ QFWDK
Sbjct  1732  QATMLKLLNSEENHRCMNYILRILSFWNLVQFKKLDGEKCTNTSYVGNLGFDSMCQFWDK  1791

Query  4438  VVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSV-FS  4614
             +VSLYK+TRH KTRE L+CCMA+C+++ A+L TS + +  +E     + SD    S+   
Sbjct  1792  LVSLYKLTRHTKTRETLICCMAICVRQYANLLTSYVLANVDESSSRCSASDQLGKSIHLY  1851

Query  4615  ECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGN-----  4779
             ECI+YFV VI+E S ASEP+NMR+AAA+SI+ASGLL+QA+ +  SV +H++P  +     
Sbjct  1852  ECIEYFVNVIKEQSSASEPVNMREAAAESIIASGLLEQAELIDSSVFSHEMPFESSGFSF  1911

Query  4780  KQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQ  4959
             + K+A+++YA ++L++WF C+KLLEDEDDG+R+ L++ VQKC +S K  S  ++G VP Q
Sbjct  1912  EPKEAVNMYASQVLEIWFLCIKLLEDEDDGVRQALAVNVQKCFSSRKMRSSSNAGEVPTQ  1971

Query  4960  VEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNHHEE  5139
             VEKVIEMSF +LSS FGHW++Y + L   V ++TN    V   D VRRVFDKEIDNHHEE
Sbjct  1972  VEKVIEMSFGYLSSIFGHWINYFEHLSQLVLNSTNY--LVPKGDLVRRVFDKEIDNHHEE  2029

Query  5140  KLLISQICCSHLEKLPVSKLTTEFRDNNICSV----LQSWRRRFCQQLISFGNAYIGTQG  5307
             KLLI QICCSHLEKLPV  L     D  I  V    L+ WR RF  QL+SF   Y+  Q 
Sbjct  2030  KLLICQICCSHLEKLPV--LNLWLSDMQIKEVFKNYLRRWRMRFYNQLMSFAEDYV-EQL  2086

Query  5308  GVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEAIQPFLRN  5487
             GVDWIGGV NHKDAFLP+Y NLL  +A SNCI +G+ +D  +++ E+ ELG+ + P LRN
Sbjct  2087  GVDWIGGVSNHKDAFLPLYANLLGIYAFSNCIFKGKVDDGSTLLAEVTELGKTLSPLLRN  2146

Query  5488  PLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             PLISNL+ LV+KSHEK+ G  ++ +        S WD FDPYFL R
Sbjct  2147  PLISNLYTLVLKSHEKVVGATLDQIYKFTDS--SIWDGFDPYFLLR  2190



>ref|XP_007214847.1| hypothetical protein PRUPE_ppa000039mg [Prunus persica]
 gb|EMJ16046.1| hypothetical protein PRUPE_ppa000039mg [Prunus persica]
Length=2195

 Score =  2242 bits (5810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1180/1921 (61%), Positives = 1426/1921 (74%), Gaps = 100/1921 (5%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVS---NDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDS  171
             GILTAVSR VLN  F +S   ++GY+   N GN    VKTILYDGIL ELCN+CE+PTDS
Sbjct  327   GILTAVSRVVLNSHFDMSRGYSNGYEVHTNGGN---CVKTILYDGILPELCNYCENPTDS  383

Query  172   HFNFHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVK  351
             HFNFH LTV+QICLQQIKTSM        E YDPI  E+GTR+L+IVWNNLEDPLSQTVK
Sbjct  384   HFNFHTLTVLQICLQQIKTSMLANLTIPSEHYDPIPVEMGTRILRIVWNNLEDPLSQTVK  443

Query  352   QVHLIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAK  531
             QVHLIFDLFLDI+ TL W+EGSE+  SFL+ IASDLL LGPRCKGRY+PL SLTKRLGAK
Sbjct  444   QVHLIFDLFLDIRSTLRWSEGSERIRSFLQNIASDLLRLGPRCKGRYVPLVSLTKRLGAK  503

Query  532   SILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLL  711
             ++LDMSP LLF+T  AY+DDDVC A T+FLKC LE LR+E WS+DGVEGGY+ YR  CL 
Sbjct  504   TMLDMSPNLLFETVHAYIDDDVCCAVTSFLKCLLEDLRNECWSSDGVEGGYVLYREKCLP  563

Query  712   PILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRD  891
             P L GL+SG +KLRSNLNTYALP+LLE+D DSIF ML FI +G S    ++ YPEL   +
Sbjct  564   PFLYGLASGVSKLRSNLNTYALPILLEVDEDSIFAMLSFISVGPSKGENQLLYPELCRGN  623

Query  892   IVLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGI  1071
             + L VEQ+VA+LVSLLKVSR+LAL+EGDIDWC  S+V  +   L TD     ++V +KGI
Sbjct  624   MELRVEQKVAILVSLLKVSRLLALLEGDIDWCNGSAVHEQFGGLETDFPDRYALVSIKGI  683

Query  1072  EVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTA  1251
             +V++ V +L+LALTH+DDSLR+DAAE+LF+NPKTASLPS LEL L+++AVPLNMRCCSTA
Sbjct  684   KVEVVVEWLVLALTHVDDSLRVDAAETLFLNPKTASLPSHLELMLLKEAVPLNMRCCSTA  743

Query  1252  FQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNF  1431
             FQMKW+SLFRKFFSRVRTALER  KQG W P      +   L+  +  +  +RA +LF+F
Sbjct  744   FQMKWSSLFRKFFSRVRTALERQFKQGIWEPLEHNNSNEMHLSCRSKHTEANRASDLFHF  803

Query  1432  MKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPP-QGKSDSYSSEISLYPYSKG  1608
             M+WLS FLFFSCYPSAPY+RKIMAMEL+LIMLNVW ++P  Q K  S S E  LYPY+KG
Sbjct  804   MRWLSSFLFFSCYPSAPYKRKIMAMELILIMLNVWSIVPATQEKIGSLSLEDCLYPYNKG  863

Query  1609  LILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPR  1788
             + LP+STLLLVGSIIDSWDRLRESSFRILLHFPTP+PGIS   +V   I+WAKKLVCSPR
Sbjct  864   ITLPDSTLLLVGSIIDSWDRLRESSFRILLHFPTPLPGISDEYMVQNVILWAKKLVCSPR  923

Query  1789  VRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITS  1968
             VRE+DAGAL  RLIFRKY                                  P +EYI S
Sbjct  924   VRETDAGALNLRLIFRKY----------------------------------PAMEYIRS  949

Query  1969  LIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissikllleki  2148
             LIDWL  ++ EGE+DLSEAC+ SFVHGVLLTLRY FEE+D++S  V S+IS ++  LEK+
Sbjct  950   LIDWLDVSIVEGERDLSEACQNSFVHGVLLTLRYAFEELDFNSDVVLSSISEMRHSLEKL  1009

Query  2149  lalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFL-ERPIEMDVSASTPDDEMKIAKA  2325
             L LVMRITSLALWVVSADAW+LP++M+ M  D   FL E P E++V AS  + E + +K 
Sbjct  1010  LELVMRITSLALWVVSADAWHLPEDMDGMVDDDDSFLSEVPDEVEVKASLLEHEDRNSKL  1069

Query  2326  EQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDI--  2499
              Q++   +Q VMVGCWLAMKEVSLLLGTIIRK+PLP+S  P S S  ++GT   +SD+  
Sbjct  1070  VQNNRRSEQSVMVGCWLAMKEVSLLLGTIIRKIPLPSS--PCSESLNSEGTSSCASDVSV  1127

Query  2500  ------VLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTE  2661
                   +LDL+QLE IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTE
Sbjct  1128  MIASNAMLDLKQLEAIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTE  1187

Query  2662  SWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKK  2841
             SWMEQLM+RTV+KGQTVDDLLRRSAGIPAAF A FLSEPEGAPK+LLP+ALRWLI+VAK 
Sbjct  1188  SWMEQLMDRTVAKGQTVDDLLRRSAGIPAAFIALFLSEPEGAPKKLLPRALRWLIDVAKA  1247

Query  2842  SLTDk--------nkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLK  2997
             S  D              S ++S  + +S +  D+   + +SK RDEGV+PTVHAFNVLK
Sbjct  1248  SFMDPVETNSSNCASSKVSSTKSDKSFESVVSSDIHIRDKVSKIRDEGVIPTVHAFNVLK  1307

Query  2998  AAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRES  3177
             AAFND NLATDTSGFSAEA+IVSIRSFSS YWEVRNSACLAYTALVRRMIGFLNVQKRES
Sbjct  1308  AAFNDTNLATDTSGFSAEAMIVSIRSFSSPYWEVRNSACLAYTALVRRMIGFLNVQKRES  1367

Query  3178  ARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLS  3357
             ARRALTG+EFFHRYP LH FLF ELK+ATEL  +G SE   SNL   VHPSLCP+LILLS
Sbjct  1368  ARRALTGVEFFHRYPLLHPFLFKELKVATELLGDGVSEQSKSNLENAVHPSLCPVLILLS  1427

Query  3358  RLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIA  3537
             RLKPS I SETGD  DPFL+MPFIR+CS Q+NLR+R+LASRALTG+VSNEKLPTV+LNI 
Sbjct  1428  RLKPSTIASETGDDLDPFLYMPFIRRCSTQSNLRVRVLASRALTGLVSNEKLPTVLLNIV  1487

Query  3538  SELPAIDNHSMTSDLSGLSNLN------ASFNSIHGMLLQLSSLLDTNCRNLADFSKKED  3699
             SELP IDN    +  S L   N       S+N IHG+LLQLSSLLDTNCRNLADFSKK+ 
Sbjct  1488  SELPRIDNQDTVTPDSSLLFHNIKRRHQCSYNWIHGVLLQLSSLLDTNCRNLADFSKKDQ  1547

Query  3700  ILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTL  3879
             IL DL   L  HSWI  P+ CPCPILN SFLK+LD+MLSI+RTC +SK      NLL  L
Sbjct  1548  ILGDLFQDLLPHSWIAKPRWCPCPILNASFLKLLDHMLSISRTCHLSKNFYAFRNLLLEL  1607

Query  3880  SSECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDL-IYLRGPPPDSEL  4056
             S+ECLD+  S+  +Y+DPT+AELR+QAA SYF+C +Q S+ + EE   +  R    +S  
Sbjct  1608  STECLDVEASEGHSYYDPTMAELRRQAAVSYFSCVFQASEKMAEEAFKMPQRSSQINSRF  1667

Query  4057  FKESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKL  4236
              K  E + +    QERL+ SLSD+ YEVR+ATLKWLL FL S ES     S+    EI++
Sbjct  1668  LKIPEMENAFVGLQERLVLSLSDSEYEVRLATLKWLLKFLTSIES--GSESDDYSCEIRI  1725

Query  4237  L--WLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPT---FVGN  4401
             +  W +   LQ  L+ LL VEKNH+C  YIL+I++T+N  Q+ K   + EK T   ++G 
Sbjct  1726  IQHW-NRTNLQTTLVNLLDVEKNHRCSYYILRILFTWNALQFQK--PRDEKCTETIYIGG  1782

Query  4402  MDSDSVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVN  4581
             M+ DSV   WDK++SLYK+TRHAK RE L+CCM +C+KR A LFT+S+ S    + +  N
Sbjct  1783  MEYDSVFLLWDKLISLYKLTRHAKARETLICCMGICVKRFAGLFTTSVLSDVRMRRLTDN  1842

Query  4582  PSDPS--KLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVS  4755
                    KL+     I +F  VI++HS +SEP+NMRKAAA+SI+A GLL+QA+ +  ++S
Sbjct  1843  SESDQLEKLTQLYSTISFFTSVIKKHSASSEPVNMRKAAAESIIACGLLEQAELIGSTLS  1902

Query  4756  NHQVPDGN-----KQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGK  4920
             N+Q+P  N     + K+A+++YA +ILD+WF C++LLEDEDDG+R++L++ +Q C T  +
Sbjct  1903  NNQIPSENPYSYFEPKEAVNIYARQILDIWFACIQLLEDEDDGIRERLAMGIQGCFTCKR  1962

Query  4921  SGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVR  5100
             SGS   SGVVP QVEKVI   FEHLSS FGHW+ YLD L  W+ +A+N    V+  D VR
Sbjct  1963  SGSS-HSGVVPTQVEKVIGSCFEHLSSIFGHWIGYLDCLLRWMLNASNY--EVAKGDLVR  2019

Query  5101  RVFDKEIDNHHEEKLLISQICCSHLEKLPVSKL-------TTEFRDNNICSVLQSWRRRF  5259
             +VFDKEIDNHHEEKL I QICCS +E+LP+SK          +FRD      L  WR RF
Sbjct  2020  QVFDKEIDNHHEEKLFICQICCSQMEELPISKSWAVDFLNKQQFRD-----YLHDWRLRF  2074

Query  5260  CQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMV  5439
               QL+SF    IG  GG DW+GG GNHKDAFLPVYVNLLAFHA+S+CI  G+ +D+  ++
Sbjct  2075  SSQLMSFAKDRIGQLGGADWVGGAGNHKDAFLPVYVNLLAFHAVSSCIFSGKTDDNMHLL  2134

Query  5440  PELLELGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFL  5619
              ++ EL  AI PFLRNPLISNL++LVVKSHE   G   + ++ ++ G  + WD F+P+FL
Sbjct  2135  SDVAELSRAINPFLRNPLISNLYLLVVKSHEDAIGSTGDGVIPKL-GEDAIWDGFNPHFL  2193

Query  5620  F  5622
              
Sbjct  2194  L  2194



>ref|XP_008230981.1| PREDICTED: LOW QUALITY PROTEIN: thyroid adenoma-associated protein 
homolog [Prunus mume]
Length=2177

 Score =  2229 bits (5776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1171/1916 (61%), Positives = 1416/1916 (74%), Gaps = 108/1916 (6%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVS---NDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDS  171
             GILTAVSR VLN  F +S   ++GY+   N GN    VKTILYDGIL ELCN+CE+PTDS
Sbjct  327   GILTAVSRAVLNSHFDMSRGYSNGYEVHTNGGN---CVKTILYDGILPELCNYCENPTDS  383

Query  172   HFNFHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVK  351
             HFNFH LTV+QICLQQIKTSM        E YDPI  E+GTR+L+IVWNNLEDPLSQTVK
Sbjct  384   HFNFHTLTVLQICLQQIKTSMLANLTIPSEHYDPIPVEMGTRILRIVWNNLEDPLSQTVK  443

Query  352   QVHLIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAK  531
             QVHLIFDLFLDI+ TLHW+EGSE+  SFL+ IASDLL LGPRCKGRY+PL SLTKRLGAK
Sbjct  444   QVHLIFDLFLDIRSTLHWSEGSERIRSFLQNIASDLLRLGPRCKGRYVPLVSLTKRLGAK  503

Query  532   SILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLL  711
             ++LDMSP LLF+T  AY+DDDVC A T+FLKC LE LR+E WS+DG+EGGY+ YR  CL 
Sbjct  504   TMLDMSPNLLFETVHAYIDDDVCCAVTSFLKCLLEDLRNECWSSDGIEGGYVLYREQCLP  563

Query  712   PILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRD  891
             P L GL+SG +KLRSNLNTYALP+LLE+D DSIF ML FI +G S    ++ YPEL   +
Sbjct  564   PFLYGLASGVSKLRSNLNTYALPILLEVDEDSIFAMLSFISVGPSKGENQLLYPELCRGN  623

Query  892   IVLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGI  1071
             + L VEQ+VA+LVSLLKVSR+LAL+EGDIDWC  S+V  +   L TD     ++V +KGI
Sbjct  624   MELRVEQKVAILVSLLKVSRLLALLEGDIDWCNDSAVHEQFGGLETDFPDRYALVSIKGI  683

Query  1072  EVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTA  1251
             +V++ V +L+LALTH+DDSLR DAAE+LF+NPKTASLPS LEL L+++AVPLNMRCCSTA
Sbjct  684   KVEVVVEWLVLALTHVDDSLRADAAETLFLNPKTASLPSHLELMLLKEAVPLNMRCCSTA  743

Query  1252  FQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNF  1431
             FQMKW+SLFRKFFSRVRTALER  KQG W P             E+ Q+  +RA +LF+F
Sbjct  744   FQMKWSSLFRKFFSRVRTALERQFKQGIWEPL------------ESKQTEANRASDLFHF  791

Query  1432  MKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPP-QGKSDSYSSEISLYPYSKG  1608
             M+WLS FLFFSCYPSAPY+RKIMAMEL+LIMLNVW ++P  Q K  S S E  LYPY+KG
Sbjct  792   MRWLSSFLFFSCYPSAPYKRKIMAMELILIMLNVWSIVPATQEKISSLSLEDRLYPYNKG  851

Query  1609  LILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPR  1788
             + LP+STLLLVGSIIDSWDRLRESSFRILLHFPTP+PGIS   +V   I+WAKKLVCSPR
Sbjct  852   ITLPDSTLLLVGSIIDSWDRLRESSFRILLHFPTPLPGISDEYMVQNVILWAKKLVCSPR  911

Query  1789  VRESDAGALTFRLIFRKYVLELGWVVRVSCNVVT-QSPSGLSNGENLEFTPSSPVIEYIT  1965
             VRE+DAGAL  RLIFRKYVL+LGW VR S +V   +S SGL NG+   +    P +EYI 
Sbjct  912   VRETDAGALNLRLIFRKYVLQLGWTVRASVDVACLRSQSGLENGDYQTYNSRYPAMEYIR  971

Query  1966  SLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllek  2145
             SLIDWL  ++ EGE+DLSEAC+ SFVHGVLLTLRY FEE+D++S  V S+IS ++  LEK
Sbjct  972   SLIDWLDVSIVEGERDLSEACQNSFVHGVLLTLRYAFEELDFNSDVVLSSISEMRHSLEK  1031

Query  2146  ilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFL-ERPIEMDVSASTPDDEMKIAK  2322
             +L LVMRITSLALWVVSADAW+LP++M+ M  D   FL E P E++V AS  + E + +K
Sbjct  1032  LLELVMRITSLALWVVSADAWHLPEDMDGMVDDDDSFLSEVPDEVEVKASLLEHEDRNSK  1091

Query  2323  AEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDI-  2499
               Q++   +Q VMVGCWLAMKEVSLLLGTIIRK+PLP+S  P S S  ++GT   +SD+ 
Sbjct  1092  LVQNNRRSEQSVMVGCWLAMKEVSLLLGTIIRKIPLPSS--PCSESLNSEGTSSCASDVS  1149

Query  2500  -------VLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLT  2658
                    +LDL+QLE                        GFTALCNRLLCSNDPRLCKLT
Sbjct  1150  VMIASDAMLDLKQLE------------------------GFTALCNRLLCSNDPRLCKLT  1185

Query  2659  ESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAK  2838
             ESWMEQLM+RTV+KGQTVDDLLRRSAGIPAAF A FLSEPEGAPK+LLP+ALRWLI+VAK
Sbjct  1186  ESWMEQLMDRTVAKGQTVDDLLRRSAGIPAAFIALFLSEPEGAPKKLLPRALRWLIDVAK  1245

Query  2839  KSLTDk--------nkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVL  2994
              S  D              S  +S  + +S +  D+   + +SK RDEGV+PTVHAFNVL
Sbjct  1246  ASFVDPVETNSSNCASSKVSSIKSDKSFESVVSSDIHISDKVSKIRDEGVIPTVHAFNVL  1305

Query  2995  KAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRE  3174
             KAAFND NLATDTSGFSAEA+IVSIRSFSS YWEVRNSACLAYTALVRR IGFLNVQKRE
Sbjct  1306  KAAFNDTNLATDTSGFSAEAMIVSIRSFSSPYWEVRNSACLAYTALVRRTIGFLNVQKRE  1365

Query  3175  SARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILL  3354
             SARRALTG+EFFHRYP LH FLF ELK+ATEL  +G S    SNL   VHPSLCP+LILL
Sbjct  1366  SARRALTGVEFFHRYPLLHPFLFKELKVATELLGDGVSGQSKSNLENAVHPSLCPVLILL  1425

Query  3355  SRLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNI  3534
             SRLKPS I SETGD  DPFL+MPFIR+CS Q+NLR+R+LASRALTG+VSNEKLPTV+LNI
Sbjct  1426  SRLKPSTIASETGDDLDPFLYMPFIRRCSTQSNLRVRVLASRALTGLVSNEKLPTVLLNI  1485

Query  3535  ASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDL  3714
              SELP IDN              +S+N IHG+LLQLSSLLDTNCRNLADFSKK+ IL DL
Sbjct  1486  VSELPRIDNQD-----------TSSYNWIHGVLLQLSSLLDTNCRNLADFSKKDQILGDL  1534

Query  3715  IHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECL  3894
                L  HSWI  P+ CPCPILN SFLK+LD+MLSI+RTC MSK      NLL  LS+ECL
Sbjct  1535  FQDLLPHSWIAKPRWCPCPILNASFLKLLDHMLSISRTCHMSKNFYAFRNLLLELSTECL  1594

Query  3895  DLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDL-IYLRGPPPDSELFKESE  4071
             D+  S+  +Y+DPT+AELR+QAA SYF+C +Q S+ + EE   +  R    +S   K  E
Sbjct  1595  DVEASEGHSYYDPTMAELRRQAAVSYFSCVFQASEKMAEEAFKMPQRRSQINSRFLKIPE  1654

Query  4072  TQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLL--WL  4245
              + +    QERL+ SLSD+ YEVR+ATLKWLL FL S ES     S+   SEI+++  W 
Sbjct  1655  MENAFVGLQERLVLSLSDSEYEVRLATLKWLLKFLTSTES--GSESDDYSSEIRIIQHW-  1711

Query  4246  SNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPT---FVGNMDSDS  4416
             +   LQ  L+ LL VEKNH+C  YIL+I++T+N  Q+ K   + EK T   ++G M+ DS
Sbjct  1712  NRTNLQTTLVNLLDVEKNHRCSYYILRILFTWNALQFQK--PRDEKCTETIYIGGMEYDS  1769

Query  4417  VLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPS  4596
             V   WDK++SLYK+TRHAK RE L+CCM +C+KR A LFT+S+ S    + +  N     
Sbjct  1770  VFLLWDKLISLYKLTRHAKARETLICCMGICVKRFAGLFTTSVLSDVRMRRLTDNSESDQ  1829

Query  4597  --KLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVP  4770
               KL+     I +F  VI++HS +SEP+NMRKAAA+SI+A GLL+QA+ +  ++SN+Q+P
Sbjct  1830  LEKLTQLYSTISFFTSVIKKHSASSEPVNMRKAAAESIIACGLLEQAELIGSTLSNNQIP  1889

Query  4771  DGN-----KQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHF  4935
               N     + K+A+++YA +ILD+WF C++LLEDEDDG+R++L++ +Q C T  +SGS  
Sbjct  1890  SENPCSYFEPKEAVNIYARQILDIWFACIQLLEDEDDGIRERLAMGIQGCFTYKRSGSS-  1948

Query  4936  SSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDK  5115
              SGVVP QVEKVI   FEHLSS FGHW+ YLD L  W+ +A+N    V+  D VR+VFDK
Sbjct  1949  HSGVVPTQVEKVIGSCFEHLSSIFGHWIGYLDCLLRWMLNASNY--EVAKGDLVRQVFDK  2006

Query  5116  EIDNHHEEKLLISQICCSHLEKLPVSKL-------TTEFRDNNICSVLQSWRRRFCQQLI  5274
             EIDNHHEEKL I QICCS +EKLP+SK          +FRD      L  WR RF  QL+
Sbjct  2007  EIDNHHEEKLFICQICCSQMEKLPISKSWAVDFLNKQQFRD-----YLHDWRLRFSSQLM  2061

Query  5275  SFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLE  5454
             SF    IG  GG DW+GG GNHKDAFLPVYVNLLAFHA+S+CI  G+ +D   ++ ++ E
Sbjct  2062  SFAKDRIGQLGGADWVGGAGNHKDAFLPVYVNLLAFHAVSSCIFSGKIDDDTHLLSDVAE  2121

Query  5455  LGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLF  5622
             L  AI PFLRNPLISNL++LVVKSHE   G   + ++ ++ G  + WD F+P+FL 
Sbjct  2122  LSRAINPFLRNPLISNLYLLVVKSHEDAIGSTSDGMIPKL-GEDAIWDGFNPHFLL  2176



>ref|XP_011014311.1| PREDICTED: thyroid adenoma-associated protein homolog [Populus 
euphratica]
Length=2222

 Score =  2227 bits (5772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1173/1917 (61%), Positives = 1424/1917 (74%), Gaps = 66/1917 (3%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             G+LTAVSR VLN  FVVS+ G +     GN   SVKTILYDGIL ELCN+CE+P DSHFN
Sbjct  330   GVLTAVSRAVLNSQFVVSSGGLNVNEENGNCCGSVKTILYDGILPELCNYCENPIDSHFN  389

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV+QICLQQ+KTSM      I   Y+PI  E+GTR+LKI+WN+LEDPLSQTVKQVH
Sbjct  390   FHALTVLQICLQQMKTSMLSNLTVISNTYEPIPVEMGTRILKIIWNSLEDPLSQTVKQVH  449

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDIQ +LHW EGSE+  SFL+KIASD+L LGP CKGRY+PLA LTKRLGAK+IL
Sbjct  450   LIFDLFLDIQSSLHWGEGSERIKSFLQKIASDILRLGPGCKGRYVPLALLTKRLGAKTIL  509

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSP LL +T +AY+DDDVC AATTFLKCFLECLRDE W+ +G+E GY  YR +CL P L
Sbjct  510   DMSPDLLLETVQAYIDDDVCCAATTFLKCFLECLRDECWNCNGIEEGYAVYRGYCLPPFL  569

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSN++TYALPVLLE+D+DSIFPML +I +G +    E+ +PEL   ++ L
Sbjct  570   FGLASGVSKLRSNVSTYALPVLLEVDIDSIFPMLAYISVGLTGAENELSHPELSCTNVEL  629

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
             GVEQ+VAVLVSL+KV R LALIEGDID  + S        L TD+    ++  +KGI+VK
Sbjct  630   GVEQQVAVLVSLVKVCRSLALIEGDIDLWDASQPLQTNGMLGTDSVNIYALFSIKGIKVK  689

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             + V +L+LAL H+D+ LR+DAAESLF+NPKT+S+PS LEL+L+++AV +NMR CST FQM
Sbjct  690   VHVEWLVLALRHVDELLRVDAAESLFLNPKTSSIPSYLELTLLKEAVLMNMRSCSTGFQM  749

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFF+RVRTALER +KQG+W P L    +G+  N   ++S+  RAENLFNFM+W
Sbjct  750   KWTSLFRKFFARVRTALERQLKQGSWQPFLDCNNNGAYSNKGIEESIIKRAENLFNFMRW  809

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHM-LPPQGKSDSYSSEISLYPYSKGLIL  1617
             LSCFLFFSCYPSAPY+RKIMAM+L+LIMLNVW + L  Q K  S   E SLYPYSKG+ L
Sbjct  810   LSCFLFFSCYPSAPYKRKIMAMDLLLIMLNVWSITLTSQHKDGSLCPESSLYPYSKGITL  869

Query  1618  PESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRE  1797
             P+STLLLVGSIIDSWDRLRESSFRILL+FP P+PGISS ++V + I WAKKLVCSPRVRE
Sbjct  870   PDSTLLLVGSIIDSWDRLRESSFRILLYFPNPLPGISSKDMVQKVINWAKKLVCSPRVRE  929

Query  1798  SDAGALTFRLIFRKYVLELGWVVRVSCNVVT-QSPSGLSNGENLEFTPSSPVIEYITSLI  1974
             SDAGAL  +L+FRKYVLELGW++R S +VV  QS S + N +N       PV+EYI SLI
Sbjct  930   SDAGALMLKLLFRKYVLELGWILRTSVDVVCFQSQSEVVNVDNQIIESKPPVVEYIKSLI  989

Query  1975  DWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekila  2154
             DWL A+VEEGE++LSEACK SFVHGVLLTLRYTFEE+DW+S AV S+IS ++  LEK+L 
Sbjct  990   DWLNASVEEGERNLSEACKNSFVHGVLLTLRYTFEELDWNSDAVLSSISEMRQALEKLLE  1049

Query  2155  lVMRITSLALWVVSADAWYLPDE----------MEEMTVDGACFLERPIEMDVSASTPDD  2304
             L++RITSLALWVVSADAWYL D           M+EM V       RP         P++
Sbjct  1050  LLVRITSLALWVVSADAWYLADMDEMADDDVYLMDEMEV------VRP---------PEE  1094

Query  2305  EMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQ--ITDGT  2478
             E   +K  QD  P +QIVMVGCWLAMKEVSLLLGTIIRK+PLP      S S+    D +
Sbjct  1095  EGISSKHVQDSRPSEQIVMVGCWLAMKEVSLLLGTIIRKIPLPGYSYSGSKSEEPCPDAS  1154

Query  2479  DQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLT  2658
                  + +LDL+QLE IGNHFLEVLLKMKHNGAIDKTR GFTALCNRLLCSNDP LCKLT
Sbjct  1155  MLTIPNAMLDLQQLEQIGNHFLEVLLKMKHNGAIDKTRVGFTALCNRLLCSNDPGLCKLT  1214

Query  2659  ESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAK  2838
             E WMEQLMERTV+KGQ VDDLLRRSAGIPAAF A FLSEP+GAPK+LLP+ALRWLI+VA 
Sbjct  1215  EIWMEQLMERTVAKGQVVDDLLRRSAGIPAAFIALFLSEPDGAPKKLLPRALRWLIDVAN  1274

Query  2839  KSL--------TDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVL  2994
              SL         + +    S + S  A DS  +  V  +E  SK RDEGV+PTVHAFNVL
Sbjct  1275  SSLLYLVDAKSMNGDTCKLSSTNSDQAPDSAKLYGVNVMEKTSKIRDEGVIPTVHAFNVL  1334

Query  2995  KAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRE  3174
             +AAFND NLATDTSGF+AEALIVSI SFSS YWEVRNSACLAYTALVRRMIGFLN+ KRE
Sbjct  1335  RAAFNDTNLATDTSGFAAEALIVSIHSFSSPYWEVRNSACLAYTALVRRMIGFLNLHKRE  1394

Query  3175  SARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILL  3354
             SARR+LTGLEFFHRYP LH FL+NEL +AT+   + +S    SNL KVVHPSLCP+LILL
Sbjct  1395  SARRSLTGLEFFHRYPALHPFLYNELNVATDALGDATSGCTESNLPKVVHPSLCPVLILL  1454

Query  3355  SRLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNI  3534
             SRLKPS I SE+GD  DPFLFMPFIR+CS Q+NLRIRILASRALTG+VSNEKLPTV+LNI
Sbjct  1455  SRLKPSTIASESGDDLDPFLFMPFIRRCSTQSNLRIRILASRALTGLVSNEKLPTVLLNI  1514

Query  3535  ASELPAIDNH----SMTSDLSGLSNLNAS-FNSIHGMLLQLSSLLDTNCRNLADFSKKED  3699
              SELP +++     S  S L   SN   S +NSIHGMLLQL SLLD NCRNLADF+KKE 
Sbjct  1515  GSELPCMEHQIAAFSFPSSLLKPSNGTVSNYNSIHGMLLQLCSLLDANCRNLADFTKKEK  1574

Query  3700  ILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTL  3879
             IL DL  VL K SWI SP++CPCPILN SF+++LD+MLS+ART  +S+    I +LLW L
Sbjct  1575  ILGDLFQVLVKRSWIASPKRCPCPILNGSFIRLLDHMLSVARTGHISENYLPIRSLLWKL  1634

Query  3880  SSECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPP----D  4047
              +ECLD+  S   +Y+DPT+AELR+QA  SYFNC  Q SKD  EE    L+ P      D
Sbjct  1635  CTECLDVEDSFGVSYYDPTVAELREQATISYFNCV-QASKDGMEE---VLQKPQAHLSHD  1690

Query  4048  SELFKESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSE  4227
              +L    ET+ +    ++RLI SLSD  YEVR+ATLKWLL FL S ES  ++  + S S 
Sbjct  1691  LKLLNLPETKETFVSLEKRLISSLSDPSYEVRLATLKWLLKFLKSTES-ISDVHHLSSSA  1749

Query  4228  IKLL--WLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPT-FVG  4398
             I ++  W S + LQ ++++LL  EK H+C  YILKI++T+N+ Q+ K   Q+   T +VG
Sbjct  1750  IGIIQHW-SKLNLQEIMVKLLDSEKYHRCKYYILKILFTWNLLQFQKPGNQNSADTKYVG  1808

Query  4399  NMDSDSVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVV  4578
             N+D+DS  QFWDK++SLY +TRH K RE L+CCMA+C+K+ + L TSS+ S   EK    
Sbjct  1809  NLDNDSTFQFWDKLLSLYNITRHKKIRETLICCMALCVKKFSSLLTSSVLSYMEEKTSKS  1868

Query  4579  NPS-DPSKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVS  4755
               S    + ++  + I +FV +I+EHS +SEP+  R AAA+SI+ASGLL+QA+ +S  V 
Sbjct  1869  CESCQLERSALLYKHITHFVNLIKEHSSSSEPVTKRNAAAESIIASGLLEQAELISSCVF  1928

Query  4756  NHQVPDG-----NKQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGK  4920
             ++++P G      + K+A+++Y  ++L++WFTC+KLLEDEDD +R+ L+L VQKC +S  
Sbjct  1929  SNEIPAGLSGSCFEPKEAVNMYGRQLLEIWFTCIKLLEDEDDAIRQWLALNVQKCFSSKA  1988

Query  4921  SGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVR  5100
             SGS F +  VP+QVEKVIE+SF +LS  FGHW+DY D L  WV +  N        D +R
Sbjct  1989  SGSSFHAVGVPMQVEKVIELSFGYLSYNFGHWIDYFDHLSQWVINGANYVTCK--GDIIR  2046

Query  5101  RVFDKEIDNHHEEKLLISQICCSHLEKLPVSK--LTTEFRDNNICSVLQSWRRRFCQQLI  5274
             RVFDKEIDNHHEEKLLI QICCSHLE+LP+SK  L          + L  WRRRFC QL 
Sbjct  2047  RVFDKEIDNHHEEKLLICQICCSHLEQLPISKSWLADGPFKQKFTNYLYYWRRRFCNQLT  2106

Query  5275  SFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLE  5454
             SF   +I   GGVDWIGG GNHKDAFLP+Y NLL F+ALSNC++ G   D   +  E++E
Sbjct  2107  SFAKDHIENLGGVDWIGGAGNHKDAFLPIYANLLGFYALSNCMVNGNIVDDMLLPSEIVE  2166

Query  5455  LGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             +G+AI PFLRNPLISNL+++VV  HE+  G   + L  +     S W  FDPYFL R
Sbjct  2167  IGKAIDPFLRNPLISNLYLIVVNLHERKVGATADMLTSKFIIDDSIW-RFDPYFLLR  2222



>ref|XP_009341002.1| PREDICTED: uncharacterized protein LOC103933073 [Pyrus x bretschneideri]
 ref|XP_009341004.1| PREDICTED: uncharacterized protein LOC103933073 [Pyrus x bretschneideri]
Length=2217

 Score =  2217 bits (5746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1159/1912 (61%), Positives = 1428/1912 (75%), Gaps = 59/1912 (3%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSR VLN  F VS    +G  +  +  + VKTILYDGIL ELCN+CE+PTDSHFN
Sbjct  326   GILTAVSRAVLNTHFDVSKGSSNGYESHTSGGNCVKTILYDGILPELCNYCENPTDSHFN  385

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV+Q+CLQQIKTSM  +     + YDPI  E+GTR+L+I+WNNLEDPLSQTVKQVH
Sbjct  386   FHALTVLQMCLQQIKTSMLASLTITSKDYDPIPVEMGTRILRIIWNNLEDPLSQTVKQVH  445

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDI+ TL W+EGSE+  SFL+ IASDLL LGPRCKGRY+PL SLTKRLGAK++L
Sbjct  446   LIFDLFLDIRSTLRWSEGSERIRSFLQSIASDLLRLGPRCKGRYVPLGSLTKRLGAKTML  505

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSPGLLF T  AY+DDDVC A T+FLK  LE LR+E W +DG+EGGY+ YR HCL P L
Sbjct  506   DMSPGLLFQTAHAYIDDDVCCALTSFLKILLEDLRNECWRSDGIEGGYVLYRGHCLPPFL  565

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
             SGL+SG +KLRSNLNTYALP+LLE+D DSIF ML FI +G S   +++  PEL   +I L
Sbjct  566   SGLASGVSKLRSNLNTYALPILLEVDEDSIFAMLAFISVGLSKGESQLLCPELYHGNIEL  625

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              VEQ+VA+LVSLLKVSR+LAL+EGDID+  + +      +L T+     ++V +KGI+V+
Sbjct  626   RVEQKVAILVSLLKVSRLLALLEGDIDYAAHENFG----ELETNFPDRHALVSIKGIKVE  681

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             + V +L+LALTH+DDSLR+DAAE+LF+NPKTASLPS LEL L+R+AVPLNMRCCSTAFQM
Sbjct  682   VCVEWLVLALTHVDDSLRVDAAETLFLNPKTASLPSHLELMLLREAVPLNMRCCSTAFQM  741

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSG-SPLNGEADQSLKHRAENLFNFMK  1437
             KW+SLFRKFF+RVRTALER  KQG W P      +G  P NG ++ +  +RA +LF FM+
Sbjct  742   KWSSLFRKFFARVRTALERQFKQGRWQPLEHSNSNGMHPSNG-SEHTEANRASDLFYFMR  800

Query  1438  WLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPP-QGKSDSYSSEISLYPYSKGLI  1614
             WLS FLFFSCYPSAPY+RKIMAMEL+LIMLNVW ++P  Q K+ S   E  LYPY+KG+ 
Sbjct  801   WLSSFLFFSCYPSAPYKRKIMAMELILIMLNVWSIVPATQEKNGSLCVEDRLYPYNKGMT  860

Query  1615  LPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVR  1794
              P+STLLLVGSIIDSWD+LRE+SFRILLHFPTP+PGIS   +V   I+WAKKLVCSPRVR
Sbjct  861   SPDSTLLLVGSIIDSWDKLRENSFRILLHFPTPLPGISDEGMVKNVILWAKKLVCSPRVR  920

Query  1795  ESDAGALTFRLIFRKYVLELGWVVRVSCNVVT-QSPSGLSNGENLEFTPSSPVIEYITSL  1971
             E+DAGALT RLIFRKYVL+LGW V+ S NV   ++ S + +G+N  +    PV+EY+ SL
Sbjct  921   ETDAGALTLRLIFRKYVLQLGWTVQASVNVACLRTESAMEDGDNQTYNTGYPVMEYVRSL  980

Query  1972  IDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekil  2151
             IDWL  ++EEGEKDLSEAC+ SFVHGVLLTLRY FEE+D++S    S+IS ++  LEK+L
Sbjct  981   IDWLDVSIEEGEKDLSEACRNSFVHGVLLTLRYAFEELDFNSDIAQSSISEMRHSLEKLL  1040

Query  2152  alVMRITSLALWVVSADAWYLPDEMEEMTVDGACFL-ERPIEMDVSASTPDDEMKIAKAE  2328
              LVMRITSLALWVVSADAW+LP++M+E+  D   FL E P E++V  S  +DE K  K  
Sbjct  1041  ELVMRITSLALWVVSADAWHLPEDMDEVVDDDDSFLSEVPDEVEVKTSQLEDEDKNYKLV  1100

Query  2329  QDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTS------DVPKSCSQITDGTDQLS  2490
             Q +   +Q VMVGCWLAMKEVSLL GTI RK+PLP+S      D   + S  +D +  ++
Sbjct  1101  QSNRRSEQSVMVGCWLAMKEVSLLFGTITRKIPLPSSPSSELLDSEATSSCASDASVLMA  1160

Query  2491  SDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWM  2670
             SD +LDL+QLE IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTE+WM
Sbjct  1161  SDAMLDLKQLERIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTETWM  1220

Query  2671  EQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLT  2850
             EQLM+RTV+KGQTVDDLLRRSAGIPAAF A FLSEPEGAPK+LLP+ALRWLI+VA  S+ 
Sbjct  1221  EQLMDRTVAKGQTVDDLLRRSAGIPAAFIALFLSEPEGAPKKLLPRALRWLIDVANASIV  1280

Query  2851  Dknkenssc-------sesssAIDSTMVP-DVAAIEMISKTRDEGVVPTVHAFNVLKAAF  3006
                + NSS        S  S  +  ++VP D+     +SK RDEGV+PTVHAFNVL+AAF
Sbjct  1281  GLVETNSSNGDMGKLPSIKSGKVFESLVPSDIDIGNKVSKIRDEGVIPTVHAFNVLRAAF  1340

Query  3007  NDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARR  3186
             ND NLA DTSGFSAEA+IVSIRSFSS +WEVRNSAC AYTALVRRMIGFLNVQKRES+RR
Sbjct  1341  NDTNLAADTSGFSAEAMIVSIRSFSSPHWEVRNSACQAYTALVRRMIGFLNVQKRESSRR  1400

Query  3187  ALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLK  3366
             ALTG+EFFHRYP LH FLF ELK+AT L  +G S    SNL   VHPSLCP+LILLSRLK
Sbjct  1401  ALTGVEFFHRYPLLHPFLFKELKVATVLLADGISGQSESNLENAVHPSLCPVLILLSRLK  1460

Query  3367  PSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASEL  3546
             PS I SETGD  DPFL MPFIRKCS Q+NLR+R+LASRALTG+VSNEKLP+V+LNI SEL
Sbjct  1461  PSTIASETGDDVDPFLLMPFIRKCSTQSNLRVRVLASRALTGLVSNEKLPSVLLNIVSEL  1520

Query  3547  PAIDNHSMTSDLSGL------SNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILS  3708
             P ID+ +  +  S L         ++S+N IHG+LLQL+SLLDTNCRNLAD SKK+ IL 
Sbjct  1521  PRIDDQAALTPESSLLLHKTERRHHSSYNWIHGILLQLTSLLDTNCRNLADSSKKDQILG  1580

Query  3709  DLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSE  3888
             DL   L  HSWIG P+ CPCPILN SFLK+LD+MLSIARTC  SK I  + NL+  LS+E
Sbjct  1581  DLFQALLAHSWIGKPRLCPCPILNASFLKLLDHMLSIARTCHTSKKIYALRNLILELSTE  1640

Query  3889  CLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKE-  4065
             CL +  S R +Y+DPT+AELR+QAA SYF+C +Q S+ + E+     +    ++  + E 
Sbjct  1641  CLAVKVSNRHSYYDPTMAELRQQAAVSYFSCVFQASEKMAEDVFQTPQRYSQNNSRYAEI  1700

Query  4066  SETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLL--  4239
              E + S    QERL+ SLSD+ YEVR+ATLKWLL F+ S ES     S+   SEI+++  
Sbjct  1701  PEMENSFAGLQERLVCSLSDSDYEVRLATLKWLLKFITSTES--GNESHDISSEIRVIQH  1758

Query  4240  WLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNK-NCGQHEKPTFVGNMDSDS  4416
             W+    LQ  L+ +L VEK H+C  YIL+I++T+N  Q+ K    +  +  +VG+M+ DS
Sbjct  1759  WV-RTNLQTTLVNILDVEKYHRCSYYILRILFTWNTLQFQKLGDAKCTETIYVGSMECDS  1817

Query  4417  VLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDP-  4593
             V   WDK++SLYKVTR AK ++ L+CC  +C+KR A LFT+SI         +++ SD  
Sbjct  1818  VFLLWDKLISLYKVTRQAKAQQTLICCFGICVKRFAGLFTTSI---------LIDNSDSD  1868

Query  4594  --SKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQV  4767
                +L+     I +F  VI +HS +SEPINMR AAA+SI+ASGLL+QA  +  +V N ++
Sbjct  1869  LFDQLTRLYSIISFFTNVIMKHSASSEPINMRMAAAESIIASGLLEQAALIGSTVFNSRI  1928

Query  4768  PDGN-----KQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSH  4932
             P  N     + K+A++ Y H+ILD+WFTC++LLEDEDD +R++L++ +Q   TS +SGS 
Sbjct  1929  PSENSCSTFEPKEAVNFYGHQILDIWFTCIQLLEDEDDEIRERLAIGIQGSFTSKRSGSS  1988

Query  4933  FSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFD  5112
               SGVVP QVEKVI   FEHLSS FGHW+ Y D+L  WV  A+N    V   D VR+VFD
Sbjct  1989  -RSGVVPTQVEKVIGSCFEHLSSIFGHWIGYFDYLLRWVLIASNR--EVPKGDLVRQVFD  2045

Query  5113  KEIDNHHEEKLLISQICCSHLEKLPVSK-LTTEF-RDNNICSVLQSWRRRFCQQLISFGN  5286
             KEIDNHHEEKL + Q+CCS LEKLP+SK    +F         L+ WR RF  QL +F  
Sbjct  2046  KEIDNHHEEKLFVCQLCCSQLEKLPISKSWAADFLNKQQFSDYLRDWRLRFSCQLTAFAK  2105

Query  5287  AYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEA  5466
               I   GG DW+GG GNHKDAFLP+Y NLLAFH LS C+L G+  D+K ++ ++ ELG+A
Sbjct  2106  DRIAKLGGADWVGGAGNHKDAFLPLYANLLAFHTLSKCVLNGKTGDNKHLLSDVAELGKA  2165

Query  5467  IQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLF  5622
             I  FLRNPLISNL++LVVKSHE   G   ++++ ++ G  + WD F+PYFL 
Sbjct  2166  INLFLRNPLISNLYLLVVKSHEDAVGSNGDNVIPKL-GEDAIWDGFNPYFLL  2216



>ref|XP_008353419.1| PREDICTED: uncharacterized protein LOC103416988 [Malus domestica]
Length=2217

 Score =  2215 bits (5740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1160/1911 (61%), Positives = 1428/1911 (75%), Gaps = 57/1911 (3%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSR VLN  F VS    +G  +  +  + VKTILYDGIL ELCN+CE+PTDSHFN
Sbjct  326   GILTAVSRAVLNTHFDVSKGSSNGYESHTSGGNCVKTILYDGILPELCNYCENPTDSHFN  385

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV+Q+CLQQIKTSM  +     + YDPI  E+GTR+L+I+WNNLEDPLSQTVKQV 
Sbjct  386   FHALTVLQMCLQQIKTSMLASLTITSKDYDPIPVEMGTRILRIIWNNLEDPLSQTVKQVQ  445

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDI+ TL W+EGSE+  SFL+ IASDLL LGPRCKGRY+PL SLTKRLGAK++L
Sbjct  446   LIFDLFLDIRSTLRWSEGSERIRSFLQSIASDLLRLGPRCKGRYVPLGSLTKRLGAKTML  505

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSPGLLF T  AY+DDDVC A T+FLK  LE LR+E W +DG+EGGY  YR HC  PIL
Sbjct  506   DMSPGLLFQTAHAYIDDDVCCALTSFLKILLEDLRNECWRSDGIEGGYALYRGHCQPPIL  565

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
             SGL+SG +KLRSNLNTYALP+LLE+D D IF ML FI +G S   +++  PEL   ++  
Sbjct  566   SGLASGVSKLRSNLNTYALPILLEVDEDGIFAMLAFISVGPSKGESQLLCPELYRGNMEX  625

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              VEQ+VA+LVSLLKVSR+LAL+EGDID+    +       L T+     ++V +KGI+V+
Sbjct  626   RVEQKVAILVSLLKVSRLLALLEGDIDYAXXENFG----GLETNFPXRHALVSIKGIKVE  681

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             + V +L+LALTH+DDSLR+DAAE+LF+NPKTASLPS LEL L+++AVPLNMRCCSTAFQM
Sbjct  682   VXVEWLVLALTHVDDSLRVDAAETLFLNPKTASLPSHLELMLLKEAVPLNMRCCSTAFQM  741

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             K +SLFRKFF+RVRTALER  KQG W P      +G  L+  ++ +  +RA +LF FM+W
Sbjct  742   KXSSLFRKFFARVRTALERQFKQGRWEPLEHSNSNGMHLSXGSEHTEANRASDLFCFMRW  801

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPP-QGKSDSYSSEISLYPYSKGLIL  1617
             LS FLFFSCYPSAPY+RKIMAMEL+LIMLNVW ++P  Q K+ S   E  LYPY+KG+  
Sbjct  802   LSSFLFFSCYPSAPYKRKIMAMELILIMLNVWSIVPASQEKNGSLCVEDRLYPYNKGMTS  861

Query  1618  PESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRE  1797
             P+STLLLVGSIIDSWD+LRE+SFRILLHFPTP+PGIS   +V   I+WAKKLVCSPRVRE
Sbjct  862   PDSTLLLVGSIIDSWDKLRENSFRILLHFPTPLPGISDEGMVQNVILWAKKLVCSPRVRE  921

Query  1798  SDAGALTFRLIFRKYVLELGWVVRVSCNVVT-QSPSGLSNGENLEFTPSSPVIEYITSLI  1974
             +DAGALT RLIFRKYVL LGW V+ S NV   ++ S + NG++  +    PV+EY+ SLI
Sbjct  922   TDAGALTLRLIFRKYVLHLGWTVQASVNVTCLRTESAMENGDDQNYNTGYPVMEYVRSLI  981

Query  1975  DWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekila  2154
             DWL  ++EEGEKDLSEAC+ SFVHGVLLTLRY FEE+D++S    S+IS ++  LEK+L 
Sbjct  982   DWLDVSIEEGEKDLSEACRNSFVHGVLLTLRYAFEELDFNSDIAQSSISGMRHSLEKLLE  1041

Query  2155  lVMRITSLALWVVSADAWYLPDEMEEMTVDGACFL-ERPIEMDVSASTPDDEMKIAKAEQ  2331
             LVMRITSLALWVVSADAW+LP++M+E+  D   FL E P E++V  S  +DE K  K  Q
Sbjct  1042  LVMRITSLALWVVSADAWHLPEDMDEVVDDDDSFLSEVPDEVEVKTSQLEDEDKNYKLVQ  1101

Query  2332  DDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTS------DVPKSCSQITDGTDQLSS  2493
              +   +Q VMVGCWLAMKEVSLLLGTI RK+PLP+S      D   + S  +D +  ++S
Sbjct  1102  SNRRSEQSVMVGCWLAMKEVSLLLGTITRKIPLPSSPSSELLDSEATSSCASDASVLMAS  1161

Query  2494  DIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWME  2673
             D +LDL+QLE IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDP LCKLTESWME
Sbjct  1162  DAMLDLKQLERIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPGLCKLTESWME  1221

Query  2674  QLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTD  2853
             QLM+RTV+KGQTVDDLLRRSAGIPAAF A FLSEPEGAPK+LLP+ALRWLI+VA  S+  
Sbjct  1222  QLMDRTVAKGQTVDDLLRRSAGIPAAFIALFLSEPEGAPKKLLPRALRWLIDVANASIVG  1281

Query  2854  knkenssc-------sesssAIDSTMVP-DVAAIEMISKTRDEGVVPTVHAFNVLKAAFN  3009
               + NSS        S  S  +  T+VP D+     +SK RDEGV+PTVHAFNVL+AAFN
Sbjct  1282  LVETNSSNGDMGKFPSIKSGKVFETVVPSDMDISNKVSKIRDEGVIPTVHAFNVLRAAFN  1341

Query  3010  DANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRA  3189
             D NLA DTSGFSAEA+IVSIRSFSSS+WEVRNSAC AYTALVRRMIGFLNVQKRES+RRA
Sbjct  1342  DTNLAADTSGFSAEAMIVSIRSFSSSHWEVRNSACQAYTALVRRMIGFLNVQKRESSRRA  1401

Query  3190  LTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKP  3369
             LTG+EFFHRYP LH FLF ELK+AT L  +G S    SNL   VHPSLCP+LILLSRLKP
Sbjct  1402  LTGVEFFHRYPLLHPFLFKELKVATVLLEDGISGQSESNLENAVHPSLCPVLILLSRLKP  1461

Query  3370  SPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELP  3549
             S I SETGD  DPFL MPFIRKCS Q+NLR+R+LASRALTG+VSNEKLP+V+LNI SELP
Sbjct  1462  STIASETGDDMDPFLLMPFIRKCSTQSNLRVRVLASRALTGLVSNEKLPSVLLNIVSELP  1521

Query  3550  AIDNH-SMTSDLSGLSNL-----NASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSD  3711
              +D+  ++T ++S L +       +S+N IHG+LLQLSSLLDTNCRNLAD SKK+ IL D
Sbjct  1522  RVDDQAALTPEVSLLLHKTEIRHQSSYNWIHGILLQLSSLLDTNCRNLADSSKKDQILGD  1581

Query  3712  LIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSEC  3891
             L   L  HSWIG P+ CPCPILN SFLK+LD+MLSIARTC  SK I  + NL+  LS+EC
Sbjct  1582  LFQALLAHSWIGKPRLCPCPILNASFLKLLDHMLSIARTCHTSKKIYALRNLILELSTEC  1641

Query  3892  LDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKE-S  4068
             LD+  S R +Y+DPT+AELR+QAA SYF+C +Q S+ + E+     +    ++  + E  
Sbjct  1642  LDVKVSNRRSYYDPTMAELRQQAAVSYFSCVFQASEKMAEDVFQTPQRYSQNNSRYAEIP  1701

Query  4069  ETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLL--W  4242
             E + S    QERL+RSLSD+ YEVR+ATLKWLL F+ S ES     S+   SEI+++  W
Sbjct  1702  EMENSFAGLQERLVRSLSDSDYEVRLATLKWLLKFITSTES--GNESHDISSEIRVIQHW  1759

Query  4243  LSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNK-NCGQHEKPTFVGNMDSDSV  4419
             +    LQ  L+ +L VEK H+C  YIL+I++T+N  Q+ K    +  +  +VG+M+ DSV
Sbjct  1760  V-RTNLQTTLVNILDVEKYHRCSYYILRILFTWNTLQFQKLGDAKCTETIYVGSMECDSV  1818

Query  4420  LQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDP--  4593
                WDK++SLYKVTRHAK ++ L+CC  +CIKR A LFT+SI         +++ SD   
Sbjct  1819  FLLWDKLISLYKVTRHAKAQQTLICCFGICIKRFAGLFTTSI---------LIDNSDSDW  1869

Query  4594  -SKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVP  4770
               +L+     I +F  VI E S +SEPIN R AAA+SI+ASGLL+QA  +  +V N ++P
Sbjct  1870  LEQLTRLYSIISFFTNVIMERSASSEPINTRMAAAESIIASGLLEQAALIGSTVFNSRIP  1929

Query  4771  DGN-----KQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHF  4935
               N     + K+A++ Y H+ILD+WFTC++LLEDEDD +R++L++ +Q   TS +SGS  
Sbjct  1930  SENSCSTFEPKEAVNFYGHQILDIWFTCIQLLEDEDDEIRERLAIGIQGSFTSKRSGSS-  1988

Query  4936  SSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDK  5115
              SGVVP QVEKVI   FEHLSS FGHW+ Y D+L  WV +A+N    V   D VR+VFDK
Sbjct  1989  RSGVVPTQVEKVIGSCFEHLSSIFGHWIGYFDYLLRWVLNASNR--EVPKGDLVRQVFDK  2046

Query  5116  EIDNHHEEKLLISQICCSHLEKLPVSK-LTTEF-RDNNICSVLQSWRRRFCQQLISFGNA  5289
             EIDNHHEEKL I Q+CCS LEKLP+SK    +F         L+ WR RF  QL +F   
Sbjct  2047  EIDNHHEEKLFICQLCCSQLEKLPISKSWAADFLNKQQFSDYLRDWRLRFSCQLTAFAKD  2106

Query  5290  YIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEAI  5469
              I   GGV W+GG GNHKDAFLP+Y NLLAF+ALSNCI  G+  D+K ++ ++ +LG+AI
Sbjct  2107  RIAKLGGVHWVGGAGNHKDAFLPLYANLLAFYALSNCIFNGKTGDNKHLLSDVAQLGKAI  2166

Query  5470  QPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLF  5622
              PFLRNPLISNL++LVVKSHE  AG   ++++ ++ G  + WD F+P+FL 
Sbjct  2167  NPFLRNPLISNLYLLVVKSHEDAAGSNGDNVIPKL-GEDAIWDEFNPHFLL  2216



>ref|XP_008348069.1| PREDICTED: uncharacterized protein LOC103411194 isoform X1 [Malus 
domestica]
Length=2217

 Score =  2212 bits (5732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1155/1914 (60%), Positives = 1404/1914 (73%), Gaps = 66/1914 (3%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSR VLN  F VS    +G  +  N  + VKTILYDGIL ELCN+CE+PTDSHFN
Sbjct  331   GILTAVSRAVLNTHFDVSKGSSNGYESHTNGGNCVKTILYDGILPELCNYCENPTDSHFN  390

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV+QICLQQIKTSM        E YDPI  E+GTR+L+IVWNNLEDPLSQTVKQVH
Sbjct  391   FHALTVLQICLQQIKTSMLANLTITSEDYDPIPVEMGTRILRIVWNNLEDPLSQTVKQVH  450

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDI+ TLHW+EGSE+  SFL+ IASDLL LGPRCKGRY PL SLT RLGAK++L
Sbjct  451   LIFDLFLDIRSTLHWSEGSERIRSFLQSIASDLLRLGPRCKGRYXPLGSLTXRLGAKTML  510

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSPGLLFDT  AY+DDDVC A T+FLK  LE LR+E WS+DGVEGGY  YR HCL PIL
Sbjct  511   DMSPGLLFDTIHAYIDDDVCCALTSFLKILLEDLRNECWSSDGVEGGYALYRGHCLPPIL  570

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYALP+LLE+D DSIF ML FI +G S   +++ YPEL   ++  
Sbjct  571   XGLASGVSKLRSNLNTYALPILLEVDEDSIFAMLAFISVGPSKGESQLSYPELCRGNMEP  630

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              V+Q+VA+LVSLLKVSR+LAL+EGDID+    +V      L T+     ++V +KGI+V+
Sbjct  631   RVQQKVAILVSLLKVSRLLALLEGDIDY----AVRENFGGLETNFPERHALVSIKGIKVE  686

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             + V +L+LALTH+DDSLR+DAAE+LF+NPKTASLPS LEL L+++AVPLNMRCCSTAFQM
Sbjct  687   VRVEWLVLALTHVDDSLRVDAAETLFLNPKTASLPSHLELMLLKEAVPLNMRCCSTAFQM  746

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW+SLFRKFF+RVRTALER  KQG W P      +G  L+  ++ +  +RA +LF FM+W
Sbjct  747   KWSSLFRKFFARVRTALERQFKQGRWEPLEHSNSNGMHLSIGSEHTEANRASDLFCFMRW  806

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPP-QGKSDSYSSEISLYPYSKGLIL  1617
             LS FLFFSCYPSAPY+RKIMAMEL+LIMLNVW ++P  Q K+ S   E  LYPY++G+ L
Sbjct  807   LSSFLFFSCYPSAPYKRKIMAMELILIMLNVWSIVPATQEKNGSLCVEDXLYPYNRGMTL  866

Query  1618  PESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRE  1797
             P+STLLLVGSIIDSWDRLRE+SFRILLHFPTP+PGIS   +V   I+WAKKLVCSPRVRE
Sbjct  867   PDSTLLLVGSIIDSWDRLRENSFRILLHFPTPLPGISDQGMVQXVILWAKKLVCSPRVRE  926

Query  1798  SDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLID  1977
             +DAGALT RLIFRKYVL+LGW VR S NV     SGL +G+N  +    PV+EYI SLI+
Sbjct  927   TDAGALTLRLIFRKYVLQLGWTVRASVNVACL--SGLESGDNQTYNXGYPVMEYIRSLIE  984

Query  1978  WLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilal  2157
             WL  ++EEGEKDLSEAC+ SFVHGVLLTLRY FEE+D++S    S+IS ++  LEK+L L
Sbjct  985   WLDVSIEEGEKDLSEACQNSFVHGVLLTLRYAFEELDFNSDIAQSSISEMRHSLEKLLEL  1044

Query  2158  VMRITSLALWVVSADAWYLP-DEMEEMTVDGACFL-ERPIEMDVSASTPDDEMKIAKAEQ  2331
             VMRITSLALWVVSADAW+LP D  E +  D   FL E P  ++   S  +DE K  K  Q
Sbjct  1045  VMRITSLALWVVSADAWHLPEDMDEVVVDDDDSFLSEVPDXVEXKTSLLEDEDKNYKFVQ  1104

Query  2332  DDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPT--------SDVPKSCSQITDGTDQL  2487
             ++   +Q VMVGCWLAMKEVSLLLGTI RK+PLP+        S+   SC+ +      +
Sbjct  1105  NNRRSEQSVMVGCWLAMKEVSLLLGTITRKIPLPSTPSSESLDSETTSSCASV-----MM  1159

Query  2488  SSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESW  2667
             +SD +LD++QLE IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESW
Sbjct  1160  ASDAMLDVKQLERIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESW  1219

Query  2668  MEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSL  2847
             MEQLM+RTV+KGQTVDDLLRRSAGIPAAF A FLSEPEGAPK+LLP+ALRWLI+VA  S 
Sbjct  1220  MEQLMDRTVAKGQTVDDLLRRSAGIPAAFIALFLSEPEGAPKKLLPRALRWLIDVANASF  1279

Query  2848  --------TDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAA  3003
                     ++ +       +S    +  +  D+   + +SK RDEGV+PTVH FNVL+A 
Sbjct  1280  VGXVETNNSNGDMGKLXSIKSDKVFEXAVSSDIDISDKVSKIRDEGVIPTVHXFNVLRAX  1339

Query  3004  FNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESAR  3183
             FND NLA DTSGFSAEA+IVS+RSFSS +WEVRNSACLAYTALVRRMIGFLNVQKRES+R
Sbjct  1340  FNDTNLAADTSGFSAEAMIVSVRSFSSPHWEVRNSACLAYTALVRRMIGFLNVQKRESSR  1399

Query  3184  RALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRL  3363
             RALTG+EFFHRYP LH FL  ELK AT L  +G S    SNL   VHPSLCP+LILLSRL
Sbjct  1400  RALTGVEFFHRYPLLHPFLIKELKAATVLLGDGISGQSESNLENAVHPSLCPVLILLSRL  1459

Query  3364  KPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASE  3543
             KPS I S TGD  DPFL MPFIRKCS Q+NLR+R+LASRAL G+VSNEKLP+V+LNI SE
Sbjct  1460  KPSTIASXTGDDVDPFLLMPFIRKCSTQSNLRVRVLASRALAGLVSNEKLPSVLLNIVSE  1519

Query  3544  LPAIDNHSM-TSDLSGL-----SNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDIL  3705
             LP  D+ +  T +LS L         +S+N  HG+LLQLSSLLDTNCRNLAD SKK+ IL
Sbjct  1520  LPRRDDQATWTPELSLLFDKTRRRQQSSYNWTHGILLQLSSLLDTNCRNLADSSKKDQIL  1579

Query  3706  SDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSS  3885
              DL   L  HSWIG P+ CPCPILN SFL +LD+MLSIAR C  S  +  + NLL  LS+
Sbjct  1580  GDLFQALLAHSWIGKPRLCPCPILNASFLNLLDHMLSIARXCHXSXNVYALRNLLLELST  1639

Query  3886  ECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDL-IYLRGPPPDSELFK  4062
             ECLD+  S    Y+DPT+AELR+QAA SYF+C +Q S  + EE      R    +S   +
Sbjct  1640  ECLDVKASNGRXYYDPTMAELRQQAAVSYFSCVFQASDKMAEEVFQTPQRYSQSNSRFME  1699

Query  4063  ESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLL-  4239
               E + S    QERL+RSLSD+ YEVR+ATLKWLL  + S ES     S+   SEI+++ 
Sbjct  1700  IPEMENSFAGLQERLVRSLSDSEYEVRLATLKWLLKXITSTES--GHESHDXSSEIRVIQ  1757

Query  4240  -WLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNK----NCGQHEKPTFVGNM  4404
              W     LQ   + LL +EK H+C  YIL+I++T+N  Q+ K     C +     + G+M
Sbjct  1758  HW-XRTNLQTTXVNLLDMEKYHRCSYYILRILFTWNTLQFQKLGDVKCTE---TIYXGSM  1813

Query  4405  DSDSVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNP  4584
             + DSV   WDK++SLYK TRHAK  + L+CC  +CIKR A L T+S+ S  ++   +   
Sbjct  1814  ECDSVFLLWDKLISLYKFTRHAKAXQTLICCFGICIKRFAGLLTTSVLSDNSDSDRL---  1870

Query  4585  SDPSKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQ  4764
                 KL+     I +F  VI +HS +SEPINMR AAA+SI+ASGLL+QA+ +  +V N++
Sbjct  1871  ---EKLTRLYGIISFFTNVIMKHSASSEPINMRMAAAESIIASGLLEQAELIGYTVFNNR  1927

Query  4765  VPDGN-----KQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGS  4929
             +P  N     + K+A++ YAH+ILD+WFTC++LLEDEDD +R++L++ +Q C TS +SGS
Sbjct  1928  IPSENPCSTFEPKEAVNFYAHQILDIWFTCIQLLEDEDDEIRERLAMGIQGCFTSKRSGS  1987

Query  4930  HFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVF  5109
                 GVVP QVEKVI   FEHLSS FGHW+ Y D+L  WV +A+N    V   D VR+VF
Sbjct  1988  S-HGGVVPTQVEKVIGSCFEHLSSVFGHWIGYFDYLLRWVLNASNR--EVPKGDLVRQVF  2044

Query  5110  DKEIDNHHEEKLLISQICCSHLEKLPVSK-LTTEFRD-NNICSVLQSWRRRFCQQLISFG  5283
             DKEIDNHHEEKL I Q+CCS L+KL +SK    +FR+       L  WR RF  QL SF 
Sbjct  2045  DKEIDNHHEEKLFICQLCCSQLDKLRISKSWAADFRNKQQFSDYLHDWRLRFSCQLTSFA  2104

Query  5284  NAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGE  5463
                I   GG DW+GG GNHKDAFLP+Y NLLAF+ALSNCI  G+  D+K +  ++ +LG+
Sbjct  2105  KDRIAKLGGADWVGGAGNHKDAFLPLYANLLAFYALSNCIFNGKTGDNKHLQSDVAKLGK  2164

Query  5464  AIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             AI PFLRNPLISNL++LVVKSHE   G   + LV ++ G  + W+ F+P+FL R
Sbjct  2165  AIBPFLRNPLISNLYLLVVKSHEDAVGSNGDDLVPKL-GEGAVWEGFNPHFLLR  2217



>ref|XP_008379831.1| PREDICTED: uncharacterized protein LOC103442807 [Malus domestica]
Length=2217

 Score =  2164 bits (5606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1132/1911 (59%), Positives = 1376/1911 (72%), Gaps = 60/1911 (3%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSR VLN  F VS    +G  +  N  + VKTILYDGIL ELCN+CE+PTDSHFN
Sbjct  331   GILTAVSRAVLNTHFDVSKGSSNGYESHTNGGNCVKTILYDGILPELCNYCENPTDSHFN  390

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV+QICLQQIKTSM        E YDPI  E+GTR+L+IVWNNLEDPLSQTVKQVH
Sbjct  391   FHALTVLQICLQQIKTSMLANLTITSEDYDPIPVEMGTRILRIVWNNLEDPLSQTVKQVH  450

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDI+ TLHW+EGSE+  SFL+ IASDLL LGPRCKGRY PL SLT RLGAK++L
Sbjct  451   LIFDLFLDIRSTLHWSEGSERIRSFLQSIASDLLRLGPRCKGRYXPLGSLTXRLGAKTML  510

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSPGLLFDT  AY+DDDVC A T+FLK  LE LR+E WS+DGVEGGY  YR HCL PIL
Sbjct  511   DMSPGLLFDTIXAYIDDDVCCALTSFLKILLEXLRNECWSSDGVEGGYALYRGHCLPPIL  570

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYALP+LLE+D DSIF ML FI +G S   +++ YPEL   ++  
Sbjct  571   XGLASGVSKLRSNLNTYALPILLEVDEDSIFAMLAFISVGPSKGESQLSYPELXRGNMEX  630

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              V+Q+VA+LVSLLKVSR+LAL+EGDID+    +     T+         ++V +KGI+V+
Sbjct  631   RVZQKVAILVSLLKVSRLLALLEGDIDYAXXENFGGXETNFPXR----HALVSIKGIKVE  686

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             + V +L+LALTH+DDSLR+DAAE+LF+NPKTASLPS LEL L+++AVPLNMRCCSTAFQM
Sbjct  687   VXVEWLVLALTHVDDSLRVDAAETLFLNPKTASLPSHLELMLLKEAVPLNMRCCSTAFQM  746

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             K +SLFRKFF+RVRTALER  KQG W P      +G  L+  ++ +  +RA +LF FM+W
Sbjct  747   KXSSLFRKFFARVRTALERQFKQGRWEPLEHSNSNGMHLSXGSEHTEANRASDLFCFMRW  806

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPP-QGKSDSYSSEISLYPYSKGLIL  1617
             LS FLFFSCYPSAPY+RKIMAMEL+LIMLNVW ++P  Q K+ S   E  LYPY+ G+  
Sbjct  807   LSSFLFFSCYPSAPYKRKIMAMELILIMLNVWSIVPAXQEKNGSLCVEDRLYPYNXGMTX  866

Query  1618  PESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRE  1797
             P+STLLLVGSIIDSWD LRE+SFRILLHFPTP+PGIS   +V   I+WAKKLVCSPRVRE
Sbjct  867   PDSTLLLVGSIIDSWDXLRENSFRILLHFPTPLPGISDZGMVQXVILWAKKLVCSPRVRE  926

Query  1798  SDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLID  1977
             +DAGALT RLIFRKYVL LGW V  S NV   S      G++  +    PV+EYI SLI+
Sbjct  927   TDAGALTLRLIFRKYVLXLGWTVXASVNVXCLSXX--EXGDBQXYNXGYPVMEYIRSLIE  984

Query  1978  WLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilal  2157
             WL  ++EEGEKDLSEAC+ SFVHGVLLTLRY FEE+D++S    S+IS ++  LEK+L L
Sbjct  985   WLDVSIEEGEKDLSEACQNSFVHGVLLTLRYAFEELDFNSDIAQSSISEMRHSLEKLLEL  1044

Query  2158  VMRITSLALWVVSADAWYLP-DEMEEMTVDGACFL-ERPIEMDVSASTPDDEMKIAKAEQ  2331
             VMRITSLALWVVSADAW+LP D  E +  D   FL E P  ++   S  +DE K  K  Q
Sbjct  1045  VMRITSLALWVVSADAWHLPEDMDEVVVDDDDSFLSEVPDXVEXKTSLLEDEDKNYKFVQ  1104

Query  2332  DDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPT--------SDVPKSCSQITDGTDQL  2487
             ++   +Q VMVGCWLAMKEVSLLLGTI RK+PLP+        S+   SC+ +      +
Sbjct  1105  NNRRSEQSVMVGCWLAMKEVSLLLGTITRKIPLPSTPSSESLDSETTSSCASV-----MM  1159

Query  2488  SSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESW  2667
             +SD +LD++QLE IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESW
Sbjct  1160  ASDAMLDVKQLERIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESW  1219

Query  2668  MEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSL  2847
             MEQLM+RTV+KGQTVDDLLRRSAGIPAAF A FLSEPEGAPK+LLP+ALRWLI+VA  S 
Sbjct  1220  MEQLMDRTVAKGQTVDDLLRRSAGIPAAFIALFLSEPEGAPKKLLPRALRWLIDVANASF  1279

Query  2848  --------TDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAA  3003
                     ++ +       +S    +  +  D+   + +SK RDEGV+PTVH FNVL+A 
Sbjct  1280  VGXVETNNSNGDMGKLXSIKSDKVFEXAVSSDIDISDKVSKIRDEGVIPTVHXFNVLRAX  1339

Query  3004  FNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESAR  3183
             FND NLA DTSGFSAEA+IVS+RSFSS +WEVRNSACLAYTAL RRMIGFLNVQKRES+R
Sbjct  1340  FNDTNLAADTSGFSAEAMIVSVRSFSSXHWEVRNSACLAYTALXRRMIGFLNVQKRESSR  1399

Query  3184  RALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRL  3363
             RALTG+EFFHR   L       LK  T       S    SNL    HPSLCP+LILLSRL
Sbjct  1400  RALTGVEFFHRXXJLXPXXIXXLKAXTXXLXXXISGQSESNLEXAXHPSLCPVLILLSRL  1459

Query  3364  KPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASE  3543
             KPS I S TGD  DPFL MPFIRKCS Q+NLR+R+LASRAL G+VSNEKLP+V+LNI SE
Sbjct  1460  KPSTIASXTGDDVDPFLLMPFIRKCSTQSNLRVRVLASRALAGLVSNEKLPSVLLNIVSE  1519

Query  3544  LPAIDNHSM-TSDLSGL-----SNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDIL  3705
             LP  D+ +  T  LS L         +S+N  HG+LLQLSSLLDTNCRNLAD SKK+ IL
Sbjct  1520  LPRRDDQATWTPXLSLLFDKTXRRQQSSYNWTHGILLQLSSLLDTNCRNLADSSKKDQIL  1579

Query  3706  SDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSS  3885
              DL   L  HSWIG P+ CPCPILN SFL +LD+MLSIAR C  S     + NL   LS+
Sbjct  1580  GDLFQALLAHSWIGKPRLCPCPILNASFLXLLDHMLSIARXCHXSXXXYALRNLJLELST  1639

Query  3886  ECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDL-IYLRGPPPDSELFK  4062
             ECLD+  S    Y+DPT+AELR+QAA SYF+C +Q S  + E       R    +S   +
Sbjct  1640  ECLDVKXSNXRXYYDPTMAELRQQAAVSYFSCVFQASXKMAEXVFQTPQRYSQXNSRXXE  1699

Query  4063  ESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLL-  4239
               E + S    QERL+RSLSD+ YEVR+ATLKWLL F+ S ES     S+   SEI+++ 
Sbjct  1700  IPEMENSFAGLQERLVRSLSDSXYEVRLATLKWLLKFITSTES--GHESHDXSSEIRVIQ  1757

Query  4240  -WLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNK-NCGQHEKPTFVGNMDSD  4413
              W     LQ   +  L  EK H+C  YIL+I++T+N  Q+ K    +  +  + G+M+ D
Sbjct  1758  HW-XRTNLQTTXVNJLDXEKYHRCSYYILRILFTWNTLQFQKLGDXKCTETIYXGSMECD  1816

Query  4414  SVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDP  4593
             SV   WDK++SLYK TRHAK  + L+CC  +CIKR A L T+S+ S  ++   +      
Sbjct  1817  SVFLLWDKLISLYKXTRHAKAXQTLICCFGICIKRFAGLLTTSVLSDNSDSDRL------  1870

Query  4594  SKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPD  4773
              KL+     I +F  VI +HS +SEPINMR AAA+SI+ASGLL+QA+ +  +V N+++P 
Sbjct  1871  EKLTRLYGIISFFTNVIMKHSASSEPINMRMAAAESIIASGLLEQAELIGYTVFNNRIPS  1930

Query  4774  GN-----KQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFS  4938
              N     + K+A++ YAH+ILD+WFTC++LLEDEDD +R++L++ +Q C TS +SGS   
Sbjct  1931  ENPCSTFEPKEAVNFYAHQILDIWFTCIQLLEDEDDEIRERLAMGIQGCFTSKRSGSS-H  1989

Query  4939  SGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKE  5118
              GVVP QVEKVI   FEHLSS FGHW+ Y D+L  WV +A+N    V   D VR+VFDKE
Sbjct  1990  GGVVPTQVEKVIGSCFEHLSSVFGHWIGYFDYLLRWVLNASNR--EVPKGDLVRQVFDKE  2047

Query  5119  IDNHHEEKLLISQICCSHLEKLPVSK-LTTEFRD-NNICSVLQSWRRRFCQQLISFGNAY  5292
             IDNHHEEKL I Q+CCS L+KL +SK    +FR+       L  WR RF  QL SF    
Sbjct  2048  IDNHHEEKLFICQLCCSQLDKLRISKSWAADFRNKQQFSDYLHDWRLRFSCQLTSFAKDR  2107

Query  5293  IGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEAIQ  5472
             I   GG DW+GG GNHKDAFLP+Y NLLAF+ALSNCI  G+  D+K +  ++ +LG+AI 
Sbjct  2108  IAKLGGADWVGGAGNHKDAFLPLYANLLAFYALSNCIFNGKTGDNKHLQSDVAKLGKAIB  2167

Query  5473  PFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             PFLRNPLISNL++LVVKSHE   G   + LV ++ G  + W+ F+P+FL R
Sbjct  2168  PFLRNPLISNLYLLVVKSHEDAVGSNGDDLVPKL-GEGAVWEGFNPHFLLR  2217



>ref|XP_008443417.1| PREDICTED: uncharacterized protein LOC103487009 [Cucumis melo]
Length=2196

 Score =  2135 bits (5533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1134/1920 (59%), Positives = 1400/1920 (73%), Gaps = 83/1920 (4%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPG--NNDSSVKTILYDGILSELCNFCEHPTDSH  174
             GILTA+ R VLNI F +     D  G+PG  N+ +SVKTILYDGIL ELCN+CE+PTDSH
Sbjct  315   GILTAIPRPVLNIQFSMVEG--DSNGHPGCLNSGNSVKTILYDGILPELCNYCENPTDSH  372

Query  175   FNFHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQ  354
             FNFH+LTV+QICLQQIKTS+          YDP+ EE+G+R+L I+W NL+DPLSQTVKQ
Sbjct  373   FNFHSLTVLQICLQQIKTSLVSNLTDTSCSYDPLPEEMGSRILSIMWTNLDDPLSQTVKQ  432

Query  355   VHLIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKS  534
             VHLIFDLFL+IQ +L W+EGSEK   +LRKIA D+L LG RCKGRY+PLASLTKRLGAK+
Sbjct  433   VHLIFDLFLEIQSSLCWSEGSEKIKLYLRKIAFDILRLGSRCKGRYVPLASLTKRLGAKA  492

Query  535   ILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLP  714
             +LDMSP LL +T +AY+DDDVC AAT+FLKCFLE LRDE WS+DG+EGGY  YR HCL P
Sbjct  493   LLDMSPSLLSETVQAYIDDDVCCAATSFLKCFLEHLRDECWSSDGIEGGYALYRGHCLPP  552

Query  715   ILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDI  894
             +L GL SG +KLRSNLNTYALPVL E+D+DSIFPML FI +  S+    I YP ++   +
Sbjct  553   VLHGLGSGISKLRSNLNTYALPVLFEVDLDSIFPMLAFISVWPSSRDNGILYPSINQGSM  612

Query  895   VLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVAL----EVTDLSTDAGVCDSVVHV  1062
              L VEQ+VA+ +SLLKVSR LALIEGDIDW E  S+      E+   S  A     +V V
Sbjct  613   ELRVEQKVAIFISLLKVSRSLALIEGDIDWLEKPSLEQQSFHEIEYFSRYA-----LVSV  667

Query  1063  KGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCC  1242
             KG++V+I V +LLLALTH+D++LR+DAAE LF+NPKT+SLPS LEL+L++KA+PLNMRC 
Sbjct  668   KGVKVEILVEWLLLALTHVDETLRVDAAEFLFLNPKTSSLPSHLELTLLKKAIPLNMRCT  727

Query  1243  STAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENL  1422
             STAFQMKW+SLFRKFFSRVRTALER  K G W P    C S S +   ++Q +  RA++L
Sbjct  728   STAFQMKWSSLFRKFFSRVRTALERKFKLGNWIPLASCCNSESYMPNGSEQIVAGRADDL  787

Query  1423  FNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYS  1602
             F FMKWLSCFLFFSCYPSAPY RKIMAM+L L+MLNVW ++P + KS+    E  L PY+
Sbjct  788   FQFMKWLSCFLFFSCYPSAPYRRKIMAMDLFLVMLNVWSIVPSKEKSN----ETLLLPYN  843

Query  1603  KGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCS  1782
             +G+ LP+S LLLVGSIIDSWDRLRE+SFRILLHFPTP+PGISS  +V + I WAK LVCS
Sbjct  844   EGITLPDSVLLLVGSIIDSWDRLRENSFRILLHFPTPLPGISSEYMVGKVIKWAKVLVCS  903

Query  1783  PRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVT-QSPSGLSNGENLEFTPSSPVIEY  1959
              RVRESDAGAL  RL+FRKYVL+LGW+VR S  VV   S + L N        + PV EY
Sbjct  904   SRVRESDAGALALRLVFRKYVLDLGWIVRASDAVVCLDSLNKLPNVREEICKSNHPVSEY  963

Query  1960  ITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklll  2139
             + SLIDWL  +V EGE +LSEACK SFVHGVLLTLRY+FEE+DW+S  V S+IS ++ LL
Sbjct  964   LKSLIDWLNVSVTEGEMNLSEACKNSFVHGVLLTLRYSFEELDWNSDVVLSSISEMRSLL  1023

Query  2140  ekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIA  2319
             EK+L LVMRITSLALWVVSADAW+LP++M +M  D A  L+ P E +VS S  + E    
Sbjct  1024  EKLLELVMRITSLALWVVSADAWHLPEDMGDMVDDDAFVLDVPDETNVSTSLSELEDSKE  1083

Query  2320  KAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQL--SS  2493
             K   +    +QIVMVGCWLAMKEVSLLLGTI RKVPLP +    S S   D  D +    
Sbjct  1084  KTTDNSRTSEQIVMVGCWLAMKEVSLLLGTITRKVPLPAA----SDSIEFDPNDSIMPRQ  1139

Query  2494  DIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWME  2673
             + VLD++QL++IG+HFLEVLLKMKHNGAIDKTRAGFTALCNRLLCS+D RLCKLTESWM+
Sbjct  1140  EEVLDVKQLKVIGDHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSDDQRLCKLTESWMD  1199

Query  2674  QLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTD  2853
             QLMERT ++GQTVDDLLRRSAGIPAAF A FL+EPEG+PK+LLP+AL+WLI+VA++ L +
Sbjct  1200  QLMERTTARGQTVDDLLRRSAGIPAAFIALFLAEPEGSPKKLLPRALKWLIDVAERLLQN  1259

Query  2854  knkensscsesssAIDSTMVPDVAAI--------EMISKTRDEGVVPTVHAFNVLKAAFN  3009
               + +   S  S    + +  D   I        E  SK RDEGV+PTVHAFNVL+AAFN
Sbjct  1260  PIERDCKNSNFSKLPSTGLSQDTKPISTHENYPSEKASKIRDEGVIPTVHAFNVLRAAFN  1319

Query  3010  DANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRA  3189
             D NLATDTSGFSA+A+IV IRSFSS YWEVRNSACLAYTALVRRMIGFLNV KRESARRA
Sbjct  1320  DTNLATDTSGFSAQAIIVCIRSFSSPYWEVRNSACLAYTALVRRMIGFLNVHKRESARRA  1379

Query  3190  LTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKP  3369
             LTGLEFFHRYP LH FL  EL++ATE   +G S +   NLAK+VHPSLCPMLILLSRLKP
Sbjct  1380  LTGLEFFHRYPALHRFLLEELEVATESLDDGCSGDSKFNLAKIVHPSLCPMLILLSRLKP  1439

Query  3370  SPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELP  3549
             S I SE GD  DPFLFMPFIRKCS Q+NLRIRILASRALTG+VSNE LP+VILNIAS LP
Sbjct  1440  STIASEAGDDLDPFLFMPFIRKCSSQSNLRIRILASRALTGLVSNENLPSVILNIASGLP  1499

Query  3550  AIDNHSMTSD----LSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLI  3717
               DN +M  +    L+  +  + S+N IHG+LLQL SLLDTNCRNL D SKK  IL+DL+
Sbjct  1500  VDDNTTMGCESSILLATATTQHTSYNRIHGILLQLISLLDTNCRNLGDISKKRRILNDLV  1559

Query  3718  HVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLD  3897
              VL   SW+     C CPIL+ S L+VL +MLSI RTC  SK   +I NLL  LS+ECLD
Sbjct  1560  EVLAHCSWMARTSHCSCPILSTSMLQVLGHMLSIVRTCPRSKSFYIIRNLLLDLSTECLD  1619

Query  3898  LYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQ  4077
             + TS + +Y+DPT+AELR+QAA  YFNC  Q     +EED         D+ L K   +Q
Sbjct  1620  VETSHKLSYYDPTLAELRQQAAICYFNCVLQP---FDEED---------DAALQKSQRSQ  1667

Query  4078  -----------MSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQS  4224
                         S ++ QERLIRSL D  YEVR++T+KWL  FL S E  +A S + S  
Sbjct  1668  SDEDVPGTLRDYSFSQLQERLIRSLQDPCYEVRLSTMKWLFKFLKSTE-YSAGSYDLSCH  1726

Query  4225  EIKLL--WLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQH--EKPTF  4392
             EI+ +  W+    LQ++L +LL++EKN++C+ YILK ++ +NM Q+ K   +   E   +
Sbjct  1727  EIRTVDQWIKT-NLQSLLTELLSLEKNYRCLYYILKNLFAWNMSQFQKFGNEECAEDVVY  1785

Query  4393  VGNMDSDSVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVV  4572
             +G MD +SVLQFWDK++SLYK+TRHAKTRE  + CM  CIKRLA  +++ I S   +   
Sbjct  1786  IGKMDCESVLQFWDKLISLYKLTRHAKTRENTIRCMGTCIKRLAVQYSACIVS---DATT  1842

Query  4573  VVNPSD--PSKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSP  4746
             + +P+    + L  +  CI  F ++I++HS ASEP+NMR AAA SI+ASGLL+QA+    
Sbjct  1843  IESPNGRISNNLDKYHSCITLFTDLIKQHSAASEPVNMRTAAADSIIASGLLEQAEIFGD  1902

Query  4747  SVSNHQVPDGN-----KQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCIT  4911
              V ++Q+P        + ++  ++YAH+IL++W TC+ LLEDEDD +RK+L+ +VQKC  
Sbjct  1903  YVFDNQIPQATANSHCEHREYANMYAHQILNMWSTCIMLLEDEDDDIRKRLAADVQKCFR  1962

Query  4912  SGKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIAD  5091
               ++    +S  VP QVE+VI  SFE+LSS FGHW+ Y D+L +WV +  N    +S AD
Sbjct  1963  LERTT---TSSDVPNQVEQVIGSSFEYLSSIFGHWVLYFDYLANWVLNTANY--TISPAD  2017

Query  5092  PVRRVFDKEIDNHHEEKLLISQICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQL  5271
             PVRRVFDKEIDNHHEEKLLI Q CC H+EKL  S+L   +      + L S R+RF  QL
Sbjct  2018  PVRRVFDKEIDNHHEEKLLICQTCCFHMEKLSSSRLIALWDTQWFMNYLVSLRKRFFHQL  2077

Query  5272  ISFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAE--DSKSMVPE  5445
             I F + Y+    G DWIGG GNHKDAFLP+Y NLL F A+SNCI+ G+++    +  V E
Sbjct  2078  IRFSDEYMSKHSGFDWIGGAGNHKDAFLPLYTNLLGFCAISNCIVNGKSKVVTMQPFVTE  2137

Query  5446  LLELGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             ++E+G+ I PFLRNPLISNL++LV++ H++      +H + E  G  + W+ FDPYFL R
Sbjct  2138  VVEIGKIINPFLRNPLISNLYLLVIRIHKEAIDVNRDHNIPE-HGHEAIWEGFDPYFLLR  2196



>ref|XP_010032511.1| PREDICTED: thyroid adenoma-associated protein homolog isoform 
X1 [Eucalyptus grandis]
 gb|KCW51904.1| hypothetical protein EUGRSUZ_J01361 [Eucalyptus grandis]
Length=2196

 Score =  2126 bits (5509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1122/1903 (59%), Positives = 1397/1903 (73%), Gaps = 52/1903 (3%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSR VLN+ FVV++D  +G     + + +VKTILYDGIL ELCNFCE+PTDSHFN
Sbjct  318   GILTAVSRNVLNMHFVVASDKCNGSEGFKDANKAVKTILYDGILPELCNFCENPTDSHFN  377

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIKTS+        E YDP+ EE+GTR+L+++W NLEDPLSQTVKQVH
Sbjct  378   FHALTVMQICLQQIKTSLLAKLVIFSEDYDPLKEEMGTRILRLIWKNLEDPLSQTVKQVH  437

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDI+ TLHW + S++   FLRKIASDLL LGPRCKGRY+PLASLTKRLGA+++L
Sbjct  438   LIFDLFLDIRSTLHWGDNSDRIKLFLRKIASDLLCLGPRCKGRYVPLASLTKRLGARALL  497

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              M PGLL +T +AY+DDDVC A T+FLKCFLE LRD+ W TDG+E GY+ YR HCL P L
Sbjct  498   GMRPGLLSETVQAYIDDDVCCAVTSFLKCFLENLRDDCWKTDGIERGYVLYREHCLHPFL  557

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYALPVLLE+D+DSIFPML FI +  + E  +  +  L+S    L
Sbjct  558   YGLASGASKLRSNLNTYALPVLLEVDIDSIFPMLAFISVTPTGEDNDFLHMGLNSTQADL  617

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              +EQ+VAV VSLLKVSR+LA IEGDIDW E + +   V  L  +     ++V +KGI++K
Sbjct  618   SIEQKVAVAVSLLKVSRLLAWIEGDIDWLEKTLLDRTVDGLEAEYVSGYALVCIKGIKMK  677

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             I V +L+ ALTH+DDSLR+DAAE LF+NPKTASLPS+LEL LM++A+P+NMRC STAFQM
Sbjct  678   ILVEWLVQALTHVDDSLRVDAAEFLFLNPKTASLPSNLELVLMKEAIPMNMRCSSTAFQM  737

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSRVRTALER +KQ  W P L    +   L+  ++ +   RA NLF FM+W
Sbjct  738   KWCSLFRKFFSRVRTALERQLKQQAWQPRLHHKGTEICLSIRSEDTSFSRANNLFFFMRW  797

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
              S FLFFSCYPSAPY+RKIMAMEL++IM++VW + P Q ++  +S E SL+PYS+G+  P
Sbjct  798   FSAFLFFSCYPSAPYKRKIMAMELIVIMMDVWAVAPSQ-ENHLFSPE-SLHPYSRGITSP  855

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             +ST LL+GSIIDSWDRLRE+SFRIL+HFPTP+PG+SS ++V   I WAKKLVCSPRVRES
Sbjct  856   DSTFLLLGSIIDSWDRLRENSFRILVHFPTPLPGLSSDQMVVNIIEWAKKLVCSPRVRES  915

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDW  1980
             DAGALT RLIFRKYVLE  W+V  S NV+  S S  S   +       PV++Y+ SLIDW
Sbjct  916   DAGALTLRLIFRKYVLEHRWIVTASVNVMCDSHSQSSESMH-------PVMDYVWSLIDW  968

Query  1981  LCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilalV  2160
             L   V+EG++DLSEACK SFVHGVLL+LRYTFEE+DW+S AV S++S ++  L K+L LV
Sbjct  969   LDVVVKEGKRDLSEACKNSFVHGVLLSLRYTFEELDWNSDAVVSSMSEMRRALNKLLDLV  1028

Query  2161  MRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEM-KIAKAEQDD  2337
             + ITSLALWVVSADAWYLP++M+EM  D    L+ P+E++  A  P  E+ + +K     
Sbjct  1029  LEITSLALWVVSADAWYLPEDMDEMVDDDNFVLDFPVEVNDPA--PSSELDRCSKV----  1082

Query  2338  GPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLS---SDIVLD  2508
               ++Q+VMVGCWLAMKEVSLLLGTIIRK+PLPTS    S  + TD  D  +    ++VLD
Sbjct  1083  -GLEQVVMVGCWLAMKEVSLLLGTIIRKIPLPTSTYSDSL-EPTDAADNSAVKIPEVVLD  1140

Query  2509  LRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMER  2688
             L+QLE +GNHFLEVLL+MKHNGAIDKTRAGFTALCNRLLCSN+P LCKLTESWME LMER
Sbjct  1141  LKQLEAMGNHFLEVLLRMKHNGAIDKTRAGFTALCNRLLCSNNPELCKLTESWMELLMER  1200

Query  2689  TVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknken  2868
             TV+KGQ VDDLLRRSAGIPAAF A FLSEPEGAPK+LLP ALRWLI+VA +SL D    N
Sbjct  1201  TVAKGQVVDDLLRRSAGIPAAFIALFLSEPEGAPKKLLPCALRWLIDVANQSLQDLYASN  1260

Query  2869  ssc--------sesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLA  3024
              +          +   + +S +  D  A E  SK RDEGV+PTVHAFNVL+ AFND NLA
Sbjct  1261  VAIGDLCIHRPEKIDHSAESALPVDSNANERTSKIRDEGVIPTVHAFNVLRTAFNDTNLA  1320

Query  3025  TDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLE  3204
             TD SGFSAEALIVSIR+FSS YWEVRNSACLAYTALVRRMIGFLNV KRESARR+LTGLE
Sbjct  1321  TDASGFSAEALIVSIRAFSSPYWEVRNSACLAYTALVRRMIGFLNVHKRESARRSLTGLE  1380

Query  3205  FFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITS  3384
             FFHRYP+LH FL  ELKIATEL  +GS+ +  S+LAKVVHPSLCP+LILLSRLKPS I S
Sbjct  1381  FFHRYPSLHFFLLEELKIATELLDDGSTRHSESSLAKVVHPSLCPVLILLSRLKPSAIAS  1440

Query  3385  ETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNH  3564
             ETGD  DPFLFMPFIR+CS Q N+RIR+LASRALTG+VSNEKLP +I+NIA++L  ++NH
Sbjct  1441  ETGDDLDPFLFMPFIRRCSTQRNMRIRVLASRALTGLVSNEKLPGIIVNIATDLSCLENH  1500

Query  3565  -SMTSDLSGLSNLNAS----FNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLG  3729
              S  +     S+ N +    FN IHGMLLQL SLLDTNCRNL DFSKK+ ILSDLI +L 
Sbjct  1501  CSGIAIPHKFSSTNEAQHTPFNLIHGMLLQLCSLLDTNCRNLVDFSKKDQILSDLIQLLA  1560

Query  3730  KHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTS  3909
             K SWIGSP+ CPCP +N +FL+VLD+MLSIAR C   +    I NLL  L++E L L  S
Sbjct  1561  KCSWIGSPRWCPCPPVNTTFLRVLDHMLSIARGCRSGETFCNIRNLLLELTAESLVLDGS  1620

Query  3910  KRPAYFDPTIAELRKQAASSYFNCAYQTSKD-VNEEDLIYLRGPPPDSELFKESETQMSV  4086
                 Y+DP ++ELR+Q+A+SYF+C +Q S +   E + +  +    D  L    ET  + 
Sbjct  1621  CVLPYYDPAVSELREQSATSYFSCFFQVSNEKTAENNHLSQKNCLSDINLLAR-ETPDAS  1679

Query  4087  TRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLL--WLSNIGL  4260
              +  E+L+  LSD+LYEVR+ATLKWLL FL   ES        S SEI  +  W +N+ L
Sbjct  1680  CQLLEKLVCCLSDSLYEVRLATLKWLLKFLGITES-GCHGHYFSSSEIAAVQQW-ANVNL  1737

Query  4261  QAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNK-NCGQHEKPTFVGNMDSDSVLQFWDK  4437
             Q  +M+LL++EKNHKC +YIL+I +T+N+QQYN+  C  +    F+G MD D  LQ W +
Sbjct  1738  QDTMMKLLSLEKNHKCTHYILRIFFTWNLQQYNQVGCQMNIGTKFMGVMDGDFTLQIWGR  1797

Query  4438  VVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSE  4617
             ++SLY + RHAKT+  ++CCMAVCIKRLA L  +SI     EK +        + +    
Sbjct  1798  LLSLYNIVRHAKTQGTIICCMAVCIKRLAGLLANSIFD-STEKTINECLVQLERQNQLYG  1856

Query  4618  CIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDG----NKQ  4785
             CI  F ++I+ HS ++EP+N+R AAA+SI+ASG+L+QA+ + P   N    +G    +  
Sbjct  1857  CISMFNKLIELHSASTEPVNLRNAAAESIIASGMLEQAEVIGPLFRNKMPAEGRPSFSDT  1916

Query  4786  KDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVE  4965
             K+   +YAH++L +WFTC++LLEDEDDG+R++L+L VQKC    +     S+  VP QVE
Sbjct  1917  KEIAIVYAHQVLKMWFTCVRLLEDEDDGIRQKLALNVQKCFMPRQLLGRSSASSVPTQVE  1976

Query  4966  KVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNHHEEKL  5145
             KV++ SFEHLSS FGHW++Y ++L  WV       C  S  D VRRVFDKEIDNHHEEKL
Sbjct  1977  KVLKSSFEHLSSIFGHWIEYFNYLAQWVHDTEK--CEKSGGDLVRRVFDKEIDNHHEEKL  2034

Query  5146  LISQICCSHLEKLPVSKL-TTEFRD-NNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDW  5319
             LI QICC H+EKL +S      F + ++I   L +WR RF  QLI+FG  ++ T+  V W
Sbjct  2035  LICQICCLHMEKLFISSFWAVNFTEADSIKKNLYAWRTRFFTQLITFGEDHM-TKDDVFW  2093

Query  5320  IGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSK-SMVPELLELGEAIQPFLRNPLI  5496
             IGGV NHKD FLP+Y NLL F+ALS C+L  +   S   +V ++++L +A+  FLRNPLI
Sbjct  2094  IGGVANHKDTFLPLYANLLGFYALSKCLLSEDGITSDLELVSDVIKLAKALSLFLRNPLI  2153

Query  5497  SNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
              NLF  VV+ HE+    + +  +L+       WD FDPYFL +
Sbjct  2154  LNLFCSVVELHERKFNLSADISLLKYRTDDLLWDFFDPYFLLK  2196



>ref|XP_004147469.1| PREDICTED: uncharacterized protein LOC101204483 [Cucumis sativus]
Length=2184

 Score =  2115 bits (5479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1120/1904 (59%), Positives = 1379/1904 (72%), Gaps = 63/1904 (3%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPG--NNDSSVKTILYDGILSELCNFCEHPTDSH  174
             GILTA+ R VLNI F +     D  G+PG  N+ +SVKTILYDGIL ELCN+CE+PTDSH
Sbjct  315   GILTAIPRPVLNIPFSMVEG--DSNGHPGCLNSGNSVKTILYDGILPELCNYCENPTDSH  372

Query  175   FNFHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQ  354
             FNFH+LTV+QICLQQIKTS+          YDP+ EE+G+R+L I+W NL+DPLSQTVKQ
Sbjct  373   FNFHSLTVLQICLQQIKTSLVSNLTDTSCSYDPLPEEMGSRILSIMWTNLDDPLSQTVKQ  432

Query  355   VHLIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKS  534
             VHLIFDLFL+IQ +L W+EGSEK   FLRKIA DLL LG RCKGRY+PLASLTKRLGAK+
Sbjct  433   VHLIFDLFLEIQSSLCWSEGSEKIKLFLRKIAFDLLRLGSRCKGRYVPLASLTKRLGAKT  492

Query  535   ILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLP  714
             +LDMSP LL +T +AY+DDDVC A T+FLKCFLE LRDE WS+DG+EGGY  YR HCL P
Sbjct  493   LLDMSPSLLSETVQAYIDDDVCCAVTSFLKCFLEHLRDECWSSDGIEGGYAIYRGHCLPP  552

Query  715   ILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDI  894
             +L GL SG +KLRSNLNTYALPVL E+D+DSIFPML FI +  S+    I YP  +   +
Sbjct  553   VLHGLGSGISKLRSNLNTYALPVLFEVDLDSIFPMLAFISVWPSSRDNGILYPGNNQGSM  612

Query  895   VLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIE  1074
              L VEQRVA+ +SLLKVSR LALIEGDIDW E  S+               ++V VKG++
Sbjct  613   ELRVEQRVAIFISLLKVSRSLALIEGDIDWLEKPSLDRY------------ALVFVKGVK  660

Query  1075  VKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAF  1254
             V+I V +LLLALTH+D++LR+DAAE LF+NPKT+SLPS LEL+L++KA+PLNMRC STAF
Sbjct  661   VEILVEWLLLALTHVDETLRVDAAEFLFLNPKTSSLPSHLELTLLKKAIPLNMRCTSTAF  720

Query  1255  QMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFM  1434
             QMKW+SLFRKFFSRVRTALER  K G W P    C   S +    +Q +  RA++LF FM
Sbjct  721   QMKWSSLFRKFFSRVRTALERQFKLGNWIPLASCCNRESYMPNGNEQIVAGRADDLFQFM  780

Query  1435  KWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLI  1614
             KWLSCFLFFSCYPSAPY RKIMAM+L L+MLNVW ++P + K +    E  L PY++G+ 
Sbjct  781   KWLSCFLFFSCYPSAPYRRKIMAMDLFLVMLNVWSIVPSKEKCN----ETLLLPYNEGIT  836

Query  1615  LPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVR  1794
             LP+S LLLV SIIDSWDRLRE+SFRILLHFPTP+PGIS   +V + I WAK LVCS RVR
Sbjct  837   LPDSVLLLVVSIIDSWDRLRENSFRILLHFPTPLPGISGEYMVGKIIKWAKVLVCSSRVR  896

Query  1795  ESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLI  1974
             ESDAGAL  RL+FRKYVL+LGW+VR S  VV             E   + PV EY+ SLI
Sbjct  897   ESDAGALALRLVFRKYVLDLGWIVRASDAVVCLDSVNKLPNVGKECKSNHPVAEYLKSLI  956

Query  1975  DWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekila  2154
             DWL  +V EGE +LSEACK SFVHGVLLTLRY+FEE+DW+S  V S+IS ++ LLEK+L 
Sbjct  957   DWLNVSVTEGEINLSEACKNSFVHGVLLTLRYSFEELDWNSDVVLSSISEMRSLLEKLLE  1016

Query  2155  lVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQD  2334
             LVMRITSLALWVVSADAW+LP++M++M  D A  L+ P E ++S S  + E    K   +
Sbjct  1017  LVMRITSLALWVVSADAWHLPEDMDDMVDDDAFVLDVPDETNMSTSFSELEDSKEKTTDN  1076

Query  2335  DGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQL--SSDIVLD  2508
                 +Q VMVGCWLAMKEVSLLLGTI RKVPLP +    S S  +D  D +    + VLD
Sbjct  1077  SRTSEQTVMVGCWLAMKEVSLLLGTITRKVPLPAA----SDSFESDPNDSIMPRQEEVLD  1132

Query  2509  LRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMER  2688
             ++QL++IG+HFLEVLLKMKHNGAIDKTRAGFTALCNRLLCS+D RLCKLTESWM+QLMER
Sbjct  1133  VKQLKVIGDHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSDDQRLCKLTESWMDQLMER  1192

Query  2689  TVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknken  2868
             T +KGQTVDDLLRRSAGIPAAF A FL+EPEG+PK+LLP+AL+WLI+VA++ L +  + +
Sbjct  1193  TTAKGQTVDDLLRRSAGIPAAFIALFLAEPEGSPKKLLPRALKWLIDVAERLLQNPIETD  1252

Query  2869  sscsesssAIDSTMVPDVAAI--------EMISKTRDEGVVPTVHAFNVLKAAFNDANLA  3024
                S  S    + +  D   I        E  SK RDEGV+PTVHAFNVL+AAFND NLA
Sbjct  1253  CKNSNFSKLPSTGLSQDTEPISTHETYPSEKASKIRDEGVIPTVHAFNVLRAAFNDTNLA  1312

Query  3025  TDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLE  3204
             TDTSGFSA+A+IV IRSFSS YWEVRNSACLAYTALVRRMIGFLNV KRESARRALTGLE
Sbjct  1313  TDTSGFSAQAIIVCIRSFSSPYWEVRNSACLAYTALVRRMIGFLNVHKRESARRALTGLE  1372

Query  3205  FFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITS  3384
             FFHRYP LH FL  EL +ATE   +G S +  SNLAKVVHPSLCPMLILLSRLKPS I S
Sbjct  1373  FFHRYPALHRFLLQELDVATESLDDGCSGDSKSNLAKVVHPSLCPMLILLSRLKPSTIGS  1432

Query  3385  ETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNH  3564
             E GD  DPFLFMPFIRKCS Q+NLRIRILASRALTG+VSNE LP+VILNIAS LP  D+ 
Sbjct  1433  EAGDDLDPFLFMPFIRKCSSQSNLRIRILASRALTGLVSNENLPSVILNIASGLPVDDST  1492

Query  3565  SMTSD----LSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGK  3732
             +M  +    L+  +    S+N IHG+LLQL SLLD NCRNL D  KK  IL+DL+ VL  
Sbjct  1493  TMGRESSILLATTTTQYTSYNRIHGILLQLISLLDINCRNLGDILKKSQILNDLVEVLAH  1552

Query  3733  HSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSK  3912
              SW+     C CPIL+ S L+VL +MLSI R C  SK   VI NLL  LS+ CLD+ TS 
Sbjct  1553  CSWMARSSHCSCPILSTSMLQVLGHMLSIVRKCPRSKSFYVIRNLLLDLSTGCLDVETSH  1612

Query  3913  RPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTR  4092
             +  Y+DPT+AELR+QAA  YFNC  Q   + ++  L   +    D ++   +      ++
Sbjct  1613  KLPYYDPTLAELRQQAAICYFNCVLQPFDEEDDATLQKSQRSQSDEDV-PATLMDYPFSQ  1671

Query  4093  FQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLL--WLSNIGLQA  4266
              QERLIRSL D  YEVR++T+KWL  FL S E  +A   + S  EI+ +  W+    LQA
Sbjct  1672  LQERLIRSLQDPCYEVRLSTMKWLFKFLKSTE-YSAGLYDLSCHEIRTVDQWIKT-NLQA  1729

Query  4267  MLMQLLAVEKNHKCMNYILKIIYTYNMQQYNK--NCGQHEKPTFVGNMDSDSVLQFWDKV  4440
             +L +LL++EKN++C+ YILK ++ +NM Q+ K  N    E   ++G MD  SVLQFWDK+
Sbjct  1730  LLTELLSLEKNYRCLYYILKNLFAWNMSQFQKFGNGECTEDVVYIGKMDCGSVLQFWDKL  1789

Query  4441  VSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDP--SKLSVFS  4614
             +SLYK+TRHAKTRE  + CM  CIKRLA  +++ I S   +     +P+    + L  F 
Sbjct  1790  ISLYKLTRHAKTRENTIRCMGTCIKRLAVQYSACIVS---DATTTESPNGKISNDLDKFH  1846

Query  4615  ECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDG-----N  4779
              CI  F ++I++HS ASEP+NMR AAA SI+ASGLL+QA+     V ++Q+P+      +
Sbjct  1847  SCITLFTDLIKQHSAASEPVNMRTAAADSIIASGLLEQAEIFGDYVFDNQIPEATVNSHS  1906

Query  4780  KQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQ  4959
             + ++  ++YAH+IL++W TC+ LLEDEDD +RK+L+ +VQK  +  ++    +S  VP Q
Sbjct  1907  ELREYANMYAHQILNMWSTCIMLLEDEDDDIRKRLAADVQKYFSLERTA---TSSDVPNQ  1963

Query  4960  VEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNHHEE  5139
             VE+VI  SFE+LSS FGHW+ Y D+L +WV +  +    VS ADPVRRVFDKEIDNHHEE
Sbjct  1964  VEQVIGSSFEYLSSIFGHWVLYFDYLANWVLNTADY--TVSPADPVRRVFDKEIDNHHEE  2021

Query  5140  KLLISQICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDW  5319
             KLLISQ CC H+EKL  SKL   +      + L   R+RF  QLI F + Y+    G DW
Sbjct  2022  KLLISQTCCFHMEKLSRSKLIALWDTQWFMNYLVGLRKRFFLQLIRFADEYMSKHSGFDW  2081

Query  5320  IGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAE--DSKSMVPELLELGEAIQPFLRNPL  5493
             IGG GNHKDAFLP+Y NLL F+A+SNCI+ G+++    + ++ E++E G+ I PFLRNPL
Sbjct  2082  IGGAGNHKDAFLPLYTNLLGFYAISNCIVNGKSKVVTMQPLITEVVETGKIINPFLRNPL  2141

Query  5494  ISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             ISNL++LV + HE+      +H + E  G  + W+ FDPYFL R
Sbjct  2142  ISNLYLLVTRIHEEAIDVNRDHNIPE-RGHEAIWEGFDPYFLLR  2184



>ref|XP_003554883.1| PREDICTED: thyroid adenoma-associated protein homolog [Glycine 
max]
Length=2185

 Score =  2113 bits (5474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1132/1911 (59%), Positives = 1407/1911 (74%), Gaps = 88/1911 (5%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTA+SR +LN  F              +  S VKT+LYDG+L ELC  CE+P DSHFN
Sbjct  325   GILTAISRDLLNAHF--------------SGVSGVKTVLYDGVLPELCRHCENPVDSHFN  370

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIKTS+      +   Y+PI EE+G R+LKI+WNNLEDPLSQTVKQVH
Sbjct  371   FHALTVMQICLQQIKTSLLSNLTDLSGEYEPIPEEMGMRILKIIWNNLEDPLSQTVKQVH  430

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDIQ +L   EG ++   FL KI SDLL LG RCKGRY+PLA LTKRLGA+ +L
Sbjct  431   LIFDLFLDIQFSL--CEGGDRIKEFLVKIGSDLLSLGSRCKGRYVPLALLTKRLGARKML  488

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSP LLF+T +AYVDDDVC AAT+FLKCFLECLRDE+W +DG+EGGY+ YR HCL P+L
Sbjct  489   DMSPDLLFETMRAYVDDDVCCAATSFLKCFLECLRDEFWESDGIEGGYVFYRGHCLPPVL  548

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+S F+KLR+NLNTYALPVLLE+DVDSIFPML FI +G + +   + YPEL   D+ +
Sbjct  549   YGLASEFSKLRTNLNTYALPVLLEVDVDSIFPMLSFISVGPNGDENGLQYPELVYVDMEV  608

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              +EQR+A+LVSLLKVSR LAL+EGDIDW E     ++   L TD+    ++V +KGI VK
Sbjct  609   NLEQRIAILVSLLKVSRSLALVEGDIDWAENPLANIKEPGLGTDS---HAIVCIKGINVK  665

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             I V +L+ ALTH+D+SLR+DAAE LF+NPKTASLPS LEL+LM++AVPLNMRCC +AFQM
Sbjct  666   IHVQWLVNALTHVDESLRVDAAELLFLNPKTASLPSHLELTLMKEAVPLNMRCCFSAFQM  725

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGS----PLNGEADQSLKHRAENLFN  1428
             KW+SLFRKFFSRVRTALER  KQG W+P  ++C  GS    P  G  D ++K RA++LF+
Sbjct  726   KWSSLFRKFFSRVRTALERQFKQGNWNP--LECNEGSEVFCPSKGNNDLTIK-RADDLFH  782

Query  1429  FMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEIS-LYPYSK  1605
             FM+WLS FLFFSCYPSAPY+RKIMAM+L+LIM+NVW +        + S   S L PYSK
Sbjct  783   FMRWLSGFLFFSCYPSAPYKRKIMAMDLILIMINVWSIKSSSSLEFNSSLPGSHLNPYSK  842

Query  1606  GLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSP  1785
             G+   +STLLLVGSI+DSWDRLRE+SF ILLHFP+P+PGIS+ + + + I  + KLVCSP
Sbjct  843   GMTSSDSTLLLVGSIVDSWDRLRENSFHILLHFPSPLPGISNEDTLKKLIASSMKLVCSP  902

Query  1786  RVRESDAGALTFRLIFRKYVLELGWVVRVSCNVV-TQSPSGLSNGENLEFTPSSPVIEYI  1962
             RVRESDAGAL+ RLIF+KYVLELGW++  S  VV   S S L N  N      +PVI Y+
Sbjct  903   RVRESDAGALSLRLIFKKYVLELGWLIEDSFKVVHLSSKSELVNEVNQFNKFRNPVILYL  962

Query  1963  TSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissikllle  2142
              S+IDWL AAV +GE+DLS+ACK SFVHGVLL LRYTFEE+DW+S  ++++IS ++ LLE
Sbjct  963   KSMIDWLDAAVRDGEQDLSKACKNSFVHGVLLALRYTFEELDWNSNVISASISELRYLLE  1022

Query  2143  kilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAK  2322
             ++L LV+RITSLALWVVS+DAW+LP++M+EM  + +  +E P    + +S  + E   +K
Sbjct  1023  RLLDLVVRITSLALWVVSSDAWHLPEDMDEMLDEDSLLMEIPDHECMPSS--EYENNNSK  1080

Query  2323  AEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITD------GTDQ  2484
                D    DQIVMVGCWLAMKEVSLLLGTIIRKVPLP++    +CS +++       T  
Sbjct  1081  PSHDGRSSDQIVMVGCWLAMKEVSLLLGTIIRKVPLPSN----ACSDLSELEEPSVDTAG  1136

Query  2485  LSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTES  2664
              SSD VLDL QL+ IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCS+D RL +LTES
Sbjct  1137  FSSDSVLDLEQLKTIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSSDSRLHRLTES  1196

Query  2665  WMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKS  2844
             WMEQLM+RTV+KGQ VDDLLRRSAGIPAAF A FLSEPEG PK+LLP+ALRWLI+V   S
Sbjct  1197  WMEQLMQRTVAKGQVVDDLLRRSAGIPAAFIALFLSEPEGTPKKLLPRALRWLIDVGNGS  1256

Query  2845  LTDknkensscsesssAIDSTMVPDVA------AIEMISKTRDEGVVPTVHAFNVLKAAF  3006
             + ++ K NS   +     DS    + A        +M+SK RDEGV+PTVHAFNVL+AAF
Sbjct  1257  MLNQTKSNSLNGDPCKPNDSANGNNYALSAERNVRQMLSKIRDEGVIPTVHAFNVLRAAF  1316

Query  3007  NDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARR  3186
             ND+NLATDTSGFSAEALI+SIRSFSS +WE+RNSACLAYTALVRRMIGFLN+ KRESARR
Sbjct  1317  NDSNLATDTSGFSAEALILSIRSFSSPHWEIRNSACLAYTALVRRMIGFLNIHKRESARR  1376

Query  3187  ALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLK  3366
             A+TGLEFFHRYP LH+FLFNEL++ATE     SS +L S     +HPSL P+LILLSRLK
Sbjct  1377  AITGLEFFHRYPALHSFLFNELEVATEFLGCASSADLESIRGNNLHPSLYPILILLSRLK  1436

Query  3367  PSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASEL  3546
             PS I  ETGD  DPFLFMP+IR+CS Q+NLR+R+LASRALT +VSNEKLP+V+ NIAS+L
Sbjct  1437  PSSIAGETGDELDPFLFMPWIRRCSTQSNLRVRVLASRALTSIVSNEKLPSVLFNIASDL  1496

Query  3547  PAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVL  3726
             P +D       L   +N   SFN IHG+LLQLS+LLD NC+ LAD SKK+ I+ +LI +L
Sbjct  1497  PCVDK------LVKSTNFPISFNFIHGILLQLSALLDINCKGLADNSKKDHIIGELIQIL  1550

Query  3727  GKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYT  3906
                SWI  P  C CPILN +FL+VLD ML+IARTC+++K    I  LL  LS+ECLD+  
Sbjct  1551  VLRSWIARPTHCQCPILNETFLRVLDQMLNIARTCQITKHFYSISKLLLELSTECLDV-E  1609

Query  3907  SKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYL--RGPPPDSELFKESETQM  4080
             S   +Y+DPTIAELR+QAA  YF C +Q S  ++EE++I+L  R   P SE   E E + 
Sbjct  1610  SYGSSYYDPTIAELREQAAIFYFGCFFQAS--IDEEEIIHLPVRHSLPTSESLPEHEIEN  1667

Query  4081  SVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKL--LWLSNI  4254
             +     +RLI  LSD+LYEVR+ATLKWLL  L + E    +  +   ++I+   LW +  
Sbjct  1668  TSLSLLDRLICCLSDSLYEVRLATLKWLLKLLKASEP-CGKVYDLFHNDIRAVELW-AKT  1725

Query  4255  GLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEK---PTFVGNMDSDSVLQ  4425
              L   L+++LA EKNHKC   IL+I+  +N+ Q+ K    H+K     +VG MD DSV Q
Sbjct  1726  NLNGTLVKILASEKNHKCKYNILRILVAWNLLQFEK--ASHDKCSGTNYVGEMDFDSVFQ  1783

Query  4426  FWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKV---VVVNPSDPS  4596
             FW+++VSLYK TRHAKT+E LV C+ VC KR+  LF SSI  L NE++   V    +   
Sbjct  1784  FWNEIVSLYKQTRHAKTQETLVRCLGVCTKRITMLFASSI--LSNERIEFLVCGEINQEE  1841

Query  4597  KLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDG  4776
              LS   +CI +F  +I++ S +SEP +MR+AAA+S++ASGLL+QA  L   V N+Q+P G
Sbjct  1842  MLSWLFDCIVFFCNMIKQRSSSSEPASMRQAAAESLIASGLLEQAGLLGSFVLNNQIPLG  1901

Query  4777  NK-----QKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSS  4941
                    + +A++LYAH++LD WF+CMKLLEDEDD +R +LS +VQKC T+ K+ S+ ++
Sbjct  1902  TSSSCFVKNEAVNLYAHQVLDAWFSCMKLLEDEDDSVRLRLSSDVQKCFTTEKTRSNLTT  1961

Query  4942  GVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEI  5121
             G VPIQV++VI   F+HLSS FGHW+DY D+LC WV  A   +C     D VRRVFDKEI
Sbjct  1962  GSVPIQVDRVIRFCFDHLSSIFGHWIDYFDYLCQWVLRA--ESCVAPQGDLVRRVFDKEI  2019

Query  5122  DNHHEEKLLISQICCSHLEKLPVSKL---TTEFRDNNICSVLQSWRRRFCQQLISFGNAY  5292
             DNH+EEKLLISQICCS++EKLP+ K      EFR     S L   R RF  QL+S+   +
Sbjct  2020  DNHYEEKLLISQICCSNMEKLPILKSWADKDEFR-----SYLDGRRARFSHQLVSYAEDH  2074

Query  5293  IGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCI-LRGEAEDSKSMVPELLELGEAI  5469
             IG Q G DWIGGVGNHKDAFLPVY NLL F++LSNCI L     D+K ++ +++ +G AI
Sbjct  2075  IGKQEGNDWIGGVGNHKDAFLPVYANLLGFYSLSNCIFLVSGNNDAKPLLSDVVVVGRAI  2134

Query  5470  QPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLF  5622
              PFLRNPLISNLF LV++SH+K+AG     L  E+ G  S WD+F+PYFL 
Sbjct  2135  NPFLRNPLISNLFKLVIQSHKKMAGDVANGLSPEM-GNCSIWDSFNPYFLL  2184



>ref|XP_004489387.1| PREDICTED: thyroid adenoma-associated protein homolog [Cicer 
arietinum]
Length=2209

 Score =  2112 bits (5472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1119/1899 (59%), Positives = 1384/1899 (73%), Gaps = 50/1899 (3%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSR +LN  F V N   DG  + G   S  KTILYDGIL ELC  CE+P DSHFN
Sbjct  335   GILTAVSRNLLNTQFSVVNGCEDG--DDGVVGSVNKTILYDGILPELCMHCENPVDSHFN  392

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIK SM      +   YDPI EE+G R+L+I+WNNLEDPLSQTVKQVH
Sbjct  393   FHALTVMQICLQQIKASMILNLTDLSVDYDPIPEEMGMRILRIIWNNLEDPLSQTVKQVH  452

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLF+DIQ +L W+EG E+   FL KI SDLL LG RCKGRY+PLA LTKRLGAK +L
Sbjct  453   LIFDLFMDIQSSLRWSEGGEQVKVFLGKIGSDLLSLGSRCKGRYVPLALLTKRLGAKKML  512

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DM P LLF+T  AYVDDDVC AAT+FLKCFLE LRDE W TDG+EGGY  YR +CL PI+
Sbjct  513   DMCPDLLFETIHAYVDDDVCCAATSFLKCFLEYLRDECWETDGIEGGYALYRGYCLPPIM  572

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SGF+K R+NLNTYA+PVLLE+DVDSIF ML F+ +G   +   + YPEL   ++ L
Sbjct  573   HGLASGFSKHRTNLNTYAVPVLLEVDVDSIFSMLAFVSVGPDGDEKGLQYPELVCANLEL  632

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              +EQ++A+LVSLLKVSR LAL+EGDIDWCE  S   E   + T +    +++ +KGI  K
Sbjct  633   NLEQKIAILVSLLKVSRSLALVEGDIDWCENPSSNEEECVIGTQS---HALLCIKGINFK  689

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             I V +L+ ALTH+D+SLR+DAAESLF+NPKT+SLPS LEL+LM++AVPLNMRCCST+FQM
Sbjct  690   IHVLWLVNALTHVDESLRVDAAESLFLNPKTSSLPSHLELTLMKEAVPLNMRCCSTSFQM  749

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGS----PLNGEADQSLKHRAENLFN  1428
             KW SLFRKFF+RVRTALER  KQG+W+P  +K L G+    P  G  + ++K RA++LF+
Sbjct  750   KWGSLFRKFFARVRTALERQFKQGSWNP--LKHLKGNGEVCPSEGNRESTIK-RADDLFH  806

Query  1429  FMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYS-SEISLYPYSK  1605
             FM+WLSCFLFFSCYPSAPY+RKIMA +L+LIM+NVW +     +  S S SE  LYPYSK
Sbjct  807   FMRWLSCFLFFSCYPSAPYKRKIMATDLILIMINVWSIKSSIIEEFSNSLSENHLYPYSK  866

Query  1606  GLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSP  1785
             G+   +ST+LLVGSI+DSWDRLRESSF+ILLH+PTP+PGIS+ E+V + I WA KLVCSP
Sbjct  867   GMTSSDSTILLVGSIVDSWDRLRESSFQILLHYPTPLPGISTEEMVKKVIAWAMKLVCSP  926

Query  1786  RVRESDAGALTFRLIFRKYVLELGWVVRVSCNVV-TQSPSGLSNGENLEFTPSSPVIEYI  1962
             RVRESDAGALT RLIFRKY +E GW++    N+    S S L NG N     ++PVI Y+
Sbjct  927   RVRESDAGALTLRLIFRKYAMEQGWLIENPFNIFHLSSKSELVNGVNPSSKLTNPVILYL  986

Query  1963  TSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissikllle  2142
              S+IDWL   V  GE+DLS+ACK SFVHGVLL LRY FEE+DW+S AV+S+IS ++ LLE
Sbjct  987   KSMIDWLDIVVRGGEQDLSKACKNSFVHGVLLALRYAFEELDWNSDAVSSSISEMRYLLE  1046

Query  2143  kilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAK  2322
             ++L LV+RITSLALWVVSADA +LP++M+EM  D    LE P   +    + + E   +K
Sbjct  1047  RLLDLVVRITSLALWVVSADALHLPEDMDEMVEDDNLLLEVPDHENEHTPSSEYENNSSK  1106

Query  2323  AEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQ--LSSD  2496
                D    +QIVMVGCWLAMKEVSLLLGTIIRKVPLP++    S     D  D    +S 
Sbjct  1107  LSHDIRSSEQIVMVGCWLAMKEVSLLLGTIIRKVPLPSNASSDSSELEGDSVDTAGFASG  1166

Query  2497  IVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQ  2676
              VLDL QLE IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRL +LTESWMEQ
Sbjct  1167  SVLDLEQLETIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLHRLTESWMEQ  1226

Query  2677  LMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDk  2856
             LM+RTV+KGQ VDDLLRRSAGIPAAFTA FLSEPEG PK+LLP+ALRWLI+V   S+ ++
Sbjct  1227  LMQRTVAKGQLVDDLLRRSAGIPAAFTALFLSEPEGTPKKLLPRALRWLIDVGNGSMMNQ  1286

Query  2857  nkensscsesssAIDS------TMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDAN  3018
              + +S   E   +  S      T   +     M SK RDEGV+PTVHAFNVLKAAFND+N
Sbjct  1287  IESDSLKGEPCKSNGSMKENNCTQEAERNVRPMSSKIRDEGVIPTVHAFNVLKAAFNDSN  1346

Query  3019  LATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTG  3198
             L+TDTSGFSAEA+I+SIRSFSS YWE+RNSACLAYTAL+RRMIGFLNV KRES RRA+TG
Sbjct  1347  LSTDTSGFSAEAMILSIRSFSSPYWEIRNSACLAYTALLRRMIGFLNVHKRESVRRAITG  1406

Query  3199  LEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPI  3378
             LEFFHRYP+LH+FLFNEL++ATE     SS +L S     +HPSL P+LILLSRLKPS I
Sbjct  1407  LEFFHRYPSLHSFLFNELEVATEFLGPTSSGDLESIQGNNLHPSLYPILILLSRLKPSSI  1466

Query  3379  TSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAID  3558
               E GD  DPFL MP+IR+CS Q+NLR+R+LASRALT +VSNEKLP+V+L+IASELP ++
Sbjct  1467  AGERGDELDPFLLMPWIRRCSTQSNLRVRVLASRALTSLVSNEKLPSVLLSIASELPCVE  1526

Query  3559  NHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHS  3738
             N      +    +   S+N IHG+LLQLSSLL+ NC NLAD SKK+ I+ +LI +L   S
Sbjct  1527  N------IVKSGSYRISYNLIHGILLQLSSLLEVNCSNLADNSKKDHIIGELIEILMPRS  1580

Query  3739  WIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRP  3918
             WI  P +C CPILN +F++VLD ML+IARTC+++     I NLL  LS+ECLDL +  R 
Sbjct  1581  WIARPNQCRCPILNETFVRVLDLMLNIARTCQITVHFFSIRNLLLELSTECLDLESYGR-  1639

Query  3919  AYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQ  4098
              Y DPTIAELR+QAA SYF C +Q SK+  E   + L+   P ++   + E + + T   
Sbjct  1640  QYHDPTIAELREQAAISYFGCLFQASKNEEESIHLPLQYSLPSTKSLPKHEMENASTGIL  1699

Query  4099  ERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWL-SNIGLQAMLM  4275
             + LIR LSD+LYEVR+ATLKWLL FL + ES   +  + S  +I+++ L +   L   L 
Sbjct  1700  DMLIRCLSDSLYEVRLATLKWLLKFLKAVES-GGKLCDLSIDDIRVIQLWAKTNLHGTLE  1758

Query  4276  QLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPT---FVGNMDSDSVLQFWDKVVS  4446
             ++LA EKNH+C  YIL+I+ ++N+ Q+ K    H+K T   +VG MD DSV QFW+K+VS
Sbjct  1759  KILASEKNHRCTYYILRILVSWNLLQFEK--ASHDKCTGTSYVGEMDFDSVSQFWNKLVS  1816

Query  4447  LYKVTRHAKTREMLVCCMAVCIKRLADLF-TSSICSLGNEKVVVVNPSDPSKLSVFSECI  4623
             LY  TRHAKTRE LV C+ VC KR+  LF TSS  S   E +VV +  +   LS   +CI
Sbjct  1817  LYDQTRHAKTRETLVYCLGVCAKRITMLFATSSFPS--KEGMVVCSEINQEMLSWLFDCI  1874

Query  4624  DYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGNK-----QK  4788
              +F  +I+E    +EP +MR AAA S++ASG+L QA+ L   V N  +P  +        
Sbjct  1875  VFFCNMIKECGSPTEPTSMRHAAAGSLIASGILKQARFLGSVVYNKNIPSASSSSCFVNN  1934

Query  4789  DALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEK  4968
             + ++ YAH +L+ WFTC+KLLEDEDD +R +LS +VQ   TS ++GS+  + VVPIQV++
Sbjct  1935  EGVNSYAHHVLNAWFTCIKLLEDEDDSVRLRLSSDVQMYFTSERTGSNLPNEVVPIQVDR  1994

Query  4969  VIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSI-ADPVRRVFDKEIDNHHEEKL  5145
             VI   F HLSS FGHW+DY ++LC WV  A N+   VS   D VRRVFDKEIDNH+EEKL
Sbjct  1995  VIRFCFNHLSSIFGHWIDYFNYLCQWVLQAENN---VSFQGDLVRRVFDKEIDNHYEEKL  2051

Query  5146  LISQICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIG  5325
             LISQICCS++EKLP+ K  T    + + S L  WR RF +QL+S+ +  I  Q   DWIG
Sbjct  2052  LISQICCSNMEKLPILKAWTN--KDELRSYLHGWRSRFSRQLVSYVDNIIEKQEWNDWIG  2109

Query  5326  GVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEAIQPFLRNPLISNL  5505
             GVGNHKD FLPVY NLL F+ALSNCI      +   ++ +++ LG +I PFLRNPLISNL
Sbjct  2110  GVGNHKDTFLPVYSNLLGFYALSNCIFTVSDNNDAKLLSDVVVLGRSINPFLRNPLISNL  2169

Query  5506  FVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLF  5622
             + LV++SHEKI    V+  +      +S WD+F+PYFL 
Sbjct  2170  YRLVIQSHEKILTNDVDKRLFPEMENHSEWDSFNPYFLL  2208



>ref|XP_007151222.1| hypothetical protein PHAVU_004G028000g [Phaseolus vulgaris]
 gb|ESW23216.1| hypothetical protein PHAVU_004G028000g [Phaseolus vulgaris]
Length=2177

 Score =  2110 bits (5467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1113/1899 (59%), Positives = 1390/1899 (73%), Gaps = 68/1899 (4%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             G+LTAVSR +LN  F        G+G        +KT+LYDG+L ELC FCE+P DSHFN
Sbjct  321   GVLTAVSRDLLNAHF-------SGVGG-------IKTVLYDGVLPELCRFCENPVDSHFN  366

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIK S+          Y+PI EE+G RVL+I+WNNLEDPLSQTVKQVH
Sbjct  367   FHALTVMQICLQQIKASLLAGLTDFSGEYEPIPEEMGVRVLRIIWNNLEDPLSQTVKQVH  426

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDIQ +L   +G  +   FL KI +DLL +G RCKGRYIPLA LTKRLGA+ +L
Sbjct  427   LIFDLFLDIQSSL--CKGGGRIKEFLVKIGTDLLSMGSRCKGRYIPLALLTKRLGARKML  484

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             +M+P LLF+TT+AYVDDDVC A T+FLKCFLECLRDE+W +DG+EGGY  YR HC+ P+L
Sbjct  485   EMTPDLLFETTQAYVDDDVCCAVTSFLKCFLECLRDEFWESDGIEGGYALYRGHCIPPVL  544

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL SG +KLR+NLNTYALPVLLE+DVDSIFPML FI +G S +   + Y E+ S D+ +
Sbjct  545   YGLGSGLSKLRTNLNTYALPVLLEVDVDSIFPMLSFISVGPSGDENRLQYTEVVSMDMEV  604

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              +EQR+A+LVSLLKVSR LAL+EGDIDW E  S   +   L  ++    ++V +KGI V+
Sbjct  605   NLEQRIAILVSLLKVSRSLALVEGDIDWAEDPSANEKEPGLGIES---HAIVCIKGINVR  661

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             I   +L+ ALTH+D+SLR+DAAESLF+NPKTASLPS LEL+LM++AVPLNMRCC +AFQM
Sbjct  662   IHFQWLVNALTHVDESLRVDAAESLFLNPKTASLPSHLELTLMKEAVPLNMRCCFSAFQM  721

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHP-SLIKCLSGSPLNGEADQSLKHRAENLFNFMK  1437
             KW+SLFRKFFSRVRTALER  KQG W+P    K     P  G   +S   RA++LF+FM+
Sbjct  722   KWSSLFRKFFSRVRTALERQFKQGNWNPLDHTKGNEVYPSKGNDKESTIKRADDLFHFMR  781

Query  1438  WLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEIS---LYPYSKG  1608
             WLS FLFFSCYPSAPY+RKIMAM+L+LIM+NVW +      S+ ++S +S   LYPY+KG
Sbjct  782   WLSGFLFFSCYPSAPYKRKIMAMDLVLIMINVWSI--KSSISEEFNSSLSVSDLYPYNKG  839

Query  1609  LILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPR  1788
             +   +STLLLVGSI+DSWDRLRE+SF ILLHFP+P+PGIS+ + + + I  + +LVCSPR
Sbjct  840   MTSSDSTLLLVGSIVDSWDRLRENSFHILLHFPSPLPGISNEDTLKKLIASSVQLVCSPR  899

Query  1789  VRESDAGALTFRLIFRKYVLELGWVVRVSCNVV-TQSPSGLSNGENLEFTPSSPVIEYIT  1965
             VRESDAGAL+ RLIF+KYVLELGW++  S NVV   S S L+N  +      +PVI Y+ 
Sbjct  900   VRESDAGALSLRLIFKKYVLELGWLIEDSLNVVHLSSKSELANEVSKSNKSRNPVIIYLK  959

Query  1966  SLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllek  2145
             S+IDWL AAV +GE+DLS+ACK SFVHGVLL LRYTFEE+DW+S  ++S+I  ++ LLE+
Sbjct  960   SMIDWLDAAVRDGEQDLSKACKNSFVHGVLLALRYTFEELDWNSDGLSSSILELRYLLER  1019

Query  2146  ilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKA  2325
             +L LV+RITSLALWVVSADAW+LP++M+EM  +    +E P +  + +S  ++      +
Sbjct  1020  LLDLVVRITSLALWVVSADAWHLPEDMDEMLDEDNLLMEIPYDEHMPSSECENNNS-KPS  1078

Query  2326  EQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVL  2505
               DD   +QIVMVGCWLAMKEVSLLLGTIIRKVPLP  +     S++   +   SSD VL
Sbjct  1079  HDDDRSSEQIVMVGCWLAMKEVSLLLGTIIRKVPLPR-NASSDLSELEGHSVDFSSDSVL  1137

Query  2506  DLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLME  2685
             D+ QL+ IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSND RL ++TESWMEQLM+
Sbjct  1138  DMEQLKTIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDSRLHRMTESWMEQLMQ  1197

Query  2686  RTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknke  2865
             RTV+KGQ VDDLLRRSAGIPAAF A FLSEPEG PK+LLP+ALRWLI+V   S+ ++ K 
Sbjct  1198  RTVAKGQVVDDLLRRSAGIPAAFIALFLSEPEGTPKKLLPRALRWLIDVGNGSMLNEIKS  1257

Query  2866  nsscsesssAIDS------TMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLAT  3027
             NS   +   + DS      T   +       SK RDEGV+PTVHAFNVL+AAFND+NLAT
Sbjct  1258  NSLNGDPCKSKDSAHGNNSTWAAERNVNLTSSKIRDEGVIPTVHAFNVLRAAFNDSNLAT  1317

Query  3028  DTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEF  3207
             DTSGF+AEALI+SIRSFSS YWE+RNSACLAYTALVRRM+GFLNV KRESARRA+TGLEF
Sbjct  1318  DTSGFAAEALILSIRSFSSPYWEIRNSACLAYTALVRRMVGFLNVHKRESARRAITGLEF  1377

Query  3208  FHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSE  3387
             FHRYP+LH+FLFNEL++ATE     SS +L S     +HPSL P+LILLSRLKPS I  E
Sbjct  1378  FHRYPSLHSFLFNELEVATEFLGCASSGDLESIRGNNLHPSLYPILILLSRLKPSSIAGE  1437

Query  3388  TGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHS  3567
             TGD  DPFLFMP+IR+CS Q+NLR+R+LASRALT +VSNEKLP V+ NI  ELP +D   
Sbjct  1438  TGDELDPFLFMPWIRRCSTQSNLRVRVLASRALTSIVSNEKLPPVLHNIIFELPCVDK-L  1496

Query  3568  MTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIG  3747
             + SD     +   SFN IHG+LLQLS+LLD N RNLAD SKK+ I+ +LI +L   SWI 
Sbjct  1497  IKSD-----SFPISFNFIHGILLQLSALLDINFRNLADNSKKDHIIGELIQILLLRSWIA  1551

Query  3748  SPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYF  3927
              P  CPCPILN +FL+VLD ML++ARTC++SK    I  LL  LS+ECLDL  S   +Y+
Sbjct  1552  RPTHCPCPILNETFLRVLDQMLNMARTCQISKHFRSISKLLLELSTECLDL-ESHSLSYY  1610

Query  3928  DPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPP--PDSELFKESETQMSVTRFQE  4101
             DPTIA+LR+QAA SYF C +    D  EE++I +R     P  E F E E + +     +
Sbjct  1611  DPTIAKLREQAAISYFGCFFHAPMD--EEEIINMRQRHVLPSLESFPEDEMENTSLGLLD  1668

Query  4102  RLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWL-SNIGLQAMLMQ  4278
             RLI  LSD+ YEVR+ATLKWLL FL + E    +  +  +++I+ + L +   L   L+ 
Sbjct  1669  RLICCLSDSSYEVRLATLKWLLKFLKASEP-CGKVHDLFRNDIRAVHLWAKTNLHGTLVN  1727

Query  4279  LLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPT---FVGNMDSDSVLQFWDKVVSL  4449
             +LA EK+H+C NYILKII  +N+ Q+ K     +K T   +VG MD D+ LQFW+++VSL
Sbjct  1728  ILASEKHHRCTNYILKIIVAWNLLQFEK--ASQDKCTGTSYVGEMDFDAALQFWNELVSL  1785

Query  4450  YKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECIDY  4629
             YK  RHAKT++ LV C+ VCIKR+  LF SSI      +  V        L    +CI +
Sbjct  1786  YKQARHAKTQQSLVRCLGVCIKRITMLFASSILPNDAIEFSVCGEIHEEMLVRLFDCIVF  1845

Query  4630  FVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGNK----QKDAL  4797
             F  +I++ S +SEP +MR AAA+S++ASGLL+QA  +   VSN Q+P G      + +A+
Sbjct  1846  FCNMIKQCSSSSEPASMRYAAAESLIASGLLEQAGLIGSFVSNKQIPLGTSSFFVRNEAM  1905

Query  4798  HLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIE  4977
             + YAH++LD+WFTC+KLLEDEDD +R +LS +VQKC T+GK+ S+ + G+VPIQV++VI 
Sbjct  1906  NSYAHQVLDVWFTCIKLLEDEDDSVRLRLSSDVQKCFTTGKTRSNHTPGLVPIQVDRVIR  1965

Query  4978  MSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNHHEEKLLISQ  5157
             + F+HLSS FGHW+DY D+LC WV  A   +C     D VRRVFDKEIDNH+EEKLLISQ
Sbjct  1966  LCFDHLSSIFGHWIDYFDYLCQWVLRA--ESCVAPQGDLVRRVFDKEIDNHYEEKLLISQ  2023

Query  5158  ICCSHLEKLPVSKL---TTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGG  5328
             ICCS++EKLP+ K      EFR     S L  WR RF  QL+S+   +IG   G DWIGG
Sbjct  2024  ICCSNMEKLPILKSWADKDEFR-----SYLHEWRARFSHQLVSYAEDHIGKHEGNDWIGG  2078

Query  5329  VGNHKDAFLPVYVNLLAFHALSNCI-LRGEAEDSKSMVPELLELGEAIQPFLRNPLISNL  5505
             VGNHKDAFLP+Y NLL F+ALSNCI L     D+K ++ +++ LG AI PFLRNPLISNL
Sbjct  2079  VGNHKDAFLPLYANLLGFNALSNCIFLACSNNDAKLLLSDVVVLGRAINPFLRNPLISNL  2138

Query  5506  FVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLF  5622
             F LVV+SHEK+AG      + E+    S WD+F+PYFL 
Sbjct  2139  FKLVVESHEKMAGDVAYGFLPEMRNC-SIWDSFNPYFLL  2176



>ref|XP_004163531.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101204483 
[Cucumis sativus]
Length=2186

 Score =  2108 bits (5462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1122/1906 (59%), Positives = 1384/1906 (73%), Gaps = 65/1906 (3%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPG--NNDSSVKTILYDGILSELCNFCEHPTDSH  174
             GILTA+ R VLNI F +     D  G+PG  N+ +SVKTILYDGIL ELCN+CE+PTDSH
Sbjct  315   GILTAIPRPVLNIPFSMVEG--DSNGHPGCLNSGNSVKTILYDGILPELCNYCENPTDSH  372

Query  175   FNFHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQ  354
             FNFH+LTV+QICLQQIKTS+          YDP+ EE+G+R+L I+W NL+DPLSQTVKQ
Sbjct  373   FNFHSLTVLQICLQQIKTSLVSNLTDTSCSYDPLPEEMGSRILSIMWTNLDDPLSQTVKQ  432

Query  355   VHLIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKS  534
             VHLIFDLFL+IQ +L W+EGSEK   FLRKIA DLL LG RCKGRY+PLASLTKRLGAK+
Sbjct  433   VHLIFDLFLEIQSSLCWSEGSEKIKLFLRKIAFDLLRLGSRCKGRYVPLASLTKRLGAKT  492

Query  535   ILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLP  714
             +LDMSP LL +T +AY+DDDVC AAT+FLKCFLE LRDE WS+DG+EGGY  YR HCL P
Sbjct  493   LLDMSPSLLSETVQAYIDDDVCCAATSFLKCFLEHLRDECWSSDGIEGGYAIYRGHCLPP  552

Query  715   ILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDI  894
             +L GL SG +KLRSNLNTYALPVL E+D+DSIFPML FI +  S+    I YP  +   +
Sbjct  553   VLHGLGSGISKLRSNLNTYALPVLFEVDLDSIFPMLAFISVWPSSRDNGILYPGNNQGSM  612

Query  895   VLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIE  1074
              L VE+RVA+ +SLLKVSR LALIEGDIDW E  S+               ++V VKG++
Sbjct  613   ELRVEKRVAIFISLLKVSRSLALIEGDIDWLEKPSLDRY------------ALVFVKGVK  660

Query  1075  VKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAF  1254
             V+I V +LLLALTH+D++LR+DAAE LF+NPKT+SLPS LEL+L++KA+PLNMRC STAF
Sbjct  661   VEILVEWLLLALTHVDETLRVDAAEFLFLNPKTSSLPSHLELTLLKKAIPLNMRCTSTAF  720

Query  1255  QMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFM  1434
             QMKW+SLFRKFFSRVRTALER  K G W P    C   S +    +Q +  RA++LF FM
Sbjct  721   QMKWSSLFRKFFSRVRTALERQFKLGNWIPLASCCNRESYMPNGNEQIVAGRADDLFQFM  780

Query  1435  KWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLI  1614
             KWLSCFLFFSCYPSAPY RKIMAM+L L+MLNVW ++P + K +    E  L PY++G+ 
Sbjct  781   KWLSCFLFFSCYPSAPYRRKIMAMDLFLVMLNVWSIVPSKEKCN----ETLLLPYNEGIT  836

Query  1615  LPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVR  1794
             LP+S LLLV SIIDSWDRLRE+SFRILLHFPTP+PGIS   +V + I WAK LVCS RVR
Sbjct  837   LPDSVLLLVVSIIDSWDRLRENSFRILLHFPTPLPGISGEYMVGKIIKWAKVLVCSSRVR  896

Query  1795  ESDAGALTFRLIFRKYVLELGWVVRVSCNVVT-QSPSGLSNGENLEFTPSSPVIEYITSL  1971
             ESDAGAL  RL+FRKYVL+LGW+VR S  VV   S + L N +      + PV EY+ SL
Sbjct  897   ESDAGALALRLVFRKYVLDLGWIVRASDAVVCLDSVNKLPNVDKEICKSNHPVAEYLKSL  956

Query  1972  IDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekil  2151
             IDWL  +V EGE +LSEACK SFVHGVLLTLRY+FEE+DW+S  V S+IS ++ LLEK+L
Sbjct  957   IDWLNVSVTEGEINLSEACKNSFVHGVLLTLRYSFEELDWNSDVVLSSISEMRSLLEKLL  1016

Query  2152  alVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQ  2331
              LVMRITSLALWVVSADAW+LP++M++M  D A  L+ P E +VS S  +   ++ K  Q
Sbjct  1017  ELVMRITSLALWVVSADAWHLPEDMDDMVDDDAFVLDVPDETNVSTSFSELGRQVRKKLQ  1076

Query  2332  DDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQL--SSDIVL  2505
                  +Q VMVGCWLAMKEVSLLLGTI RKVPLP +    S S  +D  D +    + VL
Sbjct  1077  TIQTSEQTVMVGCWLAMKEVSLLLGTITRKVPLPAA----SDSFESDPNDSIMPRQEEVL  1132

Query  2506  DLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPR-LCKLTESWMEQLM  2682
             D++QL+IIG+HFLEVLLKMKHNGAIDKTRAGFTALCNRLLCS+D   LCKLTESWM+QLM
Sbjct  1133  DVKQLKIIGDHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSDDQGILCKLTESWMDQLM  1192

Query  2683  ERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknk  2862
             ERT +KGQTVDDLLRRSAGIPAAF A FL+EPEG+PK+LLP+AL+WLI+VA++ L +  +
Sbjct  1193  ERTTAKGQTVDDLLRRSAGIPAAFIALFLAEPEGSPKKLLPRALKWLIDVAERLLQNPIE  1252

Query  2863  ensscsesssAIDSTMVPDVAAI--------EMISKTRDEGVVPTVHAFNVLKAAFNDAN  3018
              +   S  S    + +  D   I        E  SK RDEGV+PTVHAFNVL+AAFND N
Sbjct  1253  TDCKNSNFSKLPSTGLSQDTEPISTHETYPSEKASKIRDEGVIPTVHAFNVLRAAFNDTN  1312

Query  3019  LATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTG  3198
             LATDTSGFSA+A+IV IRSFSS YWEVRNSACLAYTALVRRMIGFLNV KRESARRALTG
Sbjct  1313  LATDTSGFSAQAIIVCIRSFSSPYWEVRNSACLAYTALVRRMIGFLNVHKRESARRALTG  1372

Query  3199  LEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPI  3378
             LEFFHRYP LH FL  EL +ATE   +G S +  SNLAKVVHPSLCPMLILLSRLKPS I
Sbjct  1373  LEFFHRYPALHRFLLQELDVATESLDDGCSGDSKSNLAKVVHPSLCPMLILLSRLKPSTI  1432

Query  3379  TSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAID  3558
              SE GD  DPFLFMPFIRKCS Q+NLR+RILASRALTG+VSNE LP+VILNIAS LP  D
Sbjct  1433  GSEAGDDLDPFLFMPFIRKCSSQSNLRVRILASRALTGLVSNENLPSVILNIASGLPVDD  1492

Query  3559  NHSMTSD----LSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVL  3726
             + +M  +    L+  +    S+N IHG+LLQL SLLD NCRNL D  KK  IL+DL+ VL
Sbjct  1493  STTMGRESSILLATATTQYTSYNRIHGILLQLISLLDINCRNLGDILKKSQILNDLVEVL  1552

Query  3727  GKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYT  3906
                SW+     C CPIL+ S L+VL +MLSI R C  SK   VI NLL  LS+ CLD+ T
Sbjct  1553  AHCSWMARSSHCSCPILSTSMLQVLGHMLSIVRKCPRSKSFYVIRNLLLDLSTGCLDVET  1612

Query  3907  SKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSV  4086
             S +  Y+DPT+AELR+QAA  YFNC  Q   + ++  L   +    D ++   +      
Sbjct  1613  SHKLPYYDPTLAELRQQAAICYFNCVLQPFDEEDDATLQKSQRSQSDEDV-PATLMDYPF  1671

Query  4087  TRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLL--WLSNIGL  4260
             ++ QERLIRSL D  YEVR++T+KWL  FL S E  +A   + S  EI+ +  W+    L
Sbjct  1672  SQLQERLIRSLQDPCYEVRLSTMKWLFKFLKSTE-YSAGLYDLSCHEIRTVDQWIKT-NL  1729

Query  4261  QAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNK--NCGQHEKPTFVGNMDSDSVLQFWD  4434
             QA+L +LL++EKN++C+ YILK ++ +NM Q+ K  N    E   ++G MD  SVLQFWD
Sbjct  1730  QALLTELLSLEKNYRCLYYILKNLFAWNMSQFQKFGNGECTEDVVYIGKMDCGSVLQFWD  1789

Query  4435  KVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDP--SKLSV  4608
             K++SLYK+TRHAKTRE  + CM  CIKRLA  +++ I S   +     +P+    + L  
Sbjct  1790  KLISLYKLTRHAKTRENTIRCMGTCIKRLAVQYSACIVS---DATTTESPNGKISNNLDK  1846

Query  4609  FSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDG----  4776
             F  CI  F ++I++HS ASEP+NMR AAA SI+ASGLL+QA+     V ++Q+P      
Sbjct  1847  FHSCITLFTDLIKQHSAASEPVNMRTAAADSIIASGLLEQAEIFGDYVFDNQIPQATVNS  1906

Query  4777  -NKQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVP  4953
              ++ ++  ++YAH+IL++W TC+ LLEDEDD +RK+L+ +VQK  +  ++    +S  VP
Sbjct  1907  HSELREYANMYAHQILNMWSTCIMLLEDEDDDIRKRLAADVQKYFSLERTT---TSSDVP  1963

Query  4954  IQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNHH  5133
              QVE+VI  SFE+LSS FGHW+ Y D+L +WV +  +    VS ADPVRRVFDKEIDNHH
Sbjct  1964  NQVEQVIGSSFEYLSSIFGHWVLYFDYLANWVLNTADY--TVSPADPVRRVFDKEIDNHH  2021

Query  5134  EEKLLISQICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGV  5313
             EEKLLISQ CC H+EKL  SKL   +      + L   R+RF  QLI F + Y+    G 
Sbjct  2022  EEKLLISQTCCFHMEKLSRSKLIALWDTQWFMNYLVGLRKRFFLQLIRFADEYMSKHSGF  2081

Query  5314  DWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAE--DSKSMVPELLELGEAIQPFLRN  5487
             DWIGG GNHKDAFLP+Y NLL F+A+SNCI+ G+++    + ++ E++E+G+ I PFLRN
Sbjct  2082  DWIGGAGNHKDAFLPLYTNLLGFYAISNCIVNGKSKVVTMQPLITEVVEIGKIINPFLRN  2141

Query  5488  PLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             PLISNL++LV + HE+      +H + E  G  + W+ FDPYFL R
Sbjct  2142  PLISNLYLLVTRIHEEAIDVNRDHNIPE-RGHEAIWEGFDPYFLLR  2186



>gb|KEH24998.1| death receptor interacting protein, putative [Medicago truncatula]
Length=2197

 Score =  2106 bits (5457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1121/1900 (59%), Positives = 1387/1900 (73%), Gaps = 54/1900 (3%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSR +LN  F V N         G+N    KTILYDGIL ELC  CE P DSHFN
Sbjct  325   GILTAVSRNLLNTQFDVVNGCEARDNGVGSNK---KTILYDGILPELCRHCESPVDSHFN  381

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIKT M      +   YDPI EE+  R+L+I+WNNLED LSQTVKQVH
Sbjct  382   FHALTVMQICLQQIKTLMLSNLTDMSGDYDPIPEEMVMRILRIIWNNLEDSLSQTVKQVH  441

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLF+DIQ +L W+ G E+   FL KIA+DLL LG RCKGRYIPLA LTKRLGAK +L
Sbjct  442   LIFDLFMDIQSSLRWSVGGEQIKGFLGKIAADLLSLGSRCKGRYIPLALLTKRLGAKKML  501

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DM P LLF+T  AYVDDDVC AAT+FLKCFLE LRDE W TDG+EGGY  YR +CL P+L
Sbjct  502   DMCPDLLFETIHAYVDDDVCCAATSFLKCFLEYLRDECWETDGIEGGYALYRGYCLPPVL  561

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SGF+K R+N+NTYALP+LLE+DVDSIFPML F+ +G   +   + YP +   ++ L
Sbjct  562   YGLASGFSKHRTNINTYALPILLEIDVDSIFPMLAFVSVGPDGDEKGLQYPGIVCSNLEL  621

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              +EQ++A+LVSLLKVSR LAL+EGDIDWCE  S   E  ++ T +    ++V +KGI+ K
Sbjct  622   NLEQKIAILVSLLKVSRSLALVEGDIDWCESPSTNEEKREIGTQS---HALVCIKGIDFK  678

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             I V +L+ ALTH+D+SLR+DAAESLF+NPKT+SLPS LEL+L+++AVPLNMRCCST+FQM
Sbjct  679   IRVLWLVNALTHVDESLRVDAAESLFLNPKTSSLPSHLELTLLKEAVPLNMRCCSTSFQM  738

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHP-SLIKCL-SGSPLNGEADQSLKHRAENLFNFM  1434
             KW SLFRKFFSRVRTALER  KQG+W+P   IKC     PL+G  + ++K RA++LF+FM
Sbjct  739   KWGSLFRKFFSRVRTALERQFKQGSWNPLERIKCSEEARPLDGNKELTMK-RADDLFHFM  797

Query  1435  KWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKS-DSYSSEISLYPYSKGL  1611
             +WLS FLFFSCYPSAPY+RKIMA +L+LIM+N W +     +  D++ SE  LYPYSKG+
Sbjct  798   RWLSGFLFFSCYPSAPYKRKIMATDLILIMINTWSIKSSIVEEFDNFVSENHLYPYSKGM  857

Query  1612  ILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRV  1791
                +STLLLV SI+DSWDRLRES+F+ILLH+P P+PGISS  ++ + I WA KLVCSPRV
Sbjct  858   TSSDSTLLLVASIVDSWDRLRESAFQILLHYPNPLPGISSEHMLKKVIAWAMKLVCSPRV  917

Query  1792  RESDAGALTFRLIFRKYVLELGWVVRVSCNV-VTQSPSGLSNGENLEFTPSSPVIEYITS  1968
             RESDAGALT RLIFRKY ++LGW++    ++    S S L NG N      +PVI Y+ S
Sbjct  918   RESDAGALTLRLIFRKYAIDLGWLIEDPFHISYLSSKSELVNGVNQSSKSKNPVILYLKS  977

Query  1969  LIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissikllleki  2148
             +IDWL   V  GE+DL++ACK SFVHGVLL LRY FEE++W+S   +S+IS ++ LLE++
Sbjct  978   MIDWLDVVVRGGEQDLTKACKNSFVHGVLLALRYAFEELNWNSDVTSSSISEMRYLLERL  1037

Query  2149  lalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAE  2328
             L LV+RITSLALWVVSADAW+LP++M+EM  D    LE P   +    + + E   +K  
Sbjct  1038  LDLVVRITSLALWVVSADAWHLPEDMDEMVDDDNLLLEVPDHENEHTPSSEYENNNSKPS  1097

Query  2329  QDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPT--SDVPKSCSQITDGTDQLSSDIV  2502
              D+   +QIVMVGCWLAMKEVSLLLGTI+RKVPLP   SD  +      D  D  SSD V
Sbjct  1098  HDNRASEQIVMVGCWLAMKEVSLLLGTIVRKVPLPNACSDSSELEGASIDTVD-CSSDSV  1156

Query  2503  LDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLM  2682
             LDL QLE IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRL +LTESWMEQLM
Sbjct  1157  LDLEQLETIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLHRLTESWMEQLM  1216

Query  2683  ERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknk  2862
             +RTV+KGQ VDDLLRRSAGIPAAFTA FLSEPEG PK+LLP+ALRWLI+V   S+ ++ +
Sbjct  1217  QRTVAKGQVVDDLLRRSAGIPAAFTALFLSEPEGTPKKLLPRALRWLIDVGNGSMLNQIE  1276

Query  2863  enss------csesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLA  3024
              +SS       + S    +ST   +  A EM SK RDEGV+PTVHAFNVLKAAFND+NL+
Sbjct  1277  SDSSKDNLCKSNGSMKENNSTQEAERNAREMSSKIRDEGVIPTVHAFNVLKAAFNDSNLS  1336

Query  3025  TDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLE  3204
             TDTSGFSAEA+I+SIRSFSS YWE+RNSACLAYTALVRRMIGFLNV KRESARRA++GLE
Sbjct  1337  TDTSGFSAEAMILSIRSFSSPYWEIRNSACLAYTALVRRMIGFLNVHKRESARRAISGLE  1396

Query  3205  FFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITS  3384
             FFHRYP+LH+FLFNEL++ATE     SS +L S     +HPSL P+LILLSRLKPS I  
Sbjct  1397  FFHRYPSLHSFLFNELEVATEFLGPTSSGDLESIRGNNLHPSLYPILILLSRLKPSSIAG  1456

Query  3385  ETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNH  3564
             E GD  DPFL MP+IR+CS Q+NLR+R+LASRALT +VSNEKL +V+L+IASELP ++N 
Sbjct  1457  ERGDELDPFLLMPWIRRCSTQSNLRVRVLASRALTSLVSNEKLSSVLLSIASELPCVEN-  1515

Query  3565  SMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWI  3744
                SD SG   +  S+N IHG+LLQLS LL+ NC NLAD SKK D++ +LI +L + SWI
Sbjct  1516  ---SDKSGSHGI--SYNLIHGILLQLSYLLEVNCSNLADNSKK-DLIGELIQILTQRSWI  1569

Query  3745  GSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAY  3924
             G P +C CPILN +F+KVLD ML+IARTC +++    I NLL  LS+ECLDL +  +P Y
Sbjct  1570  GRPTQCRCPILNETFIKVLDQMLNIARTCHVTQQFLTIRNLLLELSTECLDLESYGQP-Y  1628

Query  3925  FDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIY--LRGPPPDSELFKESETQMSVTRFQ  4098
             +D TIAELR+QAA SYF C +Q SK  NEE+ I+  LR   P ++   + E + + +   
Sbjct  1629  YDATIAELREQAAISYFGCLFQASK--NEEESIHSPLRHSLPSAKSLPKHEMEDASSGIL  1686

Query  4099  ERLIRSLSDALYEVRIATLKWLLLFLNSPES--RTAESSNKSQSEIKLLWLSNIGLQAML  4272
              RLIR +SD+LYEVR+ATLKWLL FL + ES  +  + S    S I L  ++N  L   L
Sbjct  1687  HRLIRCMSDSLYEVRLATLKWLLKFLKAAESDGKLCDLSIDHISVIHLWAITN--LHGTL  1744

Query  4273  MQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPT---FVGNMDSDSVLQFWDKVV  4443
             +++LA EKNHKC  YIL+I+  +N+ Q+ K    HEK T   +VG MD DSV QFW+ +V
Sbjct  1745  VKILASEKNHKCKYYILRILVAWNLLQFEK--ASHEKCTDTSYVGEMDFDSVSQFWNDLV  1802

Query  4444  SLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECI  4623
             SLY  TRHAKTRE LV C+ VC KR+  LF SS  S    + VV    +   LS   +CI
Sbjct  1803  SLYNQTRHAKTRETLVYCLGVCTKRITMLFASSFPSNKGMEFVVCGEMNQDMLSWLFDCI  1862

Query  4624  DYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGNK-----QK  4788
              YF  +I++ S  SE  +MR AAA S++ASG+L QA  L   V N  +P         + 
Sbjct  1863  VYFCNMIKQCSSPSEQTSMRHAAAGSLIASGILGQATLLGSIVYNDHIPSATSSPCFVKN  1922

Query  4789  DALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEK  4968
              +L+ YAH +L+ WFTC+KLLEDEDD +R  LS +VQK  TS ++GS+    +VPIQV++
Sbjct  1923  GSLNSYAHHVLNEWFTCIKLLEDEDDSVRLSLSSDVQKYFTSERTGSNVPHELVPIQVDR  1982

Query  4969  VIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSI-ADPVRRVFDKEIDNHHEEKL  5145
             VI   F+HLSS FGHW+DY ++LC WV  A ++   VS   D VRRVFDKEIDNH+EEKL
Sbjct  1983  VIRFCFDHLSSIFGHWIDYFNYLCQWVLQAESN---VSFEGDLVRRVFDKEIDNHYEEKL  2039

Query  5146  LISQICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIG  5325
             LISQICCS++EKLP+ K   +   + +   L  WR RF +QL+S+       Q  +DWIG
Sbjct  2040  LISQICCSNMEKLPILKSWAD--KDELVRYLHGWRSRFSRQLVSYAENITEKQEKIDWIG  2097

Query  5326  GVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEAIQPFLRNPLISNL  5505
             GVGNHKD FLPVY NLL F+ALSNCI      +   ++ +L+ LG AI PFLRNPL+SNL
Sbjct  2098  GVGNHKDTFLPVYANLLGFYALSNCIFIVSDNNDAELLSDLVVLGRAINPFLRNPLVSNL  2157

Query  5506  FVLVVKSHEKIAGGAV-EHLVLEISGAYSAWDAFDPYFLF  5622
             + LV+KSHEK+    V  +L+LE+ G +S WD+F+PYFL 
Sbjct  2158  YKLVLKSHEKVMTDDVASNLLLEM-GNHSVWDSFNPYFLL  2196



>ref|XP_008348070.1| PREDICTED: thyroid adenoma-associated protein homolog isoform 
X2 [Malus domestica]
Length=1810

 Score =  2100 bits (5442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1099/1828 (60%), Positives = 1342/1828 (73%), Gaps = 66/1828 (4%)
 Frame = +1

Query  259   EGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVHLIFDLFLDIQGTLHWAEGSEKFCSFL  438
             E YDPI  E+GTR+L+IVWNNLEDPLSQTVKQVHLIFDLFLDI+ TLHW+EGSE+  SFL
Sbjct  10    EDYDPIPVEMGTRILRIVWNNLEDPLSQTVKQVHLIFDLFLDIRSTLHWSEGSERIRSFL  69

Query  439   RKIASDLLHLGPRCKGRYIPLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTF  618
             + IASDLL LGPRCKGRY PL SLT RLGAK++LDMSPGLLFDT  AY+DDDVC A T+F
Sbjct  70    QSIASDLLRLGPRCKGRYXPLGSLTXRLGAKTMLDMSPGLLFDTIHAYIDDDVCCALTSF  129

Query  619   LKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPILSGLSSGFAKLRSNLNTYALPVLLELD  798
             LK  LE LR+E WS+DGVEGGY  YR HCL PIL GL+SG +KLRSNLNTYALP+LLE+D
Sbjct  130   LKILLEDLRNECWSSDGVEGGYALYRGHCLPPILXGLASGVSKLRSNLNTYALPILLEVD  189

Query  799   VDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVLGVEQRVAVLVSLLKVSRMLALIEGDI  978
              DSIF ML FI +G S   +++ YPEL   ++   V+Q+VA+LVSLLKVSR+LAL+EGDI
Sbjct  190   EDSIFAMLAFISVGPSKGESQLSYPELCRGNMEPRVQQKVAILVSLLKVSRLLALLEGDI  249

Query  979   DWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLF  1158
             D+    +V      L T+     ++V +KGI+V++ V +L+LALTH+DDSLR+DAAE+LF
Sbjct  250   DY----AVRENFGGLETNFPERHALVSIKGIKVEVRVEWLVLALTHVDDSLRVDAAETLF  305

Query  1159  INPKTASLPSSLELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTW  1338
             +NPKTASLPS LEL L+++AVPLNMRCCSTAFQMKW+SLFRKFF+RVRTALER  KQG W
Sbjct  306   LNPKTASLPSHLELMLLKEAVPLNMRCCSTAFQMKWSSLFRKFFARVRTALERQFKQGRW  365

Query  1339  HPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELML  1518
              P      +G  L+  ++ +  +RA +LF FM+WLS FLFFSCYPSAPY+RKIMAMEL+L
Sbjct  366   EPLEHSNSNGMHLSIGSEHTEANRASDLFCFMRWLSSFLFFSCYPSAPYKRKIMAMELIL  425

Query  1519  IMLNVWHMLPP-QGKSDSYSSEISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRIL  1695
             IMLNVW ++P  Q K+ S   E  LYPY++G+ LP+STLLLVGSIIDSWDRLRE+SFRIL
Sbjct  426   IMLNVWSIVPATQEKNGSLCVEDXLYPYNRGMTLPDSTLLLVGSIIDSWDRLRENSFRIL  485

Query  1696  LHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVS  1875
             LHFPTP+PGIS   +V   I+WAKKLVCSPRVRE+DAGALT RLIFRKYVL+LGW VR S
Sbjct  486   LHFPTPLPGISDQGMVQXVILWAKKLVCSPRVRETDAGALTLRLIFRKYVLQLGWTVRAS  545

Query  1876  CNVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVL  2055
              NV     SGL +G+N  +    PV+EYI SLI+WL  ++EEGEKDLSEAC+ SFVHGVL
Sbjct  546   VNVACL--SGLESGDNQTYNXGYPVMEYIRSLIEWLDVSIEEGEKDLSEACQNSFVHGVL  603

Query  2056  LTLRYTFEEMDWDSIAVAsnissiklllekilalVMRITSLALWVVSADAWYLP-DEMEE  2232
             LTLRY FEE+D++S    S+IS ++  LEK+L LVMRITSLALWVVSADAW+LP D  E 
Sbjct  604   LTLRYAFEELDFNSDIAQSSISEMRHSLEKLLELVMRITSLALWVVSADAWHLPEDMDEV  663

Query  2233  MTVDGACFL-ERPIEMDVSASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGT  2409
             +  D   FL E P  ++   S  +DE K  K  Q++   +Q VMVGCWLAMKEVSLLLGT
Sbjct  664   VVDDDDSFLSEVPDXVEXKTSLLEDEDKNYKFVQNNRRSEQSVMVGCWLAMKEVSLLLGT  723

Query  2410  IIRKVPLPT--------SDVPKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMK  2565
             I RK+PLP+        S+   SC+ +      ++SD +LD++QLE IGNHFLEVLLKMK
Sbjct  724   ITRKIPLPSTPSSESLDSETTSSCASV-----MMASDAMLDVKQLERIGNHFLEVLLKMK  778

Query  2566  HNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIP  2745
             HNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLM+RTV+KGQTVDDLLRRSAGIP
Sbjct  779   HNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMDRTVAKGQTVDDLLRRSAGIP  838

Query  2746  AAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSL--------TDknkensscsesssAID  2901
             AAF A FLSEPEGAPK+LLP+ALRWLI+VA  S         ++ +       +S    +
Sbjct  839   AAFIALFLSEPEGAPKKLLPRALRWLIDVANASFVGXVETNNSNGDMGKLXSIKSDKVFE  898

Query  2902  STMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFS  3081
               +  D+   + +SK RDEGV+PTVH FNVL+A FND NLA DTSGFSAEA+IVS+RSFS
Sbjct  899   XAVSSDIDISDKVSKIRDEGVIPTVHXFNVLRAXFNDTNLAADTSGFSAEAMIVSVRSFS  958

Query  3082  SSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIA  3261
             S +WEVRNSACLAYTALVRRMIGFLNVQKRES+RRALTG+EFFHRYP LH FL  ELK A
Sbjct  959   SPHWEVRNSACLAYTALVRRMIGFLNVQKRESSRRALTGVEFFHRYPLLHPFLIKELKAA  1018

Query  3262  TELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMPFIRKCS  3441
             T L  +G S    SNL   VHPSLCP+LILLSRLKPS I S TGD  DPFL MPFIRKCS
Sbjct  1019  TVLLGDGISGQSESNLENAVHPSLCPVLILLSRLKPSTIASXTGDDVDPFLLMPFIRKCS  1078

Query  3442  LQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSM-TSDLSGL-----SNLN  3603
              Q+NLR+R+LASRAL G+VSNEKLP+V+LNI SELP  D+ +  T +LS L         
Sbjct  1079  TQSNLRVRVLASRALAGLVSNEKLPSVLLNIVSELPRRDDQATWTPELSLLFDKTRRRQQ  1138

Query  3604  ASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPILNC  3783
             +S+N  HG+LLQLSSLLDTNCRNLAD SKK+ IL DL   L  HSWIG P+ CPCPILN 
Sbjct  1139  SSYNWTHGILLQLSSLLDTNCRNLADSSKKDQILGDLFQALLAHSWIGKPRLCPCPILNA  1198

Query  3784  SFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPTIAELRKQAA  3963
             SFL +LD+MLSIAR C  S  +  + NLL  LS+ECLD+  S    Y+DPT+AELR+QAA
Sbjct  1199  SFLNLLDHMLSIARXCHXSXNVYALRNLLLELSTECLDVKASNGRXYYDPTMAELRQQAA  1258

Query  3964  SSYFNCAYQTSKDVNEEDL-IYLRGPPPDSELFKESETQMSVTRFQERLIRSLSDALYEV  4140
              SYF+C +Q S  + EE      R    +S   +  E + S    QERL+RSLSD+ YEV
Sbjct  1259  VSYFSCVFQASDKMAEEVFQTPQRYSQSNSRFMEIPEMENSFAGLQERLVRSLSDSEYEV  1318

Query  4141  RIATLKWLLLFLNSPESRTAESSNKSQSEIKLL--WLSNIGLQAMLMQLLAVEKNHKCMN  4314
             R+ATLKWLL  + S ES     S+   SEI+++  W     LQ   + LL +EK H+C  
Sbjct  1319  RLATLKWLLKXITSTES--GHESHDXSSEIRVIQHW-XRTNLQTTXVNLLDMEKYHRCSY  1375

Query  4315  YILKIIYTYNMQQYNK----NCGQHEKPTFVGNMDSDSVLQFWDKVVSLYKVTRHAKTRE  4482
             YIL+I++T+N  Q+ K     C +     + G+M+ DSV   WDK++SLYK TRHAK  +
Sbjct  1376  YILRILFTWNTLQFQKLGDVKCTE---TIYXGSMECDSVFLLWDKLISLYKFTRHAKAXQ  1432

Query  4483  MLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECIDYFVEVIQEHSDA  4662
              L+CC  +CIKR A L T+S+ S  ++   +       KL+     I +F  VI +HS +
Sbjct  1433  TLICCFGICIKRFAGLLTTSVLSDNSDSDRL------EKLTRLYGIISFFTNVIMKHSAS  1486

Query  4663  SEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGN-----KQKDALHLYAHKILDL  4827
             SEPINMR AAA+SI+ASGLL+QA+ +  +V N+++P  N     + K+A++ YAH+ILD+
Sbjct  1487  SEPINMRMAAAESIIASGLLEQAELIGYTVFNNRIPSENPCSTFEPKEAVNFYAHQILDI  1546

Query  4828  WFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEHLSSTF  5007
             WFTC++LLEDEDD +R++L++ +Q C TS +SGS    GVVP QVEKVI   FEHLSS F
Sbjct  1547  WFTCIQLLEDEDDEIRERLAMGIQGCFTSKRSGSS-HGGVVPTQVEKVIGSCFEHLSSVF  1605

Query  5008  GHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNHHEEKLLISQICCSHLEKLP  5187
             GHW+ Y D+L  WV +A+N    V   D VR+VFDKEIDNHHEEKL I Q+CCS L+KL 
Sbjct  1606  GHWIGYFDYLLRWVLNASNR--EVPKGDLVRQVFDKEIDNHHEEKLFICQLCCSQLDKLR  1663

Query  5188  VSK-LTTEFRD-NNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPV  5361
             +SK    +FR+       L  WR RF  QL SF    I   GG DW+GG GNHKDAFLP+
Sbjct  1664  ISKSWAADFRNKQQFSDYLHDWRLRFSCQLTSFAKDRIAKLGGADWVGGAGNHKDAFLPL  1723

Query  5362  YVNLLAFHALSNCILRGEAEDSKSMVPELLELGEAIQPFLRNPLISNLFVLVVKSHEKIA  5541
             Y NLLAF+ALSNCI  G+  D+K +  ++ +LG+AI PFLRNPLISNL++LVVKSHE   
Sbjct  1724  YANLLAFYALSNCIFNGKTGDNKHLQSDVAKLGKAIBPFLRNPLISNLYLLVVKSHEDAV  1783

Query  5542  GGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             G   + LV ++ G  + W+ F+P+FL R
Sbjct  1784  GSNGDDLVPKL-GEGAVWEGFNPHFLLR  1810



>ref|XP_010693228.1| PREDICTED: thyroid adenoma-associated protein homolog [Beta vulgaris 
subsp. vulgaris]
Length=2178

 Score =  2080 bits (5390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1086/1887 (58%), Positives = 1379/1887 (73%), Gaps = 49/1887 (3%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             G+LTAVSR VLN  FVV  +G +  G   N    +++ILYD IL ELC +CE+P+DSHFN
Sbjct  329   GVLTAVSRNVLNFRFVVEIEGSNCSGADENGKRCLQSILYDCILPELCKYCENPSDSHFN  388

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV+QICLQQIKTS+      +   +DPI E++G RVL+I+WNNLEDPLSQTVKQVH
Sbjct  389   FHALTVLQICLQQIKTSILADLVDLTTEFDPIPEDLGARVLRIIWNNLEDPLSQTVKQVH  448

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDI+ +++  +G     +FL KI SD+L LG RCKGRY+PLASLTKRLGAK++L
Sbjct  449   LIFDLFLDIKASIYRGDGYVNMNTFLVKITSDILCLGARCKGRYVPLASLTKRLGAKTVL  508

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              MSP LL++   AY+DDDVCSA T+FLKCFLECLRDE W ++G+E GY  YR HCL P L
Sbjct  509   SMSPNLLYEVVHAYIDDDVCSAVTSFLKCFLECLRDECWDSNGIERGYAVYRGHCLPPFL  568

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYALP LL++DVDSIF ML F+ IG   + T +  PEL   D+  
Sbjct  569   YGLASGVSKLRSNLNTYALPSLLDVDVDSIFLMLSFLSIGVGVD-TGLVSPELSCLDVAF  627

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              +EQ+VAVLVSLLKVSR LAL EGDI+ C  +++ LE   +  +     +++++KGIEVK
Sbjct  628   DIEQKVAVLVSLLKVSRSLALFEGDIESCHKTAIPLEEDTMEEE----QALIYMKGIEVK  683

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +P  +L LALTH+D+SLR+DAAESLF+NPKTASLPS+LEL+LMR +VPLNMRCCSTAFQM
Sbjct  684   LPAEWLALALTHVDESLRVDAAESLFLNPKTASLPSNLELNLMRLSVPLNMRCCSTAFQM  743

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KWASLF+KFF RVRTALER IK GTW PS     + + +    D+ +  RA++L+ FMKW
Sbjct  744   KWASLFKKFFLRVRTALERQIKLGTWQPSDWGKNNIASVCKSGDELIVSRADSLYEFMKW  803

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LSCFLFFSCYPSAPYERK+MAMEL++IM+NVW ++PP  ++  + S  +LY +S+GL  P
Sbjct  804   LSCFLFFSCYPSAPYERKVMAMELIMIMVNVWSIVPPLKENCDFLSIENLYLFSEGLTRP  863

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             +ST+LLVGSI+DSWDRLRESSFRILL FPTP+PGIS+ + + E IIWAKKL CSPRVRES
Sbjct  864   DSTMLLVGSIVDSWDRLRESSFRILLSFPTPLPGISNEQKLQEVIIWAKKLACSPRVRES  923

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVVT-QSPSGLSNGENLEFTPSSPVIEYITSLID  1977
             DAGAL  RLIFRKYVLELGW+V  S NV   +S SGLSNGE        P+I YI SLID
Sbjct  924   DAGALALRLIFRKYVLELGWIVGASVNVTCHKSGSGLSNGEYQIPKSRFPIIAYINSLID  983

Query  1978  WLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilal  2157
             WL A VEEG+KDL EACK SFVHGVLLTLRYTFEE+DW+S  + S+I  ++  L K+L L
Sbjct  984   WLQAIVEEGDKDLLEACKNSFVHGVLLTLRYTFEELDWNSDVLTSSIPEMRDALGKLLEL  1043

Query  2158  VMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQDD  2337
             VMRITSLALWVVSADA  LP +M+++  D +  L+   E+  ++S    E K  K E+  
Sbjct  1044  VMRITSLALWVVSADALSLPQDMDDIEED-SFLLDNTAELVTASSELGHEAKDLKGEESA  1102

Query  2338  GPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQL--SSDIVLDL  2511
              P +QIVMVGCWLAMKE+SLLLGTIIRK+PLP +         +   DQL   SD VLD+
Sbjct  1103  RPTEQIVMVGCWLAMKEISLLLGTIIRKIPLPIATSSIGEETESMAMDQLMPMSDAVLDV  1162

Query  2512  RQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERT  2691
              QLE+IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCS+D RLC+LTESWMEQLMERT
Sbjct  1163  NQLEVIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSDDSRLCQLTESWMEQLMERT  1222

Query  2692  VSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkens  2871
             V+KGQTVDDLLRRSAGIPAAF+AFFLSEP+GAPK+LLP+ALRWLI VA  SL D+ +   
Sbjct  1223  VAKGQTVDDLLRRSAGIPAAFSAFFLSEPQGAPKKLLPRALRWLIEVAGGSLLDQAESTI  1282

Query  2872  scse--sssAI----DSTMVPDVAAIEMIS-KTRDEGVVPTVHAFNVLKAAFNDANLATD  3030
               +     +AI    D++M  D     + S K R EGV+PTVHAFNVL+AAFNDANLATD
Sbjct  1283  GDTSWNERTAISDGEDASMQTDDIIENLTSAKIRVEGVIPTVHAFNVLRAAFNDANLATD  1342

Query  3031  TSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFF  3210
             TSGFSAEA+I+SIRSFSS +WE+RNSACLAYTALVRRM+GFLNV KRESARRA+T LEFF
Sbjct  1343  TSGFSAEAMIISIRSFSSPHWEIRNSACLAYTALVRRMVGFLNVHKRESARRAITSLEFF  1402

Query  3211  HRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSET  3390
             HRYP+LH+F+F+ELKIAT+L   G S    SNLA +VHPSLCP+LILLSRLKPSPI SE 
Sbjct  1403  HRYPSLHSFIFSELKIATDLLQVGQS---NSNLASIVHPSLCPVLILLSRLKPSPIASEA  1459

Query  3391  GDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSM  3570
             GD  DPFLFMPFI++CS Q N+RIR+LASRALTG+VSNEKL  V+L+IAS LP   N + 
Sbjct  1460  GDCLDPFLFMPFIQRCSTQRNMRIRVLASRALTGLVSNEKLHLVLLDIASGLPNSVNQTE  1519

Query  3571  TSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGS  3750
              +     S    SFN+IHG LLQLS+LLD NCRNLADFS KE IL++LI +L   SWIGS
Sbjct  1520  PTQTYRAS----SFNAIHGTLLQLSALLDGNCRNLADFSLKEIILNNLIKILHNCSWIGS  1575

Query  3751  PQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFD  3930
             P+  PCPILN SFLKVL++ML+IA TC+      +I +LL  LSSECL +      ++ D
Sbjct  1576  PRSLPCPILNASFLKVLNDMLTIAGTCQAGNNYDIICSLLSDLSSECLGV--ESELSFHD  1633

Query  3931  PTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESE-TQMSVTRFQERL  4107
             PT  ELRKQA  SY +C Y   +  + E++I +      + + K            +E+L
Sbjct  1634  PTSIELRKQAVMSYLHCLYLYEE--HAEEVIPMPNQLSAANIVKAKPLANNGFDGVEEKL  1691

Query  4108  IRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLA  4287
                +SDA YEVR+ T KWLL F+ +      +  + S+  I   W +   LQ  L++LL+
Sbjct  1692  ACYMSDASYEVRLTTFKWLLQFVKTAAIEVGDDQDGSEVAIIAHW-AKANLQTTLIRLLS  1750

Query  4288  VEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPT-FVGNMDSDSVLQFWDKVVSLYKVTR  4464
              E NHKC  YIL+II+ +N+ Q+ +   +    T ++G MD +S+L FW+++VS++   R
Sbjct  1751  FETNHKCAYYILRIIFAWNLLQFQRASNKILGNTIYIGEMDFESILLFWNRLVSIHDSAR  1810

Query  4465  HAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECIDYFVEVI  4644
             H KT E+L+CC  +C+KR A  F   I  + N+K   +N     + ++  + I ++V +I
Sbjct  1811  HTKTVEILICCFGLCVKRFAS-FLRCILPVSNKKTEELN-----RCTILCKWIKHYVCLI  1864

Query  4645  QEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGNKQKDALHLYAHKILD  4824
             +++SDAS+ +N+RKAAA+S+VASGLL+QA+ +S  V+     DG++ +D+++++A  ILD
Sbjct  1865  KQYSDASQQVNLRKAAAESVVASGLLEQAEFISAYVN-----DGSEPQDSVNMFAFLILD  1919

Query  4825  LWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEHLSST  5004
             +WFTC+ LLEDED  +RK+L+LEVQKC    K      + VVP QVEKVIE+  E LSS 
Sbjct  1920  IWFTCVTLLEDEDAFIRKELALEVQKCFPP-KFRCRSLAVVVPAQVEKVIELCVEFLSSI  1978

Query  5005  FGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNHHEEKLLISQICCSHLEKL  5184
             +GHW  Y D+L  W+  A  ++C VS  D VRRVFDKE+DN+HEEKLLI QICC +LE L
Sbjct  1979  YGHWDRYCDYLLRWISDA--ASCVVSDGDLVRRVFDKELDNYHEEKLLICQICCYNLENL  2036

Query  5185  PVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPVY  5364
              + +         + + L SWR  F +QL+SF +AY+    G +WIGGVGNHKD FLP+Y
Sbjct  2037  KLLQTLGP----KLLTSLTSWRNHFFRQLLSFASAYMEKLEGAEWIGGVGNHKDTFLPLY  2092

Query  5365  VNLLAFHALSNCILRGEAEDSKSMVPELLELGEAIQPFLRNPLISNLFVLVVKSHEKIAG  5544
              NLL F+ALS  IL+ E+ED   ++ +++E+ ++I+PFL+NPL+ NL++LVV+  E+   
Sbjct  2093  GNLLGFYALSKRILKEESEDGMCLLLDVVEIEKSIRPFLKNPLVCNLYILVVRLLEEKVA  2152

Query  5545  GAVEHLVLEISGAYSAWDAFDPYFLFR  5625
              A  +L+ ++   +  WD F+PYFL R
Sbjct  2153  SA-NYLISQLLNGFQIWDGFNPYFLLR  2178



>ref|XP_010552926.1| PREDICTED: thyroid adenoma-associated protein homolog isoform 
X2 [Tarenaya hassleriana]
Length=2044

 Score =  2077 bits (5382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1094/1894 (58%), Positives = 1365/1894 (72%), Gaps = 86/1894 (5%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSR +LN +FV+S+   +   + G   S  KTILYDGIL ELCNFCE+PTD+H+N
Sbjct  218   GILTAVSRDILNSYFVLSSCCTNSHRH-GEEISGRKTILYDGILPELCNFCENPTDTHYN  276

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV+QICLQQ+K SM      + E YDP+ E +GTR+LKI+WNNLEDPLSQTVKQVH
Sbjct  277   FHALTVLQICLQQVKASMVANLTDLSEEYDPMPENMGTRILKIIWNNLEDPLSQTVKQVH  336

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDIQ T+H  + + +  +FLR IA+DLL LG RCKGRY+PLASLT+RLGAK++L
Sbjct  337   LIFDLFLDIQSTIHRTDDTMRIKTFLRSIANDLLRLGSRCKGRYVPLASLTRRLGAKTLL  396

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DM+ GLLF+T  A +DDDVC AAT+F+KCFLE  RDE WS++G++ GY++YR HCL P L
Sbjct  397   DMNTGLLFETANALIDDDVCCAATSFMKCFLEIFRDECWSSEGIDQGYMRYREHCLPPFL  456

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYALPVLLELDVDSIFP+L FI IG   E +++ +PEL +  I  
Sbjct  457   YGLASGMSKLRSNLNTYALPVLLELDVDSIFPLLAFISIGPGGEMSKLMHPELSNMSIEP  516

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
             GVEQ+VAVLVSLLKVSR LAL+EGDI+  E            TD  V  + V +KGIE++
Sbjct  517   GVEQKVAVLVSLLKVSRTLALLEGDIEQKE------------TDDAV--AFVCIKGIEIQ  562

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +PV +L++ALTH+D+S+R+DAA +LF+NPKTASLPS LEL LM++A+PLNMR  ST FQM
Sbjct  563   VPVEWLIMALTHVDESIRVDAAGTLFLNPKTASLPSPLELYLMKEAMPLNMRSSSTGFQM  622

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSRVRTALER  K G+W P +      + L+    +++  RAE+LF FM+W
Sbjct  623   KWTSLFRKFFSRVRTALERQYKLGSWEPLIAGGRIETCLSNRGSENVAQRAESLFKFMRW  682

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LS FLFFSCYPSAPY+RKIMAM+L+ IM+NVW ++  +   +S S +  LYPY+  +  P
Sbjct  683   LSSFLFFSCYPSAPYKRKIMAMDLIQIMVNVWPIVQSKDDLNSTSPQGCLYPYNDSVNSP  742

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             +STL LVGSI+DSWDRLRESSFRILLHFPTP+PGISS ++V   I WA++LVCSPRVRES
Sbjct  743   DSTLFLVGSIVDSWDRLRESSFRILLHFPTPLPGISSEDMVQRVISWAQQLVCSPRVRES  802

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVV-TQSPSGLSNGENLEFTPSSPVIEYITSLID  1977
             DAGAL  RLIFRKYVL+LG +V+ S NVV  Q      NG +       PVIEYI SL D
Sbjct  803   DAGALALRLIFRKYVLDLGSIVKASTNVVYCQRECKRMNGIDQVSITKRPVIEYIKSLTD  862

Query  1978  WLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilal  2157
             WL A+V EGE DLSEACK SFVHGVLL LRYTFEE+DW+S AV S  S ++  L+K+L L
Sbjct  863   WLDASVREGEHDLSEACKNSFVHGVLLALRYTFEELDWNSDAVLSGASEMRKELDKLLEL  922

Query  2158  VMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEM-KIAKAEQD  2334
             V RITSLALWVVS+DAWY P E  +  +D    L    + D   + PD    K +K  Q 
Sbjct  923   VTRITSLALWVVSSDAWYFP-EDGDDMIDDDSILPDVQDEDGEDALPDQYGDKDSKVLQG  981

Query  2335  DGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDV------PKSCSQITDGTDQLSSD  2496
                 +QIVMVGCWLAMKEVSLLLGTI RK+PLP+S +          S +  G    +S+
Sbjct  982   TRQSEQIVMVGCWLAMKEVSLLLGTITRKIPLPSSSLSTCVESADPASDVNGGLVTEASE  1041

Query  2497  IVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQ  2676
              +LDL+QLE IG+HFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQ
Sbjct  1042  SLLDLKQLEKIGDHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQ  1101

Query  2677  LMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDk  2856
             LMERTV+KGQTVDDLLRRSAGIPAAF AFFLSEPEG+PK++LP+ALRWLI++AKK LTD 
Sbjct  1102  LMERTVAKGQTVDDLLRRSAGIPAAFIAFFLSEPEGSPKKILPQALRWLIDLAKKPLTDP  1161

Query  2857  nkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTS  3036
             +    S    +    S + P     E +SK RDEGVVPTVHAFNVL+AAFND+NLATDTS
Sbjct  1162  DGRKGSNLVDNDVNPSELDPS----EKLSKIRDEGVVPTVHAFNVLRAAFNDSNLATDTS  1217

Query  3037  GFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHR  3216
             GFSAEA+IVSIRSFSS YWEVRNSA LAYTALVRRMIGFLNVQKRESARRAL+GLEFFHR
Sbjct  1218  GFSAEAMIVSIRSFSSPYWEVRNSATLAYTALVRRMIGFLNVQKRESARRALSGLEFFHR  1277

Query  3217  YPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGD  3396
             YP LH F++NELK AT++       +L  NL  +VHPSLCP+LILLSRLKPS I SETGD
Sbjct  1278  YPLLHPFIYNELKAATDMLDTSGPSDL--NLKNLVHPSLCPVLILLSRLKPSAIASETGD  1335

Query  3397  PFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTS  3576
               DP LFMPFI+KCS Q NLR+R+LAS+ALTG+VSNEKLPTV+  IAS+LP ID      
Sbjct  1336  DLDPLLFMPFIKKCSTQCNLRVRVLASQALTGLVSNEKLPTVLFGIASDLP-IDRTQY--  1392

Query  3577  DLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQ  3756
                       SFN +HG+LLQL +LLD NCR+L D SKK+ +L  L+ VL +  W+ SP 
Sbjct  1393  ---------GSFNFLHGILLQLGALLDINCRSLTDSSKKDQLLGQLLDVLSECKWMASPI  1443

Query  3757  KCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPT  3936
              CPCPILN SFL+VLD MLSI RTC  SK ++ I+ LL  LS+ CLD   S   +Y+DPT
Sbjct  1444  LCPCPILNASFLRVLDRMLSIGRTCSGSKHLNAIYTLLLDLSANCLDAEASYGFSYYDPT  1503

Query  3937  IAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRF---QERL  4107
             IAELR+QAA SYF+C +Q S                 S+ + E E    +  F    ERL
Sbjct  1504  IAELREQAAVSYFSCVFQPSNTRPIRSFF--------SDRWSELEIAEPINGFPDLNERL  1555

Query  4108  IRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLW-LSNIGLQAMLMQLL  4284
             I SLSD  YEVR++TLKWLL FL S ES  +       SE  ++W  +   LQ  L+QLL
Sbjct  1556  ICSLSDPSYEVRLSTLKWLLRFLKSEESNCS-------SETSVIWNWAKTELQVTLLQLL  1608

Query  4285  AVEKNHKCMNYILKIIYTYNMQQYNKNC-GQHEKPTFVGNMDSDSVLQFWDKVVSLYKVT  4461
               +K+H+C NYIL+I+  +N+  + K+  G+     +VG++D +SV Q WDK+ SLY+ +
Sbjct  1609  GKDKSHRCENYILRILCHWNLLMFRKSSKGESIGGVYVGSLDYESVFQLWDKLTSLYENS  1668

Query  4462  RHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECIDYFVEV  4641
             RHAKTR  L+CC+A+C+KR   LF     ++  +K     P +P    VF +C+ YFV +
Sbjct  1669  RHAKTRGTLICCLAICVKRFTSLFLKHFFTVP-DKCESEKPEEPRLAHVF-DCLSYFVNL  1726

Query  4642  IQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGNKQKDA---LHLYAH  4812
             +++ S +SE +N+RKA+A++++ASGLL+QA+ +   VSN Q+P   K  D     + YA 
Sbjct  1727  VKQQSSSSEQVNIRKASAEAMIASGLLEQAELIGSHVSNDQIPTETKATDVQEPCNRYAF  1786

Query  4813  KILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEH  4992
             ++L++WFTC+KLLEDEDD +R++L+ +VQKC +S  +        VP QVEKVIE+SF H
Sbjct  1787  QVLEMWFTCIKLLEDEDDVIRQELASDVQKCFSSSAAWEE-----VPTQVEKVIELSFGH  1841

Query  4993  LSSTFGHWLDYLDFLCHWV-QSATNSACAVSIADPVRRVFDKEIDNHHEEKLLISQICCS  5169
             LSS FGHW +Y  +L  WV  +AT +A +    D VR+VFDKEIDNHHEEKLLISQ+CC 
Sbjct  1842  LSSVFGHWNEYFHYLAGWVFNAATYTASSAKGGDLVRQVFDKEIDNHHEEKLLISQLCCH  1901

Query  5170  HLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDA  5349
             HL+ L  S      R+  +  +L+ WR +F  QL+ F N ++G Q G  W+GG+GNHKD+
Sbjct  1902  HLQNLAGSS----NRELPLTHLLE-WRAKFRNQLLFFANDHVGEQKG-GWLGGIGNHKDS  1955

Query  5350  FLPVYVNLLAFHALSNCILRGEAE--DSKSMVPELLELGEAIQPFLRNPLISNLFVLVVK  5523
             FLP+Y NLL F++LS C+    AE  D K ++ ++ ELG A++PFLRNPL+SN+F +V++
Sbjct  1956  FLPLYGNLLGFYSLSFCVFGSVAENYDRKPLLSDMEELGTAMKPFLRNPLVSNIFRVVIR  2015

Query  5524  SHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
              HEK  G +V+            WD FDP+FL R
Sbjct  2016  LHEKSLGMSVDDDDDG-----EVWDGFDPFFLLR  2044



>ref|XP_010552920.1| PREDICTED: thyroid adenoma-associated protein homolog isoform 
X1 [Tarenaya hassleriana]
Length=2153

 Score =  2076 bits (5380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1094/1894 (58%), Positives = 1364/1894 (72%), Gaps = 86/1894 (5%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSR +LN +FV+S+   +     G   S  KTILYDGIL ELCNFCE+PTD+H+N
Sbjct  327   GILTAVSRDILNSYFVLSSCCTNS-HRHGEEISGRKTILYDGILPELCNFCENPTDTHYN  385

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV+QICLQQ+K SM      + E YDP+ E +GTR+LKI+WNNLEDPLSQTVKQVH
Sbjct  386   FHALTVLQICLQQVKASMVANLTDLSEEYDPMPENMGTRILKIIWNNLEDPLSQTVKQVH  445

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDIQ T+H  + + +  +FLR IA+DLL LG RCKGRY+PLASLT+RLGAK++L
Sbjct  446   LIFDLFLDIQSTIHRTDDTMRIKTFLRSIANDLLRLGSRCKGRYVPLASLTRRLGAKTLL  505

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DM+ GLLF+T  A +DDDVC AAT+F+KCFLE  RDE WS++G++ GY++YR HCL P L
Sbjct  506   DMNTGLLFETANALIDDDVCCAATSFMKCFLEIFRDECWSSEGIDQGYMRYREHCLPPFL  565

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYALPVLLELDVDSIFP+L FI IG   E +++ +PEL +  I  
Sbjct  566   YGLASGMSKLRSNLNTYALPVLLELDVDSIFPLLAFISIGPGGEMSKLMHPELSNMSIEP  625

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
             GVEQ+VAVLVSLLKVSR LAL+EGDI+  E            TD  V  + V +KGIE++
Sbjct  626   GVEQKVAVLVSLLKVSRTLALLEGDIEQKE------------TDDAV--AFVCIKGIEIQ  671

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +PV +L++ALTH+D+S+R+DAA +LF+NPKTASLPS LEL LM++A+PLNMR  ST FQM
Sbjct  672   VPVEWLIMALTHVDESIRVDAAGTLFLNPKTASLPSPLELYLMKEAMPLNMRSSSTGFQM  731

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSRVRTALER  K G+W P +      + L+    +++  RAE+LF FM+W
Sbjct  732   KWTSLFRKFFSRVRTALERQYKLGSWEPLIAGGRIETCLSNRGSENVAQRAESLFKFMRW  791

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LS FLFFSCYPSAPY+RKIMAM+L+ IM+NVW ++  +   +S S +  LYPY+  +  P
Sbjct  792   LSSFLFFSCYPSAPYKRKIMAMDLIQIMVNVWPIVQSKDDLNSTSPQGCLYPYNDSVNSP  851

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             +STL LVGSI+DSWDRLRESSFRILLHFPTP+PGISS ++V   I WA++LVCSPRVRES
Sbjct  852   DSTLFLVGSIVDSWDRLRESSFRILLHFPTPLPGISSEDMVQRVISWAQQLVCSPRVRES  911

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVV-TQSPSGLSNGENLEFTPSSPVIEYITSLID  1977
             DAGAL  RLIFRKYVL+LG +V+ S NVV  Q      NG +       PVIEYI SL D
Sbjct  912   DAGALALRLIFRKYVLDLGSIVKASTNVVYCQRECKRMNGIDQVSITKRPVIEYIKSLTD  971

Query  1978  WLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilal  2157
             WL A+V EGE DLSEACK SFVHGVLL LRYTFEE+DW+S AV S  S ++  L+K+L L
Sbjct  972   WLDASVREGEHDLSEACKNSFVHGVLLALRYTFEELDWNSDAVLSGASEMRKELDKLLEL  1031

Query  2158  VMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEM-KIAKAEQD  2334
             V RITSLALWVVS+DAWY P E  +  +D    L    + D   + PD    K +K  Q 
Sbjct  1032  VTRITSLALWVVSSDAWYFP-EDGDDMIDDDSILPDVQDEDGEDALPDQYGDKDSKVLQG  1090

Query  2335  DGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDV------PKSCSQITDGTDQLSSD  2496
                 +QIVMVGCWLAMKEVSLLLGTI RK+PLP+S +          S +  G    +S+
Sbjct  1091  TRQSEQIVMVGCWLAMKEVSLLLGTITRKIPLPSSSLSTCVESADPASDVNGGLVTEASE  1150

Query  2497  IVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQ  2676
              +LDL+QLE IG+HFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQ
Sbjct  1151  SLLDLKQLEKIGDHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQ  1210

Query  2677  LMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDk  2856
             LMERTV+KGQTVDDLLRRSAGIPAAF AFFLSEPEG+PK++LP+ALRWLI++AKK LTD 
Sbjct  1211  LMERTVAKGQTVDDLLRRSAGIPAAFIAFFLSEPEGSPKKILPQALRWLIDLAKKPLTDP  1270

Query  2857  nkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTS  3036
             +    S    +    S + P     E +SK RDEGVVPTVHAFNVL+AAFND+NLATDTS
Sbjct  1271  DGRKGSNLVDNDVNPSELDPS----EKLSKIRDEGVVPTVHAFNVLRAAFNDSNLATDTS  1326

Query  3037  GFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHR  3216
             GFSAEA+IVSIRSFSS YWEVRNSA LAYTALVRRMIGFLNVQKRESARRAL+GLEFFHR
Sbjct  1327  GFSAEAMIVSIRSFSSPYWEVRNSATLAYTALVRRMIGFLNVQKRESARRALSGLEFFHR  1386

Query  3217  YPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGD  3396
             YP LH F++NELK AT++       +L  NL  +VHPSLCP+LILLSRLKPS I SETGD
Sbjct  1387  YPLLHPFIYNELKAATDMLDTSGPSDL--NLKNLVHPSLCPVLILLSRLKPSAIASETGD  1444

Query  3397  PFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTS  3576
               DP LFMPFI+KCS Q NLR+R+LAS+ALTG+VSNEKLPTV+  IAS+LP ID      
Sbjct  1445  DLDPLLFMPFIKKCSTQCNLRVRVLASQALTGLVSNEKLPTVLFGIASDLP-IDRTQY--  1501

Query  3577  DLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQ  3756
                       SFN +HG+LLQL +LLD NCR+L D SKK+ +L  L+ VL +  W+ SP 
Sbjct  1502  ---------GSFNFLHGILLQLGALLDINCRSLTDSSKKDQLLGQLLDVLSECKWMASPI  1552

Query  3757  KCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPT  3936
              CPCPILN SFL+VLD MLSI RTC  SK ++ I+ LL  LS+ CLD   S   +Y+DPT
Sbjct  1553  LCPCPILNASFLRVLDRMLSIGRTCSGSKHLNAIYTLLLDLSANCLDAEASYGFSYYDPT  1612

Query  3937  IAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRF---QERL  4107
             IAELR+QAA SYF+C +Q S                 S+ + E E    +  F    ERL
Sbjct  1613  IAELREQAAVSYFSCVFQPSNTRPIRSFF--------SDRWSELEIAEPINGFPDLNERL  1664

Query  4108  IRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLW-LSNIGLQAMLMQLL  4284
             I SLSD  YEVR++TLKWLL FL S ES  +       SE  ++W  +   LQ  L+QLL
Sbjct  1665  ICSLSDPSYEVRLSTLKWLLRFLKSEESNCS-------SETSVIWNWAKTELQVTLLQLL  1717

Query  4285  AVEKNHKCMNYILKIIYTYNMQQYNKNC-GQHEKPTFVGNMDSDSVLQFWDKVVSLYKVT  4461
               +K+H+C NYIL+I+  +N+  + K+  G+     +VG++D +SV Q WDK+ SLY+ +
Sbjct  1718  GKDKSHRCENYILRILCHWNLLMFRKSSKGESIGGVYVGSLDYESVFQLWDKLTSLYENS  1777

Query  4462  RHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECIDYFVEV  4641
             RHAKTR  L+CC+A+C+KR   LF     ++  +K     P +P    VF +C+ YFV +
Sbjct  1778  RHAKTRGTLICCLAICVKRFTSLFLKHFFTVP-DKCESEKPEEPRLAHVF-DCLSYFVNL  1835

Query  4642  IQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGNKQKDA---LHLYAH  4812
             +++ S +SE +N+RKA+A++++ASGLL+QA+ +   VSN Q+P   K  D     + YA 
Sbjct  1836  VKQQSSSSEQVNIRKASAEAMIASGLLEQAELIGSHVSNDQIPTETKATDVQEPCNRYAF  1895

Query  4813  KILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEH  4992
             ++L++WFTC+KLLEDEDD +R++L+ +VQKC +S  +        VP QVEKVIE+SF H
Sbjct  1896  QVLEMWFTCIKLLEDEDDVIRQELASDVQKCFSSSAAWEE-----VPTQVEKVIELSFGH  1950

Query  4993  LSSTFGHWLDYLDFLCHWV-QSATNSACAVSIADPVRRVFDKEIDNHHEEKLLISQICCS  5169
             LSS FGHW +Y  +L  WV  +AT +A +    D VR+VFDKEIDNHHEEKLLISQ+CC 
Sbjct  1951  LSSVFGHWNEYFHYLAGWVFNAATYTASSAKGGDLVRQVFDKEIDNHHEEKLLISQLCCH  2010

Query  5170  HLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDA  5349
             HL+ L  S      R+  +  +L+ WR +F  QL+ F N ++G Q G  W+GG+GNHKD+
Sbjct  2011  HLQNLAGSS----NRELPLTHLLE-WRAKFRNQLLFFANDHVGEQKG-GWLGGIGNHKDS  2064

Query  5350  FLPVYVNLLAFHALSNCILRGEAE--DSKSMVPELLELGEAIQPFLRNPLISNLFVLVVK  5523
             FLP+Y NLL F++LS C+    AE  D K ++ ++ ELG A++PFLRNPL+SN+F +V++
Sbjct  2065  FLPLYGNLLGFYSLSFCVFGSVAENYDRKPLLSDMEELGTAMKPFLRNPLVSNIFRVVIR  2124

Query  5524  SHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
              HEK  G +V+            WD FDP+FL R
Sbjct  2125  LHEKSLGMSVDDDDDG-----EVWDGFDPFFLLR  2153



>ref|XP_002305983.2| hypothetical protein POPTR_0004s13360g [Populus trichocarpa]
 gb|EEE86494.2| hypothetical protein POPTR_0004s13360g [Populus trichocarpa]
Length=2004

 Score =  2003 bits (5190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1069/1754 (61%), Positives = 1291/1754 (74%), Gaps = 95/1754 (5%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSR VLN  FVVS+ G +     GN   SVKTILYDGIL ELCN+CE+P DSHFN
Sbjct  284   GILTAVSRAVLNSQFVVSSGGLNVNEENGNCCGSVKTILYDGILPELCNYCENPIDSHFN  343

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV+QICLQQ+KTSM      I   Y+PI  E+GTR+LKI+WN+LEDPLSQTVKQVH
Sbjct  344   FHALTVLQICLQQMKTSMLSNLTDISNNYEPIPVEMGTRILKIIWNSLEDPLSQTVKQVH  403

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDIQ +LHW EGSE+  SFL+KIASDLL LG  CKGRY+PLA LTKRLGAK+IL
Sbjct  404   LIFDLFLDIQSSLHWGEGSERIKSFLQKIASDLLRLGTGCKGRYVPLALLTKRLGAKTIL  463

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSP LLF+  +AY+DDDVC AATTFLKCFLECLRDE W+ +G+E GY  YR HCL P L
Sbjct  464   DMSPDLLFEIVQAYIDDDVCCAATTFLKCFLECLRDECWNCNGIEEGYAIYRGHCLPPFL  523

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSN+NTYALPVLLE+DVDSIFPML +I +G      E+ YPEL   ++ L
Sbjct  524   FGLASGVSKLRSNVNTYALPVLLEVDVDSIFPMLAYISVGLIGAENELSYPELSGTNVEL  583

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
             GVEQ+VAVLVSL+KV R LALIEGDID  + S        L TD+    ++  +KGI+VK
Sbjct  584   GVEQQVAVLVSLVKVCRSLALIEGDIDLWDASQPLQTNGMLGTDSVKLYALFSIKGIKVK  643

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             + V +L+LAL H+D+ LR+DAAESLF+NPKT+S+PS LEL+L+++AV LNMR CST FQM
Sbjct  644   VHVEWLVLALRHVDELLRVDAAESLFLNPKTSSIPSCLELTLLKEAVLLNMRSCSTGFQM  703

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFF+RVRTALER +KQG+W P L    +G+  N   ++SL  RAENLFNFM+W
Sbjct  704   KWTSLFRKFFARVRTALERQLKQGSWQPLLDCNNNGAYSNKGIEESLIKRAENLFNFMRW  763

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHM-LPPQGKSDSYSSEISLYPYSKGLIL  1617
             LSCFLFFSCYPSAPY+RKIMAM+L+LIMLNVW + L  Q K  S   E SLYPYSKG+ L
Sbjct  764   LSCFLFFSCYPSAPYKRKIMAMDLLLIMLNVWPITLTSQDKDGSLRPESSLYPYSKGITL  823

Query  1618  PESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRE  1797
             P+STLLLVGSIIDSWDRLRESSFRILL+FP P+PGISS ++V + I WAKKLVCSPRVRE
Sbjct  824   PDSTLLLVGSIIDSWDRLRESSFRILLYFPNPLPGISSKDMVQKVINWAKKLVCSPRVRE  883

Query  1798  SDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLID  1977
             SDA                  +V V   ++   P               PV+EYI SLID
Sbjct  884   SDAE-----------------LVNVDSQIIESKP---------------PVVEYIKSLID  911

Query  1978  WLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilal  2157
             WL A+VEEGE++LSEACK SFVHGVLLTLRYTFEE+DW+S AV S+IS ++  LEK+L L
Sbjct  912   WLNASVEEGERNLSEACKNSFVHGVLLTLRYTFEELDWNSDAVLSSISEMRHALEKLLEL  971

Query  2158  VMRITSLALWVVSADAWYLPDE----------MEEMTVDGACFLERPIEMDVSASTPDDE  2307
             ++RITSLALWVVSADAWYL D           M+EM V       RP E         DE
Sbjct  972   LVRITSLALWVVSADAWYLADMDEMADDDVYLMDEMEV------VRPSE---------DE  1016

Query  2308  MKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQ--ITDGTD  2481
                +K  QD  P +QIVMVGCWLAMKEVSLLLGTIIRK+PLP      S S+    D + 
Sbjct  1017  GINSKHVQDSRPSEQIVMVGCWLAMKEVSLLLGTIIRKIPLPGYSYSDSKSEDPCPDASM  1076

Query  2482  QLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTE  2661
                 + +LDL+QLE IGNHFLEVLLKMKHNGAIDKTR GFTALCNRLLCSNDPRLCKLTE
Sbjct  1077  LTIPNAMLDLQQLEQIGNHFLEVLLKMKHNGAIDKTRVGFTALCNRLLCSNDPRLCKLTE  1136

Query  2662  SWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKK  2841
              WMEQLMERTV+KGQ VDDLLRRSAGIPAAF A FLSEP+GAPK+LLP+ALRWLI+VA  
Sbjct  1137  IWMEQLMERTVAKGQVVDDLLRRSAGIPAAFIALFLSEPDGAPKKLLPRALRWLIDVANS  1196

Query  2842  SL--------TDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLK  2997
             SL         + +    S + S  A DS  +  V  +E  SK RDEGV+PTVHAFNVL+
Sbjct  1197  SLLYLVDAKSMNGDSCKLSSTNSDQAPDSAKLYGVNVMEKTSKIRDEGVIPTVHAFNVLR  1256

Query  2998  AAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRES  3177
             AAFND NLATDTSGF+AEALIVSI SFSS YWEVRNSACLAYTALVRRMIGFLN+QKRES
Sbjct  1257  AAFNDTNLATDTSGFAAEALIVSIHSFSSPYWEVRNSACLAYTALVRRMIGFLNLQKRES  1316

Query  3178  ARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLS  3357
              RR+LTGLEFFHRYP+LH FLFNEL +AT+   + +S    SNL+KVVHPSLCP+LILLS
Sbjct  1317  -RRSLTGLEFFHRYPSLHPFLFNELSVATDALGDATSGCSESNLSKVVHPSLCPVLILLS  1375

Query  3358  RLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIA  3537
             RLKPS I SE+GD  DPFLFMPFIR+CS Q+NLRIR+LASRALTG+VSNEKLPT +LNI 
Sbjct  1376  RLKPSTIASESGDDLDPFLFMPFIRRCSTQSNLRIRVLASRALTGLVSNEKLPTALLNIG  1435

Query  3538  SELPAIDNH----SMTSDLSGLSN--LNASFNSIHGMLLQLSSLLDTNCRNLADFSKKED  3699
             SELP ++N     S  S L   SN  ++ ++NSIHGMLLQL SLLD NCRNLADF+KKE 
Sbjct  1436  SELPCVENQIAASSFPSSLLKPSNGTVSTNYNSIHGMLLQLCSLLDANCRNLADFTKKEK  1495

Query  3700  ILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTL  3879
             IL DL  VL K SWI SP++CPCPILN SF++VLD+MLS+A+T  + +    I +LLW L
Sbjct  1496  ILGDLFQVLAKRSWIASPKRCPCPILNGSFVRVLDHMLSVAQTGHIRENYLPIRSLLWKL  1555

Query  3880  SSECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPP----D  4047
              +ECLD+  S   +++DPT+AELR+QA  SYF+C  Q SKD  EE    L+ P      D
Sbjct  1556  CTECLDVEDSFGVSFYDPTVAELREQATISYFSCVLQASKDGMEE---VLQKPQAHLSHD  1612

Query  4048  SELFKESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSE  4227
              +L    ET+ +    ++RLI SL+D+ YEVR+ATLKWLL FL S ES  ++  + S S 
Sbjct  1613  LKLLNLPETKETFVSLEKRLISSLTDSSYEVRLATLKWLLKFLKSTES-ISDVHHLSSSA  1671

Query  4228  IKLL--WLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKP-TFVG  4398
             I ++  W S   LQ  +++LL  EK H+C  YIL+I+YT+N+ Q+ K   Q+    T+VG
Sbjct  1672  IGIIQHW-SKPNLQETMVKLLDSEKYHRCKYYILRILYTWNLLQFQKPGNQNSADITYVG  1730

Query  4399  NMDSDSVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVV  4578
             N+D+DS  QFWDK++SLY +TRH KTRE L+CCMA+C+K+ + L TSS+ S   E+    
Sbjct  1731  NLDNDSTFQFWDKLLSLYNITRHKKTRETLICCMAICVKKFSSLLTSSVLSYMEEETSKS  1790

Query  4579  NPS-DPSKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVS  4755
               S    + ++  E I  FV +I+EHS +SEP+  R AAA+SI+ASGLL+QA+ +   V 
Sbjct  1791  CESCQLERSALLYEYITLFVNLIKEHSSSSEPVTKRNAAAESIIASGLLEQAELIGSCVF  1850

Query  4756  NHQVPDG-----NKQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGK  4920
             ++++P G      + K+A+++Y  ++L++WFTC+KLLEDEDD +R+ L+L VQKC +S  
Sbjct  1851  SNEIPAGLSGSCFEPKEAVNMYGRQLLEIWFTCIKLLEDEDDAIRQWLALNVQKCFSSKA  1910

Query  4921  SGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVR  5100
             SGS F +  VP+QVEKVIE+SF +LS  FGHW+DY D L  WV +  N        D VR
Sbjct  1911  SGSSFHAVGVPMQVEKVIELSFGYLSYIFGHWIDYFDHLSQWVINGANYVTCK--GDIVR  1968

Query  5101  RVFDKEIDNHHEEK  5142
             RVFDKEIDNHHEE+
Sbjct  1969  RVFDKEIDNHHEEE  1982



>ref|XP_010032512.1| PREDICTED: thyroid adenoma-associated protein homolog isoform 
X2 [Eucalyptus grandis]
 ref|XP_010032513.1| PREDICTED: thyroid adenoma-associated protein homolog isoform 
X2 [Eucalyptus grandis]
Length=1784

 Score =  1999 bits (5180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1059/1808 (59%), Positives = 1324/1808 (73%), Gaps = 52/1808 (3%)
 Frame = +1

Query  286   VGTRVLKIVWNNLEDPLSQTVKQVHLIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLH  465
             +GTR+L+++W NLEDPLSQTVKQVHLIFDLFLDI+ TLHW + S++   FLRKIASDLL 
Sbjct  1     MGTRILRLIWKNLEDPLSQTVKQVHLIFDLFLDIRSTLHWGDNSDRIKLFLRKIASDLLC  60

Query  466   LGPRCKGRYIPLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLR  645
             LGPRCKGRY+PLASLTKRLGA+++L M PGLL +T +AY+DDDVC A T+FLKCFLE LR
Sbjct  61    LGPRCKGRYVPLASLTKRLGARALLGMRPGLLSETVQAYIDDDVCCAVTSFLKCFLENLR  120

Query  646   DEYWSTDGVEGGYIKYRAHCLLPILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLG  825
             D+ W TDG+E GY+ YR HCL P L GL+SG +KLRSNLNTYALPVLLE+D+DSIFPML 
Sbjct  121   DDCWKTDGIERGYVLYREHCLHPFLYGLASGASKLRSNLNTYALPVLLEVDIDSIFPMLA  180

Query  826   FIGIGCSAESTEIFYPELDSRDIVLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVA  1005
             FI +  + E  +  +  L+S    L +EQ+VAV VSLLKVSR+LA IEGDIDW E + + 
Sbjct  181   FISVTPTGEDNDFLHMGLNSTQADLSIEQKVAVAVSLLKVSRLLAWIEGDIDWLEKTLLD  240

Query  1006  LEVTDLSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLP  1185
               V  L  +     ++V +KGI++KI V +L+ ALTH+DDSLR+DAAE LF+NPKTASLP
Sbjct  241   RTVDGLEAEYVSGYALVCIKGIKMKILVEWLVQALTHVDDSLRVDAAEFLFLNPKTASLP  300

Query  1186  SSLELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLS  1365
             S+LEL LM++A+P+NMRC STAFQMKW SLFRKFFSRVRTALER +KQ  W P L    +
Sbjct  301   SNLELVLMKEAIPMNMRCSSTAFQMKWCSLFRKFFSRVRTALERQLKQQAWQPRLHHKGT  360

Query  1366  GSPLNGEADQSLKHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHML  1545
                L+  ++ +   RA NLF FM+W S FLFFSCYPSAPY+RKIMAMEL++IM++VW + 
Sbjct  361   EICLSIRSEDTSFSRANNLFFFMRWFSAFLFFSCYPSAPYKRKIMAMELIVIMMDVWAVA  420

Query  1546  PPQGKSDSYSSEISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGI  1725
             P Q ++  +S E SL+PYS+G+  P+ST LL+GSIIDSWDRLRE+SFRIL+HFPTP+PG+
Sbjct  421   PSQ-ENHLFSPE-SLHPYSRGITSPDSTFLLLGSIIDSWDRLRENSFRILVHFPTPLPGL  478

Query  1726  SSPELVCEAIIWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSG  1905
             SS ++V   I WAKKLVCSPRVRESDAGALT RLIFRKYVLE  W+V  S NV+  S S 
Sbjct  479   SSDQMVVNIIEWAKKLVCSPRVRESDAGALTLRLIFRKYVLEHRWIVTASVNVMCDSHSQ  538

Query  1906  LSNGENLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEM  2085
              S   +       PV++Y+ SLIDWL   V+EG++DLSEACK SFVHGVLL+LRYTFEE+
Sbjct  539   SSESMH-------PVMDYVWSLIDWLDVVVKEGKRDLSEACKNSFVHGVLLSLRYTFEEL  591

Query  2086  DWDSIAVAsnissiklllekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLER  2265
             DW+S AV S++S ++  L K+L LV+ ITSLALWVVSADAWYLP++M+EM  D    L+ 
Sbjct  592   DWNSDAVVSSMSEMRRALNKLLDLVLEITSLALWVVSADAWYLPEDMDEMVDDDNFVLDF  651

Query  2266  PIEMDVSASTPDDEM-KIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSD  2442
             P+E++  A  P  E+ + +K       ++Q+VMVGCWLAMKEVSLLLGTIIRK+PLPTS 
Sbjct  652   PVEVNDPA--PSSELDRCSKV-----GLEQVVMVGCWLAMKEVSLLLGTIIRKIPLPTST  704

Query  2443  VPKSCSQITDGTDQLS---SDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALC  2613
                S  + TD  D  +    ++VLDL+QLE +GNHFLEVLL+MKHNGAIDKTRAGFTALC
Sbjct  705   YSDSL-EPTDAADNSAVKIPEVVLDLKQLEAMGNHFLEVLLRMKHNGAIDKTRAGFTALC  763

Query  2614  NRLLCSNDPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPK  2793
             NRLLCSN+P LCKLTESWME LMERTV+KGQ VDDLLRRSAGIPAAF A FLSEPEGAPK
Sbjct  764   NRLLCSNNPELCKLTESWMELLMERTVAKGQVVDDLLRRSAGIPAAFIALFLSEPEGAPK  823

Query  2794  RLLPKALRWLINVAKKSLTDknkenssc--------sesssAIDSTMVPDVAAIEMISKT  2949
             +LLP ALRWLI+VA +SL D    N +          +   + +S +  D  A E  SK 
Sbjct  824   KLLPCALRWLIDVANQSLQDLYASNVAIGDLCIHRPEKIDHSAESALPVDSNANERTSKI  883

Query  2950  RDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTA  3129
             RDEGV+PTVHAFNVL+ AFND NLATD SGFSAEALIVSIR+FSS YWEVRNSACLAYTA
Sbjct  884   RDEGVIPTVHAFNVLRTAFNDTNLATDASGFSAEALIVSIRAFSSPYWEVRNSACLAYTA  943

Query  3130  LVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNL  3309
             LVRRMIGFLNV KRESARR+LTGLEFFHRYP+LH FL  ELKIATEL  +GS+ +  S+L
Sbjct  944   LVRRMIGFLNVHKRESARRSLTGLEFFHRYPSLHFFLLEELKIATELLDDGSTRHSESSL  1003

Query  3310  AKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALT  3489
             AKVVHPSLCP+LILLSRLKPS I SETGD  DPFLFMPFIR+CS Q N+RIR+LASRALT
Sbjct  1004  AKVVHPSLCPVLILLSRLKPSAIASETGDDLDPFLFMPFIRRCSTQRNMRIRVLASRALT  1063

Query  3490  GMVSNEKLPTVILNIASELPAIDNH-SMTSDLSGLSNLNAS----FNSIHGMLLQLSSLL  3654
             G+VSNEKLP +I+NIA++L  ++NH S  +     S+ N +    FN IHGMLLQL SLL
Sbjct  1064  GLVSNEKLPGIIVNIATDLSCLENHCSGIAIPHKFSSTNEAQHTPFNLIHGMLLQLCSLL  1123

Query  3655  DTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCE  3834
             DTNCRNL DFSKK+ ILSDLI +L K SWIGSP+ CPCP +N +FL+VLD+MLSIAR C 
Sbjct  1124  DTNCRNLVDFSKKDQILSDLIQLLAKCSWIGSPRWCPCPPVNTTFLRVLDHMLSIARGCR  1183

Query  3835  MSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKD-VNE  4011
               +    I NLL  L++E L L  S    Y+DP ++ELR+Q+A+SYF+C +Q S +   E
Sbjct  1184  SGETFCNIRNLLLELTAESLVLDGSCVLPYYDPAVSELREQSATSYFSCFFQVSNEKTAE  1243

Query  4012  EDLIYLRGPPPDSELFKESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPES  4191
              + +  +    D  L    ET  +  +  E+L+  LSD+LYEVR+ATLKWLL FL   ES
Sbjct  1244  NNHLSQKNCLSDINLLAR-ETPDASCQLLEKLVCCLSDSLYEVRLATLKWLLKFLGITES  1302

Query  4192  RTAESSNKSQSEIKLL--WLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNK-  4362
                     S SEI  +  W +N+ LQ  +M+LL++EKNHKC +YIL+I +T+N+QQYN+ 
Sbjct  1303  -GCHGHYFSSSEIAAVQQW-ANVNLQDTMMKLLSLEKNHKCTHYILRIFFTWNLQQYNQV  1360

Query  4363  NCGQHEKPTFVGNMDSDSVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSS  4542
              C  +    F+G MD D  LQ W +++SLY + RHAKT+  ++CCMAVCIKRLA L  +S
Sbjct  1361  GCQMNIGTKFMGVMDGDFTLQIWGRLLSLYNIVRHAKTQGTIICCMAVCIKRLAGLLANS  1420

Query  4543  ICSLGNEKVVVVNPSDPSKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLL  4722
             I     EK +        + +    CI  F ++I+ HS ++EP+N+R AAA+SI+ASG+L
Sbjct  1421  IFD-STEKTINECLVQLERQNQLYGCISMFNKLIELHSASTEPVNLRNAAAESIIASGML  1479

Query  4723  DQAQALSPSVSNHQVPDG----NKQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSL  4890
             +QA+ + P   N    +G    +  K+   +YAH++L +WFTC++LLEDEDDG+R++L+L
Sbjct  1480  EQAEVIGPLFRNKMPAEGRPSFSDTKEIAIVYAHQVLKMWFTCVRLLEDEDDGIRQKLAL  1539

Query  4891  EVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSA  5070
              VQKC    +     S+  VP QVEKV++ SFEHLSS FGHW++Y ++L  WV       
Sbjct  1540  NVQKCFMPRQLLGRSSASSVPTQVEKVLKSSFEHLSSIFGHWIEYFNYLAQWVHDT--EK  1597

Query  5071  CAVSIADPVRRVFDKEIDNHHEEKLLISQICCSHLEKLPVSKL-TTEFRD-NNICSVLQS  5244
             C  S  D VRRVFDKEIDNHHEEKLLI QICC H+EKL +S      F + ++I   L +
Sbjct  1598  CEKSGGDLVRRVFDKEIDNHHEEKLLICQICCLHMEKLFISSFWAVNFTEADSIKKNLYA  1657

Query  5245  WRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAED  5424
             WR RF  QLI+FG  ++ T+  V WIGGV NHKD FLP+Y NLL F+ALS C+L  +   
Sbjct  1658  WRTRFFTQLITFGEDHM-TKDDVFWIGGVANHKDTFLPLYANLLGFYALSKCLLSEDGIT  1716

Query  5425  SK-SMVPELLELGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDA  5601
             S   +V ++++L +A+  FLRNPLI NLF  VV+ HE+    + +  +L+       WD 
Sbjct  1717  SDLELVSDVIKLAKALSLFLRNPLILNLFCSVVELHERKFNLSADISLLKYRTDDLLWDF  1776

Query  5602  FDPYFLFR  5625
             FDPYFL +
Sbjct  1777  FDPYFLLK  1784



>ref|XP_006395331.1| hypothetical protein EUTSA_v10003503mg [Eutrema salsugineum]
 ref|XP_006395332.1| hypothetical protein EUTSA_v10003503mg [Eutrema salsugineum]
 gb|ESQ32617.1| hypothetical protein EUTSA_v10003503mg [Eutrema salsugineum]
 gb|ESQ32618.1| hypothetical protein EUTSA_v10003503mg [Eutrema salsugineum]
Length=2122

 Score =  1961 bits (5079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1068/1891 (56%), Positives = 1325/1891 (70%), Gaps = 106/1891 (6%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSR VL                  N+D   KTILYDGIL ELC+ CE+P DSH N
Sbjct  322   GILTAVSRGVL----------VSSFARLSNSDCDHKTILYDGILPELCDLCENPIDSHLN  371

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIKTS   T   + E YDP+ +   TRVLKI+WNNLEDPLSQTVKQVH
Sbjct  372   FHALTVMQICLQQIKTS---TLNDLSEDYDPMPDSKVTRVLKIIWNNLEDPLSQTVKQVH  428

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             ++FDL LDIQ T+H      +    L KI   LL LG RCKGRY+PLASLT+RLGAK++L
Sbjct  429   IMFDLLLDIQTTIHQTYDKVEVRESLVKIVEYLLRLGSRCKGRYVPLASLTRRLGAKTLL  488

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSP LLF+   AY+DDDVC A T+F+KCFLE LRDE W ++GVE G+  YR HCL P L
Sbjct  489   DMSPNLLFEMANAYIDDDVCCAVTSFIKCFLEMLRDECWGSEGVEQGFACYRQHCLPPFL  548

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYA+ VLLELDVDSIFP+L  I I  + E T +   EL +  + L
Sbjct  549   YGLASGISKLRSNLNTYAVQVLLELDVDSIFPLLALISIQPNGEETNLNCAELSNMGMEL  608

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              VEQ+VAVLVSLLKV R LA +EGDI+  E           S DA    ++V +KGIE+K
Sbjct  609   TVEQKVAVLVSLLKVCRTLAFLEGDIEQKE-----------SDDAF---ALVQIKGIELK  654

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +P+ +L +ALTH+D+S+R+DAAE+LF+NPKTASLPS LEL LM++AVPLNMR  ST FQM
Sbjct  655   VPIEWLKMALTHVDESVRVDAAETLFLNPKTASLPSPLELYLMKEAVPLNMRSSSTGFQM  714

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSRVRT+LE+ +K GTW P L    + +  N + D++   RAENLF FM+W
Sbjct  715   KWTSLFRKFFSRVRTSLEKQLKLGTWQPLLASGNNETCSNNKGDENAVLRAENLFKFMRW  774

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LS FL  SCYPSAPY RKIMA EL+ IM+ VW ++P +  +   S +  LYPY   +   
Sbjct  775   LSSFLCLSCYPSAPYRRKIMATELIQIMIEVWPIMPSKNPT---SRQGHLYPYCDIVTSH  831

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             ESTLLLVGSI+DSWDRLRE++FRILLHFPTP  G+SS  +V   I WAK+LVCSPRVRES
Sbjct  832   ESTLLLVGSIVDSWDRLRENAFRILLHFPTPFTGVSSEYMVQNIIPWAKQLVCSPRVRES  891

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVV-TQSPSGLSNGENLEFTPSSPVIEYITSLID  1977
             DAGALT RLIFRKYVL+LGW+V+VS NVV  Q      N  +L   P  PVIEYI SLI 
Sbjct  892   DAGALTLRLIFRKYVLDLGWIVKVSTNVVCCQRECESMNVFHLNSKPMYPVIEYIKSLIH  951

Query  1978  WLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilal  2157
             WL A+V+EGE+DLS+ACK SFVHGVLL LRYTFEE+DW+S AV S+IS ++  LEK+L L
Sbjct  952   WLDASVKEGERDLSKACKNSFVHGVLLALRYTFEELDWNSNAVLSSISEMRKELEKLLKL  1011

Query  2158  VMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEM--KIAKAEQ  2331
             V RIT+LALWVVSADA YLP++M+++  D   F +  ++ D +A+   +E   K  K  Q
Sbjct  1012  VTRITTLALWVVSADALYLPEDMDDIIEDDDFFSD--VQGDAAAAVLSEEHKNKYPKPVQ  1069

Query  2332  DDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVP-----KSCSQITDGTDQLSSD  2496
             +    +QIVMVGCWLAMKEVSLLLGTIIR +PLPTS +         S + D +   +S+
Sbjct  1070  ETIQSEQIVMVGCWLAMKEVSLLLGTIIRNIPLPTSSLTPLENGNLASALPDDSVIRNSE  1129

Query  2497  IVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQ  2676
              +LDL+QLE IG+HFLEVLLKMKHNGAIDKTRAGF+ALC+RLLCSNDPRLCKL ESWMEQ
Sbjct  1130  SLLDLKQLEKIGDHFLEVLLKMKHNGAIDKTRAGFSALCHRLLCSNDPRLCKLVESWMEQ  1189

Query  2677  LMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDk  2856
             LMERTV+KGQTVDDLLRRSAGIPAAF A FLSEPEG+PK+LLP+ALRWLI +A+K L D 
Sbjct  1190  LMERTVAKGQTVDDLLRRSAGIPAAFIALFLSEPEGSPKKLLPQALRWLIGLAEKPLMDP  1249

Query  2857  nkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTS  3036
              ++    S       S M P     E ISK RDEGVVPTVHAFNVLKAAFND NL TDTS
Sbjct  1250  MEQKGFKSMDVEVNSSDMHPS----EKISKIRDEGVVPTVHAFNVLKAAFNDTNLGTDTS  1305

Query  3037  GFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHR  3216
             GFSA A+IVSIRSFSS YWEVRNSA LAYTAL+RRMIGFLNVQKR S+RRALTGLEFFHR
Sbjct  1306  GFSAVAMIVSIRSFSSPYWEVRNSATLAYTALLRRMIGFLNVQKRGSSRRALTGLEFFHR  1365

Query  3217  YPTLHTFLFNELKIATELF-LEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETG  3393
             YP LH F+ NELK AT+L  + G S+   SNLA +VHPSL P+LILLSRLKPSPI SETG
Sbjct  1366  YPLLHPFIHNELKAATDLLDISGPSD---SNLANLVHPSLWPILILLSRLKPSPIASETG  1422

Query  3394  DPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMT  3573
             D  DPF+FMPFI KCS Q+NLR+R+LASRAL G+VSNEKL +V+L IAS LP+       
Sbjct  1423  DDLDPFVFMPFIMKCSTQSNLRVRVLASRALVGLVSNEKLQSVLLRIASTLPSNRTR---  1479

Query  3574  SDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSP  3753
                        SFN +HG++LQL +LL+ NCR+L+D SKK  I+  LI  L K +W+ SP
Sbjct  1480  ---------GGSFNYLHGIMLQLGNLLEINCRDLSDESKKGQIMKQLIDALAKCTWMASP  1530

Query  3754  QKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDP  3933
               C CPIL+ SFL+VLD+M  I  TC  SK +  I+ L   LS+ CLD   S    Y+DP
Sbjct  1531  LLCSCPILSTSFLRVLDHMRDIEWTCSESKNLRNIYKLHLDLSTNCLDADASFGFPYYDP  1590

Query  3934  TIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQERLIR  4113
             TIAELR+QAA SYF C +Q     +E   ++      +    K  E  +  +  +ERL+R
Sbjct  1591  TIAELREQAAVSYFGCVFQP---FDEATKVFQITEKANLRQQKVPEA-LDFSDLKERLLR  1646

Query  4114  SLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVE  4293
              +SD  YEVR+ATLKWLL FL S +S  +E+S+         W  N GLQ ML++LL  E
Sbjct  1647  CISDQSYEVRLATLKWLLQFLKSEDSSFSETSSIWN------WAKN-GLQVMLLELLDKE  1699

Query  4294  KNHKCMNYILKIIYTYNMQQYNKNC-GQHEKPTFVGNMDSDSVLQFWDKVVSLYKVTRHA  4470
             KNHKC NYIL+I   +N+  + K+  G+  +  +VG+++ DSV   W K+ SLY+ TR A
Sbjct  1700  KNHKCENYILRIFCQWNLLMFQKSSNGEPLESIYVGSLNYDSVFHLWGKLTSLYESTRRA  1759

Query  4471  KTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECIDYFVEVIQE  4650
             KTR  L+CC+A+C+K L  LF+       NE      P          +C+ YFV +I++
Sbjct  1760  KTRGTLMCCLAICVKHLTGLFSHK-----NESEKEEGPG----WGCVIDCVSYFVNLIKQ  1810

Query  4651  HSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDG--NKQKDALHLYAHKILD  4824
              S +SE +N+R A+A++I+ASG+L+QAQ + P VSNHQ  +   +K ++A +++A++IL+
Sbjct  1811  KSSSSEQVNVRYASAEAIIASGILEQAQLIGPLVSNHQTSEATPSKFQNACNVFAYQILE  1870

Query  4825  LWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGV-VPIQVEKVIEMSFEHLSS  5001
             +WFTC+KLLEDEDD +R +L+ +VQKC         FS+ +  P QVEKV+E+SF HLSS
Sbjct  1871  MWFTCIKLLEDEDDLIRSKLATDVQKCF--------FSTAMEAPTQVEKVLELSFNHLSS  1922

Query  5002  TFGHWLDYLDFLCHWV-QSATNSACAVSIADPVRRVFDKEIDNHHEEKLLISQICCSHLE  5178
              FGHW +YL +L   V  +A  ++     +D VRRVFDKEIDNHHEEKLLI Q CC HL+
Sbjct  1923  VFGHWDEYLQYLSKLVFNTADYTSPPKGSSDLVRRVFDKEIDNHHEEKLLILQFCCCHLQ  1982

Query  5179  KLPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLP  5358
             KL    L+         + L  WR RF  QL+SF   ++G Q    W+GGVGNHKD FLP
Sbjct  1983  KLANRDLSR--------AQLLEWRCRFHNQLLSFSRDHVGKQRE-SWVGGVGNHKDVFLP  2033

Query  5359  VYVNLLAFHALSNCILR--GEAEDSKSMVPELLELGEAIQPFLRNPLISNLFVLVVKSHE  5532
             +Y NLL  +  S+ + R   +  D KS++ +++ELGE+++PFLRNPL+SN+F +VVK HE
Sbjct  2034  LYGNLLGLYVFSDSVFRLSTDGNDKKSLLADMVELGESLKPFLRNPLVSNMFRVVVKLHE  2093

Query  5533  KIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             K    ++  L   + G    W+ FDPYFL R
Sbjct  2094  KSMDDSLVDLSTVLVG--EIWEGFDPYFLLR  2122



>ref|XP_010937104.1| PREDICTED: thyroid adenoma-associated protein homolog [Elaeis 
guineensis]
Length=2213

 Score =  1953 bits (5059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1095/1952 (56%), Positives = 1341/1952 (69%), Gaps = 133/1952 (7%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTA+ R VLN   V                    TILY+GIL ELC +CE+P DSHFN
Sbjct  318   GILTAIPRNVLNTPLVELTI------------CMAWTILYNGILPELCKYCENPIDSHFN  365

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIKTS+          Y+P+ E++   +L+I+WNNLEDPLSQTVKQVH
Sbjct  366   FHALTVMQICLQQIKTSILAELTDFSGDYEPLPEDMIGHILRIIWNNLEDPLSQTVKQVH  425

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDL LDI+ +L   EG+E++ S L KIA DLL LG RCKGRY+PLASLTKRLGAK++L
Sbjct  426   LIFDLLLDIESSLPSVEGNERYKSLLFKIAGDLLQLGTRCKGRYVPLASLTKRLGAKTLL  485

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             +++P LLF+T  AY+DDDVC AAT+FLKCFLECLRDE WS DG++ GY  +R   L P+L
Sbjct  486   ELNPDLLFETAYAYIDDDVCCAATSFLKCFLECLRDECWSHDGIDKGYDSFREFSLPPLL  545

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL SG +KLRSNLNTYAL V+L++D DSIFPML FI +G S               + L
Sbjct  546   HGLISGNSKLRSNLNTYALSVMLDVDTDSIFPMLAFISVGPSIGEHRF--------SMDL  597

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              ++Q VA LVSLLKVSR LALIEGDID    S    + +D       C ++V +KGI V+
Sbjct  598   KIDQCVAALVSLLKVSRSLALIEGDIDLHHDSLTQQKNSD-------CVALVCIKGINVR  650

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             IPV +L+LALTH DDSLRIDAAESLF+NPKT+SLPSSLELSLM++AVPLNMRC STAFQM
Sbjct  651   IPVEWLILALTHADDSLRIDAAESLFLNPKTSSLPSSLELSLMKEAVPLNMRCSSTAFQM  710

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSRVRTALER +KQG W P+          +  A  ++ HRA +LF FMKW
Sbjct  711   KWTSLFRKFFSRVRTALERQVKQGLWQPTACSGGMQDHPDDYAQDAMVHRARDLFQFMKW  770

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LSCFLF+SCYPSAPYERK MAMEL+LIM++VW   PPQG          LYPYS+G+   
Sbjct  771   LSCFLFYSCYPSAPYERKTMAMELILIMIDVWPPQPPQGTR-------LLYPYSEGITSS  823

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             +STL LVGS+IDSWDRLRE+SFRILL FPTP+PGISS   V   I WAKKLVCSPRVRES
Sbjct  824   DSTLSLVGSVIDSWDRLRENSFRILLCFPTPLPGISSNGSVNHLIRWAKKLVCSPRVRES  883

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVV-TQSPSGLSNGENLEFTPSSPVIEYITSLID  1977
             DAGALT RLIF+KYVL+LGW++R S +V    S + L NG+ L+    +P++EYI+SLI+
Sbjct  884   DAGALTLRLIFKKYVLDLGWIIRASGDVACVNSQTELMNGDILK--SRTPLVEYISSLIE  941

Query  1978  WLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilal  2157
             WLC  VEEGEKDLSEAC  SFVHGVLLTLRYTFEE+DW+S AV SN S I+ LLEK+L L
Sbjct  942   WLCVVVEEGEKDLSEACSNSFVHGVLLTLRYTFEELDWNSEAVQSNCSEIRCLLEKLLEL  1001

Query  2158  VMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQDD  2337
             +MR+T LALWVVSADAWY+P +M++M  D A   E P+EMD S S  +      K+E D 
Sbjct  1002  IMRVTKLALWVVSADAWYMPYDMDDMVDDAAFLSEVPLEMDPSESLSEPVDSNLKSENDV  1061

Query  2338  GPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQ--ITDGTDQLS----SDI  2499
              P +Q+VMVGCWLAMKEVSLLLGTIIRK+PLP+  +  S  Q       D++     SD 
Sbjct  1062  IPAEQVVMVGCWLAMKEVSLLLGTIIRKMPLPSCTLSDSSGQDYPHSNADEIECINMSDG  1121

Query  2500  VLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQL  2679
             +LDL QLE IGNHFL+VLLKMKHNGAIDKTRAGFTALCNRLLCSN PRLC LT+SWMEQL
Sbjct  1122  MLDLVQLETIGNHFLQVLLKMKHNGAIDKTRAGFTALCNRLLCSNVPRLCNLTDSWMEQL  1181

Query  2680  MERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDkn  2859
             MERT++KGQTVDDLLRRSAGIPAAF A FLSEPEG PK+LLP+ALRWLI+VA +SL +  
Sbjct  1182  MERTIAKGQTVDDLLRRSAGIPAAFIALFLSEPEGTPKKLLPRALRWLIDVANRSLCNAP  1241

Query  2860  kensscsesssAIDSTMVPDVAAIEMI---------SKTRDEGVVPTVHAFNVLKAAFND  3012
             ++    +E       T   D +  +M          SK RDEGVVPTVHAFNVL+AAFND
Sbjct  1242  EDGGWKTEVVLKDLFTNQNDTSLGDMTTETHVNMRASKIRDEGVVPTVHAFNVLRAAFND  1301

Query  3013  ANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRAL  3192
              NLA DTSGF ++A+IVSIRSFSS YWEVRN ACLAYTALVRRMIGFLNVQKR+SARRAL
Sbjct  1302  TNLAADTSGFCSDAMIVSIRSFSSPYWEVRNGACLAYTALVRRMIGFLNVQKRQSARRAL  1361

Query  3193  TGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPS  3372
             TGLEFFHRYP LH FLF+ELKIAT +  +  S ++ SN+AK +HPSLCP+LILLSRLKPS
Sbjct  1362  TGLEFFHRYPALHPFLFSELKIATAMLGDACSGHVESNMAKSIHPSLCPILILLSRLKPS  1421

Query  3373  PITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPA  3552
              I+S   D  DPFLFMPFIR+C+ Q+NLR+R+LASRAL G+VSN+KL  VI  +   LP 
Sbjct  1422  LISSGMDDTLDPFLFMPFIRRCATQSNLRVRVLASRALIGLVSNDKLQIVINEVVHGLPP  1481

Query  3553  IDNHSMTSDLSGLSNLN----------------------------ASFNSIHGMLLQLSS  3648
               +   TS  S  +N++                            ASFNSIHG+LLQLSS
Sbjct  1482  GRHWMPTSSTSISANMSNGDVTTVTSSASTSSNMSNSDITRATCAASFNSIHGLLLQLSS  1541

Query  3649  LLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIART  3828
             LLD NCRNL D  KK+ IL +LI VL + SWIGS   CPCP LN S+L+VLD ML IART
Sbjct  1542  LLDNNCRNLIDIGKKDHILGELIKVLARCSWIGSINLCPCPTLNSSYLRVLDLMLEIART  1601

Query  3829  CEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVN  4008
             C  S+ ++ I  LL  L+SECL    S      DPT  ELR+QAASSYF+C      +  
Sbjct  1602  C-TSQHLATIQTLLLELASECLGAENSLGSLQHDPTKLELRRQAASSYFSCLLGGIPEAL  1660

Query  4009  EEDLIYLRGPPPDSELFKESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPE  4188
             EED    R  PP   L + SE  +S    QER++  + D+ YEVRIA LK LL       
Sbjct  1661  EEDNQLQRYTPPTLNLSRVSEVDISPFELQERIMSCICDSAYEVRIAMLKSLL-------  1713

Query  4189  SRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYN-MQQYNKN  4365
              R  +S+     +  +   +   LQ MLM +L VE++ KC+ Y+L II+ +N ++    N
Sbjct  1714  -RLVKSTKLGDGDGIIYKWARPNLQPMLMNVLFVEEDPKCVYYVLMIIFNWNILRLVMPN  1772

Query  4366  CGQHEKPTFVGNMDSDSVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSI  4545
               Q EKP++VG  D DS    WD++V L      AKTRE+++CCM +C+K+  +L  +SI
Sbjct  1773  DLQVEKPSYVGT-DCDSAFCLWDRLVHLNSTMMRAKTREIILCCMGICMKQFVELLRNSI  1831

Query  4546  CSLGNEKVV-VVNPSDPSKL------SVFSECIDYFVEVIQEHSDASEPINMRKAAAQSI  4704
              S  N+ ++     SD S++      +     ++ F+ +++ HS  SEP++MRKA A++I
Sbjct  1832  YS--NQHLIEKETTSDHSRIDQAMGWAKAFRSVNSFINLVKHHSSPSEPVSMRKATAEAI  1889

Query  4705  VASGLLDQAQALSPSVSNHQVPDGN------------KQKDALHLYAHKILDLWFTCMKL  4848
             VASGLL++A++++  VSN  +P               K  + ++LYA +ILDLWFTC++L
Sbjct  1890  VASGLLEEAKSVASFVSNSHIPSEEPNVSDLEKLSQLKMFEVINLYACRILDLWFTCIQL  1949

Query  4849  LEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYL  5028
             LEDED GLR++L+  VQKCI        F +  VP QV++VIE SFE LSS FGHWL Y 
Sbjct  1950  LEDEDVGLRQRLAKNVQKCINFKGLNGSFKNDAVPTQVDRVIESSFEFLSSVFGHWLGYF  2009

Query  5029  DFLCHWVQSATNSACAVSIADPVRRVFDKEIDNHHEEKLLISQICCSHLEKLPVSK----  5196
             ++L   V S   S    S AD VRR+FDKEIDNHHEEKLLI QICCSHL++L  SK    
Sbjct  2010  NYLSRLVLSTAISVS--SHADLVRRIFDKEIDNHHEEKLLICQICCSHLQQLSTSKPWMV  2067

Query  5197  -LTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNL  5373
              +   F  + I   LQSWR RF  QLISF  +++  +G  DWIGG+GNHKDAF+ +Y NL
Sbjct  2068  GVDEAFNKSTIKVFLQSWRLRFLCQLISFIKSFLNIEGRTDWIGGIGNHKDAFVSIYANL  2127

Query  5374  LAFHALSNCILRGEA-----EDSKSMVPELLELGEAIQPFLRNPLISNLFVLVVKSHEKI  5538
             L  +AL+ C     +     +  K  V E LEL E + PF+RNPLISNL+ LV++SHEK+
Sbjct  2128  LGLYALTQCPHEDHSSAQTTDTHKIYVSEFLELRELVGPFIRNPLISNLYFLVIQSHEKM  2187

Query  5539  AGGAVEHLVL---EISGAYSAWDAFDPYFLFR  5625
              G      VL   +  G YS W+ FDPYFL R
Sbjct  2188  LG------VLQAPQFEGGYSVWNGFDPYFLLR  2213



>gb|EPS68931.1| hypothetical protein M569_05834 [Genlisea aurea]
Length=2127

 Score =  1944 bits (5035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1073/1891 (57%), Positives = 1353/1891 (72%), Gaps = 106/1891 (6%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSR VL+  +VVS +         ++ S+ KTI+YD IL ELC + E+P D+H N
Sbjct  327   GILTAVSREVLDTHYVVSCEYL------SDSKSTTKTIIYDAILPELCVYAENPCDTHSN  380

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIKT +QG+     +GY PISEE+ TR+++IVWNNLEDPLSQTVKQVH
Sbjct  381   FHALTVMQICLQQIKTLLQGSACSFPDGYTPISEEMETRIIRIVWNNLEDPLSQTVKQVH  440

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDIQ +    +  + F   +RKIAS+LL++G RCKGRY+P ASLTKRLGA++IL
Sbjct  441   LIFDLFLDIQSSTKCIDSLKLF---MRKIASNLLNMGARCKGRYVPWASLTKRLGARTIL  497

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              M   LL +T KAYVDDDVC AATTFLKCFLE LR+E+ + DGV  G IKYR  CL P L
Sbjct  498   SMDSELLSETVKAYVDDDVCCAATTFLKCFLEYLREEFCAMDGVALGSIKYRNQCLPPFL  557

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
             +GL+   AKLR NL+TYALP LLE+D +SIF +L  +GI   +E+  +F  E+   ++ L
Sbjct  558   NGLALENAKLRCNLSTYALPALLEIDTESIFYLLASVGI--RSENHLLFSEEVSCTELAL  615

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
               EQ+VA+LVSLLKVSR LAL+EGDIDWCE      + + L  + G    VV ++GI+VK
Sbjct  616   RPEQQVAILVSLLKVSRALALLEGDIDWCEEFQPCRDGSSLDVEDGYLYCVVGIRGIDVK  675

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             IPV +L+LAL++ D+SLRIDAAE+LF+NPKT+SLPS LE+SLMRKA+PLNMRCCST+FQM
Sbjct  676   IPVRWLVLALSNTDESLRIDAAETLFLNPKTSSLPSHLEISLMRKAIPLNMRCCSTSFQM  735

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSR RT LER IK GT +      L+G  L   A+ +   R ENLFNF+KW
Sbjct  736   KWTSLFRKFFSRARTGLERHIKLGTCNFLFSGGLNGLHLENGAEIATGERVENLFNFLKW  795

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHM---LPPQGKSDSYSSEISLYPYSKGL  1611
              SCFLFFSCYPSAPYERKIMAMEL+LIM+NVW +   LP  G+ + +SSE    PYSK  
Sbjct  796   FSCFLFFSCYPSAPYERKIMAMELLLIMINVWPVSSTLP--GRLNVFSSETIQCPYSKSF  853

Query  1612  ILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRV  1791
              +P+STL+LVGSI+DSWD LRE+SFRILL FPTP+PGISS +LV   IIWAKKLV SPRV
Sbjct  854   NMPDSTLMLVGSIVDSWDHLRENSFRILLSFPTPLPGISSADLVRGTIIWAKKLVSSPRV  913

Query  1792  RESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSP-SGLSNGENLEFTPSSPVIEYITS  1968
             RE+DAGALT RLIFRKYVL+LGW+V+ SC+VV+ S  +   NG       SSP + Y+ S
Sbjct  914   RETDAGALTLRLIFRKYVLDLGWIVKPSCDVVSSSSNTERQNGVYENHFSSSPAMIYLAS  973

Query  1969  LIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissikllleki  2148
             LIDW+  AV + E++L+E+CK S VHG+LLTLRYTFEE++WDS  + +  S +K+LLE++
Sbjct  974   LIDWVLIAVRDAEQNLTESCKNSSVHGILLTLRYTFEELNWDSSDIMNGTSEMKVLLERL  1033

Query  2149  lalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMD-VSASTPDDEMKIAKA  2325
             L LV+RI+SLAL  VS+ AW LPD+ME++  D   FLE   E+D     +   EM+ +  
Sbjct  1034  LDLVLRISSLALGAVSSSAWSLPDDMEDIVNDTESFLETSDEIDSYDCYSQVGEMRSS--  1091

Query  2326  EQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVL  2505
                    +QI+MV  WLAMKEVSLLLGTIIRKVPLP S    +        D L+SD ++
Sbjct  1092  -------EQILMVSSWLAMKEVSLLLGTIIRKVPLPGSVEATAEVSNLSKIDALNSDAMV  1144

Query  2506  DLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLME  2685
              +RQLE IG+HFLEVLLKMKHNGA+DKTRAGFTALCNRLLCSN+PRLC+LTESWME LME
Sbjct  1145  SVRQLETIGSHFLEVLLKMKHNGAVDKTRAGFTALCNRLLCSNNPRLCQLTESWMELLME  1204

Query  2686  RTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKK-SLT-Dkn  2859
             RT+S+GQTVDDLLRRSAGIPAAF+AFFL+EPEG PK LLP+ALR L++V KK S+T  K 
Sbjct  1205  RTLSEGQTVDDLLRRSAGIPAAFSAFFLAEPEGLPKVLLPRALRRLLDVVKKFSVTFSKA  1264

Query  2860  kensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSG  3039
                 S   + S+   T++P V     ISK RDEGVVPT HAFNVL+A+FND NLATDTSG
Sbjct  1265  TAIKSDMCNGSSTGRTLLPVVE----ISKFRDEGVVPTAHAFNVLRASFNDTNLATDTSG  1320

Query  3040  FSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRY  3219
             F AEALI+SI+SFSSS+WE+RNSA LAYT+LVRRMIGFLNV KRESARRALT LEFFHRY
Sbjct  1321  FCAEALILSIQSFSSSHWEIRNSASLAYTSLVRRMIGFLNVHKRESARRALTALEFFHRY  1380

Query  3220  PTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDP  3399
             P LH F  NELK+ATEL +  SS++L S+L  +VHPSL PMLILLSRLKP  I+ + GD 
Sbjct  1381  PLLHAFFLNELKVATELLVGRSSDDLRSDLKSIVHPSLYPMLILLSRLKPLLISGDAGDH  1440

Query  3400  FDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSD  3579
              DP LFMPFIR CS+QNN +IR+LAS+ALT +VS  KL  V+LNIASELP+ D       
Sbjct  1441  LDPSLFMPFIRSCSVQNNFKIRLLASKALTSLVSYGKLEGVLLNIASELPSDD-------  1493

Query  3580  LSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQK  3759
                   +  SFN IHG+LLQL+SL+DTNCR++ D SKK+ IL  LI ++ K SWIG P+ 
Sbjct  1494  -----RVPVSFNLIHGILLQLNSLVDTNCRSMTDSSKKDGILLGLIEIVAKRSWIGRPRL  1548

Query  3760  CPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPTI  3939
             C CP+LN   +K+LDNMLS A  CE S+  + I NLL+ L SECLD     R ++ DPT+
Sbjct  1549  CTCPMLNSCMIKLLDNMLSAAINCESSRSAASIRNLLYGLCSECLDFEFGDRVSFSDPTV  1608

Query  3940  AELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQERLIRSL  4119
              ELRKQAA+S+FNC ++ SK++ E+ +    G   ++  F E         F+ RLI   
Sbjct  1609  QELRKQAAASFFNCVWRNSKEIAEDRVCSSGGAADENVDFAE---------FKNRLICCT  1659

Query  4120  SDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEKN  4299
             SD  YEVRIATLKW  LFL+S    T E                  LQ  +++LL  EK+
Sbjct  1660  SDESYEVRIATLKW--LFLSSEICLTGEV-----------------LQDKVVELLHSEKH  1700

Query  4300  HKCMNYILKIIYTYN---MQQYNKNCGQHEKPTFVGNMDSDSVLQFWDKVVSLYKVTRHA  4470
             HKC+ Y+LKI+Y +N   +Q    N  + +K  F+G MD  SVL+ W+++VSL+++TRH+
Sbjct  1701  HKCLQYLLKILYAWNSIELQDEGGNNKRIQKSGFIGEMDRHSVLKLWNRLVSLFEITRHS  1760

Query  4471  KTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECID---YFVEV  4641
             KT E LVCCM +CI+R+++L  S I    +E+   ++ +DPS  +VFS+  D   YFV +
Sbjct  1761  KTGEALVCCMGICIRRISNLCISFI----SERADAIS-TDPS--NVFSDLYDPFCYFVHL  1813

Query  4642  IQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGNKQKDALHLYAHKIL  4821
             I   SDASEP N+R AAA+S+VAS +L QA  +   +S          ++A+ LYA K+L
Sbjct  1814  ISRLSDASEPGNIRNAAARSMVASDVLAQADKMGFLIST-----TFDFEEAVRLYADKLL  1868

Query  4822  DLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEHLSS  5001
             +LW TC+KLLEDED GLRK+L+ +VQK  T+G+  + F + +  IQV++VIE+ FEHLS+
Sbjct  1869  ELWSTCVKLLEDEDAGLRKKLAFDVQKYFTAGE--TFFPTSM--IQVDRVIELCFEHLSA  1924

Query  5002  TFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNHHEEKLLISQICCSHLEK  5181
              FG W DYL+FLC +V +A N  C +S  D VRRVFDKEIDNHHEEKLLI  +CCSH+EK
Sbjct  1925  VFGSWPDYLNFLCRYVINAAN--CVLSDGDLVRRVFDKEIDNHHEEKLLICHLCCSHIEK  1982

Query  5182  LPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQG-GVDWIGGVGNHKDAFLP  5358
             L  S    +F    I  +L  WR RF ++L+SF +     +   VDWIGGVGNHK+AFLP
Sbjct  1983  LYSS---AQFE---ITDLLVDWRSRFLKRLMSFIDECSAKRAINVDWIGGVGNHKNAFLP  2036

Query  5359  VYVNLLAFHALSNCILRGEAEDSKS--MVPELLELGEAIQPFLRNPLISNLFVLVVKSHE  5532
             VY NLLAF+ALSNCIL+ E E S    +V E+  LGE ++ FL NPLI+NL++ +++SHE
Sbjct  2037  VYANLLAFYALSNCILKREPEKSAEVMVVSEVSALGETMKEFLGNPLIANLYLSILRSHE  2096

Query  5533  KIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             + +G  V  +V +       W+ F PYFL R
Sbjct  2097  ERSGNEVVVVVDDSGRELCYWEEFQPYFLLR  2127



>ref|XP_008784315.1| PREDICTED: thyroid adenoma-associated protein homolog [Phoenix 
dactylifera]
Length=2214

 Score =  1938 bits (5020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1087/1952 (56%), Positives = 1342/1952 (69%), Gaps = 133/1952 (7%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTA+ R +LN       +                T+LY+GIL  LC +CE+P DSHFN
Sbjct  319   GILTAIPRNLLNTRLTELTN------------CMAWTVLYNGILPGLCKYCENPIDSHFN  366

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIKTS+          Y+P+ E++ +R+L+I+WNNLEDPLSQTVKQVH
Sbjct  367   FHALTVMQICLQQIKTSILAELTDFSGDYEPLPEDMISRILRIIWNNLEDPLSQTVKQVH  426

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDL LDI  +L   EG+E++ S L  IA DLLHLG RCKGRY+PLASLTKRLGAK++L
Sbjct  427   LIFDLLLDIGSSLPSVEGNERYKSLLCNIAGDLLHLGTRCKGRYVPLASLTKRLGAKTLL  486

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             +++P LLF+T  AY+DDDVC AAT+FLKCFLECLRDE WS DG++ GY  +R   L P+L
Sbjct  487   ELNPDLLFETAYAYIDDDVCCAATSFLKCFLECLRDECWSHDGIDKGYDSFREFSLPPLL  546

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL SG +KLRSNLNTYALPV+L++D DSIFPML FI +G S   +          ++ L
Sbjct  547   HGLISGNSKLRSNLNTYALPVILDVDTDSIFPMLAFISVGPSIGESRF--------NMDL  598

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              ++  VA LVSLLKVSR LAL+EGDID    S    + +D         ++V +KGI V+
Sbjct  599   KIDHCVAALVSLLKVSRSLALLEGDIDLYHDSLTQQKNSDYI-------ALVCIKGINVR  651

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             IPV +L+LAL H DDSLRIDAAESLF+NPKT+SLPSSLELSLM++AVPLNMRC STAFQM
Sbjct  652   IPVEWLILALAHADDSLRIDAAESLFLNPKTSSLPSSLELSLMKEAVPLNMRCSSTAFQM  711

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSG---SPLNGEADQSLKHRAENLFNF  1431
             KW SLFRKFFSRVRTALER +KQG W P+   C  G   SP +  A  ++ HRA +LF F
Sbjct  712   KWTSLFRKFFSRVRTALERQVKQGLWQPT--ACSGGIEDSP-DDYAQDAMVHRARDLFQF  768

Query  1432  MKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGL  1611
             MKWLSCFLF+SCYPSAPYERKIMAMEL+LIM++VW   PPQG          LYPYS+G+
Sbjct  769   MKWLSCFLFYSCYPSAPYERKIMAMELILIMIDVWPPRPPQGTH-------LLYPYSEGI  821

Query  1612  ILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRV  1791
                +STL LVGSIIDSWDRLRE+SFRILL FPTP+PGISS + V   I WAK+LVCSPRV
Sbjct  822   TSSDSTLSLVGSIIDSWDRLRENSFRILLCFPTPLPGISSNDSVNHLIRWAKRLVCSPRV  881

Query  1792  RESDAGALTFRLIFRKYVLELGWVVRVSCNVV-TQSPSGLSNGENLEFTPSSPVIEYITS  1968
             RESDAGALTFRLIF+KYVL+LGW++  S NVV   S + L NG+  +    SPV+EYI+S
Sbjct  882   RESDAGALTFRLIFKKYVLDLGWIIGASGNVVCVNSQTELMNGDIPK--TRSPVVEYISS  939

Query  1969  LIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissikllleki  2148
             LI+WL   VEEGEKDLSEAC+ SFVHGVLLTLRYTFEE++W+S AV S  S ++ LLEK+
Sbjct  940   LIEWLYVVVEEGEKDLSEACRNSFVHGVLLTLRYTFEELNWNSEAVLSCCSEMRCLLEKL  999

Query  2149  lalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAE  2328
             L L+MR+T LALWVVSADAW +P +M++M  D A   E P+EMD S S  +      K+E
Sbjct  1000  LELIMRVTKLALWVVSADAWCMPYDMDDMVDDAAFLSEVPLEMDPSESLSEPVDSNLKSE  1059

Query  2329  QDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQ-----ITDGTDQLS-  2490
              D  P +Q+VMVGCWLAMKEVSLLLGTIIRK+PLP+  +  S SQ       D  + ++ 
Sbjct  1060  NDVRPAEQVVMVGCWLAMKEVSLLLGTIIRKIPLPSCTLSDSSSQDYPHSNADDIESINM  1119

Query  2491  SDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWM  2670
             SD +LDL QLE IGNHFL+VLLKMKHNGAIDKTRAGFTALCNRLLCSN PRLCKLT+SWM
Sbjct  1120  SDGILDLVQLETIGNHFLQVLLKMKHNGAIDKTRAGFTALCNRLLCSNVPRLCKLTDSWM  1179

Query  2671  EQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLT  2850
             EQLMERT +KGQTVDDLLRRSAGIPAAF A FLSEPEG PK+LLP+AL+WLI+VA KSL 
Sbjct  1180  EQLMERTTAKGQTVDDLLRRSAGIPAAFIALFLSEPEGTPKKLLPRALQWLIDVANKSLC  1239

Query  2851  DknkensscsesssAIDSTMVPDVAAIEM---------ISKTRDEGVVPTVHAFNVLKAA  3003
             +  ++    +E      ST   D A  +M          SK RD+GVVPTVHAFNVL+AA
Sbjct  1240  NAPEDGDWKTEVVHKELSTNQNDTALGDMKTETHVNIRASKIRDKGVVPTVHAFNVLRAA  1299

Query  3004  FNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESAR  3183
             FND NLA DTSGF ++A+IVSIRSFSS YWEVRN ACLAYTALVRRMIGFLNVQKR+SAR
Sbjct  1300  FNDTNLAADTSGFCSDAMIVSIRSFSSPYWEVRNGACLAYTALVRRMIGFLNVQKRQSAR  1359

Query  3184  RALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRL  3363
             RALTGLEFFHRYP LH FLF+ELKIAT +  +  S ++ SN+AK +HPSLCP+LILLSRL
Sbjct  1360  RALTGLEFFHRYPALHPFLFSELKIATAMLRDACSGHMESNMAKSIHPSLCPVLILLSRL  1419

Query  3364  KPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASE  3543
             KPS I+S   D  DPFL MPFI +C+ Q+NLR+R+LASRAL G+VSN+KL TVI  +   
Sbjct  1420  KPSLISSGMDDALDPFLLMPFIWQCATQSNLRVRVLASRALIGLVSNDKLQTVINEVVHG  1479

Query  3544  LPAIDNHSMTSDLSG-LSNLN-------------------------ASFNSIHGMLLQLS  3645
             LP   + +  + LS  +SN +                         ASFNSIHG+LLQLS
Sbjct  1480  LPHGRHSTSRASLSANMSNGDVTTATSSASMSANMSNSDISRATCAASFNSIHGLLLQLS  1539

Query  3646  SLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIAR  3825
             SLLD NCRNL D  KK+ IL +LI  L K SWIGS   CPCP LN S+L+VLD ML IAR
Sbjct  1540  SLLDNNCRNLIDIGKKDQILGELIKELAKCSWIGSINLCPCPTLNSSYLRVLDLMLDIAR  1599

Query  3826  TCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDV  4005
             T   S+ ++ I   L  L+SECL    S      DPT  ELR+QAASSYF+C      + 
Sbjct  1600  T-YTSQHLATIQTFLLELASECLGAENSFGLLLHDPTKLELRRQAASSYFSCLLGGIPEA  1658

Query  4006  NEEDLIYLRGPPPDSELFKESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSP  4185
              EED+   R   P   L + SE  +S    QER++  +SD+ YEVRIATLK LL  + S 
Sbjct  1659  PEEDMQLQRFTSPTLNLLRVSEVDISPLELQERIMSCISDSTYEVRIATLKGLLRLVKSM  1718

Query  4186  ESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKN  4365
             +    +        I   W +   LQ ML  +L VE+N KC+ Y+L+II+ +N+ +   +
Sbjct  1719  KVGDGDG-------IIYKW-ARPNLQPMLTNVLFVEENPKCVYYVLRIIFNWNILRLVMS  1770

Query  4366  CG-QHEKPTFVGNMDSDSVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSS  4542
              G Q EKP ++G  D DS    WD++V L      AKTRE+++CCM +C+K+  +L  +S
Sbjct  1771  NGLQVEKPNYIGT-DCDSAFCLWDRLVHLNSTMMRAKTREIILCCMGICVKQFVELLRNS  1829

Query  4543  ICSLGNEKVV-VVNPSDPSKLSVFS------ECIDYFVEVIQEHSDASEPINMRKAAAQS  4701
             + S  N+ ++     SD S++            I+ F+ +++ HS  SEP++MRKA A++
Sbjct  1830  VYS--NQHLIEKETTSDHSRIGQAMGWAKALSSINSFISLVKRHSSPSEPVSMRKATAEA  1887

Query  4702  IVASGLLDQAQALSPSVSNHQVPDGN-------------KQKDALHLYAHKILDLWFTCM  4842
             IVASGLL++ ++++  VSN  +P                K  + ++ YA +ILD+WFTC+
Sbjct  1888  IVASGLLEETKSIASFVSNSHIPSEEPNVSDMAEKLSQLKMLEVINFYAFRILDIWFTCI  1947

Query  4843  KLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLD  5022
             +LLEDED GLR++L+  VQKCI          +  VP QV++VIE SFE LSS F HWL 
Sbjct  1948  QLLEDEDVGLRQRLAKNVQKCINFKGLNGSLKNDAVPTQVDRVIESSFEFLSSVFSHWLG  2007

Query  5023  YLDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNHHEEKLLISQICCSHLEKLPVSK--  5196
             Y ++L   V S   S    S  D VRR+FDKEIDNHHEEKLLI QICCSHL++L  SK  
Sbjct  2008  YFNYLSRLVLSTAISVS--SCRDLVRRIFDKEIDNHHEEKLLICQICCSHLQQLSTSKPW  2065

Query  5197  ---LTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPVYV  5367
                +   F  + I   +QSWR  F  QLISF  +++ T+   DWIGG+GNHKDAF+ +Y 
Sbjct  2066  MDGVDEGFNKSTIKVFIQSWRLGFLCQLISFIKSFLNTEERTDWIGGIGNHKDAFVSIYA  2125

Query  5368  NLLAFHALSNCI-----LRGEAEDS-KSMVPELLELGEAIQPFLRNPLISNLFVLVVKSH  5529
             NLL  +AL+ C      L  +  D+ K  V E +EL E I+PFLRNPLISNL+ LV++SH
Sbjct  2126  NLLGLYALTQCPHEDYDLSAQITDTHKVYVLEFVELRELIRPFLRNPLISNLYFLVIQSH  2185

Query  5530  EKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             EK+ G +      +  G YS WD FDPYFL R
Sbjct  2186  EKMLGVSQTP---QFQGGYSVWDGFDPYFLLR  2214



>ref|XP_009151835.1| PREDICTED: thyroid adenoma-associated protein homolog [Brassica 
rapa]
Length=2092

 Score =  1937 bits (5017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1054/1887 (56%), Positives = 1314/1887 (70%), Gaps = 124/1887 (7%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSR VL                  + D   +TILYDGIL ELC+ CE+P DSH N
Sbjct  318   GILTAVSRGVL----------------VSSVDCDHQTILYDGILPELCDLCENPVDSHLN  361

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIK S   T   + E YDP+ +   +RVLKI+WNNLEDPLSQTVKQVH
Sbjct  362   FHALTVMQICLQQIKMS---TLNDLAEDYDPMPDSKVSRVLKIIWNNLEDPLSQTVKQVH  418

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             L+FDL LDIQ T+H      +    L KI + LL LG RCKGRYIPLASLT+RLGAK++L
Sbjct  419   LMFDLLLDIQTTVHQTYDKVEVRESLLKIVNYLLRLGTRCKGRYIPLASLTRRLGAKTLL  478

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSP LLF+   AYVDDDVC A T+F+KCFLE LRDE W ++GVE GY  YR  CL P L
Sbjct  479   DMSPNLLFEMANAYVDDDVCCAVTSFIKCFLEMLRDECWGSEGVERGYAVYRQRCLPPFL  538

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYA+ VLLELDVD IFP+LG I IG S E T++ Y EL S  + L
Sbjct  539   YGLASGMSKLRSNLNTYAVQVLLELDVDCIFPLLGLISIGPSEEETKLVYTELSSISMEL  598

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              VEQ+VAVLVSLLKV R LA +EGDI+              S DA    + V +KGIE+K
Sbjct  599   TVEQKVAVLVSLLKVCRTLAFLEGDIE-----------QKGSADAF---AFVKIKGIELK  644

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +PV +L +ALTH+D+S+R+DAAE+LF+NPKTASLPS  EL L+++AVPLNMR  ST FQM
Sbjct  645   VPVEWLKMALTHVDESVRVDAAETLFLNPKTASLPSPFELYLIKEAVPLNMRSSSTGFQM  704

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSRVRT+LE+  K G+W P L    +   L G+ D  L  RAE+LF FM+W
Sbjct  705   KWTSLFRKFFSRVRTSLEKQYKLGSWQPRLANGNNEKCLKGDEDAVL--RAESLFKFMRW  762

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LS FL  SCYPSAPY RKIMA EL+ IM+ VW ++P      S  S   LYPY   +   
Sbjct  763   LSSFLSLSCYPSAPYRRKIMATELIQIMMEVWPIVP------SKDSTSHLYPYCDIVTSH  816

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             +STLLLVGSI+DSWDRLRE++FRILLHFPTP  G+SS ++V   I WAK LVCSPRVRES
Sbjct  817   DSTLLLVGSIVDSWDRLRENAFRILLHFPTPFTGVSSEDMVQTIIPWAKHLVCSPRVRES  876

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVV-TQSPSGLSNGENLEFTPSSPVIEYITSLID  1977
             DAG+LT RLIFRKYVL+LGW+V+VS +VV  Q     +NG +    P  PVIEYI SLI 
Sbjct  877   DAGSLTLRLIFRKYVLDLGWIVKVSSDVVCCQREREGTNGFHQNSKPKYPVIEYIKSLIH  936

Query  1978  WLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilal  2157
             WL   V+EGE+DLSEAC+ SFVHGVLL LRYTFEE+DW+S AV S++S ++  LEK+L L
Sbjct  937   WLDTCVKEGERDLSEACRNSFVHGVLLALRYTFEELDWNSNAVLSSVSEMREELEKLLKL  996

Query  2158  VMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIA--KAEQ  2331
             V RIT+LALWVVSADA  L ++M+++  D + FL   ++ D + +    E K    K  Q
Sbjct  997   VTRITTLALWVVSADALCLDEDMDDIVDDDS-FLS-DVQDDAATTVLSKEQKDTHPKPVQ  1054

Query  2332  DDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVP-----KSCSQITDGTDQLSSD  2496
             +    +Q+VMVGCWLAMKEVSLLLGTIIRK+PLPTS +         S + D +   +S+
Sbjct  1055  ETIQSEQVVMVGCWLAMKEVSLLLGTIIRKIPLPTSSLAPLENGDLASAVPDDSVVGNSE  1114

Query  2497  IVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQ  2676
              +LDL+QLE IG+HFLEVLLKMKHNGAIDKTRAGF+ALC+RLLCSNDPRLC+LTESWMEQ
Sbjct  1115  SLLDLKQLEKIGDHFLEVLLKMKHNGAIDKTRAGFSALCHRLLCSNDPRLCRLTESWMEQ  1174

Query  2677  LMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDk  2856
             LMERT++KGQTVDDLLRRSAGIPAAF A FLSEPEG+PK+LLP+ALRWLI +A+K L D 
Sbjct  1175  LMERTMAKGQTVDDLLRRSAGIPAAFIALFLSEPEGSPKKLLPQALRWLIGLAEKPLMDP  1234

Query  2857  nkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTS  3036
              +E  S         S M P     E +SK RDEGVVPTVHAFNVLKAAFND NL TDTS
Sbjct  1235  AEEKGSKHMDEEVNPSNMHPS----EKLSKVRDEGVVPTVHAFNVLKAAFNDTNLGTDTS  1290

Query  3037  GFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHR  3216
             GFSAEA+ V+IRSFSS YWEVRNSA LAYTAL+RRM+GFLNVQKR SARR LTGLEFFHR
Sbjct  1291  GFSAEAMTVAIRSFSSPYWEVRNSATLAYTALLRRMVGFLNVQKRGSARRGLTGLEFFHR  1350

Query  3217  YPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGD  3396
             YP LH F++ ELK AT++    +S    SNLA  VHPSL P+LILLSRLKPSPI SE+GD
Sbjct  1351  YPLLHPFIYGELKAATDML--DTSGQSDSNLANHVHPSLWPILILLSRLKPSPIASESGD  1408

Query  3397  PFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTS  3576
               DPF+FMPFI KCS Q+NLR+R+LASRAL G+VSNEKL +V+L++AS LP       ++
Sbjct  1409  DLDPFVFMPFIMKCSTQSNLRVRVLASRALVGLVSNEKLQSVLLSVASTLP-------SN  1461

Query  3577  DLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQ  3756
             ++ G       FN +HG+LLQL +LLDTNCR+L D SKK+ I+  L++VL K +W+ SP 
Sbjct  1462  EVQG-----GPFNYLHGVLLQLGNLLDTNCRDLTDNSKKDQIIEQLVNVLAKCTWMASPL  1516

Query  3757  KCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPT  3936
              CPCPI++ SFL+VLD+M +I       K +  ++ L   LS+ CLD   S   +Y+DPT
Sbjct  1517  LCPCPIISTSFLRVLDHMRAIGW-----KNLRDVYKLHLDLSTSCLDADASYGFSYYDPT  1571

Query  3937  IAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQERLIRS  4116
             +AELR+QAA SYF C +Q S +  E   I  R   P+  L K  E  +     + RL+R 
Sbjct  1572  VAELREQAAVSYFGCVFQPSDEAAEVFQITQR---PNLLLQKVPEA-LDFPDLKGRLLRC  1627

Query  4117  LSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEK  4296
             LSD  YEVR+ATLKW L FL + +S  +E+S+         W SN GLQ ML+ LL  EK
Sbjct  1628  LSDQSYEVRLATLKWFLQFLKAEDSSFSETSSIWH------WASN-GLQVMLLDLLEKEK  1680

Query  4297  NHKCMNYILKIIYTYNMQQYNKNCGQHEKPTFVGNMDSDSVLQFWDKVVSLYKVTRHAKT  4476
             NH+C NYIL+I+  +N+  + K   +  +  +VG++  DSV+  W ++ SLY+ TRH KT
Sbjct  1681  NHRCENYILRILCQWNLLMFKK---ESNEGIYVGSLSYDSVIHLWGRLTSLYERTRHVKT  1737

Query  4477  REMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECIDYFVEVIQEHS  4656
             R  L+ C+A+C+K L  LF                  +  + S   +C+ YFV +I+E S
Sbjct  1738  RGTLMSCLAICVKHLTSLFFD-------------KKEEEPRWSCVIDCVSYFVNLIKEKS  1784

Query  4657  DASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGNKQKDALHLYAHKILDLWFT  4836
              +SE +N+R+A+A++I+ASG+L+QA+ + P VSNHQ P  +K ++A  +YA++IL++WFT
Sbjct  1785  SSSEQVNVRQASAEAIIASGILEQAKLIGPLVSNHQTPSLSKFQNACDVYAYQILEMWFT  1844

Query  4837  CMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGV-VPIQVEKVIEMSFEHLSSTFGH  5013
             C+KLLEDEDD +R +L+ +VQKC         FS+ + VP QVEKV+E+SF+HLS  FGH
Sbjct  1845  CIKLLEDEDDIIRSKLATDVQKCF--------FSTAMEVPTQVEKVLELSFDHLSFVFGH  1896

Query  5014  WLDYLDFLCHWVQSATNSACAVSIA-DPVRRVFDKEIDNHHEEKLLISQICCSHLEKLPV  5190
             W +Y  +L  WV S  +    +    D VRRVFDKEIDNHHEEKLLI Q CC HL+KL  
Sbjct  1897  WNEYFLYLSRWVFSTADYTAPLKGGIDLVRRVFDKEIDNHHEEKLLILQFCCHHLQKLAN  1956

Query  5191  SKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVN  5370
             S L            L  WR +F  +L+ F   ++G Q    W+GGVGNHKD FLP+Y N
Sbjct  1957  SDLPH--------GQLLEWRSKFHNKLLCFAKDHVGKQRE-SWVGGVGNHKDVFLPLYGN  2007

Query  5371  LLAFHALSNCILR--GEAEDSKSMVPELLELGEAIQPFLRNPLISNLFVLVVKSHEKIAG  5544
             LL  +  SNCILR   +  D K+M  +++ELGEA++PFLRNPL+SN+F +VV  HEK   
Sbjct  2008  LLGLYVFSNCILRFSTDGNDKKAMFADMVELGEALKPFLRNPLVSNMFRVVVGLHEKSVD  2067

Query  5545  GAVEHLVLEISGAYSAWDAFDPYFLFR  5625
              ++  +   + G    W+ FDPYFL R
Sbjct  2068  DSLVDMSSVLVG--EVWEGFDPYFLLR  2092



>ref|NP_191076.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE79347.1| uncharacterized protein AT3G55160 [Arabidopsis thaliana]
Length=2130

 Score =  1927 bits (4993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1055/1889 (56%), Positives = 1327/1889 (70%), Gaps = 118/1889 (6%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILT VSR +L                  N+D   KTILYDGIL ELC+ CE+P DSH N
Sbjct  322   GILTTVSRGIL----------VSSFARLSNSDCDHKTILYDGILLELCDLCENPIDSHLN  371

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FH LTVMQIC+QQIKTSM  TD  + EGYDP+ + +  RVL+I+WNNLEDPLSQTVKQVH
Sbjct  372   FHVLTVMQICMQQIKTSML-TD--LSEGYDPMPDSMAARVLRIIWNNLEDPLSQTVKQVH  428

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             L+FDL LDIQ T+H  +        L KI + LL LG RCKGRY+PLASLT+RLGAK+++
Sbjct  429   LMFDLLLDIQTTVHQTDDKVGMRESLLKIVNYLLRLGSRCKGRYVPLASLTRRLGAKTLM  488

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSP LLF+   AY+DDDVC A T+F+KCFLE LRDE W ++GV+ GY +YR HCL P L
Sbjct  489   DMSPNLLFEMANAYIDDDVCYAVTSFIKCFLELLRDESWGSEGVDQGYARYREHCLPPFL  548

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYA+ VLLELDVDSIF +L +I IG S E T++ Y EL +  + L
Sbjct  549   YGLASGKSKLRSNLNTYAVQVLLELDVDSIFLLLAYISIGPSEEETKLNYTELSNMSMEL  608

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              VEQ+V VLVSLLKV R LA +EGDI+              STDA    +VV +KGIE+K
Sbjct  609   TVEQKVVVLVSLLKVCRTLAFLEGDIE-----------QKRSTDAF---AVVQIKGIELK  654

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             IP+ +L +ALTH+D+S+R+DAAE+LF+NPKT+SLPS LEL LM++AVPLNMR  ST FQM
Sbjct  655   IPIEWLKMALTHVDESVRVDAAETLFLNPKTSSLPSPLELYLMKEAVPLNMRSSSTGFQM  714

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFF RVRT+LE+  K G+  P             ++D++   RAE+LF FM+W
Sbjct  715   KWTSLFRKFFLRVRTSLEKQYKLGSLQPL------------KSDKNAVLRAESLFKFMRW  762

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LS FL+ SCYPSAPY RKIMA EL+ IM+ VW   P     D  S +  LYPY   +   
Sbjct  763   LSSFLYLSCYPSAPYRRKIMATELIQIMIEVW---PVVASKDPTSHQGHLYPYCDIVTSH  819

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             +STLLLVGSI+DSWDRLRE+SFRILLHFPTP  GISS ++V   I WAK+LVCSPRVRES
Sbjct  820   DSTLLLVGSIVDSWDRLRENSFRILLHFPTPFTGISSEDMVQIIIPWAKQLVCSPRVRES  879

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVV-TQSPSGLSNGENLEFTPSSPVIEYITSLID  1977
             DAGALT RLIFRKYVL+LGW+V+VS  V   +      +  N    P  PV+EYI SLI 
Sbjct  880   DAGALTLRLIFRKYVLDLGWIVKVSTTVFCCERECENIDCRNQNSKPKYPVVEYIKSLIQ  939

Query  1978  WLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilal  2157
             WL A+V EGE+DLSEACK SFVHGVLL LRYTFEE+DW+S AV  +IS ++  LEK+L L
Sbjct  940   WLDASVTEGERDLSEACKNSFVHGVLLALRYTFEELDWNSNAV-LSISEMRKELEKLLKL  998

Query  2158  VMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKI-AKAEQD  2334
             V RIT+LALWVVSADA  LP++M+++  D + F    ++ D +A   ++      K   +
Sbjct  999   VTRITTLALWVVSADALCLPEDMDDIIDDDSFF--SNVQDDSAAVLSEEHTSTYPKHVHE  1056

Query  2335  DGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDV-----PKSCSQITDGTDQLSSDI  2499
                 +Q+VMVGCWLAMKEVSLLLGTIIRK+PLPTS +       + S + +     +S+ 
Sbjct  1057  TVQSEQVVMVGCWLAMKEVSLLLGTIIRKIPLPTSSLRPLENGDTASSVPNDLVIGNSES  1116

Query  2500  VLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQL  2679
             +LDL+QLE IG+HFLEVLLKMKHNGAIDKTRAGFTALC+RLLCSNDPRLCKLTESWMEQL
Sbjct  1117  LLDLKQLEKIGDHFLEVLLKMKHNGAIDKTRAGFTALCHRLLCSNDPRLCKLTESWMEQL  1176

Query  2680  MERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDkn  2859
             MERTV+KGQTVDD+LRRSAGIPAAF A FLSEPEG+PK+LLP+ALRWLI +A+K L +  
Sbjct  1177  MERTVAKGQTVDDVLRRSAGIPAAFIALFLSEPEGSPKKLLPRALRWLIGLAEKPLMEPL  1236

Query  2860  kensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSG  3039
             ++  S       ++     D+ + E +SK RDEGVVPTVHAFNVLKA FND NL+TDTSG
Sbjct  1237  EQKGSKHM----VEEINSSDMHSNEKLSKVRDEGVVPTVHAFNVLKATFNDTNLSTDTSG  1292

Query  3040  FSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRY  3219
             FSAEA+IVSIRSFSS YWEVRNSA LAYTALVRRMIGFLNVQKR S RRALTGLEFFHRY
Sbjct  1293  FSAEAMIVSIRSFSSPYWEVRNSATLAYTALVRRMIGFLNVQKRGSTRRALTGLEFFHRY  1352

Query  3220  PTLHTFLFNELKIATELF-LEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGD  3396
             P LH F+++ELK AT+L    GSS+   SNLA +VHPSL P+LILLSRLKPSPI SE+GD
Sbjct  1353  PLLHPFIYSELKAATDLLDTSGSSD---SNLANLVHPSLWPILILLSRLKPSPIASESGD  1409

Query  3397  PFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTS  3576
               DPF+FMPFI KCS Q+NLR+R+LASRAL G+VSNEKL +V+L IAS LP+        
Sbjct  1410  DLDPFVFMPFIMKCSTQSNLRVRVLASRALVGLVSNEKLQSVLLRIASTLPSNGAQ----  1465

Query  3577  DLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQ  3756
                       SFN +HG+LLQL +LLDTNCR+LAD SKK+ I+  LI+VL   SW+ SP 
Sbjct  1466  --------GGSFNYLHGILLQLGNLLDTNCRDLADNSKKDQIIGKLINVLANCSWLASPL  1517

Query  3757  KCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPT  3936
              CPCPIL  SFL+VLD+M  I  TC  SK +  I+ L   LS+ CLD   S   +Y+DP+
Sbjct  1518  TCPCPILCTSFLRVLDHMRVIEWTCSESKNLRDIYKLHLDLSTNCLDADASYGFSYYDPS  1577

Query  3937  IAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQERLIRS  4116
             IAELR+QAA SYF C +Q S +  E   I  R P   S+   E+   +      ERL+R 
Sbjct  1578  IAELREQAAVSYFGCVFQPSDEAAEVFQITQR-PNLQSQKVPEA---LDFPHLNERLLRC  1633

Query  4117  LSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEK  4296
             +SD  YEVR+ATLKW L FL S +S  +ESS+         W  N GLQ +L++LL  EK
Sbjct  1634  ISDQSYEVRLATLKWFLRFLKSEDSSFSESSSIWN------WAKN-GLQVILLELLDKEK  1686

Query  4297  NHKCMNYILKIIYTYNMQQYNKNCGQHE-KPTFVGNMDSDSVLQFWDKVVSLYKVTRHAK  4473
             NHKC NYIL+I++ +N+  + K+C +   +  +VG+++ DSV   W ++ SLY+ TR AK
Sbjct  1687  NHKCENYILRILFQWNLLMFKKSCNKESVEGIYVGSLNYDSVFHLWGRLTSLYESTRRAK  1746

Query  4474  TREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECIDYFVEVIQEH  4653
             TR  L+CC+A+C+K L  LF        NE        +  + S  ++C+ YFV +I++ 
Sbjct  1747  TRGTLMCCLAICVKHLTGLFIHK-----NES----EKEEEPRWSCITDCVSYFVNLIKQK  1797

Query  4654  SDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDG---NKQKDALHLYAHKILD  4824
             S  SE +N+R A+A++I+ASG+L+QA+ + P VSNHQ+      +K + A  +YA++IL+
Sbjct  1798  SLPSEQVNVRHASAEAIIASGILEQAKLIGPLVSNHQISSETTPSKFQKACDVYAYQILE  1857

Query  4825  LWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEHLSST  5004
             +WFTC+KLLEDEDD +R +L+ +VQKC         F++  VP QV+KV+E+SF HLSS 
Sbjct  1858  MWFTCIKLLEDEDDVIRSKLATDVQKCF--------FTAVEVPTQVDKVLELSFNHLSSI  1909

Query  5005  FGHWLDYLDFLCHWV-QSATNSACAVSIADPVRRVFDKEIDNHHEEKLLISQICCSHLEK  5181
              GHW +Y  +L  WV  +A  ++     +D VRRVFDKEIDNHHEEKLLI Q CC HL+K
Sbjct  1910  LGHWNEYSQYLSRWVFNTADYTSPPKGGSDLVRRVFDKEIDNHHEEKLLILQFCCYHLQK  1969

Query  5182  LPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPV  5361
             LP        RD ++  +L  WR +F  QL++F   ++  Q    W+GGVGNHKD FLP+
Sbjct  1970  LPN-------RDFSLAQLLD-WRSKFHNQLLAFAKDHVSKQRE-SWVGGVGNHKDVFLPL  2020

Query  5362  YVNLLAFHALSNCILR--GEAEDSKSMVPELLELGEAIQPFLRNPLISNLFVLVVKSHEK  5535
             Y NLL  +  S+CI R   ++ D K++  +++ELGEA++PFLRNPL+SN+F +VV+ HEK
Sbjct  2021  YGNLLGLYVFSDCIFRFSTDSNDKKTLFSDIIELGEALKPFLRNPLVSNMFRVVVRLHEK  2080

Query  5536  IAGGAVEHLVLEISGAYSAWDAFDPYFLF  5622
             +   ++  L   +SG    W+ FDPYFL 
Sbjct  2081  LLNDSLMDLSTVLSG--EIWEGFDPYFLL  2107



>ref|XP_009393702.1| PREDICTED: thyroid adenoma-associated protein homolog [Musa acuminata 
subsp. malaccensis]
 ref|XP_009393703.1| PREDICTED: thyroid adenoma-associated protein homolog [Musa acuminata 
subsp. malaccensis]
Length=2191

 Score =  1924 bits (4985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1084/1947 (56%), Positives = 1329/1947 (68%), Gaps = 142/1947 (7%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILT V RT LN+    S++G            S  TILY+GIL ELC +CE+P DSHFN
Sbjct  315   GILTVVPRTTLNMRLAESSNG------------SFWTILYNGILPELCKYCENPMDSHFN  362

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV QICLQQIKTS+          Y P++E    RVLKI+WNNLEDPLSQTVKQVH
Sbjct  363   FHALTVTQICLQQIKTSILADLTDFSGDYIPLAEGTMNRVLKIIWNNLEDPLSQTVKQVH  422

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             L+FDL LDI+ ++   EGS++   FL KIA DLLHLGPRCKGRY+PLA+LTKRLGAK++L
Sbjct  423   LVFDLLLDIESSVPPFEGSDRNNLFLYKIARDLLHLGPRCKGRYVPLAALTKRLGAKTLL  482

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             D++  LLF+T  AY+DDDVC AAT+FLKCFLECLRDE WS  G+E GY  +R  CL PIL
Sbjct  483   DLNHDLLFETAYAYIDDDVCCAATSFLKCFLECLRDECWSHGGIERGYDVFRDLCLPPIL  542

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL SG +KLRSNLNTYALPV+LE+D+DSIFPML FI +G +     I           L
Sbjct  543   YGLVSGHSKLRSNLNTYALPVVLEVDMDSIFPMLAFISVGSNIRENVI---------ADL  593

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              +EQ VA LVSLLKVSR LALIEGDID        LE      ++    +VV VKGI V+
Sbjct  594   KIEQCVAALVSLLKVSRTLALIEGDID--------LEHDLALNNSSDHVAVVCVKGINVR  645

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             IP  +  LAL H DDSLRIDAAESLF+NPKT+SLPS+ ELSLMR AVPLNMRC STAFQM
Sbjct  646   IPSVWFTLALKHADDSLRIDAAESLFLNPKTSSLPSTFELSLMRVAVPLNMRCSSTAFQM  705

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFF+RVRTALER +KQG W P       G+  +      +  RAE+LF FM+W
Sbjct  706   KWTSLFRKFFTRVRTALERQVKQGFWQPDTCFNGDGNATHDSTRDIVIRRAEDLFQFMQW  765

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LSCFLF SCYPSAPYERK MAMEL+L+M++VW ++ PQG          LYPYSK +  P
Sbjct  766   LSCFLFHSCYPSAPYERKTMAMELILVMIDVWPIVMPQGTQH-------LYPYSKAITSP  818

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             + TL LVGS+IDSWDRLR +SFRILL FPTP+PGISS + V   I WAKKLVCSPRVRES
Sbjct  819   DVTLALVGSVIDSWDRLRINSFRILLCFPTPLPGISSIDSVNILIKWAKKLVCSPRVRES  878

Query  1801  DAGALTFRLIFRKYVLELGWVVRVS--CNVVTQSPSGLSNGENLEFTPSSPVIEYITSLI  1974
             DAGALTFRLIF+KYVL LGW + VS   N +T S   + NG+        P+I+Y++SLI
Sbjct  879   DAGALTFRLIFKKYVLGLGWELGVSERANCLT-SQLKIINGDLGILKSGDPIIKYLSSLI  937

Query  1975  DWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekila  2154
             +WLCA +EEGEKDLSEAC+KS VHGVLLTLRYTFEE+DW+S+ V S+IS ++ L+EK+L 
Sbjct  938   EWLCAVIEEGEKDLSEACRKSSVHGVLLTLRYTFEELDWNSVGVQSSISDVRTLMEKLLD  997

Query  2155  lVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQD  2334
             L+MRITSLALWVVSADAW +P +++++  D     +   ++D   +  D   KI   E  
Sbjct  998   LIMRITSLALWVVSADAWSMPYDVDDVIDDSVFLPDLSFDVDQPDTVSDPGDKILAYEDV  1057

Query  2335  DGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSS-------  2493
                 DQ+VMVGCWLAMKEVSLLLGT+IRK+PLP+  +  S   I  G    SS       
Sbjct  1058  TKSADQVVMVGCWLAMKEVSLLLGTVIRKIPLPSCTLSDS---INHGVAPRSSEEIEMLA  1114

Query  2494  --DIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESW  2667
               D VLDL QLE IGNHFL+VLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRL K+TE W
Sbjct  1115  LTDGVLDLVQLETIGNHFLQVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLVKMTERW  1174

Query  2668  MEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSL  2847
             MEQLMERT  KGQTVDDLLRRSAGIPAAF A FLSEPEG PK+LLP+ALRWLI VA KSL
Sbjct  1175  MEQLMERTTVKGQTVDDLLRRSAGIPAAFIALFLSEPEGTPKKLLPRALRWLIGVANKSL  1234

Query  2848  TDknkensscsesssA-------IDSTMVPD---VAAIEMISKTRDEGVVPTVHAFNVLK  2997
             ++ ++   S +E  S        I    + D   + A    SK RDEGVVPTVHAFNVL+
Sbjct  1235  SNGSEVGFSQTEIISKEGPVGSEITDAGLEDSTTLLANARNSKIRDEGVVPTVHAFNVLR  1294

Query  2998  AAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRES  3177
             AAFND NLATDTSGF AEA IVS+RSFSS YWEVRNSACLAYT LVRRMIGF N+QKRE+
Sbjct  1295  AAFNDTNLATDTSGFCAEATIVSVRSFSSPYWEVRNSACLAYTTLVRRMIGFFNIQKREA  1354

Query  3178  ARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLS  3357
             +RRALTGLEFFHRYP LH FL +ELKIATEL  +G S ++ SN+AKV+HPSLCP+LILLS
Sbjct  1355  SRRALTGLEFFHRYPALHAFLLSELKIATELLGDGCSRHMESNIAKVIHPSLCPILILLS  1414

Query  3358  RLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIA  3537
             RLKPS I+S T D  DP LFMPFI+KC+ Q+NLR+RILASRALTG+VSNEKL  VI  +A
Sbjct  1415  RLKPSVISSATDDAVDPSLFMPFIQKCATQSNLRVRILASRALTGLVSNEKLQNVICEVA  1474

Query  3538  SELPAIDNH-----SMTSDLSG----------LSNLNASFNSIHGMLLQLSSLLDTNCRN  3672
               LP   +      S+T DL G          ++N  ASFNSIHG+LLQL SLLD NCR+
Sbjct  1475  HGLPHGRHQMSMPLSLTYDLPGSAKMCNGLGSVANRAASFNSIHGLLLQLFSLLDNNCRD  1534

Query  3673  LADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCIS  3852
             L D SKKE IL +L  VL K  WIGS Q CPCPILN S+++VLD ML I RT   S+  +
Sbjct  1535  LTDVSKKEQILGELFQVLSKCYWIGSTQSCPCPILNSSYIRVLDLMLDITRT-YTSQHTT  1593

Query  3853  VIWNLLWTLSSECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLR  4032
              I +LL  L+S CLD   S    ++DPTI ELRKQA +SYF+C     K V  E+LI L 
Sbjct  1594  TIRSLLLQLASGCLDAGKSSWLTWYDPTIVELRKQATASYFSCLL-GRKHVVSEELIELW  1652

Query  4033  GPPPDSELFKES-ETQMSVTRFQERLIRSLSDALYEVRIATLKWLL----LFLNSPESRT  4197
                  S + +E  ET+ SV+  Q++++  + D  YEVR+ TLK LL      + SP+S  
Sbjct  1653  NVSATSSIIQEVLETETSVSELQQKIMSCVLDPTYEVRLVTLKKLLELVMSLMPSPKSGV  1712

Query  4198  AESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQH  4377
               +  KS             L  ML++LL +E+N KC+ Y+LKI + +N+ Q  K  G  
Sbjct  1713  IYTWAKSN------------LHLMLIKLLPMEENPKCIYYVLKIFFNWNLLQLEKPTGLK  1760

Query  4378  EKPTFVGNMDSDSVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFT-------  4536
                T     D D    FWD+++ LY   + +KTRE+ +CCM +CIK+   L T       
Sbjct  1761  CSIT----EDCDFYFHFWDRLIHLYSSVKRSKTREITLCCMGLCIKQFLGLITFIDQHEV  1816

Query  4537  SSICSLGNEKVVVVNPSDPSKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASG  4716
                 ++G+ K   +N S+    ++ S  IDYFV ++  HS  SEP+NMRKAAA++I+ASG
Sbjct  1817  MEETAVGSSK---INQSEWWARALRS--IDYFVCLVNRHSAPSEPVNMRKAAAEAIIASG  1871

Query  4717  LLDQAQALSPSVSNHQ-------VPDGNKQ------KDALHLYAHKILDLWFTCMKLLED  4857
             LL +A +++  VSN         + D  K+       + ++ YA KILDLWFTC++LLED
Sbjct  1872  LLAEAMSVTSVVSNSHFTFEETSIIDIEKKIFQSEMPEVINFYACKILDLWFTCIQLLED  1931

Query  4858  EDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFL  5037
             ED+GLR++L+ +VQ CI+S  +   ++    P QV++VIE+S + LSS FGHWL YL++L
Sbjct  1932  EDNGLRQRLAKDVQTCISSKATNGSYTDA-APTQVDRVIELSIDFLSSLFGHWLGYLNYL  1990

Query  5038  CHWVQSATNSACAVSIADPVRRVFDKEIDNHHEEKLLISQICCSHLEKLPVSKLTTEFR-  5214
              + V S  +S    S  D VRR+FDKEIDNHHEEKLLI Q CC HLE L V K ++E + 
Sbjct  1991  ANLVLSTASSVS--SQGDLVRRIFDKEIDNHHEEKLLICQFCCLHLENLSVPK-SSEVQV  2047

Query  5215  ------DNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLL  5376
                   +++I      WR RF Q LISF N+ +  +G  DWIGG+GNHKDAF+ +Y NLL
Sbjct  2048  RPEVLSESSIQKFSSFWRLRFLQLLISFVNSCLEYEGITDWIGGIGNHKDAFVSLYTNLL  2107

Query  5377  AFHALSN---CILRGEAEDS-KSMVPELLELGEAIQPFLRNPLISNLFVLVVKSHEKIAG  5544
               +ALS     +L   + DS K  + E  +L   I+PFLRNPLIS+L+ LV++SHE + G
Sbjct  2108  GLYALSQQPYGVLNSCSTDSHKLYLSEFTQLEGIIKPFLRNPLISDLYNLVIQSHENMLG  2167

Query  5545  GAVEHLVLEISGAYSAWDAFDPYFLFR  5625
                     +  G + + D FDPYFL R
Sbjct  2168  ALHTQ---QHQGHFLSKDGFDPYFLIR  2191



>ref|XP_010427277.1| PREDICTED: thyroid adenoma-associated protein homolog isoform 
X3 [Camelina sativa]
Length=2134

 Score =  1910 bits (4949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1056/1898 (56%), Positives = 1323/1898 (70%), Gaps = 135/1898 (7%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILT  SR +L     VS+  +       N +   KTILYDGIL ELC+ CE+P DSH N
Sbjct  322   GILTTFSRGIL-----VSSFSW-----LSNTECDHKTILYDGILLELCDLCENPIDSHLN  371

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIKTSM  TD  + E YD + + +  RVL+I+WNNLEDPLSQTVKQVH
Sbjct  372   FHALTVMQICLQQIKTSML-TD--LSEDYDLMPDSMTARVLRIIWNNLEDPLSQTVKQVH  428

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             L+FDL LDIQ T+H  +        L KI + LL LG RCKGRY+PLASLT+RLGAK+++
Sbjct  429   LMFDLLLDIQTTVHQTDDKVGIRGSLLKIVNYLLRLGSRCKGRYVPLASLTRRLGAKTLM  488

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSP LLF+   AY+DDDVC A T+FLKCFLE LRDE W ++GV+ GY +YR HCL P L
Sbjct  489   DMSPNLLFEMANAYIDDDVCYAVTSFLKCFLEMLRDESWGSEGVDQGYARYREHCLPPFL  548

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYA+ VLLELDVDSIF +L +I IG S E T++ Y EL +  + L
Sbjct  549   YGLASGMSKLRSNLNTYAVQVLLELDVDSIFLLLAYISIGPSEEETKLNYTELSNMSMEL  608

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              VEQ+V VLVSLLKV R LA +EGDI+              STDA    ++V +KG+E+K
Sbjct  609   TVEQKVVVLVSLLKVCRTLAFLEGDIE-----------QKRSTDAF---AIVQIKGVELK  654

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +P+ +L +ALTH+D+S+R+DAAE+LF+NPK A LPS LEL LM++AVPLNMR  ST FQM
Sbjct  655   VPIEWLKMALTHVDESVRVDAAETLFLNPKNARLPSPLELYLMKEAVPLNMRSSSTGFQM  714

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSRVRT+LE+  K G+  P             ++D++   RAE+LF FM+W
Sbjct  715   KWTSLFRKFFSRVRTSLEKQYKHGSLQPL------------KSDENAVLRAESLFKFMRW  762

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LS FLF SCYPSAPY RKIMA EL+ IM+ VW   P     D  S +  LYPY   +   
Sbjct  763   LSSFLFLSCYPSAPYRRKIMATELLQIMIEVW---PVVASKDPTSHQGHLYPYCDIVTSH  819

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             +STLLLVGSI+DSWDRLRE+SFRILLH+PTP  G+SS ++V   I WAK LVCSPRVRES
Sbjct  820   DSTLLLVGSIVDSWDRLRENSFRILLHYPTPFTGVSSEDMVQNIIPWAKHLVCSPRVRES  879

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLS-NGENLEFTPSSPVIEYITSLID  1977
             DAGALT RLIFRKYVL+LGW+V+VS NV        S NG      P  PVIEYI SLI 
Sbjct  880   DAGALTLRLIFRKYVLDLGWIVKVSTNVFCCERECESINGLYQNSKPKYPVIEYIKSLIH  939

Query  1978  WLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilal  2157
             WL  +V EGE+DLSEACK SFVHGVLL LRYTFEE+DW+S A   ++S ++  LEK+L L
Sbjct  940   WLDVSVMEGERDLSEACKNSFVHGVLLALRYTFEELDWNSNA-GLSMSEMRKELEKLLKL  998

Query  2158  VMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKI-AKAEQD  2334
             V RIT+LALWVVSADA  LP++M+++  D   FL   ++ D +A   ++   I  K   +
Sbjct  999   VTRITTLALWVVSADALSLPEDMDDIIEDDG-FLSN-VQDDAAAVLSEEHKSIFPKPVHE  1056

Query  2335  DGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDV------PKSCSQITDGTDQLSSD  2496
                 +Q+VMVGCWLAMKEVSLLLGTIIRK+PLPT  +        +C+  +D   + +S+
Sbjct  1057  TIQSEQVVMVGCWLAMKEVSLLLGTIIRKIPLPTCSLRPLEKGDSACAVPSDSMIE-NSE  1115

Query  2497  IVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQ  2676
             ++LDL+QLE IG+HFLEVLLKMKHNGAIDKTRAGFTALC+RLLCSNDPRLCKLTESWM+Q
Sbjct  1116  LLLDLKQLEKIGDHFLEVLLKMKHNGAIDKTRAGFTALCHRLLCSNDPRLCKLTESWMDQ  1175

Query  2677  LMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDk  2856
             LMERTV++GQTVDD+LRRSAGIPAAF A FLSEPEG+PK+LLP+ALRWLI++A+K L D 
Sbjct  1176  LMERTVARGQTVDDVLRRSAGIPAAFIALFLSEPEGSPKKLLPQALRWLISLAEKPLLDP  1235

Query  2857  nkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTS  3036
              ++  S       ++     D+ + E +SK RDEGVVPTVHAFNVLKAAFND NL+TDTS
Sbjct  1236  MEQKGSKHM----VEEVNSSDMHSSENLSKVRDEGVVPTVHAFNVLKAAFNDTNLSTDTS  1291

Query  3037  GFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHR  3216
             GFSAEA+IVSIRSFSS YWEVRNSA LAYTALVRRMIGFLNVQKR S RRALTGLEFFHR
Sbjct  1292  GFSAEAMIVSIRSFSSQYWEVRNSATLAYTALVRRMIGFLNVQKRVSTRRALTGLEFFHR  1351

Query  3217  YPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGD  3396
             YP LH F+++ELK AT+L    +S    SNL  +VHPSL P+LILLSRLKPSPI SETGD
Sbjct  1352  YPLLHPFIYSELKTATDLL--DTSGPSDSNLVNLVHPSLWPILILLSRLKPSPIASETGD  1409

Query  3397  PFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTS  3576
               DPF+FMPFI KCS Q NLR+R+LASRAL G+VSNEKL +V+L IAS LP         
Sbjct  1410  DLDPFVFMPFIMKCSTQRNLRVRVLASRALVGLVSNEKLQSVLLQIASTLP---------  1460

Query  3577  DLSGLSNL--NASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGS  3750
                  SN+    SFN +HG+LLQL +LLDTNCR+LAD SKK+ I+  LI+VL K +W+ S
Sbjct  1461  -----SNVAQGGSFNYLHGILLQLGNLLDTNCRDLADDSKKDQIIGKLINVLSKCTWMAS  1515

Query  3751  PQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFD  3930
             P  CPCPIL  SFL+VLD+M  I R    SK +  I+ L   LS+ CLD   S   +Y+D
Sbjct  1516  PLTCPCPILCTSFLRVLDHMRVIERASSESKNLRDIYKLHLDLSTNCLDTDASFGFSYYD  1575

Query  3931  PTIAELRKQAASSYFNCAYQTSKDVNE-------EDLIYLRGPPPDSELFKESETQMSVT  4089
             P+IAELR+QAA SYF C +Q S +  E        +L+ L+  P  S+            
Sbjct  1576  PSIAELREQAAVSYFGCIFQPSDEAAEVFQITQRSNLLRLQKVPEASD----------YP  1625

Query  4090  RFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAM  4269
                ERL+R LSD  YEVR+ATLKW L FL S +S  +ESS+         W  N GLQ +
Sbjct  1626  DLNERLLRCLSDQSYEVRLATLKWFLQFLKSEDSSFSESSSIWN------WAKN-GLQVV  1678

Query  4270  LMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNC-GQHEKPTFVGNMDSDSVLQFWDKVVS  4446
             L++LL  EKNHKC NYILKI++ +N+  + K+C G+  +  +VG+++ D VL  W ++ S
Sbjct  1679  LLELLDKEKNHKCENYILKILFQWNLLMFKKSCKGESVEGIYVGSLNYDLVLHLWGRLTS  1738

Query  4447  LYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECID  4626
             LY+ TR AK R  L+CC+A+C+K L  LF     S   E+         S+     +C+ 
Sbjct  1739  LYESTRRAKIRGTLMCCLAICVKHLTGLFFHKNDSEKEEE---------SRWGCVIDCVS  1789

Query  4627  YFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGN---KQKDAL  4797
             YFV +I+E S +SE +N+R A+A++I+ASG+L+QA+ + P V NHQ+P  N     + A 
Sbjct  1790  YFVNMIKEKSLSSEQVNVRHASAEAIIASGILEQAKIVGPLVLNHQIPSENIPSTFQKAC  1849

Query  4798  HLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIE  4977
             ++YA++ILD+WFTC+KLLEDEDD +R +L+ +VQKC         F++  VP QV+KV+E
Sbjct  1850  NVYAYQILDMWFTCIKLLEDEDDIIRSKLATDVQKCF--------FTAMEVPTQVDKVLE  1901

Query  4978  MSFEHLSSTFGHWLDYLDFLCHWV-QSATNSACAVSIADPVRRVFDKEIDNHHEEKLLIS  5154
             +SF HLSS FGHW +Y  +L  WV  +A  S      +D VRRVFDKEIDNHHEEKLLI 
Sbjct  1902  LSFNHLSSVFGHWNEYSQYLSKWVFNTADYSPPPKGGSDLVRRVFDKEIDNHHEEKLLIL  1961

Query  5155  QICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVG  5334
             Q  C HL+KLP+S  +         + L  WR +F  QL+S    ++  Q    W+GGVG
Sbjct  1962  QFGCYHLQKLPMSDFSL--------AQLLDWRGKFHNQLLSLAKDHVSKQRE-SWVGGVG  2012

Query  5335  NHKDAFLPVYVNLLAFHALSNCILR--GEAEDSKSMVPELLELGEAIQPFLRNPLISNLF  5508
             NHKD FLP+Y NLL  +  SNCI R   ++ D K++  +++ELG A++PFLRNPL+SN+F
Sbjct  2013  NHKDVFLPLYGNLLGLYVFSNCIFRFPTDSNDKKTLCADMVELGGALKPFLRNPLVSNMF  2072

Query  5509  VLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLF  5622
              +VV+ HE +   ++  L   +SG    W+ FDPYFL 
Sbjct  2073  RVVVRLHENLLDDSLVDLATVLSG--EIWEGFDPYFLL  2108



>ref|XP_010427275.1| PREDICTED: thyroid adenoma-associated protein homolog isoform 
X1 [Camelina sativa]
 ref|XP_010427276.1| PREDICTED: thyroid adenoma-associated protein homolog isoform 
X2 [Camelina sativa]
Length=2134

 Score =  1910 bits (4949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1056/1898 (56%), Positives = 1324/1898 (70%), Gaps = 135/1898 (7%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILT  SR +L     VS+  +       N +   KTILYDGIL ELC+ CE+P DSH N
Sbjct  322   GILTTFSRGIL-----VSSFSW-----LSNTECDHKTILYDGILLELCDLCENPIDSHLN  371

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIKTSM  TD  + E YD + + +  RVL+I+WNNLEDPLSQTVKQVH
Sbjct  372   FHALTVMQICLQQIKTSML-TD--LSEDYDLMPDSMTARVLRIIWNNLEDPLSQTVKQVH  428

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             L+FDL LDIQ T+H  +        L KI + LL LG RCKGRY+PLASLT+RLGAK+++
Sbjct  429   LMFDLLLDIQTTVHQTDDKVGIRGSLLKIVNYLLRLGSRCKGRYVPLASLTRRLGAKTLM  488

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSP LLF+   AY+DDDVC A T+FLKCFLE LRDE W ++GV+ GY +YR HCL P L
Sbjct  489   DMSPNLLFEMANAYIDDDVCYAVTSFLKCFLEMLRDESWGSEGVDQGYARYREHCLPPFL  548

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYA+ VLLELDVDSIF +L +I IG S E T++ Y EL +  + L
Sbjct  549   YGLASGMSKLRSNLNTYAVQVLLELDVDSIFLLLAYISIGPSEEETKLNYTELSNMSMEL  608

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              VEQ+V VLVSLLKV R LA +EGDI+              STDA    ++V +KG+E+K
Sbjct  609   TVEQKVVVLVSLLKVCRTLAFLEGDIE-----------QKRSTDAF---AIVQIKGVELK  654

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +P+ +L +ALTH+D+S+R+DAAE+LF+NPKTA LPS LEL L+++AVPLNMR  ST FQM
Sbjct  655   VPIEWLKMALTHVDESVRVDAAETLFLNPKTARLPSPLELYLLKEAVPLNMRSSSTGFQM  714

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSRVRT+LE+  K G+  P             ++D++   RAE+LF FM+W
Sbjct  715   KWTSLFRKFFSRVRTSLEKQYKHGSLQPL------------KSDENAVLRAESLFKFMRW  762

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LS FLF SCYPSAPY RKIMA EL+ IM+ VW   P     D  S +  LYPY   +   
Sbjct  763   LSSFLFLSCYPSAPYRRKIMATELLQIMIEVW---PVVASKDPTSHQGHLYPYCDIVTSH  819

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             +STLLLVGSI+DSWDRLRE+SFRILLH+PTP  G+SS ++V   I WAK LVCSPRVRES
Sbjct  820   DSTLLLVGSIVDSWDRLRENSFRILLHYPTPFTGVSSEDMVQNIIPWAKHLVCSPRVRES  879

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLS-NGENLEFTPSSPVIEYITSLID  1977
             DAGALT RLIFRKYVL+LGW+V+VS NV        S NG      P  PVIEYI SLI 
Sbjct  880   DAGALTLRLIFRKYVLDLGWIVKVSTNVFCCEKECESINGLYQNSKPKYPVIEYIKSLIH  939

Query  1978  WLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilal  2157
             WL  +V EGE+DLSEACK SFVHGVLL LRYTFEE+DW+S A   ++S ++  LEK+L L
Sbjct  940   WLDVSVMEGERDLSEACKNSFVHGVLLALRYTFEELDWNSNA-GLSMSEMRKELEKLLKL  998

Query  2158  VMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKI-AKAEQD  2334
             V RIT+LALWVVSADA  LP++M+++  D   FL   ++ D +A   ++   I  K   +
Sbjct  999   VTRITTLALWVVSADALSLPEDMDDIIEDDG-FLSN-VQDDAAAVLSEEHKSIFPKPVHE  1056

Query  2335  DGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDV------PKSCSQITDGTDQLSSD  2496
                 +Q+VMVGCWLAMKEVSLLLGTIIRK+PLPT  +        +C+  +D   + +S+
Sbjct  1057  TIQSEQVVMVGCWLAMKEVSLLLGTIIRKIPLPTCSLRPLEKGDSACAVPSDSMIE-NSE  1115

Query  2497  IVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQ  2676
             ++LDL+QLE IG+HFLEVLLKMKHNGAIDKTRAGFTALC+RLLCSNDPRLCKLTESWM+Q
Sbjct  1116  LLLDLKQLEKIGDHFLEVLLKMKHNGAIDKTRAGFTALCHRLLCSNDPRLCKLTESWMDQ  1175

Query  2677  LMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDk  2856
             LMERTV++GQTVDD+LRRSAGIPAAF A FLSEPEG+PK+LLP+ALRWLI++A+K L D 
Sbjct  1176  LMERTVARGQTVDDVLRRSAGIPAAFIALFLSEPEGSPKKLLPQALRWLISLAEKPLLDP  1235

Query  2857  nkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTS  3036
              ++  S       ++     D+ + E +SK RDEGVVPTVHAFNVLKAAFND NL+TDTS
Sbjct  1236  MEQKGSKHM----VEEVNSSDMHSSENLSKVRDEGVVPTVHAFNVLKAAFNDTNLSTDTS  1291

Query  3037  GFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHR  3216
             GFSAEA+IVSIRSFSS YWEVRNSA LAYTALVRRMIGFLNVQKR S RRALTGLEFFHR
Sbjct  1292  GFSAEAMIVSIRSFSSQYWEVRNSATLAYTALVRRMIGFLNVQKRVSTRRALTGLEFFHR  1351

Query  3217  YPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGD  3396
             YP LH F+++ELK AT+L    +S    SNL  +VHPSL P+LILLSRLKPSPI SETGD
Sbjct  1352  YPLLHPFIYSELKTATDLL--DTSGPSDSNLVNLVHPSLWPILILLSRLKPSPIASETGD  1409

Query  3397  PFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTS  3576
               DPF+FMPFI KCS Q NLR+R+LASRAL G+VSNEKL +V+L IAS LP         
Sbjct  1410  DLDPFVFMPFIMKCSTQRNLRVRVLASRALVGLVSNEKLQSVLLQIASTLP---------  1460

Query  3577  DLSGLSNL--NASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGS  3750
                  SN+    SFN +HG+LLQL +LLDTNCR+LAD SKK+ I+  LI+VL K +W+ S
Sbjct  1461  -----SNVAQGGSFNYLHGILLQLGNLLDTNCRDLADDSKKDQIIGKLINVLSKCTWMAS  1515

Query  3751  PQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFD  3930
             P  CPCPIL  SFL+VLD+M  I R    SK +  I+ L   LS+ CLD   S   +Y+D
Sbjct  1516  PLTCPCPILCTSFLRVLDHMRVIERASSESKNLRDIYKLHLDLSTNCLDTDASFGFSYYD  1575

Query  3931  PTIAELRKQAASSYFNCAYQTSKDVNE-------EDLIYLRGPPPDSELFKESETQMSVT  4089
             P+IAELR+QAA SYF C +Q S +  E        +L+ L+  P  S+            
Sbjct  1576  PSIAELREQAAVSYFGCIFQPSDEAAEVFQITQRSNLLRLQKVPEASD----------YP  1625

Query  4090  RFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAM  4269
                ERL+R LSD  YEVR+ATLKW L FL S +S  +ESS+         W  N GLQ +
Sbjct  1626  DLNERLLRCLSDQSYEVRLATLKWFLQFLKSEDSSFSESSSIWN------WAKN-GLQVV  1678

Query  4270  LMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNC-GQHEKPTFVGNMDSDSVLQFWDKVVS  4446
             L++LL  EKNHKC NYILKI++ +N+  + K+C G+  +  +VG+++ D VL  W ++ S
Sbjct  1679  LLELLDKEKNHKCENYILKILFQWNLLMFKKSCKGESVEGIYVGSLNYDLVLHLWGRLTS  1738

Query  4447  LYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECID  4626
             LY+ TR AK R  L+CC+A+C+K L  LF     S   E+         S+     +C+ 
Sbjct  1739  LYESTRRAKIRGTLMCCLAICVKHLTGLFFHKNDSEKEEE---------SRWGCVIDCVS  1789

Query  4627  YFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGN---KQKDAL  4797
             YFV +I+E S +SE +N+R A+A++I+ASG+L+QA+ + P V NHQ+P  N     + A 
Sbjct  1790  YFVNMIKEKSLSSEQVNVRHASAEAIIASGILEQAKIVGPLVLNHQIPSENIPSTFQKAC  1849

Query  4798  HLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIE  4977
             ++YA++ILD+WFTC+KLLEDEDD +R +L+ +VQKC         F++  VP QV+KV+E
Sbjct  1850  NVYAYQILDMWFTCIKLLEDEDDIIRSKLATDVQKCF--------FTAMEVPTQVDKVLE  1901

Query  4978  MSFEHLSSTFGHWLDYLDFLCHWV-QSATNSACAVSIADPVRRVFDKEIDNHHEEKLLIS  5154
             +SF HLSS FGHW +Y  +L  WV  +A  S      +D VRRVFDKEIDNHHEEKLLI 
Sbjct  1902  LSFNHLSSVFGHWNEYSQYLSKWVFNTADYSPPPKGGSDLVRRVFDKEIDNHHEEKLLIL  1961

Query  5155  QICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVG  5334
             Q  C HL+KLP+S  +         + L  WR +F  QL+S    ++  Q    W+GGVG
Sbjct  1962  QFGCYHLQKLPMSDFSL--------AQLLDWRGKFHNQLLSLAKDHVSKQRE-SWVGGVG  2012

Query  5335  NHKDAFLPVYVNLLAFHALSNCILR--GEAEDSKSMVPELLELGEAIQPFLRNPLISNLF  5508
             NHKD FLP+Y NLL  +  SNCI R   ++ D K++  +++ELG A++PFLRNPL+SN+F
Sbjct  2013  NHKDVFLPLYGNLLGLYVFSNCIFRFPTDSNDKKTLCADMVELGGALKPFLRNPLVSNMF  2072

Query  5509  VLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLF  5622
              +VV+ HE +   ++  L   +SG    W+ FDPYFL 
Sbjct  2073  RVVVRLHENLLDDSLVDLATVLSG--EIWEGFDPYFLL  2108



>ref|XP_010516077.1| PREDICTED: thyroid adenoma-associated protein homolog isoform 
X2 [Camelina sativa]
Length=2138

 Score =  1899 bits (4919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1045/1891 (55%), Positives = 1314/1891 (69%), Gaps = 117/1891 (6%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILT VSR +L                  N+D   +TILYDGIL ELC+ CE+P DSH N
Sbjct  322   GILTTVSRGIL----------VSSFAQLSNSDCDHRTILYDGILLELCDLCENPIDSHLN  371

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIKTSM  TD  + E YD + + +  RVL+I+WNNLEDPLSQTVKQVH
Sbjct  372   FHALTVMQICLQQIKTSML-TD--LSEDYDRMPDSMTARVLRIIWNNLEDPLSQTVKQVH  428

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             L+FDL LDIQ T+H  +        L KI + LL LG RCKGRY+PLASLT+RLGAK+++
Sbjct  429   LMFDLLLDIQTTVHQTDDKVGIRESLLKIVNYLLRLGSRCKGRYVPLASLTRRLGAKTLM  488

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSP LLF+   AY+DDDVC A T+FLKCFLE LRDE W ++GV+ GY +YR HCL P L
Sbjct  489   DMSPNLLFEMANAYIDDDVCYAVTSFLKCFLEMLRDESWGSEGVDQGYARYREHCLPPFL  548

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYA+ VLLELDVDSIF +L +I IG S E T++ Y EL +  + L
Sbjct  549   YGLASGMSKLRSNLNTYAVQVLLELDVDSIFLLLAYISIGPSEEETKLNYTELSNMSMEL  608

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              VEQ+V VLVSLLKV R LA +EGDI+              STDA    ++V +KG+E+K
Sbjct  609   TVEQKVVVLVSLLKVCRTLAFLEGDIE-----------QKRSTDAF---AIVQIKGVELK  654

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +P+ +L +ALTH+D+S+R+DAAE+LF+NPK A LPS LEL LM++AVPLNMR  ST FQM
Sbjct  655   VPIEWLKMALTHVDESVRVDAAETLFLNPKNARLPSPLELYLMKEAVPLNMRSSSTGFQM  714

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSRVRT+LE+  K G+  P             ++D++   RAE+LF FM+W
Sbjct  715   KWTSLFRKFFSRVRTSLEKQYKHGSLQPL------------KSDENAVLRAESLFKFMRW  762

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LS FLF SCYPSAPY RKIMA EL+ IM+ VW   P     D  S +  LYPY   +   
Sbjct  763   LSSFLFLSCYPSAPYRRKIMATELLQIMIEVW---PVVASKDPTSHQGHLYPYCDIVTSH  819

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             +STLLLVGSI+DSWDRLRE+SFRILLH+PTP  G+SS ++V   I WAK LVCSPRVRES
Sbjct  820   DSTLLLVGSIVDSWDRLRENSFRILLHYPTPFTGVSSEDMVQNIIPWAKHLVCSPRVRES  879

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLS-NGENLEFTPSSPVIEYITSLID  1977
             DAGALT RLIFRKYVL+LGW+V+VS NV        S NG      P  PVIEYI SLI 
Sbjct  880   DAGALTLRLIFRKYVLDLGWIVKVSTNVFCCERECESINGLYQNSKPKYPVIEYIKSLIH  939

Query  1978  WLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilal  2157
             WL  +V EGE+DLSEACK SFVHGVLL LRYTFEE+DW+S A   ++S ++  LEK+L L
Sbjct  940   WLDVSVMEGERDLSEACKNSFVHGVLLALRYTFEELDWNSNA-GLSMSEMRKELEKLLKL  998

Query  2158  VMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQDD  2337
             V RIT+LALWVVSADA  LP++M+++  D   FL    +   +  + + +    K   + 
Sbjct  999   VTRITTLALWVVSADALSLPEDMDDIIEDDG-FLSNVQDDAAAVLSEEHKSTFPKPVHET  1057

Query  2338  GPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDV-----PKSCSQITDGTDQLSSDIV  2502
                +Q+VMVGCWLAMKEVSLLLGTIIRK+PLPT  +       S S     +   +S+++
Sbjct  1058  IQSEQVVMVGCWLAMKEVSLLLGTIIRKIPLPTCSLRPLENGDSASAAPSDSVIENSELL  1117

Query  2503  LDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLM  2682
             LDL+QLE IG+HFLEVLLKMKHNGAIDKTRA FTALC+RLLCSNDPRLCKLTESWMEQLM
Sbjct  1118  LDLKQLEKIGDHFLEVLLKMKHNGAIDKTRARFTALCHRLLCSNDPRLCKLTESWMEQLM  1177

Query  2683  ERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknk  2862
             ERTV++GQTVDD+LRRSAGIPAAF A FLSEPEG+PK+LLP+ALRWLI++A+K L D  +
Sbjct  1178  ERTVARGQTVDDVLRRSAGIPAAFIALFLSEPEGSPKKLLPQALRWLISLAEKPLLDPME  1237

Query  2863  ensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGF  3042
             +  S       ++     D+ + E +SK RDEGVVPTVHAFNVLKAAFND NL+TDTSGF
Sbjct  1238  QKGSKHM----VEEVNSSDMHSSENLSKVRDEGVVPTVHAFNVLKAAFNDTNLSTDTSGF  1293

Query  3043  SAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYP  3222
             SAEA+IVSIRSFSS YWEVRNSA LAYTALVRRMIGFLNVQKR S RRALTGLEFFHRYP
Sbjct  1294  SAEAMIVSIRSFSSQYWEVRNSATLAYTALVRRMIGFLNVQKRVSTRRALTGLEFFHRYP  1353

Query  3223  TLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPF  3402
              LH F+++ELK AT+L    +S    SNL  +VHPSL P+LILLSRLKPSPI SETGD  
Sbjct  1354  LLHPFIYSELKTATDLL--DTSGPSDSNLVNLVHPSLWPILILLSRLKPSPIASETGDDL  1411

Query  3403  DPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDL  3582
             DPF+FMPFI KCS Q NLR+R+LASRAL G+VSNEKL +V+L IAS LP           
Sbjct  1412  DPFVFMPFIMKCSTQRNLRVRVLASRALVGLVSNEKLQSVLLQIASTLP-----------  1460

Query  3583  SGLSNL--NASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQ  3756
                SN+    SFN +HG+LLQL +LLDTNCR+LAD SKK+ I+  LI+VL K +W+ SP 
Sbjct  1461  ---SNVAQGGSFNYLHGILLQLGNLLDTNCRDLADDSKKDQIIGKLINVLSKCTWMASPL  1517

Query  3757  KCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPT  3936
              CPCPIL  SFL+VLD+M  I R    SK +  I+ L   LS+ CLD   S   +Y+DP+
Sbjct  1518  TCPCPILCTSFLRVLDHMRVIERASSESKNLRDIYKLHLDLSTNCLDTDASYGFSYYDPS  1577

Query  3937  IAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQERLIRS  4116
             IA++R+QAA SYF C +Q S +  E   I  R   P+    ++           ER +R 
Sbjct  1578  IADVREQAAVSYFGCIFQPSDEAAEVFQITQR---PNLLRLQKVPEASDYPDLNERFLRC  1634

Query  4117  LSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEK  4296
             LSD  YEVR+ATLKWLL FL S +S  +ESS+         W  N  LQ +L++LL  EK
Sbjct  1635  LSDQSYEVRLATLKWLLQFLKSEDSSFSESSSIWN------WAKN-SLQVVLLELLDNEK  1687

Query  4297  NHKCMNYILKIIYTYNMQQYNKNC-GQHEKPTFVGNMDSDSVLQFWDKVVSLYKVTRHAK  4473
             NHKC NYILKI++ +N+  + K+  G+  +  +VG+++ D VL  W ++ SLY+ TR AK
Sbjct  1688  NHKCENYILKILFQWNLLMFKKSSKGESVEGIYVGSLNYDLVLHLWGRLTSLYESTRRAK  1747

Query  4474  TREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECIDYFVEVIQEH  4653
              R  L+CC+A+C+K L  LF     S   E+         S+     +C+ YFV +I+E 
Sbjct  1748  IRGTLMCCLAICVKHLTGLFFHKNDSEKEEE---------SRRGCVIDCVSYFVNMIKEK  1798

Query  4654  SDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGN---KQKDALHLYAHKILD  4824
             S +SE +N+R A+A++I+ASG+L+QA+ + P V NHQ+P  N     ++A ++YA++ILD
Sbjct  1799  SLSSEQVNVRHASAEAIIASGILEQAKIVGPLVLNHQIPSENIPSTFQNACNVYAYQILD  1858

Query  4825  LWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEHLSST  5004
             +WFTC+KLLEDEDD +R +L+ +VQKC         F++  VP QV+KV+E+SF HLSS 
Sbjct  1859  MWFTCIKLLEDEDDIIRSKLATDVQKCF--------FTAMEVPTQVDKVLELSFNHLSSV  1910

Query  5005  FGHWLDYLDFLCHWV-QSATNSACAVSIADPVRRVFDKEIDNHHEEKLLISQICCSHLEK  5181
             FGHW +Y  +L  WV  +A  S      +D VRRVFDKEIDNHHEEKLLI Q  C HL+K
Sbjct  1911  FGHWNEYSQYLSKWVFNTADYSPPPKGGSDLVRRVFDKEIDNHHEEKLLILQFGCYHLQK  1970

Query  5182  LPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPV  5361
             LP+S            + L  WR +F  QL+SF   +I  Q    W+GGVGNHKD FLP+
Sbjct  1971  LPMSDFPL--------AQLLDWRSKFHNQLLSFAKDHISKQRE-SWLGGVGNHKDVFLPL  2021

Query  5362  YVNLLAFHALSNCILR--GEAEDSKSMVPELLELGEAIQPFLRNPLISNLFVLVVKSHEK  5535
             Y NLL  +  SNCI+R   ++ D K++  +++ELG A++PFLRNPL+ N+F +VV+ H+ 
Sbjct  2022  YGNLLGLYVFSNCIIRFSTDSNDKKALCSDMIELGGALKPFLRNPLVCNMFRVVVRLHQN  2081

Query  5536  IAGGAVEHLVLEISGAYSA--WDAFDPYFLF  5622
             +   +++  +++++   S   W+ FDPYFL 
Sbjct  2082  LLDDSLDDSLVDLATVLSGEIWEGFDPYFLL  2112



>ref|XP_010516074.1| PREDICTED: thyroid adenoma-associated protein homolog isoform 
X1 [Camelina sativa]
 ref|XP_010516075.1| PREDICTED: thyroid adenoma-associated protein homolog isoform 
X1 [Camelina sativa]
 ref|XP_010516076.1| PREDICTED: thyroid adenoma-associated protein homolog isoform 
X1 [Camelina sativa]
Length=2138

 Score =  1899 bits (4918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1045/1891 (55%), Positives = 1314/1891 (69%), Gaps = 117/1891 (6%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILT VSR +L                  N+D   +TILYDGIL ELC+ CE+P DSH N
Sbjct  322   GILTTVSRGIL----------VSSFAQLSNSDCDHRTILYDGILLELCDLCENPIDSHLN  371

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIKTSM  TD  + E YD + + +  RVL+I+WNNLEDPLSQTVKQVH
Sbjct  372   FHALTVMQICLQQIKTSML-TD--LSEDYDRMPDSMTARVLRIIWNNLEDPLSQTVKQVH  428

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             L+FDL LDIQ T+H  +        L KI + LL LG RCKGRY+PLASLT+RLGAK+++
Sbjct  429   LMFDLLLDIQTTVHQTDDKVGIRESLLKIVNYLLRLGSRCKGRYVPLASLTRRLGAKTLM  488

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSP LLF+   AY+DDDVC A T+FLKCFLE LRDE W ++GV+ GY +YR HCL P L
Sbjct  489   DMSPNLLFEMANAYIDDDVCYAVTSFLKCFLEMLRDESWGSEGVDQGYARYREHCLPPFL  548

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYA+ VLLELDVDSIF +L +I IG S E T++ Y EL +  + L
Sbjct  549   YGLASGMSKLRSNLNTYAVQVLLELDVDSIFLLLAYISIGPSEEETKLNYTELSNMSMEL  608

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              VEQ+V VLVSLLKV R LA +EGDI+              STDA    ++V +KG+E+K
Sbjct  609   TVEQKVVVLVSLLKVCRTLAFLEGDIE-----------QKRSTDAF---AIVQIKGVELK  654

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +P+ +L +ALTH+D+S+R+DAAE+LF+NPK A LPS LEL LM++AVPLNMR  ST FQM
Sbjct  655   VPIEWLKMALTHVDESVRVDAAETLFLNPKNARLPSPLELYLMKEAVPLNMRSSSTGFQM  714

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSRVRT+LE+  K G+  P             ++D++   RAE+LF FM+W
Sbjct  715   KWTSLFRKFFSRVRTSLEKQYKHGSLQPL------------KSDENAVLRAESLFKFMRW  762

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LS FLF SCYPSAPY RKIMA EL+ IM+ VW   P     D  S +  LYPY   +   
Sbjct  763   LSSFLFLSCYPSAPYRRKIMATELLQIMIEVW---PVVASKDPTSHQGHLYPYCDIVTSH  819

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             +STLLLVGSI+DSWDRLRE+SFRILLH+PTP  G+SS ++V   I WAK LVCSPRVRES
Sbjct  820   DSTLLLVGSIVDSWDRLRENSFRILLHYPTPFTGVSSEDMVQNIIPWAKHLVCSPRVRES  879

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLS-NGENLEFTPSSPVIEYITSLID  1977
             DAGALT RLIFRKYVL+LGW+V+VS NV        S NG      P  PVIEYI SLI 
Sbjct  880   DAGALTLRLIFRKYVLDLGWIVKVSTNVFCCERECESINGLYQNSKPKYPVIEYIKSLIH  939

Query  1978  WLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilal  2157
             WL  +V EGE+DLSEACK SFVHGVLL LRYTFEE+DW+S A   ++S ++  LEK+L L
Sbjct  940   WLDVSVMEGERDLSEACKNSFVHGVLLALRYTFEELDWNSNA-GLSMSEMRKELEKLLKL  998

Query  2158  VMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQDD  2337
             V RIT+LALWVVSADA  LP++M+++  D   FL    +   +  + + +    K   + 
Sbjct  999   VTRITTLALWVVSADALSLPEDMDDIIEDDG-FLSNVQDDAAAVLSEEHKSTFPKPVHET  1057

Query  2338  GPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDV-----PKSCSQITDGTDQLSSDIV  2502
                +Q+VMVGCWLAMKEVSLLLGTIIRK+PLPT  +       S S     +   +S+++
Sbjct  1058  IQSEQVVMVGCWLAMKEVSLLLGTIIRKIPLPTCSLRPLENGDSASAAPSDSVIENSELL  1117

Query  2503  LDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLM  2682
             LDL+QLE IG+HFLEVLLKMKHNGAIDKTRA FTALC+RLLCSNDPRLCKLTESWMEQLM
Sbjct  1118  LDLKQLEKIGDHFLEVLLKMKHNGAIDKTRARFTALCHRLLCSNDPRLCKLTESWMEQLM  1177

Query  2683  ERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknk  2862
             ERTV++GQTVDD+LRRSAGIPAAF A FLSEPEG+PK+LLP+ALRWLI++A+K L D  +
Sbjct  1178  ERTVARGQTVDDVLRRSAGIPAAFIALFLSEPEGSPKKLLPQALRWLISLAEKPLLDPME  1237

Query  2863  ensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGF  3042
             +  S       ++     D+ + E +SK RDEGVVPTVHAFNVLKAAFND NL+TDTSGF
Sbjct  1238  QKGSKHM----VEEVNSSDMHSSENLSKVRDEGVVPTVHAFNVLKAAFNDTNLSTDTSGF  1293

Query  3043  SAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYP  3222
             SAEA+IVSIRSFSS YWEVRNSA LAYTALVRRMIGFLNVQKR S RRALTGLEFFHRYP
Sbjct  1294  SAEAMIVSIRSFSSQYWEVRNSATLAYTALVRRMIGFLNVQKRVSTRRALTGLEFFHRYP  1353

Query  3223  TLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPF  3402
              LH F+++ELK AT+L    +S    SNL  +VHPSL P+LILLSRLKPSPI SETGD  
Sbjct  1354  LLHPFIYSELKTATDLL--DTSGPSDSNLVNLVHPSLWPILILLSRLKPSPIASETGDDL  1411

Query  3403  DPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDL  3582
             DPF+FMPFI KCS Q NLR+R+LASRAL G+VSNEKL +V+L IAS LP           
Sbjct  1412  DPFVFMPFIMKCSTQRNLRVRVLASRALVGLVSNEKLQSVLLQIASTLP-----------  1460

Query  3583  SGLSNL--NASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQ  3756
                SN+    SFN +HG+LLQL +LLDTNCR+LAD SKK+ I+  LI+VL K +W+ SP 
Sbjct  1461  ---SNVAQGGSFNYLHGILLQLGNLLDTNCRDLADDSKKDQIIGKLINVLSKCTWMASPL  1517

Query  3757  KCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPT  3936
              CPCPIL  SFL+VLD+M  I R    SK +  I+ L   LS+ CLD   S   +Y+DP+
Sbjct  1518  TCPCPILCTSFLRVLDHMRVIERASSESKNLRDIYKLHLDLSTNCLDTDASYGFSYYDPS  1577

Query  3937  IAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQERLIRS  4116
             IA++R+QAA SYF C +Q S +  E   I  R   P+    ++           ER +R 
Sbjct  1578  IADVREQAAVSYFGCIFQPSDEAAEVFQITQR---PNLLRLQKVPEASDYPDLNERFLRC  1634

Query  4117  LSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEK  4296
             LSD  YEVR+ATLKWLL FL S +S  +ESS+         W  N  LQ +L++LL  EK
Sbjct  1635  LSDQSYEVRLATLKWLLQFLKSEDSSFSESSSIWN------WAKN-SLQVVLLELLDNEK  1687

Query  4297  NHKCMNYILKIIYTYNMQQYNKNC-GQHEKPTFVGNMDSDSVLQFWDKVVSLYKVTRHAK  4473
             NHKC NYILKI++ +N+  + K+  G+  +  +VG+++ D VL  W ++ SLY+ TR AK
Sbjct  1688  NHKCENYILKILFQWNLLMFKKSSKGESVEGIYVGSLNYDLVLHLWGRLTSLYESTRRAK  1747

Query  4474  TREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECIDYFVEVIQEH  4653
              R  L+CC+A+C+K L  LF     S   E+         S+     +C+ YFV +I+E 
Sbjct  1748  IRGTLMCCLAICVKHLTGLFFHKNDSEKEEE---------SRRGCVIDCVSYFVNMIKEK  1798

Query  4654  SDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGN---KQKDALHLYAHKILD  4824
             S +SE +N+R A+A++I+ASG+L+QA+ + P V NHQ+P  N     ++A ++YA++ILD
Sbjct  1799  SLSSEQVNVRHASAEAIIASGILEQAKIVGPLVLNHQIPSENIPSTFQNACNVYAYQILD  1858

Query  4825  LWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEHLSST  5004
             +WFTC+KLLEDEDD +R +L+ +VQKC         F++  VP QV+KV+E+SF HLSS 
Sbjct  1859  MWFTCIKLLEDEDDIIRSKLATDVQKCF--------FTAMEVPTQVDKVLELSFNHLSSV  1910

Query  5005  FGHWLDYLDFLCHWV-QSATNSACAVSIADPVRRVFDKEIDNHHEEKLLISQICCSHLEK  5181
             FGHW +Y  +L  WV  +A  S      +D VRRVFDKEIDNHHEEKLLI Q  C HL+K
Sbjct  1911  FGHWNEYSQYLSKWVFNTADYSPPPKGGSDLVRRVFDKEIDNHHEEKLLILQFGCYHLQK  1970

Query  5182  LPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPV  5361
             LP+S            + L  WR +F  QL+SF   +I  Q    W+GGVGNHKD FLP+
Sbjct  1971  LPMSDFPL--------AQLLDWRSKFHNQLLSFAKDHISKQRE-SWLGGVGNHKDVFLPL  2021

Query  5362  YVNLLAFHALSNCILR--GEAEDSKSMVPELLELGEAIQPFLRNPLISNLFVLVVKSHEK  5535
             Y NLL  +  SNCI+R   ++ D K++  +++ELG A++PFLRNPL+ N+F +VV+ H+ 
Sbjct  2022  YGNLLGLYVFSNCIIRFSTDSNDKKALCSDMIELGGALKPFLRNPLVCNMFRVVVRLHQN  2081

Query  5536  IAGGAVEHLVLEISGAYSA--WDAFDPYFLF  5622
             +   +++  +++++   S   W+ FDPYFL 
Sbjct  2082  LLDDSLDDSLVDLATVLSGEIWEGFDPYFLL  2112



>emb|CDX85226.1| BnaC07g25370D [Brassica napus]
Length=2061

 Score =  1896 bits (4912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1037/1893 (55%), Positives = 1301/1893 (69%), Gaps = 171/1893 (9%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSR VL                  + D   KTILYDGIL ELC+ CE+P DSH N
Sbjct  322   GILTAVSRGVL----------------VSSVDCDNKTILYDGILPELCDLCENPIDSHLN  365

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIK S   T   + E YDP+ +   +RVLKI+WNNLEDPLSQTVKQVH
Sbjct  366   FHALTVMQICLQQIKMS---TLNDLAEDYDPMPDSKVSRVLKIIWNNLEDPLSQTVKQVH  422

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             L+FDL LDIQ T+H      +    L KI + LL LG RCKGRY+PLASLT+RLGAK++L
Sbjct  423   LMFDLLLDIQTTVHQTYDKVEVRESLLKIVNYLLRLGSRCKGRYVPLASLTRRLGAKTLL  482

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSP LLF+   AYVDDDVC A T+F+KCFLE LRDE W ++GVE GY  YR  CL P L
Sbjct  483   DMSPNLLFEMANAYVDDDVCCAVTSFIKCFLEMLRDECWGSEGVERGYAVYRQRCLPPFL  542

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYA+ VLLELDVD IFP+LG I IG S E T++ Y EL S  + L
Sbjct  543   YGLASGMSKLRSNLNTYAVQVLLELDVDCIFPLLGLISIGPSEEETKLVYTELSSISMEL  602

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              VEQ+VAVLVSLLKV R LA +EGDI+              S DA    + V +KGIE+K
Sbjct  603   TVEQKVAVLVSLLKVCRTLAFLEGDIE-----------QKGSADAF---AFVKIKGIELK  648

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +PV +L +ALTH+D+S+R+DAAE+LF+NPKTASLPS LEL L+++AVPLNMR  ST FQM
Sbjct  649   VPVEWLKMALTHVDESVRVDAAETLFLNPKTASLPSPLELYLIKEAVPLNMRSSSTGFQM  708

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSRVRT+LE+  K G+W P L    S + L+ + D+    RAE+LF FM+W
Sbjct  709   KWTSLFRKFFSRVRTSLEKQYKLGSWQPRLANGNSETCLSKKCDEDAVLRAESLFKFMRW  768

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LS FL  SCYPSAPY RKIMA EL+ IM+  W ++P +  +        LYPY   +   
Sbjct  769   LSSFLSLSCYPSAPYRRKIMATELIQIMIEFWPIVPSKDPTSH------LYPYCDIVTSH  822

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             +STLLLVGSI+DSWDRLRE++FRILLHFPTP  G+SS ++V   I WAK LVCSPRVRES
Sbjct  823   DSTLLLVGSIVDSWDRLRENAFRILLHFPTPFTGVSSEDMVQTIIPWAKHLVCSPRVRES  882

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDW  1980
             DAG+LT RLIFRKY                                      YI SLI W
Sbjct  883   DAGSLTLRLIFRKY--------------------------------------YIKSLIHW  904

Query  1981  LCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilalV  2160
             L   V+EGE+DLSEAC+ SFVHGVLL LRYTFEE+DW+S A+ S++S ++  LEK+L LV
Sbjct  905   LDTCVKEGERDLSEACRNSFVHGVLLALRYTFEELDWNSNALLSSVSEMREELEKLLKLV  964

Query  2161  MRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQDDG  2340
              RIT+LALWVVSADA  L ++M+++  D + FL      D +A+T      I+K ++D  
Sbjct  965   TRITTLALWVVSADALCLDEDMDDIVDDDS-FLSDV--QDAAAAT-----AISKEQKDTH  1016

Query  2341  PM--------DQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVP-----KSCSQITDGTD  2481
             P         +Q+VMVGCWLAMKEVSLLLGTIIRK+PLPTS +         S + D + 
Sbjct  1017  PKPVQETIQSEQVVMVGCWLAMKEVSLLLGTIIRKIPLPTSSLAPLENGDLASAVPDDSV  1076

Query  2482  QLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTE  2661
               +S+ +LDL+QLE IG+HFLEVLLKMKHNGAIDKTRAGF+ALC+RLLCSNDPRLC+LTE
Sbjct  1077  VGNSESLLDLKQLEKIGDHFLEVLLKMKHNGAIDKTRAGFSALCHRLLCSNDPRLCRLTE  1136

Query  2662  SWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKK  2841
             SWMEQLMERTV+KGQTVDDLLRRSAGIPAAF A FLSEPEG+PK+LLP+ALRWLI +A+K
Sbjct  1137  SWMEQLMERTVAKGQTVDDLLRRSAGIPAAFIALFLSEPEGSPKKLLPQALRWLIGLAEK  1196

Query  2842  SLTDknkensscsesssAIDSTMVP-DVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDAN  3018
              L D  ++  S S+    +D  + P ++   E +SK RDEGVVPTVHAFNVLKAAFND N
Sbjct  1197  PLMDPVEQKDSNSKH---MDEEVDPSNMHPSEKLSKVRDEGVVPTVHAFNVLKAAFNDTN  1253

Query  3019  LATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTG  3198
             L TDTSGFSAEA+ V+IRSFSS YWEVRNSA LAYTAL+RRM+GFLNVQKR SARR LTG
Sbjct  1254  LGTDTSGFSAEAMTVAIRSFSSPYWEVRNSATLAYTALLRRMVGFLNVQKRGSARRGLTG  1313

Query  3199  LEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPI  3378
             LEFFHRYP LH F++ ELK AT++    +S    SNLA  VHPSL P+LILLSRLKPSPI
Sbjct  1314  LEFFHRYPLLHPFIYGELKAATDML--DTSGPSDSNLANHVHPSLWPILILLSRLKPSPI  1371

Query  3379  TSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAID  3558
              SE+GD  DPF+FMPFI KCS Q+NLR+R+LASRAL G+VSNEKL +V+L IAS LP+ +
Sbjct  1372  ASESGDDLDPFVFMPFIMKCSTQSNLRVRVLASRALVGLVSNEKLQSVLLRIASTLPSNE  1431

Query  3559  NHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHS  3738
                             SFN +HG+LLQL +LLDTNCR+LAD SKK+ I+  L++VL K +
Sbjct  1432  VQC------------GSFNYLHGVLLQLGNLLDTNCRDLADDSKKDQIIEQLVNVLAKCT  1479

Query  3739  WIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRP  3918
             W+ SP  CPCPI++ SFL+VLD+M +I       K +  ++ L   LS+ CLD   S   
Sbjct  1480  WMVSPLLCPCPIISTSFLRVLDHMRAIGW-----KNLRDVYKLHLDLSTRCLDADASYGF  1534

Query  3919  AYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQ  4098
             +Y+DPT+AELR+QAA SYF C +Q S +  E   ++     P+S L K  E  +     +
Sbjct  1535  SYYDPTVAELREQAAVSYFGCVFQPSDEAAE---VFQITQKPNSPLQKVPEA-LDFPDLK  1590

Query  4099  ERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQ  4278
             +RL+R LSD  YEVR+ATLKW L FL + +S  +E+S+         W SN GLQ ML+ 
Sbjct  1591  DRLLRCLSDQSYEVRLATLKWFLQFLKAEDSSFSETSSIWH------WASN-GLQVMLLD  1643

Query  4279  LLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPTFVGNMDSDSVLQFWDKVVSLYKV  4458
             LL  EKNH+C NYIL+I+  +N+  + K+    ++  +VG++  DSV+  W ++ SLY+ 
Sbjct  1644  LLEKEKNHRCENYILRILCQWNLLMFKKS---SKEGVYVGSLSYDSVVHLWGRLTSLYER  1700

Query  4459  TRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECIDYFVE  4638
             TRH KTR  L+ C+A+C+K L  LF                  +  + S   +C+ YFV 
Sbjct  1701  TRHVKTRGTLMSCLAICVKHLTGLFFD-------------KKEEEPRWSCVIDCVSYFVN  1747

Query  4639  VIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGNKQKDALHLYAHKI  4818
             +I+E S +SE +N+R+A+A++I+ASG+L+QA  + P VSNHQ P  +K ++A  +YA++I
Sbjct  1748  LIKEKSSSSEQVNVRQASAEAIIASGILEQANLIGPLVSNHQTPSRSKFQNACDVYAYQI  1807

Query  4819  LDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGV-VPIQVEKVIEMSFEHL  4995
             L++WFTC+KLLEDEDD +R +L+ +VQKC         FS+ + VP QVEKV+E+SF+HL
Sbjct  1808  LEMWFTCIKLLEDEDDLIRSKLATDVQKCF--------FSTAMEVPTQVEKVLELSFDHL  1859

Query  4996  SSTFGHWLDYLDFLCHWV-QSATNSACAVSIADPVRRVFDKEIDNHHEEKLLISQICCSH  5172
             SS FGHW +Y  +L  WV  +A  +A     +D VRRVFDKEIDNHHEEKLLI Q CC H
Sbjct  1860  SSVFGHWNEYFLYLSRWVFSTADYTAPLKGGSDLVRRVFDKEIDNHHEEKLLILQFCCDH  1919

Query  5173  LEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAF  5352
             L+KL    L            L  WR +F  +L+ F   ++G Q    W+GGVGNHKD F
Sbjct  1920  LQKLANRDLPQ--------GQLLEWRSKFHNKLLCFAKDHVGKQRE-SWVGGVGNHKDVF  1970

Query  5353  LPVYVNLLAFHALSNCILR--GEAEDSKSMVPELLELGEAIQPFLRNPLISNLFVLVVKS  5526
             LP+Y NLL  +  SNCILR   +  D K+M  +++ELGEA++PFLRNPL+SN+F +VV  
Sbjct  1971  LPLYGNLLGLYVFSNCILRFSTDGNDKKAMFADMVELGEALKPFLRNPLVSNMFRVVVGL  2030

Query  5527  HEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             HEK    ++  L   ++G    W+ FDPYFL R
Sbjct  2031  HEKSVDDSLVDLSSVLAG--EVWEGFDPYFLLR  2061



>emb|CDX86407.1| BnaA06g31240D [Brassica napus]
Length=2053

 Score =  1892 bits (4900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1036/1886 (55%), Positives = 1290/1886 (68%), Gaps = 161/1886 (9%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSR VL                  + D   +TILYDGIL ELC+ CE+P DSH N
Sbjct  318   GILTAVSRGVL----------------VSSVDCDHQTILYDGILPELCDLCENPVDSHLN  361

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIK S   T   + E YDP+ +   +RVLKI+WNNLEDPLSQTVKQVH
Sbjct  362   FHALTVMQICLQQIKMS---TLNDLAEDYDPMPDSKVSRVLKIIWNNLEDPLSQTVKQVH  418

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             L+FDL LDIQ T+H      +    L KI + LL LG RCKGRYIPLASLT+RLGAK++L
Sbjct  419   LMFDLLLDIQTTVHQTYDKVEVRESLLKIVNYLLRLGTRCKGRYIPLASLTRRLGAKTLL  478

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSP LLF+   AYVDDDVC A T+F+KCFLE LRDE W ++GVE GY  YR  CL P L
Sbjct  479   DMSPNLLFEMANAYVDDDVCCAVTSFIKCFLEMLRDECWGSEGVERGYAVYRQRCLPPFL  538

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYA+ VLLELDVD IFP+LG I IG S E T++ Y EL S  + L
Sbjct  539   YGLASGMSKLRSNLNTYAVQVLLELDVDCIFPLLGLISIGPSEEETKLVYTELSSISMEL  598

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              VEQ+VAVLVSLLKV R LA +EGDI+              S DA    + V +KGIE+K
Sbjct  599   TVEQKVAVLVSLLKVCRTLAFLEGDIE-----------QKGSADAF---AFVKIKGIELK  644

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +PV +L +ALTH+D+S+R+DAAE+LF+NPKTASLPS  EL L+++AVPLNMR  ST FQM
Sbjct  645   VPVEWLKMALTHVDESVRVDAAETLFLNPKTASLPSPFELYLIKEAVPLNMRSSSTGFQM  704

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSRVRT+LE+  K G+W P L    +   L G+ D  L  RAE+LF FM+W
Sbjct  705   KWTSLFRKFFSRVRTSLEKQYKLGSWQPRLANGNNEKCLKGDEDAVL--RAESLFKFMRW  762

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LS FL  SCYPSAPY RKIMA EL+ IM+ VW ++P      S  S   LYPY   +   
Sbjct  763   LSSFLSLSCYPSAPYRRKIMATELIQIMMEVWPIVP------SKDSTSHLYPYCDIVTSH  816

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             +STLLLVGSI+DSWDRLRE++FRILLHFPTP  G+SS ++V   I WAK LVCSPRVRES
Sbjct  817   DSTLLLVGSIVDSWDRLRENAFRILLHFPTPFTGVSSEDMVQTIIPWAKHLVCSPRVRES  876

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDW  1980
             DAG+LT RLIFRKY                                      YI SLI W
Sbjct  877   DAGSLTLRLIFRKY--------------------------------------YIKSLIHW  898

Query  1981  LCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilalV  2160
             L   V+EGE+DLSEAC+ SFVHGVLL LRYTFEE+DW+S AV S++S ++  LEK+L LV
Sbjct  899   LDTCVKEGERDLSEACRNSFVHGVLLALRYTFEELDWNSNAVLSSVSEMREELEKLLKLV  958

Query  2161  MRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIA--KAEQD  2334
              RIT+LALWVVSADA  L ++M+++  D + FL   ++ D + +    E K    K  Q+
Sbjct  959   TRITTLALWVVSADALCLDEDMDDIVDDDS-FLS-DVQDDAATTVLSKEQKDTHPKPVQE  1016

Query  2335  DGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVP-----KSCSQITDGTDQLSSDI  2499
                 +Q+VMVGCWLAMKEVSLLLGTIIRK+PLPTS +         S + D +   +S+ 
Sbjct  1017  TIQSEQVVMVGCWLAMKEVSLLLGTIIRKIPLPTSSLAPLENGDLASAVPDDSVVGNSES  1076

Query  2500  VLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQL  2679
             +LDL+QLE IG+HFLEVLLKMKHNGAIDKTRAGF+ALC+RLLCSNDPRLC+LTESWMEQL
Sbjct  1077  LLDLKQLEKIGDHFLEVLLKMKHNGAIDKTRAGFSALCHRLLCSNDPRLCRLTESWMEQL  1136

Query  2680  MERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDkn  2859
             MERT++KGQTVDDLLRRSAGIPAAF A FLSEPEG+PK+LLP+ALRWLI +A+K L D  
Sbjct  1137  MERTMAKGQTVDDLLRRSAGIPAAFIALFLSEPEGSPKKLLPQALRWLIGLAEKPLMDPA  1196

Query  2860  kensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSG  3039
             +E  S         S M P     E +SK RDEGVVPTVHAFNVLKAAFND NL TDTSG
Sbjct  1197  EEKGSKHMDEEVNPSNMHPS----EKLSKVRDEGVVPTVHAFNVLKAAFNDTNLGTDTSG  1252

Query  3040  FSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRY  3219
             FSAEA+ V+IRSFSS YWEVRNSA LAYTAL+RRM+GFLNVQKR SARR LTGLEFFHRY
Sbjct  1253  FSAEAMTVAIRSFSSPYWEVRNSATLAYTALLRRMVGFLNVQKRGSARRGLTGLEFFHRY  1312

Query  3220  PTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDP  3399
             P LH F++ ELK AT++    +S    SNLA  VHPSL P+LILLSRLKPSPI SE+GD 
Sbjct  1313  PLLHPFIYGELKAATDML--DTSGQSDSNLANHVHPSLWPILILLSRLKPSPIASESGDD  1370

Query  3400  FDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSD  3579
              DPF+FMPFI KCS Q+NLR+R+LASRAL G+VSNEKL +V+L++AS LP       +++
Sbjct  1371  LDPFVFMPFIMKCSTQSNLRVRVLASRALVGLVSNEKLQSVLLSVASTLP-------SNE  1423

Query  3580  LSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQK  3759
             + G       FN +HG+LLQL +LLDTNCR+L D SKK+ I+  L++VL K +W+ SP  
Sbjct  1424  VQG-----GPFNYLHGVLLQLGNLLDTNCRDLTDNSKKDQIIEQLVNVLAKCTWMASPLL  1478

Query  3760  CPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPTI  3939
             CPCPI++ SFL+VLD+M +I       K +  ++ L   LS+ CLD   S   +Y+DPT+
Sbjct  1479  CPCPIISTSFLRVLDHMRAIGW-----KNLRDVYKLHLDLSTSCLDADASYGFSYYDPTV  1533

Query  3940  AELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQERLIRSL  4119
             AELR+QAA SYF C +Q S +  E   I  R   P+  L K  E  +     + RL+R L
Sbjct  1534  AELREQAAVSYFGCVFQPSDEAAEVFQITQR---PNLLLQKVPEA-LDFPDLKGRLLRCL  1589

Query  4120  SDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEKN  4299
             SD  YEVR+ATLKW L FL + +S  +E+S+         W SN GLQ ML+ LL  EKN
Sbjct  1590  SDQSYEVRLATLKWFLQFLKAEDSSFSETSSIWH------WASN-GLQVMLLDLLEKEKN  1642

Query  4300  HKCMNYILKIIYTYNMQQYNKNCGQHEKPTFVGNMDSDSVLQFWDKVVSLYKVTRHAKTR  4479
             H+C NYIL+I+  +N+  + K   +  +  +VG++  DSV+  W ++ SLY+ TRH KTR
Sbjct  1643  HRCENYILRILCQWNLLMFKK---ESNEGIYVGSLSYDSVIHLWGRLTSLYERTRHVKTR  1699

Query  4480  EMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECIDYFVEVIQEHSD  4659
               L+ C+A+C+K L  LF                  +  + S   +C+ YFV +I+E S 
Sbjct  1700  GTLMSCLAICVKHLTSLFFD-------------KKEEEPRWSCVIDCVSYFVNLIKEKSS  1746

Query  4660  ASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGNKQKDALHLYAHKILDLWFTC  4839
             +SE +N+R+A+A++I+ASG+L+QA+ + P VSNHQ P  +K ++A  +YA++IL++WFTC
Sbjct  1747  SSEQVNVRQASAEAIIASGILEQAKLIGPLVSNHQTPSLSKFQNACDVYAYQILEMWFTC  1806

Query  4840  MKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGV-VPIQVEKVIEMSFEHLSSTFGHW  5016
             +KLLEDEDD +R +L+ +VQKC         FS+ + VP QVEKV+E+SF+HLS  FGHW
Sbjct  1807  IKLLEDEDDIIRSKLATDVQKCF--------FSTAMEVPTQVEKVLELSFDHLSFVFGHW  1858

Query  5017  LDYLDFLCHWVQSATNSACAVSIA-DPVRRVFDKEIDNHHEEKLLISQICCSHLEKLPVS  5193
              +Y  +L  WV S  +    +    D VRRVFDKEIDNHHEEKLLI Q CC HL+KL  S
Sbjct  1859  NEYFLYLSRWVFSTADYTAPLKGGIDLVRRVFDKEIDNHHEEKLLILQFCCHHLQKLANS  1918

Query  5194  KLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNL  5373
              L            L  WR +F  +L+ F   ++G Q    W+GGVGNHKD FLP+Y NL
Sbjct  1919  DLPH--------GQLLEWRSKFHNKLLCFAKDHVGKQRE-SWVGGVGNHKDVFLPLYGNL  1969

Query  5374  LAFHALSNCILR--GEAEDSKSMVPELLELGEAIQPFLRNPLISNLFVLVVKSHEKIAGG  5547
             L  +  SNCILR   +  D K+M  +++ELGEA++PFLRNPL+SN+F +VV  HEK    
Sbjct  1970  LGLYVFSNCILRFSTDGNDKKAMFADMVELGEALKPFLRNPLVSNMFRVVVGLHEKSVDD  2029

Query  5548  AVEHLVLEISGAYSAWDAFDPYFLFR  5625
             ++  +   + G    W+ FDPYFL R
Sbjct  2030  SLVDMSSVLVG--EVWEGFDPYFLLR  2053



>emb|CAB75750.1| putative protein [Arabidopsis thaliana]
Length=2149

 Score =  1865 bits (4830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1031/1881 (55%), Positives = 1300/1881 (69%), Gaps = 147/1881 (8%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILT VSR +L                  N+D   KTILYDGIL ELC+ CE+P DSH N
Sbjct  322   GILTTVSRGIL----------VSSFARLSNSDCDHKTILYDGILLELCDLCENPIDSHLN  371

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FH LTVMQIC+QQIKTSM  TD  + EGYDP+ + +  RVL+I+WNNLEDPLSQTVKQVH
Sbjct  372   FHVLTVMQICMQQIKTSML-TD--LSEGYDPMPDSMAARVLRIIWNNLEDPLSQTVKQVH  428

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             L+FDL LDIQ T+H  +        L KI + LL LG RCKGRY+PLASLT+RLGAK+++
Sbjct  429   LMFDLLLDIQTTVHQTDDKVGMRESLLKIVNYLLRLGSRCKGRYVPLASLTRRLGAKTLM  488

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSP LLF+   AY+DDDVC A T+F+KCFLE LRDE W ++GV+ GY +YR HCL P L
Sbjct  489   DMSPNLLFEMANAYIDDDVCYAVTSFIKCFLELLRDESWGSEGVDQGYARYREHCLPPFL  548

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYA+ VLLELDVDSIF +L +I IG S E T++ Y EL +  + L
Sbjct  549   YGLASGKSKLRSNLNTYAVQVLLELDVDSIFLLLAYISIGPSEEETKLNYTELSNMSMEL  608

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              VEQ+V VLVSLLKV R LA +EGDI+              STDA    +VV +KGIE+K
Sbjct  609   TVEQKVVVLVSLLKVCRTLAFLEGDIE-----------QKRSTDAF---AVVQIKGIELK  654

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             IP+ +L +ALTH+D+S+R+DAAE+LF+NPKT+SLPS LEL LM++AVPLNMR  ST FQM
Sbjct  655   IPIEWLKMALTHVDESVRVDAAETLFLNPKTSSLPSPLELYLMKEAVPLNMRSSSTGFQM  714

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFF RVRT+LE+  K G+  P             ++D++   RAE+LF FM+W
Sbjct  715   KWTSLFRKFFLRVRTSLEKQYKLGSLQPL------------KSDKNAVLRAESLFKFMRW  762

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LS FL+ SCYPSAPY RKIMA EL+ IM+ VW   P     D  S +  LYPY   +   
Sbjct  763   LSSFLYLSCYPSAPYRRKIMATELIQIMIEVW---PVVASKDPTSHQGHLYPYCDIVTSH  819

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             +STLLLVGSI+DSWDRLRE+SFRILLHFPTP  GISS ++V   I WAK+LVCSPRVRES
Sbjct  820   DSTLLLVGSIVDSWDRLRENSFRILLHFPTPFTGISSEDMVQIIIPWAKQLVCSPRVRES  879

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDW  1980
             DA                       C  +        +  N    P  PV+EYI SLI W
Sbjct  880   DA----------------------ECENI--------DCRNQNSKPKYPVVEYIKSLIQW  909

Query  1981  LCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilalV  2160
             L A+V EGE+DLSEACK SFVHGVLL LRYTFEE+DW+S AV  +IS ++  LEK+L LV
Sbjct  910   LDASVTEGERDLSEACKNSFVHGVLLALRYTFEELDWNSNAV-LSISEMRKELEKLLKLV  968

Query  2161  MRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKI-AKAEQDD  2337
              RIT+LALWVVSADA  LP++M+++  D + F    ++ D +A   ++      K   + 
Sbjct  969   TRITTLALWVVSADALCLPEDMDDIIDDDSFF--SNVQDDSAAVLSEEHTSTYPKHVHET  1026

Query  2338  GPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDV-----PKSCSQITDGTDQLSSDIV  2502
                +Q+VMVGCWLAMKEVSLLLGTIIRK+PLPTS +       + S + +     +S+ +
Sbjct  1027  VQSEQVVMVGCWLAMKEVSLLLGTIIRKIPLPTSSLRPLENGDTASSVPNDLVIGNSESL  1086

Query  2503  LDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLM  2682
             LDL+QLE IG+HFLEVLLKMKHNGAIDKTRAGFTALC+RLLCSNDPRLCKLTESWMEQLM
Sbjct  1087  LDLKQLEKIGDHFLEVLLKMKHNGAIDKTRAGFTALCHRLLCSNDPRLCKLTESWMEQLM  1146

Query  2683  ERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknk  2862
             ERTV+KGQTVDD+LRRSAGIPAAF A FLSEPEG+PK+LLP+ALRWLI +A+K L +  +
Sbjct  1147  ERTVAKGQTVDDVLRRSAGIPAAFIALFLSEPEGSPKKLLPRALRWLIGLAEKPLMEPLE  1206

Query  2863  ensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGF  3042
             +  S       ++     D+ + E +SK RDEGVVPTVHAFNVLKA FND NL+TDTSGF
Sbjct  1207  QKGSKHM----VEEINSSDMHSNEKLSKVRDEGVVPTVHAFNVLKATFNDTNLSTDTSGF  1262

Query  3043  SAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYP  3222
             SAEA+IVSIRSFSS YWEVRNSA LAYTALVRRMIGFLNVQKR S RRALTGLEFFHRYP
Sbjct  1263  SAEAMIVSIRSFSSPYWEVRNSATLAYTALVRRMIGFLNVQKRGSTRRALTGLEFFHRYP  1322

Query  3223  TLHTFLFNELKIATELF-LEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDP  3399
              LH F+++ELK AT+L    GSS+   SNLA +VHPSL P+LILLSRLKPSPI SE+GD 
Sbjct  1323  LLHPFIYSELKAATDLLDTSGSSD---SNLANLVHPSLWPILILLSRLKPSPIASESGDD  1379

Query  3400  FDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSD  3579
              DPF+FMPFI KCS Q+NLR+R+LASRAL G+VSNEKL +V+L IAS LP+         
Sbjct  1380  LDPFVFMPFIMKCSTQSNLRVRVLASRALVGLVSNEKLQSVLLRIASTLPSNGAQ-----  1434

Query  3580  LSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQK  3759
                      SFN +HG+LLQL +LLDTNCR+LAD SKK+ I+  LI+VL   SW+ SP  
Sbjct  1435  -------GGSFNYLHGILLQLGNLLDTNCRDLADNSKKDQIIGKLINVLANCSWLASPLT  1487

Query  3760  CPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPTI  3939
             CPCPIL  SFL+VLD+M  I  TC  SK +  I+ L   LS+ CLD   S   +Y+DP+I
Sbjct  1488  CPCPILCTSFLRVLDHMRVIEWTCSESKNLRDIYKLHLDLSTNCLDADASYGFSYYDPSI  1547

Query  3940  AELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQERLIRSL  4119
             AELR+QAA SYF C +Q S +  E   I  R P   S+   E+   +      ERL+R +
Sbjct  1548  AELREQAAVSYFGCVFQPSDEAAEVFQITQR-PNLQSQKVPEA---LDFPHLNERLLRCI  1603

Query  4120  SDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEKN  4299
             SD  YEVR+ATLKW L FL S +S  +ESS+         W  N GLQ +L++LL  EKN
Sbjct  1604  SDQSYEVRLATLKWFLRFLKSEDSSFSESSSIWN------WAKN-GLQVILLELLDKEKN  1656

Query  4300  HKCMNYILKIIYTYNMQQYNKNCGQHE-KPTFVGNMDSDSVLQFWDKVVSLYKVTRHAKT  4476
             HKC NYIL+I++ +N+  + K+C +   +  +VG+++ DSV   W ++ SLY+ TR AKT
Sbjct  1657  HKCENYILRILFQWNLLMFKKSCNKESVEGIYVGSLNYDSVFHLWGRLTSLYESTRRAKT  1716

Query  4477  REMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECIDYFVEVIQEHS  4656
             R  L+CC+A+C+K L  LF        NE        +  + S  ++C+ YFV +I++ S
Sbjct  1717  RGTLMCCLAICVKHLTGLFIHK-----NES----EKEEEPRWSCITDCVSYFVNLIKQKS  1767

Query  4657  DASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDG---NKQKDALHLYAHKILDL  4827
               SE +N+R A+A++I+ASG+L+QA+ + P VSNHQ+      +K + A  +YA++IL++
Sbjct  1768  LPSEQVNVRHASAEAIIASGILEQAKLIGPLVSNHQISSETTPSKFQKACDVYAYQILEM  1827

Query  4828  WFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEHLSSTF  5007
             WFTC+KLLEDEDD +R +L+ +VQKC         F++  VP QV+KV+E+SF HLSS  
Sbjct  1828  WFTCIKLLEDEDDVIRSKLATDVQKCF--------FTAVEVPTQVDKVLELSFNHLSSIL  1879

Query  5008  GHWLDYLDFLCHWV-QSATNSACAVSIADPVRRVFDKEIDNHHEEKLLISQICCSHLEKL  5184
             GHW +Y  +L  WV  +A  ++     +D VRRVFDKEIDNHHEEKLLI Q CC HL+KL
Sbjct  1880  GHWNEYSQYLSRWVFNTADYTSPPKGGSDLVRRVFDKEIDNHHEEKLLILQFCCYHLQKL  1939

Query  5185  PVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPVY  5364
             P        RD ++  +L  WR +F  QL++F   ++  Q    W+GGVGNHKD FLP+Y
Sbjct  1940  PN-------RDFSLAQLLD-WRSKFHNQLLAFAKDHVSKQRE-SWVGGVGNHKDVFLPLY  1990

Query  5365  VNLLAFHALSNCILR--GEAEDSKSMVPELLELGEAIQPFLRNPLISNLFVLVVKSHEKI  5538
              NLL  +  S+CI R   ++ D K++  +++ELGEA++PFLRNPL+SN+F +VV+ HEK+
Sbjct  1991  GNLLGLYVFSDCIFRFSTDSNDKKTLFSDIIELGEALKPFLRNPLVSNMFRVVVRLHEKL  2050

Query  5539  AGGAVEHLVLEISGAYSAWDA  5601
                ++  L   +SG    W+A
Sbjct  2051  LNDSLMDLSTVLSG--EIWEA  2069



>ref|XP_002878022.1| hypothetical protein ARALYDRAFT_324042 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54281.1| hypothetical protein ARALYDRAFT_324042 [Arabidopsis lyrata subsp. 
lyrata]
Length=2128

 Score =  1857 bits (4810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1028/1881 (55%), Positives = 1289/1881 (69%), Gaps = 148/1881 (8%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILT VSR +L                  N+D   KTILYDGIL ELC+ CE+P DSH N
Sbjct  322   GILTTVSRGIL----------VSSFARLSNSDCDHKTILYDGILLELCDLCENPIDSHLN  371

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQIC+QQIKTSM  TD  + E  DP+ + +  RVL+I+WNNLEDPLSQTVKQVH
Sbjct  372   FHALTVMQICMQQIKTSML-TD--LSEDCDPMPDSMAARVLRIIWNNLEDPLSQTVKQVH  428

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             L+FDL LDIQ T+H  +        L KI + LL LG RCKGRY+PLASLT+RLGAK+++
Sbjct  429   LMFDLLLDIQTTVHQTDDKVGIRESLLKIVNYLLRLGSRCKGRYVPLASLTRRLGAKTLM  488

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSP LLF+   AY+DDDVC A T+F+KCFLE LRDE W ++GV  GY +YR HCL P L
Sbjct  489   DMSPNLLFEMANAYIDDDVCYAVTSFIKCFLEMLRDESWGSEGVAQGYARYREHCLPPFL  548

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYA+ VLLELDVDSIF +L +I IG S E T++ Y EL +  + L
Sbjct  549   YGLASGISKLRSNLNTYAVQVLLELDVDSIFLLLAYISIGPSEEETKLNYTELSNMSMEL  608

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              VEQ+V VLVSLLKV R LA +EGDI+              STDA    +VV +KGIE+K
Sbjct  609   TVEQKVVVLVSLLKVCRTLAFLEGDIE-----------QKRSTDAF---AVVQIKGIELK  654

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +P+ +L +ALTH+D+S+R+DAAE+LF+NPKT+SLPS LEL LM++AVPLNMR  ST FQM
Sbjct  655   VPIEWLKMALTHVDESVRVDAAETLFLNPKTSSLPSPLELYLMKEAVPLNMRSSSTGFQM  714

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFF RVRT+LE+  K G+  P             ++D+S   RAE+LF FM+W
Sbjct  715   KWTSLFRKFFLRVRTSLEKQYKLGSLQPL------------KSDKSAVLRAESLFKFMRW  762

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LS FL+ SCYPSAPY RKIMA EL+ IM+ VW   P     D  S +  LYPY   +   
Sbjct  763   LSSFLYLSCYPSAPYRRKIMATELIQIMIEVW---PVVASKDLTSHQGHLYPYCDIVTSH  819

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             +STLLL+GSI+DSWDRLRE+SFRILLHFPTP  GISS ++V   I WAK+LVCSPRVRES
Sbjct  820   DSTLLLIGSIVDSWDRLRENSFRILLHFPTPFTGISSEDMVQIIIPWAKQLVCSPRVRES  879

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDW  1980
             DA                       C  +        NG      P  PV+EYI SLI W
Sbjct  880   DA----------------------ECESI--------NGLYQNAKPKYPVVEYIKSLIHW  909

Query  1981  LCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilalV  2160
             L  +V EGE+DLSEACK SFVHGVLL LRYTFEE+DW+S AV  +IS ++  LEK+L LV
Sbjct  910   LDTSVTEGERDLSEACKNSFVHGVLLALRYTFEELDWNSNAV-LSISEMRKELEKLLKLV  968

Query  2161  MRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKI-AKAEQDD  2337
              RIT+LALWVVSADA  LP++M+++  D + F    ++ D +A   ++      K   + 
Sbjct  969   TRITTLALWVVSADALCLPEDMDDIIDDDSFF--SNVQDDAAAVLSEEHTSTHPKPVHET  1026

Query  2338  GPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDV-----PKSCSQITDGTDQLSSDIV  2502
                +Q+VMVGCWLAMKEVSLLLGTIIRK+PLPTS +       + S + +     +S+ +
Sbjct  1027  VQSEQVVMVGCWLAMKEVSLLLGTIIRKIPLPTSSLRPLENGDTASAVPNDLVIGNSESL  1086

Query  2503  LDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLM  2682
             LDL+QLE IG+HFLEVLLKMKHNGAIDKTRAGFTALC+RLLCSNDPRLCKLTESWMEQLM
Sbjct  1087  LDLKQLEKIGDHFLEVLLKMKHNGAIDKTRAGFTALCHRLLCSNDPRLCKLTESWMEQLM  1146

Query  2683  ERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknk  2862
             ERTV++GQTVDDLLRRSAGIPAAF A FLSEPEG+PK+LLP+ALRWLI +A+K L +  +
Sbjct  1147  ERTVARGQTVDDLLRRSAGIPAAFIALFLSEPEGSPKKLLPQALRWLIGLAEKPLMEPLE  1206

Query  2863  ensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGF  3042
             +  S +     ++     D+   E +SK RDEGVVPTVHAFNVLKA FND NL+TDTSGF
Sbjct  1207  QKVSENM----VEEINSSDMHTSEKLSKVRDEGVVPTVHAFNVLKATFNDTNLSTDTSGF  1262

Query  3043  SAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYP  3222
             SAEA+IVSIRSFSS YWEVRNSA LAYTALVRRMIGFLNVQKR S RRALTGLEFFHRYP
Sbjct  1263  SAEAMIVSIRSFSSPYWEVRNSATLAYTALVRRMIGFLNVQKRGSTRRALTGLEFFHRYP  1322

Query  3223  TLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPF  3402
              LH F+++ELK AT+L    +S    SNLA +VHPSL P+LILLSRLKPSPI SETGD  
Sbjct  1323  LLHPFIYSELKAATDLL--DTSGPSDSNLANLVHPSLWPILILLSRLKPSPIASETGDDL  1380

Query  3403  DPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDL  3582
             DPF+FMPFI KCS Q+NLR+R+LASRAL G+VSNEKL +V+L IAS LP+          
Sbjct  1381  DPFVFMPFIMKCSTQSNLRVRVLASRALVGLVSNEKLQSVLLRIASTLPS----------  1430

Query  3583  SGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQKC  3762
             +G+     SFN +HG+LLQL +LLDTNCR+L D SKK+ I+  LI VL K SW+ SP  C
Sbjct  1431  NGVQ--GGSFNYLHGILLQLGNLLDTNCRDLVDDSKKDQIIGKLITVLAKCSWLASPLTC  1488

Query  3763  PCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPTIA  3942
             PCPIL  SFL+VLD+M  I  TC  SK +  I+ L   LS+ CLD   S   +Y+DP+IA
Sbjct  1489  PCPILCTSFLRVLDHMRVIEWTCSESKNLRDIYKLHLDLSTNCLDADASYGFSYYDPSIA  1548

Query  3943  ELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQERLIRSLS  4122
             ELR+QAA SYF C +Q S +  E   I  R      ++       +S     ERL+R +S
Sbjct  1549  ELREQAAVSYFGCVFQPSDEAAEVFQITQRSNLRSQKV----PEALSFPDLNERLLRCIS  1604

Query  4123  DALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEKNH  4302
             D  YEVR+ATLKW L FL S +S  +ESS+         W  N GLQ +L++LL  EKNH
Sbjct  1605  DQSYEVRLATLKWFLRFLKSEDSSFSESSSIWN------WAKN-GLQVILLELLDKEKNH  1657

Query  4303  KCMNYILKIIYTYNMQQYNKNC-GQHEKPTFVGNMDSDSVLQFWDKVVSLYKVTRHAKTR  4479
             KC NYIL+I++ +N+  + K+C G+  +  +VG+++ DSV   W ++ SLY+ TR AK R
Sbjct  1658  KCENYILRILFQWNLLMFKKSCNGESVEGIYVGSLNYDSVFHLWGRLTSLYENTRRAKIR  1717

Query  4480  EMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECIDYFVEVIQEHSD  4659
               L+CC+A+C+K L  LF        NE        +  +    ++C+ YFV +I++ S 
Sbjct  1718  GTLMCCLAICVKHLTGLFFHK-----NES----EKEEEPRWGCITDCVSYFVNLIKQKSL  1768

Query  4660  ASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDG---NKQKDALHLYAHKILDLW  4830
              SE +N+R A+A++I+ASG+L+QA+ + P VSNHQ+      +K + A  +Y ++IL++W
Sbjct  1769  PSEQVNVRHASAEAIIASGILEQAKLIGPLVSNHQISSETTPSKFQKACDVYTYQILEMW  1828

Query  4831  FTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFG  5010
             FTC+KLLEDEDD +R +L+++VQKC         F++  VP QV+KV+E+SF HLSS FG
Sbjct  1829  FTCVKLLEDEDDLIRSKLAMDVQKCF--------FTAMGVPTQVDKVLELSFNHLSSVFG  1880

Query  5011  HWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNHHEEKLLISQICCSHLEKLPV  5190
             HW +Y  +L  WV +  +        D VRRVFDKEIDNHHEEKLLI Q CC HL+KLP 
Sbjct  1881  HWNEYSQYLSRWVFNTADYTSPPKGGDLVRRVFDKEIDNHHEEKLLILQFCCYHLQKLP-  1939

Query  5191  SKLTTEFRDNNICSVLQ--SWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPVY  5364
                      N  CS+ Q   WR +F  QL+SF   ++  Q    W+GGVGNHKD FLP+Y
Sbjct  1940  ---------NRDCSLAQLLDWRSKFHNQLLSFAKDHVSKQRE-SWVGGVGNHKDVFLPLY  1989

Query  5365  VNLLAFHALSNCILR--GEAEDSKSMVPELLELGEAIQPFLRNPLISNLFVLVVKSHEKI  5538
              NLL  +  SNCI R   ++ D K++  +++ELGEA++PFLRNPL+SN+F +VV+ HEK 
Sbjct  1990  GNLLGLYVFSNCIFRFSTDSNDKKTLFSDIVELGEALKPFLRNPLVSNMFRVVVRLHEKF  2049

Query  5539  AGGAVEHLVLEISGAYSAWDA  5601
                 +  L   +SG    W+A
Sbjct  2050  LDDPLLDLSTVLSG--EIWEA  2068



>ref|XP_006827201.1| hypothetical protein AMTR_s00010p00258470 [Amborella trichopoda]
 gb|ERM94438.1| hypothetical protein AMTR_s00010p00258470 [Amborella trichopoda]
Length=2287

 Score =  1856 bits (4807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1035/1974 (52%), Positives = 1341/1974 (68%), Gaps = 139/1974 (7%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLG----------NPGNNDSSVKTILYDGILSELCNF  150
             GILTA+ R VLN+ F VS++  +             N  +  SS+ TIL+DGIL ELC+ 
Sbjct  354   GILTAIPREVLNMPFTVSSESAESSNLVSIEACNGYNVSHISSSIWTILFDGILPELCDC  413

Query  151   CEHPTDSHFNFHALTVMQICLQQIKTSMQGTDGYI-EEGYDPISEEVGTRVLKIVWNNLE  327
             CE+P DSHFNFH+LTV QI LQQIK S+      + +E Y P SE +  R++KI+WNNLE
Sbjct  414   CENPLDSHFNFHSLTVTQIALQQIKASLLANIVCLRKENYIPFSEALANRIMKIIWNNLE  473

Query  328   DPLSQTVKQVHLIFDLFLDIQGTL--HWAEG----------SEKFCSFLRKIASDLLHLG  471
             DPL+QTVKQVHLIFD+ LDIQ  +  H  +G          + K  S+L  IAS+LL LG
Sbjct  474   DPLNQTVKQVHLIFDILLDIQSLVPEHKNKGDGGSQLAQQENGKKKSYLLSIASELLRLG  533

Query  472   PRCKGRYIPLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDE  651
              RCKGRYIPLASL KRLGAK++L M   LLF+T +AY DDDVC +AT+FLKCFLECLRDE
Sbjct  534   GRCKGRYIPLASLAKRLGAKTLLGMRERLLFETVQAYSDDDVCCSATSFLKCFLECLRDE  593

Query  652   YWSTDGVEGGYIKYRAHCLLPILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFI  831
              W++DGVE GY  +R  CL PI+SGL SG +KLRSNLNTYAL V+L +DVD IF ML  I
Sbjct  594   CWNSDGVEKGYSSFRRLCLPPIMSGLISGHSKLRSNLNTYALSVVLAVDVDGIFDMLTVI  653

Query  832   -GIGCSAESTEIFYPELDSRDI--VLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSV  1002
              G  C  ES     P+    DI   L V+QRVA LVSLLKVSR LAL+EGDIDW      
Sbjct  654   TGNQCDEESV----PDSAFGDIQMSLTVDQRVASLVSLLKVSRSLALVEGDIDW------  703

Query  1003  ALEVTDLSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASL  1182
              LE T+       C ++V++KG+ VKIPV +L LALTH+DDSLRIDAAE LF+NPKT+SL
Sbjct  704   -LEKTEQYCLNSNCLAIVYLKGVVVKIPVEWLKLALTHVDDSLRIDAAELLFLNPKTSSL  762

Query  1183  PSSLELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCL  1362
             PSSLELSL+RKA+PLNMRCCSTAFQMKW SLFRKFFSRVRTAL+R +KQG+   S+ +  
Sbjct  763   PSSLELSLLRKAIPLNMRCCSTAFQMKWRSLFRKFFSRVRTALDRQVKQGS-QESMFQ--  819

Query  1363  SGSPLNG---EADQSLKHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNV  1533
                PLN      D   K R   LF+FMKWLSCFLFFSCYPSAPYERK ++MEL+L M++V
Sbjct  820   --GPLNSCFSSFDDDTK-RGLELFHFMKWLSCFLFFSCYPSAPYERKTISMELILTMISV  876

Query  1534  WHMLPP----QGKSDSYSSEISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILLH  1701
             W + P     +G+S S     S+ PY + +  P  TLLL+G I+DSWD+LRESSFRILL+
Sbjct  877   WPINPTMFLDEGQSGS-----SVPPYDEVITSPYVTLLLLGCIVDSWDKLRESSFRILLN  931

Query  1702  FPTPIPGISSPELVCEAIIWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCN  1881
             +PTP+PG+S+ + V E I+WAK LVCSPRVRESDAGAL  RL+FRKYVLE GW++R+S N
Sbjct  932   YPTPLPGLSNGDAVKEIIVWAKGLVCSPRVRESDAGALILRLLFRKYVLEHGWIIRLSSN  991

Query  1882  VVTQSPS----GLSNGENLE-FTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVH  2046
             VV + P      +   ENL+     SPV +Y+ SL++WL AA E+GEKDL EAC+KSFVH
Sbjct  992   VVYEHPQLGGVQVQMSENLQTHRFRSPVSDYVLSLVEWLRAAAEKGEKDLKEACEKSFVH  1051

Query  2047  GVLLTLRYTFEEMDWDSIAVAsnissiklllekilalVMRITSLALWVVSADAWYLPDEM  2226
             G+LLTLRYTFEE+DW+S  V  +   +K  LEK+L +VMRITSLALWVVSADAW++P+E 
Sbjct  1052  GILLTLRYTFEELDWNSEVVMESRLQLKGALEKLLEVVMRITSLALWVVSADAWFMPEES  1111

Query  2227  EEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLG  2406
              ++  DG    +  +E+D+S    +D   +     ++ P++Q+VMVGCWLAMKEVSLLLG
Sbjct  1112  GDIVEDGGFLPDVTVEIDISE---NDLKALDNVIPEEQPVEQVVMVGCWLAMKEVSLLLG  1168

Query  2407  TIIRKVPLPTS--------DVPKSCSQITDGTDQ--------LSSDIVLDLRQLEIIGNH  2538
             TI RK+PLPT         D+  + S   +G+++        +  D +L+L+QLE IG+H
Sbjct  1169  TITRKIPLPTDVSSSSSSSDLCNAGS--ANGSEEDLCMQQQAIVFDGMLELKQLEAIGDH  1226

Query  2539  FLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQTVDD  2718
             FL+VLLKMKHNGAIDKTRAGFTALCNRLLCSND RLC++TESWME+LMER V+KGQTVDD
Sbjct  1227  FLQVLLKMKHNGAIDKTRAGFTALCNRLLCSNDSRLCRMTESWMEKLMERIVAKGQTVDD  1286

Query  2719  LLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSL--------------TDk  2856
             LLRRSAGIP+AF A FLSEPEG PK+LLP+ALRWLI+VAK SL               D 
Sbjct  1287  LLRRSAGIPSAFIALFLSEPEGTPKKLLPRALRWLIDVAKSSLLILSAPSGTHNYKCGDI  1346

Query  2857  nkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTS  3036
             +    +  ++     S +  D      +SK RDEGV+PTVHAFN L+AAFND NLATDTS
Sbjct  1347  SSSEDTTMKNKPLSSSLLTSDTPISSGVSKVRDEGVIPTVHAFNALRAAFNDTNLATDTS  1406

Query  3037  GFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHR  3216
             GF AEALI+SIRSFSS YWE+RNSACLAYTALVRRMIGFLNV KRESARRALTGLEFFHR
Sbjct  1407  GFCAEALIISIRSFSSPYWEIRNSACLAYTALVRRMIGFLNVHKRESARRALTGLEFFHR  1466

Query  3217  YPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGD  3396
             YP+LH FL+ ELK+ATE+  +G+S+   S++AK+VHPSLCP+LILLSRLKPS I+SE+  
Sbjct  1467  YPSLHPFLYEELKVATEMLGDGNSQKSESSIAKIVHPSLCPILILLSRLKPSTISSESAH  1526

Query  3397  PFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTS  3576
               DPFLF+PF+R C+ Q++L++R+LAS+ALTG+VSNEKL   + +IA ELP +D    TS
Sbjct  1527  SLDPFLFLPFVRLCATQSSLKVRLLASKALTGLVSNEKLHATLQSIAYELPCMDVLGSTS  1586

Query  3577  DLSGLSNLN----------ASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVL  3726
               S   N+N           SFNSIHGMLLQLSSL++ NCRNLAD SKKE I+S ++ VL
Sbjct  1587  TGSD-GNINNGALEGKPRFCSFNSIHGMLLQLSSLVNINCRNLADISKKEQIISQMMPVL  1645

Query  3727  GKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYT  3906
                SWIGS + CPCP LN S+L+VLD++LS+A+    SK + VI +LL  L+SECL+L  
Sbjct  1646  MTCSWIGSTKLCPCPTLNGSYLQVLDHLLSVAKDSSTSKYVLVIQSLLLELTSECLELGA  1705

Query  3907  SKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQM--  4080
                   FDPT  ELR+ +   YF+C      D+ ++          +SE+   + +++  
Sbjct  1706  PVASDLFDPTKVELRRISTLIYFSCMIGGDLDMYKDG----SHSQANSEVASSNSSRLPE  1761

Query  4081  --SVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNI  4254
               S  +  +++I  + DA YEVR+ATLK +  F+N  ES     +        +   +  
Sbjct  1762  IESSVKLDDKIISCIRDACYEVRLATLKVIHKFVNLIESDGPGFTMGGHYFDCMYGWARF  1821

Query  4255  GLQAMLMQLLAVEKNHKCMNYILKIIYTYN-MQQYNKNCGQHEKPTFVGNMDSDSVLQFW  4431
              LQ +LM+LL +E N KC+ Y+L+I++++N +Q  N+     ++   V  MD DSVL+FW
Sbjct  1822  NLQPILMRLLDMEDNPKCIYYVLRILFSWNSIQSQNREDLLFKERMDVSKMDRDSVLRFW  1881

Query  4432  DKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPS-DPSKLSV  4608
             +K++SL K  RH+KT+E L+CCM +C+K+L   F        NE++          +L  
Sbjct  1882  EKLISLRKDVRHSKTKETLLCCMGICVKQLTKFFRR------NEQMAAFTKEYSLERLHD  1935

Query  4609  FSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGNKQK  4788
                CI  FV  I+  + +SEP+ MRKAAA+++VASGLL++A  +   VSN +V   ++++
Sbjct  1936  IYSCIYSFVLEIRHCASSSEPVTMRKAAAEAMVASGLLEEATFVGTLVSNERVFCFDEEE  1995

Query  4789  ----------DALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFS  4938
                       + ++ YA  ILDLWFTC+KLLEDED GLR +LS+ +Q+CI +      + 
Sbjct  1996  RRGSISCNWLETINRYAIDILDLWFTCIKLLEDEDVGLRCKLSIAMQRCINTMGFTKIYE  2055

Query  4939  SGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKE  5118
             +G VP+QVE+V+E +FE  SS FG+WL YL++L   V +A N     +  D +RRVFDKE
Sbjct  2056  NGDVPVQVERVLESTFECQSSVFGNWLGYLNYLSGQVFNAGNY--VTNKWDLIRRVFDKE  2113

Query  5119  IDNHHEEKLLISQICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIG  5298
             IDNHHEE+LL+ QI C H++KL   K   E    +I S+++ WR ++  Q++SF   YI 
Sbjct  2114  IDNHHEERLLVCQISCFHIQKLLSRKNIHEIWGKDIKSMVEKWRMKYLGQILSFSENYIN  2173

Query  5299  TQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRG-----EAEDSKSMVPELLELGE  5463
             +   + WI G+ NH+DAF+ +Y NLL  +A S+C         E      + P L+ LG 
Sbjct  2174  SDDSIVWIAGIANHQDAFISLYANLLGLYAFSHCPGDENHPPFEIVSGVPLYPGLVGLGG  2233

Query  5464  AIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
              + P LRNPLISNL+ LV+K +EK++G  +       +   S    FDPYFL R
Sbjct  2234  IMTPLLRNPLISNLYFLVLKVYEKLSGVKLCSSEQNKNRDLSCCQGFDPYFLLR  2287



>ref|XP_004972741.1| PREDICTED: thyroid adenoma-associated protein homolog isoform 
X1 [Setaria italica]
Length=2167

 Score =  1816 bits (4703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1018/1922 (53%), Positives = 1303/1922 (68%), Gaps = 119/1922 (6%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILT++ RTVLNI  + S               S+ T+LYDGIL ELC  CE+P DSHFN
Sbjct  318   GILTSIPRTVLNIRQLHSG-------------GSLWTVLYDGILPELCKHCENPIDSHFN  364

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV QICLQQIKTS+          Y P S  V  R+L+I+W NLEDPLSQTVKQVH
Sbjct  365   FHALTVTQICLQQIKTSVLADFTDFSGDYKPFSINVINRILRIIWRNLEDPLSQTVKQVH  424

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDL LDI+  +   +       FL  IA+DLL LGPRCKGRY+PLASLTKRLGAKS+L
Sbjct  425   LIFDLLLDIESCIPLEDYEHNNKLFLSNIANDLLRLGPRCKGRYVPLASLTKRLGAKSLL  484

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              + P LL +T  AY++DDVC AATTFLK FLE LRDE W+ DGV+ GY  +R  CL P++
Sbjct  485   RLKPNLLSETAYAYIEDDVCCAATTFLKSFLETLRDECWNDDGVDQGYDAFRVLCLPPLM  544

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL SG +KLRSNLNTYALP L+E+D DSIF MLGFI +G SA++TE+        DIVL
Sbjct  545   RGLVSGNSKLRSNLNTYALPALIEVDTDSIFTMLGFISVGPSAKATEL--------DIVL  596

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
               +Q +A LVSLLKVSR LAL+EGDID        L       D G   +V+ V+GI V 
Sbjct  597   KNDQCIAALVSLLKVSRNLALVEGDID---LDPDKLSQPQKEDDRGA--AVISVRGINVT  651

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +PVN+  LALTH D+SLRIDAAESLF+NPKT+SLPSSLELSL+++AVPLNMRC STAFQM
Sbjct  652   VPVNWFALALTHNDESLRIDAAESLFLNPKTSSLPSSLELSLLKEAVPLNMRCSSTAFQM  711

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFF+RVRTAL+R +KQG+W PS    + G+     A+ ++  RAE+LF FMKW
Sbjct  712   KWTSLFRKFFARVRTALDRQVKQGSWIPSSTASVKGADSVDAANAAVTQRAEDLFQFMKW  771

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LS FLF SCYPS PYERK +AMEL+L +L+VW +   +GK+D       LYPY+  +ILP
Sbjct  772   LSSFLFNSCYPSGPYERKTIAMELILTLLDVWPICRSEGKND-------LYPYNDSIILP  824

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             +ST+  VGSIIDSWDRLRE+SFRILL FPTP+PGISS   + + I WAK LV SPRVRES
Sbjct  825   DSTISFVGSIIDSWDRLRENSFRILLQFPTPLPGISSSLSINDVIRWAKTLVLSPRVRES  884

Query  1801  DAGALTFRLIFRKYVLELGWVVRVS-----CNVVTQSPSGLSNGENLEFTPSSPVIEYIT  1965
             DAGALTFRLIFRKYV+ELG+++  S         TQS    +NG+    T  +PV +YI+
Sbjct  885   DAGALTFRLIFRKYVVELGFILVFSKESDCLECYTQS----TNGDTKAVTSQNPVAQYIS  940

Query  1966  SLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllek  2145
             +LI WLC  VEEGE+DLSEACKKSFVHGVLLTLRYTF+E+DW+S  V S +S ++ L+E+
Sbjct  941   ALIQWLCTVVEEGERDLSEACKKSFVHGVLLTLRYTFDELDWNSEVVQSGVSEMRCLVER  1000

Query  2146  ilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKA  2325
             +L L+MR+TSLALWVVS+DAWY+P +M++M  DG+ FL    E D   +  + E K AK 
Sbjct  1001  VLQLIMRVTSLALWVVSSDAWYMPYDMDDMIDDGS-FLSDIYEEDQRTTGSEKEEKNAKP  1059

Query  2326  EQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLP-TSDVPKSCSQITDGTDQLS-SDI  2499
               +  P DQ+VMVGCWLAMKEVSLL GTIIRK+PLP  S    S   + D T++ S S+ 
Sbjct  1060  GSNGKPADQVVMVGCWLAMKEVSLLFGTIIRKIPLPGCSHSNSSQDGLLDSTEETSMSEE  1119

Query  2500  VLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQL  2679
             +LD+ QLE +G+HFL+VLLKMKHNGAIDKTRAG TALCNRLLCSND RLC++TESWM  L
Sbjct  1120  ILDVGQLETMGDHFLQVLLKMKHNGAIDKTRAGLTALCNRLLCSNDSRLCQMTESWMVLL  1179

Query  2680  MERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDkn  2859
             M+RT++KGQTVDDLLRRSAGIPAAF A FL+EPEG PK+LLP+AL WLI  AK SL +  
Sbjct  1180  MDRTIAKGQTVDDLLRRSAGIPAAFIALFLAEPEGTPKKLLPRALEWLIEFAKTSLANFQ  1239

Query  2860  kensscsesss-------AIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDAN  3018
             K+N   S  +          +S       +   +SK+RDEGVVPTVH FNVL+AAFNDAN
Sbjct  1240  KDNHQKSGITRDGVGELCESESGTTASAHSNGNLSKSRDEGVVPTVHVFNVLRAAFNDAN  1299

Query  3019  LATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTG  3198
             LATDTSGFSAEA IV+I +FSS YWEVRN+ACLAYTALVRRM+GFLNVQKRESARR+LTG
Sbjct  1300  LATDTSGFSAEATIVAIHAFSSPYWEVRNAACLAYTALVRRMVGFLNVQKRESARRSLTG  1359

Query  3199  LEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPI  3378
             LEFFHRYP LH FL +EL+IATEL   G S +L S++ K +HPSLCP+LILLSRLKPSPI
Sbjct  1360  LEFFHRYPALHPFLSSELRIATELLAGGVSSDLESHIVKAIHPSLCPILILLSRLKPSPI  1419

Query  3379  TSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAID  3558
             +  T D  DPFL +PFI++C+ Q+N R+R+LASRAL G+VSNE+L  V+ +I   LP + 
Sbjct  1420  SCGTDDSLDPFLLLPFIQRCATQSNYRVRVLASRALIGLVSNERLQQVVSDILGNLPNV-  1478

Query  3559  NHSMTSDL--------SGLSNLNA-------SFNSIHGMLLQLSSLLDTNCRNLADFSKK  3693
             NH ++  +        + + N N        SFNSIHG+LLQLSSLLD N R L D SKK
Sbjct  1479  NHEVSPSVQLSDPPISANMENGNLLRFSKSFSFNSIHGLLLQLSSLLDNNFRGLTDSSKK  1538

Query  3694  EDILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLW  3873
             + I+  LI VL + SW+GS + C CP+++ S+L+VLD +L +ART + S+   VI  LL 
Sbjct  1539  DQIIGQLIEVLSRCSWLGSTKLCSCPVVSTSYLRVLDLVLDVARTGK-SRHTEVIQTLLL  1597

Query  3874  TLSSECLDLYTSKRPAYFDPTIAELRKQAASSYFNCA--YQTSKDVNEEDLIYLRGPPPD  4047
              LSS+CL+   S R A+ DPT  EL++QA  S+F+C    + + + +EED + L+     
Sbjct  1598  ELSSQCLNSAVSTRYAFHDPTRIELQQQATESFFSCVGLSKRNDEASEED-VQLQILGEH  1656

Query  4048  SELFKESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSE  4227
             +        ++S+    + ++  L++ +Y+VRI  LK +L    S   R   S N     
Sbjct  1657  TSNISAMPGEVSLPELHKEIMSCLTEPMYDVRITVLKRILQLTKS--IRYGHSKN-----  1709

Query  4228  IKLLWLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPTFVGNMD  4407
             I   W +   LQ +LM+ L  E++ KC+ Y LKII+ +NM          E P F    D
Sbjct  1710  ILRQW-AGANLQPVLMERLFAEEHPKCLYYNLKIIFLWNM----------ESP-FNNGED  1757

Query  4408  SDSVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNE----KVVV  4575
             S ++L FWD++V L     HAKTRE+++CCM +C+K  A L  + +  +G +        
Sbjct  1758  SGTILSFWDRLVHLNSTMSHAKTREIILCCMGMCMKWFAKLLRNGLPMVGLKTSELSASF  1817

Query  4576  VNPSDPSKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVS  4755
             V  ++ ++LS     +++FV +++  S  SE +N R+AAA++IVASGLL++A  ++ SVS
Sbjct  1818  VRINEGNRLSDAMLGVNFFVTLVKNQSAPSETVNARRAAAEAIVASGLLEEASFVASSVS  1877

Query  4756  NHQVP----DGNKQKDALH--------LYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQ  4899
             N   P    +G+ +K  +         +YA KILDLWF C++LLEDED  LR+ L+  +Q
Sbjct  1878  NLCFPSECDEGHIKKKCMEASVSEFISIYACKILDLWFICIQLLEDEDAYLRQNLAKNIQ  1937

Query  4900  KCITSGKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAV  5079
               I +G S S+F     P+QV++VIE+SF++L+S FG WL Y+++L   V    N+    
Sbjct  1938  NIIANG-SASNFCDDSTPLQVDRVIELSFDYLTSLFGPWLKYIEYLLRIVLDTGNTLN--  1994

Query  5080  SIADPVRRVFDKEIDNHHEEKLLISQICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRF  5259
             S  D VR++FDKEIDNHHEEKLLI QICC +++KL  SK   E       S LQ+WR RF
Sbjct  1995  SREDLVRQIFDKEIDNHHEEKLLICQICCFNIQKLLQSKYQME-TGGKTESFLQNWRERF  2053

Query  5260  CQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMV  5439
               QL    + Y+  +G +DWIGG+GNHKD F+ VY +LL  + L+        +   + +
Sbjct  2054  LSQLTLLTSGYLEKEGKIDWIGGIGNHKDVFISVYADLLGLYVLAPSGSLEHQDSHATYL  2113

Query  5440  PELLELGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFL  5619
              E   L   I+PFL+NPLISNL+VLV  SHE++         +  S        FDPYFL
Sbjct  2114  QEFSNLDGFIKPFLKNPLISNLYVLVKLSHERLRCPDKPEDQMASS--------FDPYFL  2165

Query  5620  FR  5625
              R
Sbjct  2166  IR  2167



>gb|EEC82967.1| hypothetical protein OsI_27972 [Oryza sativa Indica Group]
Length=2055

 Score =  1779 bits (4608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1013/1918 (53%), Positives = 1294/1918 (67%), Gaps = 116/1918 (6%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTA+ RTVLN+  + SN              S+ TILY+GIL ELC  CE+P DSHFN
Sbjct  211   GILTAIPRTVLNMRQLHSN-------------GSLWTILYNGILPELCKHCENPIDSHFN  257

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV QICLQQIKTS+          Y+P S +V  R+L+I+W+NLEDPLSQTVKQVH
Sbjct  258   FHALTVTQICLQQIKTSVLADFTDFSGDYEPFSRDVINRILRIIWSNLEDPLSQTVKQVH  317

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDL LDI+  +   +  E    FL  IASDLL LGPRCKGRYIPLASLTKRLGAKS+L
Sbjct  318   LIFDLLLDIESCIPSGDPEENSKLFLFNIASDLLRLGPRCKGRYIPLASLTKRLGAKSLL  377

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              +   LL +T  AY+DDDVC AAT+FLKCFLE LRDE W  DG+E GY  +R  CL P+L
Sbjct  378   KLKSNLLLETAYAYMDDDVCCAATSFLKCFLETLRDECWKDDGIEQGYDAFRFLCLPPLL  437

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL SG +KLRSNLNTYALP  +E+D DSIF MLGFI +G SA++ E+        D+ L
Sbjct  438   RGLVSGNSKLRSNLNTYALPAAIEVDADSIFAMLGFINVGPSAKAIEL--------DVAL  489

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTD-AGVCDSVVHVKGIEV  1077
               +Q +A LVSLLKVSR LAL+EGDID        L+   LS   A  CD+V+ ++GI V
Sbjct  490   KNDQCIAALVSLLKVSRNLALVEGDID--------LDPDVLSQQVANKCDAVISIRGINV  541

Query  1078  KIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQ  1257
              +PV + +LALTH ++SLRIDAAESLF+NPKT+SLPS+LELSL+++AVPLNMRC STAFQ
Sbjct  542   TVPVKWFVLALTHNEESLRIDAAESLFLNPKTSSLPSALELSLLKQAVPLNMRCSSTAFQ  601

Query  1258  MKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQ---SLKHRAENLFN  1428
             MKW SLFRKFF+RVRTAL+R +KQG W PS    LSG   +   D    +   RAE+LF 
Sbjct  602   MKWTSLFRKFFARVRTALDRQVKQGLWLPS---SLSGDKDSNSVDTVKATTIKRAEDLFQ  658

Query  1429  FMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKG  1608
             FMKWLS FLF SCYPS PYER+ +AMEL+L +L+VW +   +GK+D       LYPYS  
Sbjct  659   FMKWLSSFLFNSCYPSGPYERRTIAMELILTLLDVWPICRSEGKND-------LYPYSDS  711

Query  1609  LILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPR  1788
             + LP+ST+  VGSIIDSWDRLRE+SFRILL FPTP+PGISS   +   I WAKKLV SPR
Sbjct  712   ITLPDSTISFVGSIIDSWDRLRENSFRILLQFPTPLPGISSSTSIDSVIRWAKKLVLSPR  771

Query  1789  VRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITS  1968
             VRESDAGALTFRLIFRKYVLE G V+  S           S  ++ E T  +PV +YI+S
Sbjct  772   VRESDAGALTFRLIFRKYVLEFGCVLVFSKENDCLQCYTKSTNDDTELTSQNPVAQYISS  831

Query  1969  LIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissikllleki  2148
             LI WLCA VEEGEKDLSEACKKSFVHGVLLTLRYTF+E+DW++  V S I+ ++ L+EK+
Sbjct  832   LIQWLCAVVEEGEKDLSEACKKSFVHGVLLTLRYTFDELDWNTEVVQSCIAEMRCLVEKL  891

Query  2149  lalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAE  2328
             L L+MR+TSLALWVVS+DAWY+P ++++M  D + FL   I+ D   +  +      K+ 
Sbjct  892   LQLIMRVTSLALWVVSSDAWYMPYDVDDMIDDDS-FLSDIIDEDQPGTASEIAETNVKSG  950

Query  2329  QDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLP-TSDVPKSCSQITDGTDQ--LSSDI  2499
              +  P + +VMVGCWLAMKEVSLL GTIIRK+PLP  S    S   + + T++  ++ DI
Sbjct  951   HNGKPAEHVVMVGCWLAMKEVSLLFGTIIRKIPLPGCSHSNSSHGDLAENTEETGMTGDI  1010

Query  2500  VLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQL  2679
              LD+ QLE +GNHFL+VLLKMKHNGAIDKTRAG TALCNRLLCSND RLCK+TESWME L
Sbjct  1011  -LDVEQLEKMGNHFLQVLLKMKHNGAIDKTRAGLTALCNRLLCSNDSRLCKMTESWMELL  1069

Query  2680  MERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDkn  2859
             M+RTV+KGQTVDDLLRRSAGIPAAF A FL+EPEG PK+LLP+AL WLI  AK SL +  
Sbjct  1070  MDRTVAKGQTVDDLLRRSAGIPAAFIALFLAEPEGTPKKLLPRALEWLIEFAKTSLANFQ  1129

Query  2860  kensscsesssAI-------DSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDAN  3018
              +++   ++            S     V +   +SK+R+EGVVPTVH FNVL+AAFNDAN
Sbjct  1130  NDSNQKLDTEKDFLGEPCESQSETTAGVHSNGNLSKSRNEGVVPTVHVFNVLRAAFNDAN  1189

Query  3019  LATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTG  3198
             LATDTSGF AEA IV+I +FSS YWEVRN+ACLAYTALVRRM+GFLNV KRESARR+LTG
Sbjct  1190  LATDTSGFCAEATIVAIHAFSSPYWEVRNAACLAYTALVRRMVGFLNVHKRESARRSLTG  1249

Query  3199  LEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPI  3378
             LEFFHRYP LH FL +EL +AT L  +G S NL S +AK +HPSLCP+LILLSRLKPSPI
Sbjct  1250  LEFFHRYPALHPFLLSELNVATGLLADGISSNLGSQIAKAIHPSLCPILILLSRLKPSPI  1309

Query  3379  TSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAID  3558
             +  T D  DPFL +PFI++C+ Q+N R+R+LASRAL G+VSNE+L  V+ +I   LP   
Sbjct  1310  SRGTDDSLDPFLLLPFIQRCATQSNYRVRVLASRALIGLVSNERLQHVVGDILHNLPC-G  1368

Query  3559  NHSMTSDLS-------GLSNLNA-----SFNSIHGMLLQLSSLLDTNCRNLADFSKKEDI  3702
             +H +T+  +       G  NL       SFNSIHG+LLQLSSLLD N R L D +KK+ I
Sbjct  1369  SHEVTAHRALCLSADMGNENLTLPAKSFSFNSIHGLLLQLSSLLDNNFRALTDSTKKDQI  1428

Query  3703  LSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLS  3882
             LS LI  L K SW+GS + C CP+++ S+L+VLD ML +ART + S     I  LLW LS
Sbjct  1429  LSQLIEALSKCSWLGSVKLCACPVVSTSYLRVLDLMLDVARTGK-SGHTDAIQILLWELS  1487

Query  3883  SECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAY--QTSKDVNEEDLIYLRGPPPDSEL  4056
              +CL+  TS   A+ DPT  ELR+QAA+SYF+C    +   + N+E+ + L+     S +
Sbjct  1488  YQCLNNGTSTHYAFHDPTQIELRQQAAASYFSCVGLPKRHDETNDEN-VQLQILDMTSSI  1546

Query  4057  FKESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKL  4236
               E   ++S+    + +   L D  Y+VRI  LK +L        + A+S+    S+  L
Sbjct  1547  -PEMPREVSLYELHKEIASCLVDPAYDVRITALKRIL--------QLAKSARSGDSKKFL  1597

Query  4237  LWLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQ-QYNKNCGQHEKPTFVGNMDSD  4413
                +   LQ ++++ +  E++ KC+ Y LKII+++NM+ Q+N               DS 
Sbjct  1598  HQWAKSNLQHVILKRIFEEEHPKCLYYNLKIIFSWNMECQFN------------SEEDSS  1645

Query  4414  SVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDP  4593
             + L FWD++V L     HAKTRE ++CCM +C+++ A +    + S  +E        D 
Sbjct  1646  TFLSFWDRLVHLNSTVSHAKTRETILCCMGMCMRQFAKMLRGLLDSKTHEHSTSFVRIDE  1705

Query  4594  SK-LSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVP  4770
              K LS        FV +++  S  SE +N R+AAA++I+ASGLL++A   +PS+SN  +P
Sbjct  1706  GKNLSTAILSASSFVNLVKNLSAPSETVNARRAAAEAIIASGLLEEANLFAPSLSNAYLP  1765

Query  4771  DGNKQK------------DALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITS  4914
               + +             + ++LY+ KILDLWF C++LLEDED  LR++L+  VQK I  
Sbjct  1766  SEHDENHIEEKCSNATVSELINLYSCKILDLWFICIQLLEDEDTYLRQKLANNVQKIIAK  1825

Query  4915  GKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADP  5094
             G S ++      P+QV++VIE+SFE+L+S  GHWL Y ++L   V    N+    S  D 
Sbjct  1826  G-SANNLCDDSTPLQVDRVIELSFEYLTSLLGHWLKYTEYLLRLVLDTANT--LNSRGDL  1882

Query  5095  VRRVFDKEIDNHHEEKLLISQICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLI  5274
             +R++FDKEIDNHHEEKLLI QICCS ++KL  SK   E     +   LQ+WR  F  QLI
Sbjct  1883  IRQIFDKEIDNHHEEKLLICQICCSSIQKLLQSKYLVE-TGAEVELFLQNWRESFLHQLI  1941

Query  5275  SFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKS-MVPELL  5451
             S  ++++  +G  DWIGG+GNHKD F+ VY NLL  +AL+      + +D  +  +    
Sbjct  1942  SLTSSFLEKEGKTDWIGGIGNHKDVFISVYANLLGLYALAQSQSLEQLKDRHTEYLKNFS  2001

Query  5452  ELGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             +L   I PFL+NPLISNL  LV +SHE       +    +  G+ SA ++FDPYFL R
Sbjct  2002  DLDGVITPFLKNPLISNLHSLVKESHETFNSPKKQ---WDQVGS-SATESFDPYFLIR  2055



>ref|XP_008662801.1| PREDICTED: thyroid adenoma-associated protein homolog [Zea mays]
Length=2161

 Score =  1774 bits (4596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1012/1919 (53%), Positives = 1289/1919 (67%), Gaps = 119/1919 (6%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILT++ RTVLN+  + S+               + T+LYDGIL ELC  CE+P DSHFN
Sbjct  318   GILTSIPRTVLNMHQLHSS-------------GPLWTVLYDGILPELCKHCENPVDSHFN  364

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV QICLQQIKTS+          Y P S +V  R+L I+W NLEDPLSQTVKQVH
Sbjct  365   FHALTVTQICLQQIKTSVSSDITDFSGDYKPFSRDVVNRILGIIWRNLEDPLSQTVKQVH  424

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDL LDI+  +   +       FL  +A+DLL LGPRCKGRY+PLASLTKRLGAKS+L
Sbjct  425   LIFDLLLDIELCIASEDREHNNNLFLCNVANDLLRLGPRCKGRYVPLASLTKRLGAKSLL  484

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              +   LL +T  AY+DDDVC A TTFLK FLE LR E W+ DGVE GY  +RA CL P +
Sbjct  485   TLKSNLLSETAYAYIDDDVCCAVTTFLKSFLETLRGECWNDDGVELGYDAFRALCLPPFM  544

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL SG +KLRSNLNTYALP L+E+D +SIF MLGFI IG S   T++        D+VL
Sbjct  545   RGLVSGNSKLRSNLNTYALPALIEVDAESIFTMLGFISIGPSTNETKL--------DVVL  596

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
               +Q +A LVSLLKVSR LAL+EGDID        ++  D    A     V+ VKGI+V 
Sbjct  597   KNDQCIAALVSLLKVSRNLALVEGDIDLDPDELSQIQQMDSKGAA-----VISVKGIKVT  651

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +P N+  LALTH D+SLRIDAAESLF+NPKT+SLPSSLELSL+++AVPLNMRC STAFQM
Sbjct  652   VPFNWFALALTHSDESLRIDAAESLFLNPKTSSLPSSLELSLLKEAVPLNMRCSSTAFQM  711

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFF+RVRTAL+R +KQG+W PSL   + G+     +  ++  RAE+LF FMKW
Sbjct  712   KWTSLFRKFFARVRTALDRQVKQGSWIPSLTSSVKGAGSIDTSKATVVKRAEDLFQFMKW  771

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LS FLF SCYPS PYERK +AMEL+L +L+VW +   +GK       I LYPY+  +ILP
Sbjct  772   LSSFLFNSCYPSGPYERKTIAMELILTLLDVWPICRSEGK-------IDLYPYNDSIILP  824

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             +ST+  VGSIIDSWDRLRE+SFRILL FPTP+PGIS    + + I WAKKLV SPRVRES
Sbjct  825   DSTISFVGSIIDSWDRLRENSFRILLQFPTPLPGISLSTSINDVIRWAKKLVLSPRVRES  884

Query  1801  DAGALTFRLIFRKYVLELGWVVRVS-----CNVVTQSPSGLSNGENLEFTPSSPVIEYIT  1965
             DAGALTFRLIFRKYVL+LG ++  S         TQS +G     + E T  +PV +YI+
Sbjct  885   DAGALTFRLIFRKYVLQLGCILVFSKESDCLECYTQSMNG-----DTEVTSQNPVAQYIS  939

Query  1966  SLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllek  2145
             SLI WLC  VEEGE+DLSEACKKSFVHGVLLTLRYTF+EMDW+S  V S IS ++ L+EK
Sbjct  940   SLIQWLCIVVEEGERDLSEACKKSFVHGVLLTLRYTFDEMDWNSEVVQSCISEMRYLVEK  999

Query  2146  ilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKA  2325
             +L L+MR+TS+ALWVVS+DA  LP +M++M  DG+ FL   I  D   +T + E K AK 
Sbjct  1000  LLQLIMRVTSVALWVVSSDALSLPYDMDDMIDDGS-FLS-DIYDDQPTTTSEREEKNAKP  1057

Query  2326  EQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLP-TSDVPKSCSQITDGTDQLS-SDI  2499
               +  P +Q+VMVGCWLAMKEVSLL GTIIRK+PLP  S    S + + D  ++ S S+ 
Sbjct  1058  GSNGKPAEQVVMVGCWLAMKEVSLLFGTIIRKIPLPGCSHSASSQNGLPDSIEETSISEE  1117

Query  2500  VLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQL  2679
             +LD+ QL+++G+HFL+VLLKMKHNGAIDKTRAGFTALCNRLLCSND RLCK+TESWM  L
Sbjct  1118  ILDVGQLKMMGDHFLQVLLKMKHNGAIDKTRAGFTALCNRLLCSNDSRLCKMTESWMVLL  1177

Query  2680  MERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDkn  2859
             M+RT++KGQTVDDL+RRSAGIPAAF A FL+EPEG PK+LLP+AL WLI  AK SL +  
Sbjct  1178  MDRTIAKGQTVDDLIRRSAGIPAAFIALFLAEPEGTPKKLLPRALEWLIEFAKNSLANFQ  1237

Query  2860  kensscsesssAI--DSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDT  3033
             K+++  S     +    +    V +   +SK RDEGVVPTVH FNVLKAAFNDANLATDT
Sbjct  1238  KDSNQRSGVMKELLESQSETTSVYSNGNLSKGRDEGVVPTVHVFNVLKAAFNDANLATDT  1297

Query  3034  SGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFH  3213
             SGFSAEA IV+IR+FSS YWEVRN+ACLAYTALVRRM+GFLNVQKRESARR+LTGLEFFH
Sbjct  1298  SGFSAEATIVAIRAFSSPYWEVRNAACLAYTALVRRMVGFLNVQKRESARRSLTGLEFFH  1357

Query  3214  RYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETG  3393
             RYP LH FL +EL+  TE   +G S NL S++ K +HPSLCP+LILLSRLKPSPI+  T 
Sbjct  1358  RYPALHPFLSSELQTTTEQLADGVSSNLESHITKAIHPSLCPILILLSRLKPSPISCGTD  1417

Query  3394  DPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMT  3573
             D  DPFL +PFI++C+ Q+N R+RILASRALT +VSNE+L  VI +I   LP   + +M 
Sbjct  1418  DSLDPFLLLPFIQRCATQSNYRVRILASRALTCLVSNERLQYVISDILDNLPRGSHKAMA  1477

Query  3574  SDLS----------GLSN---LNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDL  3714
               +           G +N   L+ SFNSIHG+LLQL+SLLD N R L D S K+ I+  L
Sbjct  1478  HSVQHTDPAISANMGKANVLLLSKSFNSIHGLLLQLASLLDNNFRGLTDGSMKDQIIGLL  1537

Query  3715  IHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECL  3894
             + VL + SW+G  + C CPI+  S+L+VLD ML +ART + S+   VI  LL  L+S+CL
Sbjct  1538  LEVLSRCSWLGCTKLCSCPIVITSYLRVLDLMLDVARTGK-SRHTEVIQALLLELTSQCL  1596

Query  3895  DLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSK--DVNEEDL-IYLRGPPPDSELFKE  4065
                 S + A+ DPT  EL++QA  S+ +C   + K  + N++D+ + + G P      + 
Sbjct  1597  SNTASTQYAFHDPTRIELKQQATESFLSCVGLSKKTDETNDDDVQLQILGEPT----LEM  1652

Query  4066  SETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWL  4245
                  S+    + ++  L+D  Y+VRI  LK +L    S     A++       I   W 
Sbjct  1653  PRVDYSLHEVHKEILSCLTDPSYDVRITVLKRILWLTKSIRHGYADN-------ILHQW-  1704

Query  4246  SNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPTFVGNMDSDSVLQ  4425
             + + LQ  LM+ L VE++ KC+ Y LKII+++NM ++  N G+          DS ++L 
Sbjct  1705  AGVNLQPALMERLFVEEHPKCLYYNLKIIFSWNM-EFPFNNGE----------DSSTLLS  1753

Query  4426  FWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSI---CSLGNE---KVVVVNPS  4587
              WD++V L     HAKTRE+++CCM +C+K         I   C   +E     V +N  
Sbjct  1754  LWDRLVHLNSTMSHAKTREIVLCCMGMCMKLFTKQSRGGISMDCLKTSEISASFVRINEG  1813

Query  4588  DPSKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQV  4767
             D    ++    ++ FV +++  S+ SE +N R+AAA++IVASGLL++A  ++ SVSN   
Sbjct  1814  DGLSDAMLR--LNLFVTLVKNQSEPSESMNARRAAAEAIVASGLLEEASYVASSVSNMYS  1871

Query  4768  P-----DGNKQK-------DALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCIT  4911
             P     D  K+K       + + LY  KILDLWF C++LLEDED  LR++L+ ++QK I 
Sbjct  1872  PSEFDEDHTKEKCMEDSVFEFVSLYTCKILDLWFVCIQLLEDEDAYLRQKLAKDIQKIIA  1931

Query  4912  SGKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIAD  5091
              G S + F     P+QV++VIE+S ++L+S FG WL Y++FL   V    N+    S  D
Sbjct  1932  KG-SANTFCDDSTPLQVDRVIELSLDYLTSLFGLWLKYVEFLLRIVLGTGNALN--SRGD  1988

Query  5092  PVRRVFDKEIDNHHEEKLLISQICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQL  5271
              VR++FDKEIDNHHEEKLLI QICCS+++KL  SK   E         LQ+WR  F +QL
Sbjct  1989  LVRQIFDKEIDNHHEEKLLICQICCSNIQKLLNSKCQMEAGAETKL-FLQNWREIFLKQL  2047

Query  5272  ISFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSM-VPEL  5448
              S    YI  +G  DWIGG+GNHKD F+ VY  LL  +AL+      + ED  ++ + E 
Sbjct  2048  TSLTGGYIEKEGKNDWIGGIGNHKDVFISVYAVLLGLYALTQSGSLDQLEDHCAVYLQEF  2107

Query  5449  LELGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
               L  +I PFL+NPLISNL+ LV  SHE+          +  SG+     +FDPYFL R
Sbjct  2108  ANLERSITPFLKNPLISNLYALVKLSHERFISSDKPEDQVGDSGS-----SFDPYFLIR  2161



>ref|XP_006290484.1| hypothetical protein CARUB_v10016558mg [Capsella rubella]
 ref|XP_006290485.1| hypothetical protein CARUB_v10016558mg [Capsella rubella]
 gb|EOA23382.1| hypothetical protein CARUB_v10016558mg [Capsella rubella]
 gb|EOA23383.1| hypothetical protein CARUB_v10016558mg [Capsella rubella]
Length=1949

 Score =  1769 bits (4583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 975/1720 (57%), Positives = 1214/1720 (71%), Gaps = 109/1720 (6%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILT VSR +L              G   N+D   KTILYDGIL ELC+ CE+P DSH N
Sbjct  322   GILTTVSRGIL----------VSSFGRLSNSDCDHKTILYDGILLELCDLCENPIDSHLN  371

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIKTSM  TD  + E YDP+ + +  R+L+ +WNNLEDPLSQTVKQVH
Sbjct  372   FHALTVMQICLQQIKTSML-TD--LSEDYDPMPDSMTARILRTIWNNLEDPLSQTVKQVH  428

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             L+FDL LDIQ T+H  +        L KI + LL LG RCKGRY+PLASLT+RLGAK+++
Sbjct  429   LMFDLLLDIQTTVHQTDDKVGIRGSLLKIVNYLLRLGSRCKGRYVPLASLTRRLGAKTLM  488

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSP LLF+   AYVDDDVC A T+FLKCFLE LRDE W ++GV+ GY +YR HCL P L
Sbjct  489   DMSPNLLFEMANAYVDDDVCYAVTSFLKCFLEMLRDESWGSEGVDQGYARYREHCLPPFL  548

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYA+ VLLELDVDSIF +L +I IG S E T++ Y EL +  + L
Sbjct  549   YGLASGMSKLRSNLNTYAVQVLLELDVDSIFLLLAYISIGPSEEETKLNYTELSNMSMEL  608

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              VEQ+V VLVSLLKV R LA +EGDI+              STD     ++V +KG+E+K
Sbjct  609   TVEQKVVVLVSLLKVCRTLAFLEGDIE-----------QKRSTDTF---AIVQIKGVELK  654

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +P+ +L +ALTH+D+S+R+DAAE+LF+NPKTA LPS LEL LM++AVPLNMR  ST FQM
Sbjct  655   VPIEWLKMALTHVDESVRVDAAETLFLNPKTARLPSPLELYLMKEAVPLNMRSSSTGFQM  714

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSRVRT+LE+  KQG+W P             ++D +   RAE+L  FM+W
Sbjct  715   KWTSLFRKFFSRVRTSLEKQYKQGSWQPL------------KSDDNAVLRAESLSKFMRW  762

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LS FLF SCYPSAPY RKIMA EL+ IM++VW   P     D  S +  LYPY   +   
Sbjct  763   LSSFLFLSCYPSAPYRRKIMATELIQIMIDVW---PVVASKDPASHQGHLYPYCDIVTSH  819

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
              STLLLVGSI+DSWDRLRE+SFRILLH+PTP  GISS ++V   I WAK LVCSPRVRES
Sbjct  820   NSTLLLVGSIVDSWDRLRENSFRILLHYPTPFTGISSEDMVQNIIPWAKHLVCSPRVRES  879

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVV-----TQSPSGLSNGENLEFTPSSPVIEYIT  1965
             DAGALT RLIFRKYVL+LGW+V+VS +V       +S +GL     +++    PVIEYI 
Sbjct  880   DAGALTLRLIFRKYVLDLGWIVKVSTSVFCGPRECESRNGLYQNSKVKY----PVIEYIK  935

Query  1966  SLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllek  2145
             SLI WL  +V EGE+DLSEACK SFVHGVLL LRYTFEE+DW+S AV  +IS ++  LEK
Sbjct  936   SLIHWLDDSVMEGERDLSEACKNSFVHGVLLALRYTFEELDWNSNAV-LSISEMRKELEK  994

Query  2146  ilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKA  2325
             +L LV RIT+LALWVVSADA  LP++M+++  D + FL    +   +  + + +    K 
Sbjct  995   LLKLVTRITTLALWVVSADALCLPEDMDDIIEDDS-FLSNVQDDAAAVLSEEHKSTYPKH  1053

Query  2326  EQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDV-----PKSCSQITDGTDQLS  2490
               +    +Q+VMVGCWLAMKEVSLLLGTIIRK+PLPTS +       + S +   +   +
Sbjct  1054  VHETIQSEQVVMVGCWLAMKEVSLLLGTIIRKIPLPTSSLRPLENGNTASAVPSDSVIGN  1113

Query  2491  SDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWM  2670
             S+++LDL QLE IG+HFLEVLLKMKHNGAIDKTRAGFTALC+RLLCSNDPRLCKLTESWM
Sbjct  1114  SELLLDLNQLEKIGDHFLEVLLKMKHNGAIDKTRAGFTALCHRLLCSNDPRLCKLTESWM  1173

Query  2671  EQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLT  2850
             EQLMERTV++GQTVDD+LRRSAGIPAAF A FLSEPEG+PK+LLP ALRWLI +A+K L 
Sbjct  1174  EQLMERTVARGQTVDDVLRRSAGIPAAFIALFLSEPEGSPKKLLPHALRWLIGLAEKPLL  1233

Query  2851  DknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATD  3030
             D  ++  S       ++     D+ + E +SK R+EGVVPTVHAFNVLKAAFND NL+TD
Sbjct  1234  DPMEQKGSKHM----VEEVNSSDMHSSENLSKVREEGVVPTVHAFNVLKAAFNDTNLSTD  1289

Query  3031  TSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFF  3210
             TSGF+AEA+IVSIRSFSS YWEVRNSA LAYTALVRRMIGFLNVQKR S RRALTGLEFF
Sbjct  1290  TSGFAAEAMIVSIRSFSSQYWEVRNSATLAYTALVRRMIGFLNVQKRGSTRRALTGLEFF  1349

Query  3211  HRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSET  3390
             HRYP LH F+++ELK AT+L    +S    SN A +VHPSL P+LILLSRLKPSPI SET
Sbjct  1350  HRYPLLHPFIYSELKTATDLL--DASGPCDSNAANLVHPSLWPILILLSRLKPSPIASET  1407

Query  3391  GDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSM  3570
             GD  DPF+FMPFI KCS Q+NLR+R+LASRAL G+VSNEKL +V+L IAS LP+      
Sbjct  1408  GDDLDPFVFMPFIMKCSTQSNLRVRVLASRALVGLVSNEKLQSVLLQIASTLPSNGAQ--  1465

Query  3571  TSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGS  3750
                         SFN +HG+LLQL SLLDTNCR+LAD SKK+ I+  LI+V  K +W+ S
Sbjct  1466  ----------GRSFNYLHGILLQLGSLLDTNCRDLADDSKKDQIIGKLINVFSKCTWMAS  1515

Query  3751  PQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFD  3930
             P  CPCPIL  SFL+VL+ M  I  T   S+ +  I+ L   LS+ CLD   S   +Y+D
Sbjct  1516  PLTCPCPILCTSFLRVLNYMRVIEWTSSESQNLRDIYKLHLDLSTNCLDTDASYGFSYYD  1575

Query  3931  PTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQERLI  4110
             P+IAELR+QAA SYF C +Q S +  E   I  R   P+ +L K  E         ERL+
Sbjct  1576  PSIAELREQAAVSYFGCIFQPSDEAAEVFQITQR---PNLQLQKVPEAS-DFPDLNERLL  1631

Query  4111  RSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAV  4290
             RSLSD  YEVR+ATLKW L FL S +S  +ESS+         W  N GLQ +L++LL  
Sbjct  1632  RSLSDQSYEVRLATLKWFLQFLKSEDSSFSESSSIWN------WAKN-GLQEVLLKLLDK  1684

Query  4291  EKNHKCMNYILKIIYTYNMQQYNKNC-GQHEKPTFVGNMDSDSVLQFWDKVVSLYKVTRH  4467
             EKNHKC NYILKI++ +N+  + K+C G+  +  +VG+++ D VL  W ++ SL++ TR 
Sbjct  1685  EKNHKCENYILKILFQWNLLMFKKSCNGESVEGIYVGSLNYDLVLHLWGRLTSLFESTRR  1744

Query  4468  AKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECIDYFVEVIQ  4647
             AK R  L+CC+A+C++ L  LF  +  S   E+         S+ S   +C+ YFV +I+
Sbjct  1745  AKIRGTLMCCLAICVQHLTGLFFHNNDSEKEEE---------SRWSCVIDCVSYFVNLIK  1795

Query  4648  EHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGN---KQKDALHLYAHKI  4818
             + S +SE +N+R A+A++I+ASG+L+QA+ + P V NHQ+P  N   K ++A +LYA++I
Sbjct  1796  QKSLSSEQVNVRHASAEAIIASGILEQAKIVGPRVFNHQIPSKNTPSKFQNACNLYAYQI  1855

Query  4819  LDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEHLS  4998
             LD+WFTC+KLLEDEDD +R +L+ +VQKC         F++  VP QV+KV+E+SF HLS
Sbjct  1856  LDMWFTCIKLLEDEDDLIRSKLATDVQKCF--------FTAMEVPTQVDKVLELSFNHLS  1907

Query  4999  STFGHWLDYLDFLCHWV-QSATNSACAVSIADPVRRVFDK  5115
             S FGHW +Y  +L  WV  +A  S       D VRRVFDK
Sbjct  1908  SVFGHWNEYSQYLSRWVFNTADYSPPPKGGGDLVRRVFDK  1947



>ref|XP_010234347.1| PREDICTED: thyroid adenoma-associated protein homolog [Brachypodium 
distachyon]
Length=2167

 Score =  1767 bits (4576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1014/1921 (53%), Positives = 1303/1921 (68%), Gaps = 116/1921 (6%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTA+ R  LN+  +             ++D S+ TILYDGIL ELC  CE+P D HFN
Sbjct  317   GILTAIPRKALNVRQL-------------HSDGSLWTILYDGILPELCKHCENPIDRHFN  363

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV QICLQQIK+S+          Y P S +V  R+LKI+W+NLEDPLSQTVKQVH
Sbjct  364   FHALTVTQICLQQIKSSVSADFTDFSGDYKPFSRDVINRLLKIIWSNLEDPLSQTVKQVH  423

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDL LDI+  +   + + K   FL  IASDLL LGPRCKGRYIPLASLTKRLGAKS+L
Sbjct  424   LIFDLLLDIEACVPSEDQNNKL--FLCNIASDLLRLGPRCKGRYIPLASLTKRLGAKSLL  481

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              +   L+ +T  AY+DDDVC AAT+FLKCFLE LRDE W +DGVE GY  +RA CL P++
Sbjct  482   SLKADLILETAYAYMDDDVCCAATSFLKCFLETLRDECWDSDGVEEGYDAFRALCLPPLM  541

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+ G +KLRSNLNTYALP ++E+D DSIF MLGFI +G SA++T+I        D  L
Sbjct  542   RGLTFGNSKLRSNLNTYALPAVIEVDTDSIFTMLGFISVGPSAKATKI--------DFAL  593

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSV-VHVKGIEV  1077
               +Q +A LVSLLKVSR LAL+EGDI         L+  +LS   G  D+V + VKGI V
Sbjct  594   KSDQCIAALVSLLKVSRNLALVEGDIH--------LDSNELSQQEGKKDAVAISVKGIVV  645

Query  1078  KIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQ  1257
              +PVN+ +LALTH D+++RIDAAESLF+NPKT+SLPSSLELSL+++AVPLNMRC STAFQ
Sbjct  646   TVPVNWFVLALTHSDETIRIDAAESLFLNPKTSSLPSSLELSLLKEAVPLNMRCSSTAFQ  705

Query  1258  MKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEA--DQSLKHRAENLFNF  1431
             MKW  LFRKFF+RVRTAL+R +KQG+W PS    +  +   G A    ++  RAE+LF F
Sbjct  706   MKWTGLFRKFFARVRTALDRQLKQGSWIPSPTSIVKEANPVGTAIVKDTVVQRAEDLFQF  765

Query  1432  MKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGL  1611
             MKWL  FLF SCYPS PYERK +AMEL+LI+L+VW +   +GK D       LYPY+  +
Sbjct  766   MKWLGSFLFNSCYPSGPYERKTIAMELILILLDVWPICRTEGKKD-------LYPYNDSI  818

Query  1612  ILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRV  1791
              LP+ST+  VGSIIDSWDRLRE+SFRILL FPTP+PGIS    + + I WAK+LV SPRV
Sbjct  819   TLPDSTISFVGSIIDSWDRLRENSFRILLQFPTPLPGISLTTSIDDVIRWAKELVLSPRV  878

Query  1792  RESDAGALTFRLIFRKYVLELGWVVRVSC-NVVTQSPSGLSNGENLEFTPSSPVIEYITS  1968
             RESDAGALTFRLIFRKYVLELG ++  S  N   Q  +  +N +    T  +PV +YI+S
Sbjct  879   RESDAGALTFRLIFRKYVLELGCIIVFSEENDCLQCYTKSTNEDTEIITSQNPVAQYISS  938

Query  1969  LIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissikllleki  2148
             L+ WLC  VEEGE+DLSEACKKSFVHGVLLTLRYTFEE+ W+S  + S +S ++ L+ K+
Sbjct  939   LLQWLCTVVEEGERDLSEACKKSFVHGVLLTLRYTFEELHWNSAVIQSCVSEMRHLVGKL  998

Query  2149  lalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAE  2328
             L L+MRITSLALWVVS+DAWY+P +M++M  DG+ FL   ++ D S +      K AK+ 
Sbjct  999   LQLIMRITSLALWVVSSDAWYMPYDMDDMIDDGS-FLSDIVDEDHSDTASAIAEKNAKSG  1057

Query  2329  QDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPT-SDVPKSCSQITDGTDQLS-SDIV  2502
                 P + ++MVGCWLAMKEVSLL GTI+RK+PLP  S    S S + D  ++ S S  +
Sbjct  1058  NGGKPAEHVIMVGCWLAMKEVSLLFGTIVRKIPLPVCSHSNSSQSGLPDNNEETSMSPEI  1117

Query  2503  LDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLM  2682
             LD+ QLE++G+HFL+VLLKMKHNGAIDKTRAG TALCNRLLCSND RLCK+TESWM  LM
Sbjct  1118  LDVEQLEMMGDHFLQVLLKMKHNGAIDKTRAGLTALCNRLLCSNDSRLCKMTESWMVLLM  1177

Query  2683  ERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknk  2862
             +RTV+KGQTVDDLLRRSAGIPA+F A FL+EPEG PK+LLP+AL WLI  A+ SL +  K
Sbjct  1178  DRTVAKGQTVDDLLRRSAGIPASFMALFLAEPEGTPKKLLPRALEWLIEFARTSLANFQK  1237

Query  2863  ensscsesssAI-------DSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANL  3021
             + +  SE+            S     V +   +SK+RDEGVVP VH FNVL+AAFNDANL
Sbjct  1238  DCNQKSEAMKDCVGVFCEPQSGSTISVHSNGTLSKSRDEGVVPAVHVFNVLRAAFNDANL  1297

Query  3022  ATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGL  3201
             A DTSGF AEA IV++R+FSS YWEVRN+ACLAYTALVRRM+GFLNVQKRESARR++TGL
Sbjct  1298  AADTSGFCAEATIVAVRAFSSPYWEVRNAACLAYTALVRRMVGFLNVQKRESARRSITGL  1357

Query  3202  EFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPIT  3381
             EFFHRYP LH FL +ELK+ATE   +G S NL S++AK +HPSLCP+LILLSRLKPSPI+
Sbjct  1358  EFFHRYPALHPFLSSELKVATEQLADGVSCNLESHIAKAIHPSLCPILILLSRLKPSPIS  1417

Query  3382  SETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPA-ID  3558
                 DP DPFL +PFI+KC+ Q+N R+RILASRAL G+VSNE+L  V+ +I ++LP+  +
Sbjct  1418  CGADDPLDPFLLLPFIQKCATQSNYRVRILASRALIGLVSNERLHHVVSHILADLPSRRE  1477

Query  3559  NHSMTSDLSGLS----NLN-------ASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDIL  3705
              HS    +S +S    N N       +SFNS HG+LLQL SLLD+N R L D +KK+ IL
Sbjct  1478  AHSSQGSVSPVSANVENRNSPRPAKSSSFNSTHGLLLQLCSLLDSNFRGLTDSNKKDQIL  1537

Query  3706  SDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSS  3885
               LI VL K  W+G  + C CP+++ S+L VLD ML +ART + SK   VI  LL  LSS
Sbjct  1538  GQLIEVLSKCYWLGCRKLCTCPVVSTSYLSVLDRMLDVARTGK-SKHADVIQTLLLQLSS  1596

Query  3886  ECLDLYTSKRPAYFDPTIAELRKQAASSYFNC-AYQTSKDVNEEDLIYLRGPPPDSELFK  4062
             +CL+  TS    + DPT  EL++QAA+SYF+C       D   E+ I L+     +    
Sbjct  1597  QCLNNATSTHYTFHDPTQIELQQQAAASYFSCVGIPKRHDETAEEDIRLQILDQRTSSMS  1656

Query  4063  ESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLW  4242
             E   Q+S+    + ++  L+D +Y+VRI  LK +L  + S   R+ ++ N     I   W
Sbjct  1657  EMPCQVSLPELHKEIMSCLADPIYDVRITVLKRILQLVKS--IRSGDAMN-----ILHQW  1709

Query  4243  LSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQ-QYNKNCGQHEKPTFVGNMDSDSV  4419
              +   L +++M+ L  E++ KC+ Y LKII ++NM+ Q+N               DS++ 
Sbjct  1710  -ARANLHSVIMERLFAEEHPKCIYYSLKIILSWNMECQFN------------NGEDSNTF  1756

Query  4420  LQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLG---NE-KVVVVNPS  4587
             L  WD+++ L  +  HAKTREM++CCM +C+K+ A L  + +   G   NE     V  +
Sbjct  1757  LCIWDRLIHLNSIVSHAKTREMILCCMGMCMKQFAKLLRNGVLLEGLQTNELSTSSVRIN  1816

Query  4588  DPSKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQV  4767
             D ++LS      + FV +++  S  SE +N R+AAA++I+ASGLL++A  +  SVSN  V
Sbjct  1817  DGNRLSAAITSTNLFVSLVKNQSAPSETVNSRRAAAEAIIASGLLEEANFVKASVSNAYV  1876

Query  4768  PDGNKQ------------KDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCIT  4911
             P  + +             + + LYA KILDLWF C++LLEDED  LR++L+  VQK I 
Sbjct  1877  PSEHNECHIEERCSEADLGEVVSLYACKILDLWFICIQLLEDEDVHLRQKLAKNVQKIIA  1936

Query  4912  SGKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIAD  5091
             +G S ++      P+QV++VIE+SFE L+  FGHWL Y+++L   V + +N+    S  D
Sbjct  1937  NG-SANNLCDDSTPLQVDRVIELSFEFLTYLFGHWLKYIEYLLRVVLNTSNTLN--SHGD  1993

Query  5092  PVRRVFDKEIDNHHEEKLLISQICCSHLEKLPVS--KLTTEFRDNNICSVLQSWRRRFCQ  5265
              VR++FDKEIDNHHEEKLLI QI CS+++KL  S  ++TT+ R       LQ+WR  F  
Sbjct  1994  LVRQIFDKEIDNHHEEKLLICQISCSNIQKLLGSENQVTTKGRTELF---LQNWRENFLH  2050

Query  5266  QLISFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSM-VP  5442
             QL S  + Y+   G  DWIGG+GNHKD F  VY NLL  + L+      + ED   + + 
Sbjct  2051  QLTSLTSGYLEEDGKTDWIGGIGNHKDVFPSVYANLLGLYTLTQSGSMEQLEDRHKLYLQ  2110

Query  5443  ELLELGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLF  5622
             E   L   I PFL+NPLI NL++LV KSH  I   +      E     SA ++FDPYFL 
Sbjct  2111  EFSGLERFITPFLKNPLILNLYLLVKKSHGIIGSPSKP----EDQVGSSASESFDPYFLL  2166

Query  5623  R  5625
             R
Sbjct  2167  R  2167



>ref|XP_004972742.1| PREDICTED: thyroid adenoma-associated protein homolog isoform 
X2 [Setaria italica]
Length=2126

 Score =  1764 bits (4570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 996/1917 (52%), Positives = 1275/1917 (67%), Gaps = 150/1917 (8%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILT++ RTVLNI  + S               S+ T+LYDGIL ELC  CE+P DSHFN
Sbjct  318   GILTSIPRTVLNIRQLHSG-------------GSLWTVLYDGILPELCKHCENPIDSHFN  364

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV QICLQQIKTS+          Y P S  V  R+L+I+W NLEDPLSQTVKQVH
Sbjct  365   FHALTVTQICLQQIKTSVLADFTDFSGDYKPFSINVINRILRIIWRNLEDPLSQTVKQVH  424

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDL LDI+  +   +       FL  IA+DLL LGPRCKGRY+PLASLTKRLGAKS+L
Sbjct  425   LIFDLLLDIESCIPLEDYEHNNKLFLSNIANDLLRLGPRCKGRYVPLASLTKRLGAKSLL  484

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              + P LL +T  AY++DDVC AATTFLK FLE LRDE W+ DGV+ GY  +R  CL P++
Sbjct  485   RLKPNLLSETAYAYIEDDVCCAATTFLKSFLETLRDECWNDDGVDQGYDAFRVLCLPPLM  544

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL SG +KLRSNLNTYALP L+E+D DSIF MLGFI +G SA++TE+        DIVL
Sbjct  545   RGLVSGNSKLRSNLNTYALPALIEVDTDSIFTMLGFISVGPSAKATEL--------DIVL  596

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
               +Q +A LVSLLKVSR LAL+EGDID        L       D G   +V+ V+GI V 
Sbjct  597   KNDQCIAALVSLLKVSRNLALVEGDID---LDPDKLSQPQKEDDRGA--AVISVRGINVT  651

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +PVN+  LALTH D+SLRIDAAESLF+NPKT+SLPSSLELSL+++AVPLNMRC STAFQM
Sbjct  652   VPVNWFALALTHNDESLRIDAAESLFLNPKTSSLPSSLELSLLKEAVPLNMRCSSTAFQM  711

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFF+RVRTAL+R +KQG+W PS    + G+     A+ ++  RAE+LF FMKW
Sbjct  712   KWTSLFRKFFARVRTALDRQVKQGSWIPSSTASVKGADSVDAANAAVTQRAEDLFQFMKW  771

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LS FLF SCYPS PYERK +AMEL+L +L+VW +   +GK+D       LYPY+  +ILP
Sbjct  772   LSSFLFNSCYPSGPYERKTIAMELILTLLDVWPICRSEGKND-------LYPYNDSIILP  824

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             +ST+  VGSIIDSWDRLRE+SFRILL FPTP+PGISS   + + I WAK LV SPRVRES
Sbjct  825   DSTISFVGSIIDSWDRLRENSFRILLQFPTPLPGISSSLSINDVIRWAKTLVLSPRVRES  884

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDW  1980
             DA                                          T  +PV +YI++LI W
Sbjct  885   DAAV----------------------------------------TSQNPVAQYISALIQW  904

Query  1981  LCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilalV  2160
             LC  VEEGE+DLSEACKKSFVHGVLLTLRYTF+E+DW+S  V S +S ++ L+E++L L+
Sbjct  905   LCTVVEEGERDLSEACKKSFVHGVLLTLRYTFDELDWNSEVVQSGVSEMRCLVERVLQLI  964

Query  2161  MRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQDDG  2340
             MR+TSLALWVVS+DAWY+P +M++M  DG+ FL    E D   +  + E K AK   +  
Sbjct  965   MRVTSLALWVVSSDAWYMPYDMDDMIDDGS-FLSDIYEEDQRTTGSEKEEKNAKPGSNGK  1023

Query  2341  PMDQIVMVGCWLAMKEVSLLLGTIIRKVPLP-TSDVPKSCSQITDGTDQLS-SDIVLDLR  2514
             P DQ+VMVGCWLAMKEVSLL GTIIRK+PLP  S    S   + D T++ S S+ +LD+ 
Sbjct  1024  PADQVVMVGCWLAMKEVSLLFGTIIRKIPLPGCSHSNSSQDGLLDSTEETSMSEEILDVG  1083

Query  2515  QLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTV  2694
             QLE +G+HFL+VLLKMKHNGAIDKTRAG TALCNRLLCSND RLC++TESWM  LM+RT+
Sbjct  1084  QLETMGDHFLQVLLKMKHNGAIDKTRAGLTALCNRLLCSNDSRLCQMTESWMVLLMDRTI  1143

Query  2695  SKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkenss  2874
             +KGQTVDDLLRRSAGIPAAF A FL+EPEG PK+LLP+AL WLI  AK SL +  K+N  
Sbjct  1144  AKGQTVDDLLRRSAGIPAAFIALFLAEPEGTPKKLLPRALEWLIEFAKTSLANFQKDNHQ  1203

Query  2875  csesss-------AIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDT  3033
              S  +          +S       +   +SK+RDEGVVPTVH FNVL+AAFNDANLATDT
Sbjct  1204  KSGITRDGVGELCESESGTTASAHSNGNLSKSRDEGVVPTVHVFNVLRAAFNDANLATDT  1263

Query  3034  SGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFH  3213
             SGFSAEA IV+I +FSS YWEVRN+ACLAYTALVRRM+GFLNVQKRESARR+LTGLEFFH
Sbjct  1264  SGFSAEATIVAIHAFSSPYWEVRNAACLAYTALVRRMVGFLNVQKRESARRSLTGLEFFH  1323

Query  3214  RYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETG  3393
             RYP LH FL +EL+IATEL   G S +L S++ K +HPSLCP+LILLSRLKPSPI+  T 
Sbjct  1324  RYPALHPFLSSELRIATELLAGGVSSDLESHIVKAIHPSLCPILILLSRLKPSPISCGTD  1383

Query  3394  DPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMT  3573
             D  DPFL +PFI++C+ Q+N R+R+LASRAL G+VSNE+L  V+ +I   LP + NH ++
Sbjct  1384  DSLDPFLLLPFIQRCATQSNYRVRVLASRALIGLVSNERLQQVVSDILGNLPNV-NHEVS  1442

Query  3574  SDL--------SGLSNLNA-------SFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILS  3708
               +        + + N N        SFNSIHG+LLQLSSLLD N R L D SKK+ I+ 
Sbjct  1443  PSVQLSDPPISANMENGNLLRFSKSFSFNSIHGLLLQLSSLLDNNFRGLTDSSKKDQIIG  1502

Query  3709  DLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSE  3888
              LI VL + SW+GS + C CP+++ S+L+VLD +L +ART + S+   VI  LL  LSS+
Sbjct  1503  QLIEVLSRCSWLGSTKLCSCPVVSTSYLRVLDLVLDVARTGK-SRHTEVIQTLLLELSSQ  1561

Query  3889  CLDLYTSKRPAYFDPTIAELRKQAASSYFNCA--YQTSKDVNEEDLIYLRGPPPDSELFK  4062
             CL+   S R A+ DPT  EL++QA  S+F+C    + + + +EED + L+     +    
Sbjct  1562  CLNSAVSTRYAFHDPTRIELQQQATESFFSCVGLSKRNDEASEED-VQLQILGEHTSNIS  1620

Query  4063  ESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLW  4242
                 ++S+    + ++  L++ +Y+VRI  LK +L    S   R   S N     I   W
Sbjct  1621  AMPGEVSLPELHKEIMSCLTEPMYDVRITVLKRILQLTKS--IRYGHSKN-----ILRQW  1673

Query  4243  LSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPTFVGNMDSDSVL  4422
              +   LQ +LM+ L  E++ KC+ Y LKII+ +NM          E P F    DS ++L
Sbjct  1674  -AGANLQPVLMERLFAEEHPKCLYYNLKIIFLWNM----------ESP-FNNGEDSGTIL  1721

Query  4423  QFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNE----KVVVVNPSD  4590
              FWD++V L     HAKTRE+++CCM +C+K  A L  + +  +G +        V  ++
Sbjct  1722  SFWDRLVHLNSTMSHAKTREIILCCMGMCMKWFAKLLRNGLPMVGLKTSELSASFVRINE  1781

Query  4591  PSKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVP  4770
              ++LS     +++FV +++  S  SE +N R+AAA++IVASGLL++A  ++ SVSN   P
Sbjct  1782  GNRLSDAMLGVNFFVTLVKNQSAPSETVNARRAAAEAIVASGLLEEASFVASSVSNLCFP  1841

Query  4771  ----DGNKQKDALH--------LYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITS  4914
                 +G+ +K  +         +YA KILDLWF C++LLEDED  LR+ L+  +Q  I +
Sbjct  1842  SECDEGHIKKKCMEASVSEFISIYACKILDLWFICIQLLEDEDAYLRQNLAKNIQNIIAN  1901

Query  4915  GKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADP  5094
             G S S+F     P+QV++VIE+SF++L+S FG WL Y+++L   V    N+    S  D 
Sbjct  1902  G-SASNFCDDSTPLQVDRVIELSFDYLTSLFGPWLKYIEYLLRIVLDTGNTLN--SREDL  1958

Query  5095  VRRVFDKEIDNHHEEKLLISQICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLI  5274
             VR++FDKEIDNHHEEKLLI QICC +++KL  SK   E       S LQ+WR RF  QL 
Sbjct  1959  VRQIFDKEIDNHHEEKLLICQICCFNIQKLLQSKYQME-TGGKTESFLQNWRERFLSQLT  2017

Query  5275  SFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLE  5454
                + Y+  +G +DWIGG+GNHKD F+ VY +LL  + L+        +   + + E   
Sbjct  2018  LLTSGYLEKEGKIDWIGGIGNHKDVFISVYADLLGLYVLAPSGSLEHQDSHATYLQEFSN  2077

Query  5455  LGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             L   I+PFL+NPLISNL+VLV  SHE++         +  S        FDPYFL R
Sbjct  2078  LDGFIKPFLKNPLISNLYVLVKLSHERLRCPDKPEDQMASS--------FDPYFLIR  2126



>gb|AFW57164.1| hypothetical protein ZEAMMB73_924221 [Zea mays]
Length=2194

 Score =  1752 bits (4538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1012/1952 (52%), Positives = 1289/1952 (66%), Gaps = 152/1952 (8%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILT++ RTVLN+  + S+               + T+LYDGIL ELC  CE+P DSHFN
Sbjct  318   GILTSIPRTVLNMHQLHSS-------------GPLWTVLYDGILPELCKHCENPVDSHFN  364

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV QICLQQIKTS+          Y P S +V  R+L I+W NLEDPLSQTVKQVH
Sbjct  365   FHALTVTQICLQQIKTSVSSDITDFSGDYKPFSRDVVNRILGIIWRNLEDPLSQTVKQVH  424

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDL LDI+  +   +       FL  +A+DLL LGPRCKGRY+PLASLTKRLGAKS+L
Sbjct  425   LIFDLLLDIELCIASEDREHNNNLFLCNVANDLLRLGPRCKGRYVPLASLTKRLGAKSLL  484

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              +   LL +T  AY+DDDVC A TTFLK FLE LR E W+ DGVE GY  +RA CL P +
Sbjct  485   TLKSNLLSETAYAYIDDDVCCAVTTFLKSFLETLRGECWNDDGVELGYDAFRALCLPPFM  544

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL SG +KLRSNLNTYALP L+E+D +SIF MLGFI IG S   T++        D+VL
Sbjct  545   RGLVSGNSKLRSNLNTYALPALIEVDAESIFTMLGFISIGPSTNETKL--------DVVL  596

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
               +Q +A LVSLLKVSR LAL+EGDID        ++  D    A     V+ VKGI+V 
Sbjct  597   KNDQCIAALVSLLKVSRNLALVEGDIDLDPDELSQIQQMDSKGAA-----VISVKGIKVT  651

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +P N+  LALTH D+SLRIDAAESLF+NPKT+SLPSSLELSL+++AVPLNMRC STAFQM
Sbjct  652   VPFNWFALALTHSDESLRIDAAESLFLNPKTSSLPSSLELSLLKEAVPLNMRCSSTAFQM  711

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFF+RVRTAL+R +KQG+W PSL   + G+     +  ++  RAE+LF FMKW
Sbjct  712   KWTSLFRKFFARVRTALDRQVKQGSWIPSLTSSVKGAGSIDTSKATVVKRAEDLFQFMKW  771

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILP  1620
             LS FLF SCYPS PYERK +AMEL+L +L+VW +   +GK       I LYPY+  +ILP
Sbjct  772   LSSFLFNSCYPSGPYERKTIAMELILTLLDVWPICRSEGK-------IDLYPYNDSIILP  824

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
             +ST+  VGSIIDSWDRLRE+SFRILL FPTP+PGIS    + + I WAKKLV SPRVRES
Sbjct  825   DSTISFVGSIIDSWDRLRENSFRILLQFPTPLPGISLSTSINDVIRWAKKLVLSPRVRES  884

Query  1801  DAGALTFRLIFRKYVLELGWVVRVS-----CNVVTQSPSGLSNGENLEFTPSSPVIEYIT  1965
             DAGALTFRLIFRKYVL+LG ++  S         TQS +G     + E T  +PV +YI+
Sbjct  885   DAGALTFRLIFRKYVLQLGCILVFSKESDCLECYTQSMNG-----DTEVTSQNPVAQYIS  939

Query  1966  SLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllek  2145
             SLI WLC  VEEGE+DLSEACKKSFVHGVLLTLRYTF+EMDW+S  V S IS ++ L+EK
Sbjct  940   SLIQWLCIVVEEGERDLSEACKKSFVHGVLLTLRYTFDEMDWNSEVVQSCISEMRYLVEK  999

Query  2146  ilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKA  2325
             +L L+MR+TS+ALWVVS+DA  LP +M++M  DG+ FL   I  D   +T + E K AK 
Sbjct  1000  LLQLIMRVTSVALWVVSSDALSLPYDMDDMIDDGS-FLS-DIYDDQPTTTSEREEKNAKP  1057

Query  2326  EQDDGPMDQIVMVGCWLAMKE--------VSLLLGTIIRKVPLP-TSDVPKSCSQITDGT  2478
               +  P +Q+VMVGCWLAMKE        VSLL GTIIRK+PLP  S    S + + D  
Sbjct  1058  GSNGKPAEQVVMVGCWLAMKEFHAIVALQVSLLFGTIIRKIPLPGCSHSASSQNGLPDSI  1117

Query  2479  DQLS-SDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKL  2655
             ++ S S+ +LD+ QL+++G+HFL+VLLKMKHNGAIDKTRAGFTALCNRLLCSND RLCK+
Sbjct  1118  EETSISEEILDVGQLKMMGDHFLQVLLKMKHNGAIDKTRAGFTALCNRLLCSNDSRLCKM  1177

Query  2656  TESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVA  2835
             TESWM  LM+RT++KGQTVDDL+RRSAGIPAAF A FL+EPEG PK+LLP+AL WLI  A
Sbjct  1178  TESWMVLLMDRTIAKGQTVDDLIRRSAGIPAAFIALFLAEPEGTPKKLLPRALEWLIEFA  1237

Query  2836  KKSLTDknkensscsesssAI--DSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFN  3009
             K SL +  K+++  S     +    +    V +   +SK RDEGVVPTVH FNVLKAAFN
Sbjct  1238  KNSLANFQKDSNQRSGVMKELLESQSETTSVYSNGNLSKGRDEGVVPTVHVFNVLKAAFN  1297

Query  3010  DANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRA  3189
             DANLATDTSGFSAEA IV+IR+FSS YWEVRN+ACLAYTALVRRM+GFLNVQKRESARR+
Sbjct  1298  DANLATDTSGFSAEATIVAIRAFSSPYWEVRNAACLAYTALVRRMVGFLNVQKRESARRS  1357

Query  3190  LTGLEFFH-------------------------RYPTLHTFLFNELKIATELFLEGSSEN  3294
             LTGLEFFH                         RYP LH FL +EL+  TE   +G S N
Sbjct  1358  LTGLEFFHRQQLSIFYMIHGQIDQNFFSIVAALRYPALHPFLSSELQTTTEQLADGVSSN  1417

Query  3295  LTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILA  3474
             L S++ K +HPSLCP+LILLSRLKPSPI+  T D  DPFL +PFI++C+ Q+N R+RILA
Sbjct  1418  LESHITKAIHPSLCPILILLSRLKPSPISCGTDDSLDPFLLLPFIQRCATQSNYRVRILA  1477

Query  3475  SRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDLS----------GLSN---LNASFN  3615
             SRALT +VSNE+L  VI +I   LP   + +M   +           G +N   L+ SFN
Sbjct  1478  SRALTCLVSNERLQYVISDILDNLPRGSHKAMAHSVQHTDPAISANMGKANVLLLSKSFN  1537

Query  3616  SIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPILNCSFLK  3795
             SIHG+LLQL+SLLD N R L D S K+ I+  L+ VL + SW+G  + C CPI+  S+L+
Sbjct  1538  SIHGLLLQLASLLDNNFRGLTDGSMKDQIIGLLLEVLSRCSWLGCTKLCSCPIVITSYLR  1597

Query  3796  VLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPTIAELRKQAASSYF  3975
             VLD ML +ART + S+   VI  LL  L+S+CL    S + A+ DPT  EL++QA  S+ 
Sbjct  1598  VLDLMLDVARTGK-SRHTEVIQALLLELTSQCLSNTASTQYAFHDPTRIELKQQATESFL  1656

Query  3976  NCAYQTSK--DVNEEDL-IYLRGPPPDSELFKESETQMSVTRFQERLIRSLSDALYEVRI  4146
             +C   + K  + N++D+ + + G P      +      S+    + ++  L+D  Y+VRI
Sbjct  1657  SCVGLSKKTDETNDDDVQLQILGEPT----LEMPRVDYSLHEVHKEILSCLTDPSYDVRI  1712

Query  4147  ATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEKNHKCMNYILK  4326
               LK +L    S     A++       I   W + + LQ  LM+ L VE++ KC+ Y LK
Sbjct  1713  TVLKRILWLTKSIRHGYADN-------ILHQW-AGVNLQPALMERLFVEEHPKCLYYNLK  1764

Query  4327  IIYTYNMQQYNKNCGQHEKPTFVGNMDSDSVLQFWDKVVSLYKVTRHAKTREMLVCCMAV  4506
             II+++NM ++  N G+          DS ++L  WD++V L     HAKTRE+++CCM +
Sbjct  1765  IIFSWNM-EFPFNNGE----------DSSTLLSLWDRLVHLNSTMSHAKTREIVLCCMGM  1813

Query  4507  CIKRLADLFTSSI---CSLGNE---KVVVVNPSDPSKLSVFSECIDYFVEVIQEHSDASE  4668
             C+K         I   C   +E     V +N  D    ++    ++ FV +++  S+ SE
Sbjct  1814  CMKLFTKQSRGGISMDCLKTSEISASFVRINEGDGLSDAMLR--LNLFVTLVKNQSEPSE  1871

Query  4669  PINMRKAAAQSIVASGLLDQAQALSPSVSNHQVP-----DGNKQK-------DALHLYAH  4812
              +N R+AAA++IVASGLL++A  ++ SVSN   P     D  K+K       + + LY  
Sbjct  1872  SMNARRAAAEAIVASGLLEEASYVASSVSNMYSPSEFDEDHTKEKCMEDSVFEFVSLYTC  1931

Query  4813  KILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEH  4992
             KILDLWF C++LLEDED  LR++L+ ++QK I  G S + F     P+QV++VIE+S ++
Sbjct  1932  KILDLWFVCIQLLEDEDAYLRQKLAKDIQKIIAKG-SANTFCDDSTPLQVDRVIELSLDY  1990

Query  4993  LSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNHHEEKLLISQICCSH  5172
             L+S FG WL Y++FL   V    N+    S  D VR++FDKEIDNHHEEKLLI QICCS+
Sbjct  1991  LTSLFGLWLKYVEFLLRIVLGTGNALN--SRGDLVRQIFDKEIDNHHEEKLLICQICCSN  2048

Query  5173  LEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAF  5352
             ++KL  SK   E         LQ+WR  F +QL S    YI  +G  DWIGG+GNHKD F
Sbjct  2049  IQKLLNSKCQMEAGAETKL-FLQNWREIFLKQLTSLTGGYIEKEGKNDWIGGIGNHKDVF  2107

Query  5353  LPVYVNLLAFHALSNCILRGEAEDSKSM-VPELLELGEAIQPFLRNPLISNLFVLVVKSH  5529
             + VY  LL  +AL+      + ED  ++ + E   L  +I PFL+NPLISNL+ LV  SH
Sbjct  2108  ISVYAVLLGLYALTQSGSLDQLEDHCAVYLQEFANLERSITPFLKNPLISNLYALVKLSH  2167

Query  5530  EKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             E+          +  SG+     +FDPYFL R
Sbjct  2168  ERFISSDKPEDQVGDSGS-----SFDPYFLIR  2194



>gb|EEE68119.1| hypothetical protein OsJ_26194 [Oryza sativa Japonica Group]
Length=2138

 Score =  1739 bits (4505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 994/1918 (52%), Positives = 1278/1918 (67%), Gaps = 140/1918 (7%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTA+ RTVLN+  + SN              S+ T+LY+GIL ELC  CE+P DSHFN
Sbjct  318   GILTAIPRTVLNMRQLHSN-------------GSLWTMLYNGILPELCKHCENPIDSHFN  364

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV QICLQQIKTS+          Y+P S +V  R+L+I+W+NLEDPLSQTVKQVH
Sbjct  365   FHALTVTQICLQQIKTSVLADFTDFSGDYEPFSRDVINRILRIIWSNLEDPLSQTVKQVH  424

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDL LDI+  +   +  E    FL  IASDLL LGPRCKGRYIPLASLTKRLGAKS+L
Sbjct  425   LIFDLLLDIESCIPSGDPEENSKLFLFNIASDLLRLGPRCKGRYIPLASLTKRLGAKSLL  484

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              +   LL +T  AY+DDDVC AAT+FLKCFLE LRDE W  DG+E GY  +R  CL P+L
Sbjct  485   KLKSNLLLETAYAYMDDDVCCAATSFLKCFLETLRDECWKDDGIEQGYDAFRFLCLPPLL  544

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL SG +KLRSNLNTYALP  +E+D DSIF MLGFI +G SA++ E+        D+ L
Sbjct  545   RGLVSGNSKLRSNLNTYALPAAIEVDADSIFAMLGFINVGPSAKAIEL--------DVAL  596

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTD-AGVCDSVVHVKGIEV  1077
               +Q +A LVSLLKVSR LAL+EGDID        L+   LS   A  CD+V+ ++GI V
Sbjct  597   KNDQCIAALVSLLKVSRNLALVEGDID--------LDPDVLSQQVANKCDAVISIRGINV  648

Query  1078  KIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQ  1257
              +PV + +LALTH ++SLRIDAAESLF+NPKT+SLPS+LELSL+++AVPLNMRC STAFQ
Sbjct  649   TVPVKWFVLALTHNEESLRIDAAESLFLNPKTSSLPSALELSLLKQAVPLNMRCSSTAFQ  708

Query  1258  MKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQ---SLKHRAENLFN  1428
             MKW SLFRKFF+RVRTAL+R +KQG W PS    LSG   +   D    +   RAE+LF 
Sbjct  709   MKWTSLFRKFFARVRTALDRQVKQGLWLPS---SLSGDKDSNSVDTVKATTIKRAEDLFQ  765

Query  1429  FMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKG  1608
             FMKWLS FLF SCYPS PYER+ +AMEL+L +L+VW +   +GK+D       LYPYS  
Sbjct  766   FMKWLSSFLFNSCYPSGPYERRTIAMELILTLLDVWPICRSEGKND-------LYPYSDS  818

Query  1609  LILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPR  1788
             + LP+ST+  VGSIIDSWDRLRE+SFRILL FPTP+PGISS   +   I WAKKLV SPR
Sbjct  819   ITLPDSTISFVGSIIDSWDRLRENSFRILLQFPTPLPGISSSTSIDSVIRWAKKLVLSPR  878

Query  1789  VRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITS  1968
             VRESDA     +   +                        S  ++ E T  +PV +YI+S
Sbjct  879   VRESDAENDCLQCYTK------------------------STNDDTELTSQNPVAQYISS  914

Query  1969  LIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissikllleki  2148
             LI WLCA VEEGEKDLSEACKKSFVHGVLLTLRYTF+E+DW++  V S I+ ++ L+EK+
Sbjct  915   LIQWLCAVVEEGEKDLSEACKKSFVHGVLLTLRYTFDELDWNTEVVQSCIAEMRCLVEKL  974

Query  2149  lalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAE  2328
             L L+MR+TSLALWVVS+DAWY+P ++++M  D + FL   I+ D   +  +      K+ 
Sbjct  975   LQLIMRVTSLALWVVSSDAWYMPYDVDDMIDDDS-FLSDIIDEDQPGTASEIAETNVKSG  1033

Query  2329  QDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLP-TSDVPKSCSQITDGTDQ--LSSDI  2499
              +  P + +VMVGCWLAMKEVSLL GTIIRK+PLP  S    S   + + T++  ++ DI
Sbjct  1034  HNGKPAEHVVMVGCWLAMKEVSLLFGTIIRKIPLPGCSHSNSSHGDLAENTEETGMTGDI  1093

Query  2500  VLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQL  2679
              LD+ QLE +GNHFL+VLLKMKHNGAIDKTRAG TALCNRLLCSND RLCK+TESWME L
Sbjct  1094  -LDVEQLEKMGNHFLQVLLKMKHNGAIDKTRAGLTALCNRLLCSNDSRLCKMTESWMELL  1152

Query  2680  MERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDkn  2859
             M+RTV+KGQTVDDLLRRSAGIPAAF A FL+EPEG PK+LLP+AL WLI  AK SL +  
Sbjct  1153  MDRTVAKGQTVDDLLRRSAGIPAAFIALFLAEPEGTPKKLLPRALEWLIEFAKTSLANFQ  1212

Query  2860  kensscsesssAI-------DSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDAN  3018
              +++   ++            S     V +   +SK+R+EGVVPTVH FNVL+AAFNDAN
Sbjct  1213  NDSNQKLDTEKDFLGEPCESQSETTAGVHSNGNLSKSRNEGVVPTVHVFNVLRAAFNDAN  1272

Query  3019  LATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTG  3198
             LATDTSGF AEA IV+I +FSS YWEVRN+ACLAYTALVRRM+GFLNV KRESARR+LTG
Sbjct  1273  LATDTSGFCAEATIVAIHAFSSPYWEVRNAACLAYTALVRRMVGFLNVHKRESARRSLTG  1332

Query  3199  LEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPI  3378
             LEFFHRYP LH FL +EL +AT L  +G S NL S +AK +HPSLCP+LILLSRLKPSPI
Sbjct  1333  LEFFHRYPALHPFLLSELNVATGLLADGISSNLGSQIAKAIHPSLCPILILLSRLKPSPI  1392

Query  3379  TSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAID  3558
             +  T D  DPFL +PFI++C+ Q+N R+R+LASRAL G+VSNE+L  V+ +I   LP   
Sbjct  1393  SRGTDDSLDPFLLLPFIQRCATQSNYRVRVLASRALIGLVSNERLQHVVGDILHNLPCA-  1451

Query  3559  NHSMTSDLS-------GLSNLNA-----SFNSIHGMLLQLSSLLDTNCRNLADFSKKEDI  3702
             +H +T+  +       G  NL       SFNSIHG+LLQLSSLLD N R L D +KK+ I
Sbjct  1452  SHEVTAHRALCLSADMGNGNLTLPAKSFSFNSIHGLLLQLSSLLDNNFRALTDSTKKDQI  1511

Query  3703  LSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLS  3882
             LS LI  L K SW+GS + C CP+++ S+L+VLD ML +ART + S     I  LLW LS
Sbjct  1512  LSQLIEALSKCSWLGSVKLCACPVVSTSYLRVLDLMLDVARTGK-SGHTDAIQILLWELS  1570

Query  3883  SECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAY--QTSKDVNEEDLIYLRGPPPDSEL  4056
              +CL+  TS   A+ DPT  ELR+QAA+SYF+C    +   + N+E+ + L+     S +
Sbjct  1571  YQCLNNGTSTHYAFHDPTQIELRQQAAASYFSCVGLPKRHDETNDEN-VQLQILDMTSSI  1629

Query  4057  FKESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKL  4236
               E   ++S+    + +   L D  Y+VRI  LK +L        + A+S+    S+  L
Sbjct  1630  -PEMPREVSLYELHKEIASCLVDPAYDVRITALKRIL--------QLAKSARSGDSKKFL  1680

Query  4237  LWLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQ-QYNKNCGQHEKPTFVGNMDSD  4413
                +   LQ ++++ +  E++ KC+ Y LKII+++NM+ Q+N               DS 
Sbjct  1681  HQWAKSNLQHVILKRIFEEEHPKCLYYNLKIIFSWNMECQFN------------SEEDSS  1728

Query  4414  SVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDP  4593
             + L FWD++V L     HAKTRE ++CCM +C+++ A +    + S  +E        D 
Sbjct  1729  TFLSFWDRLVHLNSTVSHAKTRETILCCMGMCMRQFAKMLRGLLDSKTHEHSTSFVRIDE  1788

Query  4594  SK-LSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVP  4770
              K LS        FV +++  S  SE +N R+AAA++I+ASGLL++A   +PS+SN  +P
Sbjct  1789  GKNLSTAILSASSFVNLVKNLSAPSETVNARRAAAEAIIASGLLEEANLFAPSLSNAYLP  1848

Query  4771  DGNKQK------------DALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITS  4914
               + +             + ++LY+ KILDLWF C++LLEDED  LR++L+  VQK I  
Sbjct  1849  SEHDENHIEEKCSNATVSELINLYSCKILDLWFICIQLLEDEDTYLRQKLANNVQKIIAK  1908

Query  4915  GKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADP  5094
             G S ++      P+QV++VIE+SFE+L+S  GHWL Y ++L   V    N+    S  D 
Sbjct  1909  G-SANNLCDDSTPLQVDRVIELSFEYLTSLLGHWLKYTEYLLRLVLDTANT--LNSRGDL  1965

Query  5095  VRRVFDKEIDNHHEEKLLISQICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLI  5274
             +R++FDKEIDNHHEEKLLI QICCS ++KL  SK   E     +   LQ+WR  F  QLI
Sbjct  1966  IRQIFDKEIDNHHEEKLLICQICCSSIQKLLQSKYLVE-TGAEVELFLQNWRESFLHQLI  2024

Query  5275  SFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKS-MVPELL  5451
             S  ++++  +G  DWIGG+GNHKD F+ VY NLL  +AL+      + +D  +  +    
Sbjct  2025  SLTSSFLEKEGKTDWIGGIGNHKDVFISVYANLLGLYALAQSQSLEQLKDRHTEYLKNFS  2084

Query  5452  ELGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             +L   I PFL+NPLISNL+ LV +SHE       +    +  G+ SA ++FDPYFL R
Sbjct  2085  DLDGVITPFLKNPLISNLYSLVKESHETFNSPKKQ---WDQVGS-SATESFDPYFLIR  2138



>ref|NP_001061088.1| Os08g0169700 [Oryza sativa Japonica Group]
 dbj|BAF23002.1| Os08g0169700 [Oryza sativa Japonica Group]
Length=2122

 Score =  1734 bits (4492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 993/1918 (52%), Positives = 1273/1918 (66%), Gaps = 156/1918 (8%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTA+ RTVLN+  + SN              S+ T+LY+GIL ELC  CE+P DSHFN
Sbjct  318   GILTAIPRTVLNMRQLHSN-------------GSLWTMLYNGILPELCKHCENPIDSHFN  364

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV QICLQQIKTS+          Y+P S +V  R+L+I+W+NLEDPLSQTVKQVH
Sbjct  365   FHALTVTQICLQQIKTSVLADFTDFSGDYEPFSRDVINRILRIIWSNLEDPLSQTVKQVH  424

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDL LDI+  +   +  E    FL  IASDLL LGPRCKGRYIPLASLTKRLGAKS+L
Sbjct  425   LIFDLLLDIESCIPSGDPEENSKLFLFNIASDLLRLGPRCKGRYIPLASLTKRLGAKSLL  484

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              +   LL +T  AY+DDDVC AAT+FLKCFLE LRDE W  DG+E GY  +R  CL P+L
Sbjct  485   KLKSNLLLETAYAYMDDDVCCAATSFLKCFLETLRDECWKDDGIEQGYDAFRFLCLPPLL  544

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL SG +KLRSNLNTYALP  +E+D DSIF MLGFI +G SA++ E+        D+ L
Sbjct  545   RGLVSGNSKLRSNLNTYALPAAIEVDADSIFAMLGFINVGPSAKAIEL--------DVAL  596

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTD-AGVCDSVVHVKGIEV  1077
               +Q +A LVSLLKVSR LAL+EGDID        L+   LS   A  CD+V+ ++GI V
Sbjct  597   KNDQCIAALVSLLKVSRNLALVEGDID--------LDPDVLSQQVANKCDAVISIRGINV  648

Query  1078  KIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQ  1257
              +PV + +LALTH ++SLRIDAAESLF+NPKT+SLPS+LELSL+++AVPLNMRC STAFQ
Sbjct  649   TVPVKWFVLALTHNEESLRIDAAESLFLNPKTSSLPSALELSLLKQAVPLNMRCSSTAFQ  708

Query  1258  MKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQ---SLKHRAENLFN  1428
             MKW SLFRKFF+RVRTAL+R +KQG W PS    LSG   +   D    +   RAE+LF 
Sbjct  709   MKWTSLFRKFFARVRTALDRQVKQGLWLPS---SLSGDKDSNSVDTVKATTIKRAEDLFQ  765

Query  1429  FMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKG  1608
             FMKWLS FLF SCYPS PYER+ +AMEL+L +L+VW +   +GK+D       LYPYS  
Sbjct  766   FMKWLSSFLFNSCYPSGPYERRTIAMELILTLLDVWPICRSEGKND-------LYPYSDS  818

Query  1609  LILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPR  1788
             + LP+ST+  VGSIIDSWDRLRE+SFRILL FPTP+PGISS   +   I WAKKLV SPR
Sbjct  819   ITLPDSTISFVGSIIDSWDRLRENSFRILLQFPTPLPGISSSTSIDSVIRWAKKLVLSPR  878

Query  1789  VRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITS  1968
             VRESDA                                        E T  +PV +YI+S
Sbjct  879   VRESDA----------------------------------------ELTSQNPVAQYISS  898

Query  1969  LIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissikllleki  2148
             LI WLCA VEEGEKDLSEACKKSFVHGVLLTLRYTF+E+DW++  V S I+ ++ L+EK+
Sbjct  899   LIQWLCAVVEEGEKDLSEACKKSFVHGVLLTLRYTFDELDWNTEVVQSCIAEMRCLVEKL  958

Query  2149  lalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAE  2328
             L L+MR+TSLALWVVS+DAWY+P ++++M  D + FL   I+ D   +  +      K+ 
Sbjct  959   LQLIMRVTSLALWVVSSDAWYMPYDVDDMIDDDS-FLSDIIDEDQPGTASEIAETNVKSG  1017

Query  2329  QDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLP-TSDVPKSCSQITDGTDQ--LSSDI  2499
              +  P + +VMVGCWLAMKEVSLL GTIIRK+PLP  S    S   + + T++  ++ DI
Sbjct  1018  HNGKPAEHVVMVGCWLAMKEVSLLFGTIIRKIPLPGCSHSNSSHGDLAENTEETGMTGDI  1077

Query  2500  VLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQL  2679
              LD+ QLE +GNHFL+VLLKMKHNGAIDKTRAG TALCNRLLCSND RLCK+TESWME L
Sbjct  1078  -LDVEQLEKMGNHFLQVLLKMKHNGAIDKTRAGLTALCNRLLCSNDSRLCKMTESWMELL  1136

Query  2680  MERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDkn  2859
             M+RTV+KGQTVDDLLRRSAGIPAAF A FL+EPEG PK+LLP+AL WLI  AK SL +  
Sbjct  1137  MDRTVAKGQTVDDLLRRSAGIPAAFIALFLAEPEGTPKKLLPRALEWLIEFAKTSLANFQ  1196

Query  2860  kensscsesssAI-------DSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDAN  3018
              +++   ++            S     V +   +SK+R+EGVVPTVH FNVL+AAFNDAN
Sbjct  1197  NDSNQKLDTEKDFLGEPCESQSETTAGVHSNGNLSKSRNEGVVPTVHVFNVLRAAFNDAN  1256

Query  3019  LATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTG  3198
             LATDTSGF AEA IV+I +FSS YWEVRN+ACLAYTALVRRM+GFLNV KRESARR+LTG
Sbjct  1257  LATDTSGFCAEATIVAIHAFSSPYWEVRNAACLAYTALVRRMVGFLNVHKRESARRSLTG  1316

Query  3199  LEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPI  3378
             LEFFHRYP LH FL +EL +AT L  +G S NL S +AK +HPSLCP+LILLSRLKPSPI
Sbjct  1317  LEFFHRYPALHPFLLSELNVATGLLADGISSNLGSQIAKAIHPSLCPILILLSRLKPSPI  1376

Query  3379  TSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAID  3558
             +  T D  DPFL +PFI++C+ Q+N R+R+LASRAL G+VSNE+L  V+ +I   LP   
Sbjct  1377  SRGTDDSLDPFLLLPFIQRCATQSNYRVRVLASRALIGLVSNERLQHVVGDILHNLPCA-  1435

Query  3559  NHSMTSDLS-------GLSNLNA-----SFNSIHGMLLQLSSLLDTNCRNLADFSKKEDI  3702
             +H +T+  +       G  NL       SFNSIHG+LLQLSSLLD N R L D +KK+ I
Sbjct  1436  SHEVTAHRALCLSADMGNGNLTLPAKSFSFNSIHGLLLQLSSLLDNNFRALTDSTKKDQI  1495

Query  3703  LSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLS  3882
             LS LI  L K SW+GS + C CP+++ S+L+VLD ML +ART + S     I  LLW LS
Sbjct  1496  LSQLIEALSKCSWLGSVKLCACPVVSTSYLRVLDLMLDVARTGK-SGHTDAIQILLWELS  1554

Query  3883  SECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAY--QTSKDVNEEDLIYLRGPPPDSEL  4056
              +CL+  TS   A+ DPT  ELR+QAA+SYF+C    +   + N+E+ + L+     S +
Sbjct  1555  YQCLNNGTSTHYAFHDPTQIELRQQAAASYFSCVGLPKRHDETNDEN-VQLQILDMTSSI  1613

Query  4057  FKESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKL  4236
               E   ++S+    + +   L D  Y+VRI  LK +L        + A+S+    S+  L
Sbjct  1614  -PEMPREVSLYELHKEIASCLVDPAYDVRITALKRIL--------QLAKSARSGDSKKFL  1664

Query  4237  LWLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQ-QYNKNCGQHEKPTFVGNMDSD  4413
                +   LQ ++++ +  E++ KC+ Y LKII+++NM+ Q+N               DS 
Sbjct  1665  HQWAKSNLQHVILKRIFEEEHPKCLYYNLKIIFSWNMECQFN------------SEEDSS  1712

Query  4414  SVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDP  4593
             + L FWD++V L     HAKTRE ++CCM +C+++ A +    + S  +E        D 
Sbjct  1713  TFLSFWDRLVHLNSTVSHAKTRETILCCMGMCMRQFAKMLRGLLDSKTHEHSTSFVRIDE  1772

Query  4594  SK-LSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVP  4770
              K LS        FV +++  S  SE +N R+AAA++I+ASGLL++A   +PS+SN  +P
Sbjct  1773  GKNLSTAILSASSFVNLVKNLSAPSETVNARRAAAEAIIASGLLEEANLFAPSLSNAYLP  1832

Query  4771  DGNKQK------------DALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITS  4914
               + +             + ++LY+ KILDLWF C++LLEDED  LR++L+  VQK I  
Sbjct  1833  SEHDENHIEEKCSNATVSELINLYSCKILDLWFICIQLLEDEDTYLRQKLANNVQKIIAK  1892

Query  4915  GKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADP  5094
             G S ++      P+QV++VIE+SFE+L+S  GHWL Y ++L   V    N+    S  D 
Sbjct  1893  G-SANNLCDDSTPLQVDRVIELSFEYLTSLLGHWLKYTEYLLRLVLDTANT--LNSRGDL  1949

Query  5095  VRRVFDKEIDNHHEEKLLISQICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLI  5274
             +R++FDKEIDNHHEEKLLI QICCS ++KL  SK   E     +   LQ+WR  F  QLI
Sbjct  1950  IRQIFDKEIDNHHEEKLLICQICCSSIQKLLQSKYLVE-TGAEVELFLQNWRESFLHQLI  2008

Query  5275  SFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKS-MVPELL  5451
             S  ++++  +G  DWIGG+GNHKD F+ VY NLL  +AL+      + +D  +  +    
Sbjct  2009  SLTSSFLEKEGKTDWIGGIGNHKDVFISVYANLLGLYALAQSQSLEQLKDRHTEYLKNFS  2068

Query  5452  ELGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             +L   I PFL+NPLISNL+ LV +SHE       +    +  G+ SA ++FDPYFL R
Sbjct  2069  DLDGVITPFLKNPLISNLYSLVKESHETFNSPKKQ---WDQVGS-SATESFDPYFLIR  2122



>gb|EMT08978.1| hypothetical protein F775_05570 [Aegilops tauschii]
Length=2193

 Score =  1722 bits (4461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 998/1914 (52%), Positives = 1304/1914 (68%), Gaps = 133/1914 (7%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTA+ R  LN+  + SN              S+ T+LYDGIL ELC  CE+P D HFN
Sbjct  374   GILTAIPRKALNVRQLHSN-------------GSLWTVLYDGILPELCMHCENPIDRHFN  420

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV QICLQQIKTS+          Y P S +V  RVLKI+W+NLEDPLSQTVKQVH
Sbjct  421   FHALTVTQICLQQIKTSVLADFTDFSGDYKPFSRDVVNRVLKIIWSNLEDPLSQTVKQVH  480

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDL LDI+  L   + S K    L  IA+DLL LGPRCKGRYIPLASLT+RLGAKS+L
Sbjct  481   LIFDLLLDIESCLPSEDQSVKL--VLCDIANDLLRLGPRCKGRYIPLASLTRRLGAKSLL  538

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              +   LL +T  AY+DDDVC AAT+FLKCFLE LRDE W+ DGVE GY  +R  CL P++
Sbjct  539   SLKSNLLLETAYAYIDDDVCCAATSFLKCFLENLRDECWNEDGVEQGYDAFRGLCLPPLM  598

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL SG +KLRSNLNTYA+P ++E+D DSIF MLGFI +G SA++ ++        D+ L
Sbjct  599   RGLVSGNSKLRSNLNTYAVPTVIEVDTDSIFAMLGFISVGPSADANKL--------DVPL  650

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
               +Q +A LVSLLKVSR LAL+EGDI     S   LE  D   D G    ++ VKGI V+
Sbjct  651   KSDQCIAALVSLLKVSRNLALVEGDIHM--DSDELLEQED---DKGAV--IISVKGITVR  703

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +P N+ +LALTH D++LRIDAAESLF+NPKT+SLPSSLELSL++ AVPLNMRC STAFQM
Sbjct  704   VPANWFVLALTHSDETLRIDAAESLFLNPKTSSLPSSLELSLLKLAVPLNMRCSSTAFQM  763

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHP---SLIKCLSGSPLNGEADQSLKHRAENLFNF  1431
             KWA LFRKFF+RVRTAL+R +KQG+W P   S++K     P++   D +++ RAE+LF F
Sbjct  764   KWAGLFRKFFARVRTALDRQLKQGSWLPSPNSIVK--EAHPVDTVMDTTVQ-RAEDLFQF  820

Query  1432  MKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGL  1611
             MKWL  FLF SCYPSAPYERK +AMEL+LIM++VW +   +GK+D       ++PY+  +
Sbjct  821   MKWLGSFLFNSCYPSAPYERKTIAMELILIMVDVWPIRRSEGKTD-------VHPYNDSI  873

Query  1612  ILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRV  1791
              LP+ST+  VGSIIDSWD+LRE+SFRILL FPTP+PGIS    + + I WAK+LV SPRV
Sbjct  874   TLPDSTISFVGSIIDSWDKLRENSFRILLQFPTPLPGISQSASINDVIRWAKELVLSPRV  933

Query  1792  RESDAGALTFRLIFRKYVLELGWVVRVS-CNVVTQSPSGLSNGENLEFTPSSPVIEYITS  1968
             RESDAGALTFRLIFRKYVLELG V+  S  N   Q  +  ++ +    T  +PV +YI+S
Sbjct  934   RESDAGALTFRLIFRKYVLELGCVIVFSEENDCLQCYTKSTDEDTEVITSQNPVAQYISS  993

Query  1969  LIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissikllleki  2148
             LI WLC  VEEGE+DL EACK+SFVHGVLLTLRYTF+E++W+S A+ S +S ++ L+ K+
Sbjct  994   LIQWLCTVVEEGERDLCEACKRSFVHGVLLTLRYTFDELNWNSAAIQSCLSEMRSLVGKL  1053

Query  2149  lalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAE  2328
             L L+MRITSLALWVVS+DAWY+P +M++M  DG+ FL   I+ D   +      K AK+ 
Sbjct  1054  LQLIMRITSLALWVVSSDAWYMPYDMDDMIDDGS-FLLDIIDEDQPDTALATTEKNAKSG  1112

Query  2329  QDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPT-SDVPKSCSQITDGTDQLS-SDIV  2502
              +  P + ++MVGCWLAMKEVSLL GTI+RK+PLP  S    S + ++D T+Q + S  V
Sbjct  1113  NNGKPAEHVIMVGCWLAMKEVSLLFGTIVRKIPLPVCSHSNSSQNGLSDNTEQTNMSGEV  1172

Query  2503  LDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLM  2682
             LD+ QLE++G+HFL+VLLKMKHNGAIDKTRAG TALCNRLLCSND RLCK+TESWM  LM
Sbjct  1173  LDVEQLEMMGDHFLQVLLKMKHNGAIDKTRAGLTALCNRLLCSNDSRLCKMTESWMLLLM  1232

Query  2683  ERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknk  2862
             +R V+KGQTVDDLLRRSAGIPA+F A FL+EP+G PK+LLP+AL+WLI  AK SL++  K
Sbjct  1233  DRAVAKGQTVDDLLRRSAGIPASFMALFLAEPDGTPKKLLPRALQWLIEFAKTSLSNFQK  1292

Query  2863  ensscsesss--AIDST-----MVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANL  3021
             +++  SE+     +DS      +   V +   +SK+RDEGVVPTVHAFNVL+AAFNDANL
Sbjct  1293  DHNQKSEAMKDCIVDSCESQSGITTSVHSNGNLSKSRDEGVVPTVHAFNVLRAAFNDANL  1352

Query  3022  ATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGL  3201
             A DTSGF AEA IV++ +FSS YWEVRN+ACLAYTALVRRM+GFLNVQKRESAR      
Sbjct  1353  AADTSGFCAEATIVAVHAFSSPYWEVRNAACLAYTALVRRMVGFLNVQKRESAR------  1406

Query  3202  EFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPIT  3381
                 RYP LH FL +ELK+ATEL  +G S NL S++AK +HPSLCP+LILLSRLKP+PI+
Sbjct  1407  ----RYPALHPFLSSELKVATELLADGVSCNLESHIAKAIHPSLCPILILLSRLKPTPIS  1462

Query  3382  SETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDN  3561
               T DP DPFL +PFI+KC+ Q+N R+R+LASRAL G+VSNE+L  V+ +I  +LP    
Sbjct  1463  CATDDPLDPFLLLPFIQKCATQSNYRVRVLASRALIGLVSNERLQHVVGDILDDLPCGGR  1522

Query  3562  HSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSW  3741
                T +     + ++SFNSIHG+LLQL SLLD N R L D +KK+ IL  L+ VL K SW
Sbjct  1523  KVSTHN-----SQSSSFNSIHGLLLQLFSLLDRNFRGLTDSNKKDQILGQLVEVLSKCSW  1577

Query  3742  IGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPA  3921
             +G  + C CP+++ S+L+VLD ML +ART + SK   VI  LL  LSS+ L+  TS   A
Sbjct  1578  LGCCKLCACPVVSTSYLRVLDQMLDVARTGK-SKHTDVIRTLLLQLSSQSLNNVTSTHHA  1636

Query  3922  YFDPTIAELRKQAASSYFNC-AYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQ  4098
             + DPT  E ++QA +SYF+C       D   E+ + L+     +    E+   +S+T   
Sbjct  1637  FHDPTQIEFQQQAVASYFSCVGIPKGHDETAEEDVRLQILDQSTSSMSETPCAVSLTELH  1696

Query  4099  ERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQ  4278
             + ++  L+D +Y+VRI  LK +L  + S   R+ +S N     I   W +   L +++M+
Sbjct  1697  KEIMSCLADPIYDVRITVLKRILQLVKS--IRSGDSKN-----ILHQW-ARASLHSVIME  1748

Query  4279  LLAVEKNHKCMNYILKIIYTYNMQ-QYNKNCGQHEKPTFVGNMDSDSVLQFWDKVVSLYK  4455
              L+VE++ KC+ Y L+II+++N++ Q+N               D ++ L  WD++V L  
Sbjct  1749  RLSVEEHPKCLYYSLRIIFSWNVECQFN------------NGEDCNTFLSIWDRLVLLNS  1796

Query  4456  VTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDP-----SKLSVFSEC  4620
                HAKTRE+++CCM +C+K+ A L    +   G +   +   S       ++LS     
Sbjct  1797  TVSHAKTREIILCCMGMCMKQFAKLMRDGVLPEGLKTSELSTSSGSIHKGNNRLSAAIIS  1856

Query  4621  IDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGNKQKDALH  4800
              D FV ++++ S  SE +N R+AAA++I+ASGLL++A  +   VSN  +P  ++Q +  H
Sbjct  1857  TDLFVSLVKKQSAPSETVNSRRAAAEAIIASGLLEEANFVKARVSNTYIP--SEQDNECH  1914

Query  4801  ---------------LYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHF  4935
                            LYA KILDLWF C++LLEDED  LR++L+ +VQK I +G SG+  
Sbjct  1915  LEEKCLKASPGEFASLYACKILDLWFICIQLLEDEDVHLRQKLANDVQKIIGNG-SGNKL  1973

Query  4936  SSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDK  5115
                  P+QV++VI +SFE ++  FGHWL Y+++L   V    N+    S  D VR++FDK
Sbjct  1974  CDDSTPLQVDRVIALSFEFITCLFGHWLKYVEYLLRMVLDTANT--LDSDGDLVRQIFDK  2031

Query  5116  EIDNHHEEKLLISQICCSHLEKLPVS--KLTTEFRDNNICSVLQSWRRRFCQQLISFGNA  5289
             EIDNHHEEKLLI QI CS+++KL  S  +L T  R     ++LQ+WR RF  QL S  + 
Sbjct  2032  EIDNHHEEKLLICQISCSNIQKLVRSGHQLATSGRSE---ALLQNWRERFLHQLTSLTSG  2088

Query  5290  YIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALS-NCILRGEAEDS-KSMVPELLELGE  5463
             Y+  +G  DWIGG+GNHKD F  VY NLL  +AL+ +  L  +AED  +S + E  +L  
Sbjct  2089  YLEKEGKTDWIGGIGNHKDVFASVYANLLGLYALTESSWLPEQAEDRHESYLREFSDLEG  2148

Query  5464  AIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
              I PFL+NPLISNL++LV +SH+            +  G  +A + FDPYFL R
Sbjct  2149  FIAPFLKNPLISNLYLLVKRSHKPEE---------DQGGGSAASENFDPYFLLR  2193



>gb|EMS47786.1| Thyroid adenoma-associated protein-like protein [Triticum urartu]
Length=2159

 Score =  1722 bits (4460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1000/1918 (52%), Positives = 1299/1918 (68%), Gaps = 141/1918 (7%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTA+ R  LN+  + SN              S+ T+LYDGIL ELC  CE+P D HFN
Sbjct  340   GILTAIPRKALNVRQLHSN-------------GSLWTVLYDGILPELCMHCENPIDRHFN  386

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV QICLQQIKTS+          Y P S +V  RVLKI+W+NLEDPLSQTVKQVH
Sbjct  387   FHALTVTQICLQQIKTSVLADFTDFSGDYKPFSRDVVNRVLKIIWSNLEDPLSQTVKQVH  446

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDL LDI+  L   + S K    L  IA+DLL LGPRCKGRYIPLASLT+RLGAKS+L
Sbjct  447   LIFDLLLDIESCLPSEDQSVKL--VLCDIANDLLRLGPRCKGRYIPLASLTRRLGAKSLL  504

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              +   LL +T  AY+DDDVC AAT+FLKCFLE LRDE W+ DGVE GY  +R  CL P++
Sbjct  505   SLKSNLLLETAYAYIDDDVCCAATSFLKCFLENLRDECWNEDGVEQGYDAFRGLCLPPLM  564

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL SG +KLRSNLNTYA+P ++E+D DSIF MLGFI +G SA++ ++        D+ L
Sbjct  565   RGLVSGNSKLRSNLNTYAVPTVIEVDTDSIFAMLGFISVGPSADANKL--------DVPL  616

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
               +Q +A LVSLLKVSR LAL+EGDI     S   LE  D   + G    ++ VKGI V+
Sbjct  617   KSDQCIAALVSLLKVSRNLALVEGDIHM--DSDELLEQED---NKGAV--IISVKGIAVR  669

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +P N+ +LALTH D++LRIDAAESLF+NPKT+SLPSSLELSL++ AVPLNMRC STAFQM
Sbjct  670   VPANWFVLALTHSDETLRIDAAESLFLNPKTSSLPSSLELSLLKLAVPLNMRCSSTAFQM  729

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHP---SLIKCLSGSPLNGEADQSLKHRAENLFNF  1431
             KWA LFRKFF+RVRTAL+R +KQG+W P   S++K     P++   D +++ RAE+LF F
Sbjct  730   KWAGLFRKFFARVRTALDRQLKQGSWLPSPNSIVK--EARPVDTVMDTTVQ-RAEDLFQF  786

Query  1432  MKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGL  1611
             MKWL  FLF SCYPSAPYERK +AMEL+LIM++VW +   +GK+D       ++PY+  +
Sbjct  787   MKWLGSFLFNSCYPSAPYERKTIAMELILIMVDVWPIRRSEGKTD-------VHPYNDSI  839

Query  1612  ILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRV  1791
              LP+ST+  VGSIIDSWD+LRE+SFRILL FPTP+PGIS    + + I WAK+LV SPRV
Sbjct  840   TLPDSTISFVGSIIDSWDKLRENSFRILLQFPTPLPGISQSASINDVIRWAKELVLSPRV  899

Query  1792  RESDAGALTFRLIFRKYVLELGWVVRVS-CNVVTQSPSGLSNGENLEFTPSSPVIEYITS  1968
             RESDAGALTFRLIFRKYVLELG V+  S  N   Q  +  ++G+       +PV +YI+S
Sbjct  900   RESDAGALTFRLIFRKYVLELGCVIVFSEENDCLQCYTKSTDGDTEVIASQNPVAQYISS  959

Query  1969  LIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissikllleki  2148
             LI WLC  VEEGE+DL EACK+SFVHGVLLTLRYTF+E+ W+S A+ S +S ++ L+ K+
Sbjct  960   LIQWLCTVVEEGERDLCEACKRSFVHGVLLTLRYTFDELHWNSAAIQSCLSEMRSLVGKL  1019

Query  2149  lalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAE  2328
             L L+MRITSLALWVVS+DAWY+P +M++M  DG+ FL   I+ D   +      K AK+ 
Sbjct  1020  LQLIMRITSLALWVVSSDAWYMPYDMDDMIDDGS-FLLDIIDEDQPDTALATTEKNAKSG  1078

Query  2329  QDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPT-SDVPKSCSQITDGTDQLS-SDIV  2502
              +  P + ++MVGCWLAMKEVSLL GTI+RK+PLP  S    S + ++D T+Q + S  V
Sbjct  1079  NNGKPAEHVIMVGCWLAMKEVSLLFGTIVRKIPLPVCSHSNSSQNSLSDNTEQTNMSGEV  1138

Query  2503  LDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLM  2682
             LD+ QLE++G+HFL+VLLKMKHNGAIDKTRAG TALCNRLLCSND RLCK+TESWM  LM
Sbjct  1139  LDVEQLEMMGDHFLQVLLKMKHNGAIDKTRAGLTALCNRLLCSNDSRLCKMTESWMVLLM  1198

Query  2683  ERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknk  2862
             +R V+KGQTVDDLLRRSAGIPA+F A FL+EPEG PK+LLP+AL+WLI  AK SL++  K
Sbjct  1199  DRAVAKGQTVDDLLRRSAGIPASFMALFLAEPEGTPKKLLPRALQWLIEFAKTSLSNFQK  1258

Query  2863  ensscsesssAI-------DSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANL  3021
             +++  SE+            S +   V +   +SK+RDEGVVPTVHAFNVL+AAFNDANL
Sbjct  1259  DHNQKSEAMKDCIVDSCESQSGITTSVHSNGNLSKSRDEGVVPTVHAFNVLRAAFNDANL  1318

Query  3022  ATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGL  3201
             A DTSGF AEA IV++ +FSS YWEVRN+ACLAYTALVRRM+GFLNVQKRESAR      
Sbjct  1319  AADTSGFCAEATIVAVHAFSSPYWEVRNAACLAYTALVRRMVGFLNVQKRESAR------  1372

Query  3202  EFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPIT  3381
                 RYP LH FL +ELK+ATEL  +G S NL S++AK +HPSLCP+LILLSRLKPSPI+
Sbjct  1373  ----RYPALHPFLSSELKVATELLADGVSGNLESHIAKAIHPSLCPILILLSRLKPSPIS  1428

Query  3382  SETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDN  3561
               T DP DPFL +PFI+KC+ Q+N R+R+LASRAL G+VSNE+L  V+ +I  +LP    
Sbjct  1429  CATDDPLDPFLLLPFIQKCATQSNYRVRVLASRALIGLVSNERLQHVVGDILDDLPCGGR  1488

Query  3562  HSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSW  3741
                T++         SFN+IHG+LLQL SLLD+N R L D +KK+ IL  LI VL K SW
Sbjct  1489  KVSTNNSQSF-----SFNTIHGLLLQLFSLLDSNFRGLTDSNKKDQILGQLIEVLSKCSW  1543

Query  3742  IGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPA  3921
             +G  + C CP+++ S+L+VLD ML  AR  + SK   VI  LL  LSS+ L+  TS   A
Sbjct  1544  LGCHKLCACPVVSTSYLRVLDQMLDAARAGK-SKHTDVIRTLLLQLSSQSLNNVTSTHHA  1602

Query  3922  YFDPTIAELRKQAASSYFNCAY--QTSKDVNEEDLIYLRGPPPDSELFKESET--QMSVT  4089
             + DPT  E ++Q  +SYF+C    +   +  EED   +R    D      SET   +S+T
Sbjct  1603  FHDPTQIEFQQQTVASYFSCVGIPKGHDETAEED---VRSQILDQSTSSMSETPCAVSLT  1659

Query  4090  RFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAM  4269
                + ++  L+D +Y+VRI  LK +L  + S   R+ +S N     I   W +   L ++
Sbjct  1660  ELHKEIMSCLADPIYDVRITALKRILQLVKS--IRSGDSKN-----ILHQW-ARASLHSV  1711

Query  4270  LMQLLAVEKNHKCMNYILKIIYTYNMQ-QYNKNCGQHEKPTFVGNMDSDSVLQFWDKVVS  4446
             +M+ L+VE++ KC+ Y L+II+++N++ Q+N               D ++ L  WD++V 
Sbjct  1712  IMERLSVEEHPKCLYYSLRIIFSWNVECQFN------------NGEDCNTFLSIWDRLVH  1759

Query  4447  LYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNP----SDPSKLSVFS  4614
             L     HAKTRE+++CCM +C+K+ A L    +   G +   +          ++LS   
Sbjct  1760  LNSTVSHAKTREIILCCMGMCMKQFAKLMRDGVLPEGFKTSELSTSFGSIHKGNRLSAAI  1819

Query  4615  ECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGNKQKDA  4794
                D FV ++++ S  SE +N R+AAA++I+ASGLL++A  +   VSN  +P  ++Q + 
Sbjct  1820  ISTDLFVSLVKKQSAPSETVNSRRAAAEAIIASGLLEEANYVKACVSNAYIP--SEQDNE  1877

Query  4795  LH---------------LYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGS  4929
              H               LYA KILDLWF C++LLEDED  LR++L+ +VQK I +G SG+
Sbjct  1878  CHLEEKCLKASAGEFVSLYACKILDLWFICIQLLEDEDVHLRQKLANDVQKIIGNG-SGN  1936

Query  4930  HFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVF  5109
                    P+QV++VI +SFE ++  FGHWL Y+++L   V    N+    S  D VR++F
Sbjct  1937  KLCDDSTPLQVDRVIALSFEFITCLFGHWLKYVEYLLRMVLDTANT--LDSDGDLVRQIF  1994

Query  5110  DKEIDNHHEEKLLISQICCSHLEKLPVS--KLTTEFRDNNICSVLQSWRRRFCQQLISFG  5283
             DKEIDNHHEEKLLI QI CS+++KL  S  +L T  R     ++LQ+WR RF  QL S  
Sbjct  1995  DKEIDNHHEEKLLICQISCSNIQKLVRSGHQLATSGRSE---ALLQNWRDRFLHQLTSLT  2051

Query  5284  NAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCIL---RGEAEDS-KSMVPELL  5451
             + Y+  +G  DWIGG+GNHKD F  VY NLL  +AL+       + E ED  KS + E  
Sbjct  2052  SGYLEKEGKTDWIGGIGNHKDVFASVYANLLGLYALTESRWLSEQAELEDRHKSYLQEFS  2111

Query  5452  ELGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             +L   I PFL+NPLISNL++LV +SHE+           + +G  +A ++FDPYFL R
Sbjct  2112  DLEGFITPFLKNPLISNLYLLVKRSHER----------EDQAGGSAASESFDPYFLLR  2159



>ref|XP_002445127.1| hypothetical protein SORBIDRAFT_07g004530 [Sorghum bicolor]
 gb|EES14622.1| hypothetical protein SORBIDRAFT_07g004530 [Sorghum bicolor]
Length=2121

 Score =  1718 bits (4449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 990/1916 (52%), Positives = 1270/1916 (66%), Gaps = 153/1916 (8%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILT++ RTVLN+  + S+               + TILYDGIL ELC  CE+P DSHFN
Sbjct  318   GILTSIPRTVLNMRQLHSS-------------GPLWTILYDGILPELCKHCENPVDSHFN  364

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV QICLQQIKTS+          Y P S +V  R+L I+W NLEDPLSQTVKQVH
Sbjct  365   FHALTVTQICLQQIKTSISSDFTDFSGDYKPFSRDVVNRILGIIWRNLEDPLSQTVKQVH  424

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDL LDI+  +   +       FL  IA+DLL LGPRCKGRY+PLASLTKRLGAKS+L
Sbjct  425   LIFDLLLDIELCIASEDHEHNNKLFLCNIANDLLRLGPRCKGRYVPLASLTKRLGAKSLL  484

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              +   LL +T  AY+DDDVC AATTFLK FLE LR E W+ DGVE GY  +R  CL P +
Sbjct  485   ILKSYLLSETAYAYIDDDVCCAATTFLKSFLETLRGECWNDDGVELGYDAFRDLCLPPFM  544

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL SG +KLRSNLNTYALP L+E+D +SIF MLGFI IG S + T++        D+VL
Sbjct  545   RGLVSGNSKLRSNLNTYALPALIEVDAESIFTMLGFISIGPSTKETKL--------DVVL  596

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGV---CDSVVHVKGI  1071
               +Q +A LVSLLKVSR LAL+EGDID        L+  +LS    +     +V+ +KGI
Sbjct  597   KNDQCIAALVSLLKVSRNLALVEGDID--------LDPDELSQPQQMDSKGAAVISIKGI  648

Query  1072  EVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTA  1251
             +V +PVN+  LALTH D+SLRIDAAESLF+NPKT+SLPSSLELSL+++AVPLNMRC STA
Sbjct  649   KVTVPVNWFALALTHSDESLRIDAAESLFLNPKTSSLPSSLELSLLKEAVPLNMRCSSTA  708

Query  1252  FQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNF  1431
             FQMKW SLFRKFF+RVRTAL+R +KQG+W PSL   +  +     ++ ++  RAE+LF F
Sbjct  709   FQMKWTSLFRKFFARVRTALDRQVKQGSWIPSLTSSVKAADSIDTSEATVVKRAEDLFRF  768

Query  1432  MKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGL  1611
             MKWLS FLF SCYPS PYERK +AM+L+L +L+VW +   +GK       I LYPY+  +
Sbjct  769   MKWLSSFLFNSCYPSGPYERKTIAMKLILTLLDVWPICRSEGK-------IDLYPYNDSI  821

Query  1612  ILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRV  1791
             ILP ST+  VGSIIDSWDRLRE+SFRILL FPTP+PGIS    + + I WAKKLV SPRV
Sbjct  822   ILPVSTISFVGSIIDSWDRLRENSFRILLQFPTPLPGISLSTSINDVIRWAKKLVLSPRV  881

Query  1792  RESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSL  1971
             RESDA                         VVT                 +PV +YI+SL
Sbjct  882   RESDA-------------------------VVTSQ---------------NPVAQYISSL  901

Query  1972  IDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekil  2151
             I WLC  VEEGE+DLSEACKKSFVHGVLLTLRYTF+EMDW+S  V S IS ++ L+EK+L
Sbjct  902   IQWLCIVVEEGERDLSEACKKSFVHGVLLTLRYTFDEMDWNSEVVQSCISEMRCLVEKLL  961

Query  2152  alVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQ  2331
              L+MR+TS+ALWVVS+DA  LP +M+++  DG+  L    E D  AS  ++     K   
Sbjct  962   QLIMRVTSVALWVVSSDALCLPYDMDDVIDDGS-LLSDIHEEDQPASEREEN---TKPGS  1017

Query  2332  DDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLP-TSDVPKSCSQITDGTDQLSSDIVLD  2508
             +  P +Q+VMVGCWLAMKEVSLL GTIIRK+PLP  S    S + + D T+   S+ +LD
Sbjct  1018  NGKPAEQVVMVGCWLAMKEVSLLFGTIIRKIPLPGCSHSASSQNGLPDSTETSMSEEILD  1077

Query  2509  LRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMER  2688
             + QL+++G+HFL+VLLKMKHNGAIDKTRAGFTALCNRLLCSND RLCK+TESWM  LM+R
Sbjct  1078  VGQLKMMGDHFLQVLLKMKHNGAIDKTRAGFTALCNRLLCSNDSRLCKMTESWMVLLMDR  1137

Query  2689  TVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknken  2868
             T++KGQTVDDL+RRSAGIPAAF A FL+EPEG PK+LLP+AL WLI  AK SL +  K++
Sbjct  1138  TIAKGQTVDDLIRRSAGIPAAFIALFLAEPEGTPKKLLPRALEWLIEFAKNSLANFQKDS  1197

Query  2869  sscsesss-------AIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLAT  3027
             +  S              S     V +   +SK RDEGVVPTVH FNVL+AAFNDANLAT
Sbjct  1198  NQRSGVMKDGLGELLESQSETTISVHSNGNLSKGRDEGVVPTVHVFNVLRAAFNDANLAT  1257

Query  3028  DTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEF  3207
             DTSGFSA+A +V+IR+FSS YWEVRN+ACLAYTALVRRM+GFLNVQKRESARR+LTGLEF
Sbjct  1258  DTSGFSADATMVAIRAFSSPYWEVRNAACLAYTALVRRMVGFLNVQKRESARRSLTGLEF  1317

Query  3208  FHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSE  3387
             FHRYP LH FL +EL+ ATE   +G S NL S++ K +HPSLCP+LILLSRLKPSPI+  
Sbjct  1318  FHRYPALHPFLSSELQTATEQLADGVSSNLESHITKAIHPSLCPILILLSRLKPSPISCG  1377

Query  3388  TGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHS  3567
             T D  DPFL + FI++C+ Q+N R+RILASRALTG+VSNE+L  V+ +I   LP  ++ +
Sbjct  1378  TDDSLDPFLLLHFIQRCATQSNYRVRILASRALTGLVSNERLQYVVSDILDSLPHGNHKA  1437

Query  3568  MT-----SDLSGLSN-------LNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSD  3711
             M      SD +  +N       L+ SFNSIHG+LLQL+SLLD N R L D S K+ I+  
Sbjct  1438  MVHSVQHSDAAVSANMGNGNVLLSKSFNSIHGLLLQLASLLDNNFRCLTDGSTKDQIIGL  1497

Query  3712  LIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSEC  3891
             L+ VL + SW+G  + C CP++  S+L+VLD ML +AR  + S+   VI  LL  LSS+C
Sbjct  1498  LLEVLSRCSWLGCTKLCSCPVVITSYLRVLDLMLDVARIGK-SRHTEVIQALLLELSSQC  1556

Query  3892  LDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSK--DVNEEDLIYLRGPPPDSELFKE  4065
             L    S + A+ DPT  EL++QA  S+ +C   + K  + N+ED+       P SE+ +E
Sbjct  1557  LSNTVSSQYAFHDPTRIELKQQATESFLSCVGLSKKNNETNDEDVQLQILGEPTSEMPRE  1616

Query  4066  SETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWL  4245
                  S+    + ++  L+D  Y+VRI  LK +L    S     AE+       I   W 
Sbjct  1617  ---DYSLHELHKEIMSCLTDPSYDVRITVLKRILWLTKSIRHGDAEN-------ILHQW-  1665

Query  4246  SNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPTFVGNMDSDSVLQ  4425
             + + LQ  LM+ L VE++ KC+ Y LKII+++NM ++  N G+          DS ++L 
Sbjct  1666  AGVNLQPALMERLFVEEHPKCLYYNLKIIFSWNM-EFPFNNGE----------DSSTLLS  1714

Query  4426  FWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSI---CSLGNE-KVVVVNPSDP  4593
              WD++V L     HAKTRE+++CCM +C+K    L    +   C   +E     V  ++ 
Sbjct  1715  LWDRLVHLNSTMSHAKTREIVLCCMGMCMKLFTKLSRGGVSMDCLKTSEISASFVRINEG  1774

Query  4594  SKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPD  4773
             ++LS     ++ FV +++  S+ SE +N R+AAA++IVASGLL++A  ++ SVSN   P+
Sbjct  1775  NRLSDVMLRVNLFVTLVKNQSEPSESVNARRAAAEAIVASGLLEEANYVASSVSNMYSPE  1834

Query  4774  GN----KQK-------DALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGK  4920
              +    K+K       + + LYA KILDLWF C++LLEDED  LR++L+ ++QK I  G 
Sbjct  1835  FDEGPIKEKCMEASVFEFISLYACKILDLWFVCIQLLEDEDAYLRQKLAKDIQKIIAKG-  1893

Query  4921  SGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVR  5100
             S + F     P+QV++VIE+S ++L+S FGHWL Y++FL   V    N+    S  D VR
Sbjct  1894  SANTFCDDSTPLQVDRVIELSLDYLTSLFGHWLKYIEFLLRVVLDTGNALN--SRGDLVR  1951

Query  5101  RVFDKEIDNHHEEKLLISQICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLISF  5280
             ++FDKEIDNHHEEKLLI QICCS+++KL  SK   E         LQ WR  F  QL S 
Sbjct  1952  QIFDKEIDNHHEEKLLICQICCSNIQKLLHSKCQMEAGAKTKL-FLQDWRETFLNQLTSL  2010

Query  5281  GNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSM-VPELLEL  5457
                Y+  +G  +WIGG+GNHKD F+ VY  LL  +AL+      + ED++++ + E   L
Sbjct  2011  TGGYLEKEGKNNWIGGIGNHKDVFISVYAVLLGLYALTQSGSLEQLEDNRAIYLQEFSNL  2070

Query  5458  GEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
                I PFL+NPLISNL+ LV  SHE+          +  SG+     +FDPYFL R
Sbjct  2071  EGFITPFLKNPLISNLYGLVKLSHERFRSSDKPEDQVGNSGS-----SFDPYFLIR  2121



>ref|XP_006659168.1| PREDICTED: thyroid adenoma-associated protein homolog [Oryza 
brachyantha]
Length=2125

 Score =  1715 bits (4441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 987/1928 (51%), Positives = 1262/1928 (65%), Gaps = 173/1928 (9%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTA+ RTVLN+  + SN              S+ TILYDGIL ELC  CE+P DSHFN
Sbjct  318   GILTAIPRTVLNMCQLHSN-------------GSLWTILYDGILPELCKHCENPVDSHFN  364

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV QICLQQIKTS+          Y P+S +   R+L+I+W+NLEDPLSQTVKQVH
Sbjct  365   FHALTVTQICLQQIKTSILTDSTDFSGDYKPLSTDAINRILRIIWSNLEDPLSQTVKQVH  424

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDL LDI+  +   E  E    FL  IASDLL LGPRCKGRYIPLASLTKRLGAKS+L
Sbjct  425   LIFDLLLDIESCIPAGEPEENSKLFLFNIASDLLCLGPRCKGRYIPLASLTKRLGAKSLL  484

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              +   LL +T  AY+DDDVC AAT+FLKCFLE LRDE W  DGV+ GY  +R  CL P+L
Sbjct  485   RLKSNLLLETAYAYIDDDVCCAATSFLKCFLETLRDECWKDDGVQKGYDAFRFLCLPPLL  544

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL SG +KLRSN+NTYALP ++E+D DSIF MLGFI +G SA++ ++        D+ L
Sbjct  545   QGLVSGNSKLRSNVNTYALPAVIEVDADSIFAMLGFINVGPSAKAIKL--------DVYL  596

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGV-CDSVVHVKGIEV  1077
               +Q +A LVSLLKVSR LAL+EGDID        L+  +LS  A   C +V+ ++GI V
Sbjct  597   KNDQCIAALVSLLKVSRNLALVEGDID--------LDPDELSQQAANNCAAVISIRGINV  648

Query  1078  KIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQ  1257
              +PV + +LALTH ++SLRIDAAESLF+NPKT+SLPSSLELSL+++AVPLNMRC STAFQ
Sbjct  649   TVPVKWFVLALTHNEESLRIDAAESLFLNPKTSSLPSSLELSLLKEAVPLNMRCSSTAFQ  708

Query  1258  MKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQ---SLKHRAENLFN  1428
             MKW SLFRKFF+RVRTAL+R +KQG W PS     SG   +   D    +   RAE+LF 
Sbjct  709   MKWTSLFRKFFARVRTALDRQVKQGLWLPS-----SGDKDSNSVDTFKATTSQRAEHLFQ  763

Query  1429  FMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKG  1608
             FMKWLS FLF SCYPS PYER+ +AMEL+L +L+VW +   +GK+D       LYPYS  
Sbjct  764   FMKWLSSFLFNSCYPSGPYERRTIAMELILTLLDVWPICRFEGKND-------LYPYSDS  816

Query  1609  LILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPR  1788
             + LP+ST+  VGSIIDSWD+LRE+SFRILL FPTP+PGISS   +   I WAKKLV SPR
Sbjct  817   ITLPDSTVSFVGSIIDSWDKLRENSFRILLQFPTPLPGISSSTSINSVIRWAKKLVLSPR  876

Query  1789  VRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITS  1968
             VRESDA                                        E T  +PV +YI S
Sbjct  877   VRESDA----------------------------------------EATCQNPVAQYIAS  896

Query  1969  LIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissikllleki  2148
             LI WLCA VEEGEKDLSEACKKSFVHG+LLTLRYTF+++DW++  V S I+ ++ L+EK+
Sbjct  897   LIQWLCAVVEEGEKDLSEACKKSFVHGILLTLRYTFDDLDWNTDIVQSCIAEMRCLVEKL  956

Query  2149  lalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAE  2328
             L L+MR+TSLALWVVS+DAWY+P ++++M  D + FL   I+ D   +    E  I K+ 
Sbjct  957   LQLIMRVTSLALWVVSSDAWYMPYDVDDMIDDDS-FLSEIIDEDQPGALEIAETNI-KSG  1014

Query  2329  QDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPT---SDVPKS-CSQITDGTDQLSSD  2496
              +  P + +VMVGCWLAMKEVSLL GTIIRK+PLP    S+ P    +  T+ TD  SS 
Sbjct  1015  NNSKPAEHVVMVGCWLAMKEVSLLFGTIIRKIPLPGCSHSNSPHGDLAGNTEETD--SSG  1072

Query  2497  IVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQ  2676
              +LD+ QLE +GNHFL+VLLKMKHNGAIDKTRAG TALCNRLLCSND RLCK+TESWM  
Sbjct  1073  DILDVEQLEKMGNHFLQVLLKMKHNGAIDKTRAGLTALCNRLLCSNDSRLCKMTESWMVL  1132

Query  2677  LMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDk  2856
             LM+RTV+KGQTVDDLLRRSAGIPAAF A FL+EPEG PK+LLP+AL WLI  AK SL + 
Sbjct  1133  LMDRTVAKGQTVDDLLRRSAGIPAAFIALFLAEPEGTPKKLLPRALEWLIEFAKTSLVNF  1192

Query  2857  nkensscsesss-------AIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDA  3015
              K+ +   ++          + S     V +   +SK+R+EG+VPTVH FNVL+AAFNDA
Sbjct  1193  QKDCNQKLQTVEYFPGEPCQLQSGTTAGVHSNGNLSKSRNEGIVPTVHVFNVLRAAFNDA  1252

Query  3016  NLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALT  3195
             NLATDTSGF AEA IV+I +FSS YWEVRN+ACLAYTALVRRM+GFLNV KRESARR+LT
Sbjct  1253  NLATDTSGFCAEATIVAIHAFSSPYWEVRNAACLAYTALVRRMVGFLNVHKRESARRSLT  1312

Query  3196  GLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSP  3375
             GLEFFHRYP LH FL +ELK+ATEL  +G S NL S +AK +HPSLCP+LILLSRLKPSP
Sbjct  1313  GLEFFHRYPALHPFLLSELKVATELLADGHSSNLESQIAKAIHPSLCPILILLSRLKPSP  1372

Query  3376  ITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELP--  3549
             I+  T D  DPFL +PFI++C+ Q+N R+R+LASRAL G+VSNE+L  V+ +I   LP  
Sbjct  1373  ISCVTDDSLDPFLLLPFIQRCATQSNYRVRVLASRALVGLVSNERLQYVVGDILHNLPCG  1432

Query  3550  --------AIDNHSMTSDLSGLSNLNA-----SFNSIHGMLLQLSSLLDTNCRNLADFSK  3690
                     A+ +    S   G  NL       SFNSIHG+LLQLSSLLD N R L D +K
Sbjct  1433  SHEVAAHRALCSDPFLSADMGNGNLTLPAKSFSFNSIHGLLLQLSSLLDNNFRALMDSTK  1492

Query  3691  KEDILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLL  3870
             K+ I S LI  L K SW+G    C CP+++ S+L+VLD ML +AR  + S  +  I  LL
Sbjct  1493  KDQIFSQLIEFLSKCSWLGCINLCTCPVVSTSYLRVLDLMLDVARIGK-SGHMEAIQTLL  1551

Query  3871  WTLSSECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAY------QTSKDVNEEDLIYLR  4032
               LS +CL+  T    A+ DPT  ELR+QA +SYF+C        +T+ + ++  +++  
Sbjct  1552  LELSYQCLNNRTLTHYAFHDPTQIELRQQATASYFSCVGLPKRHDETTDEDDQSQILH--  1609

Query  4033  GPPPDSELFKESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSN  4212
                  +    E   ++S+    + +   L D +Y+VRI  LK +L        + A+S+ 
Sbjct  1610  ----TTSSITEMPHKVSIYELHKEITSCLVDPVYDVRITVLKRIL--------QLAKSTR  1657

Query  4213  KSQSEIKLLWLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQ-QYNKNCGQHEKPT  4389
                ++  L   +   LQ ++++ +  E++ KC+ Y LKII+++NM+ Q+N          
Sbjct  1658  SGDNKKVLHQWAKANLQPVILKRIFEEEHPKCLYYNLKIIFSWNMECQFN----------  1707

Query  4390  FVGNMDSDSVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSIC---SLGN  4560
                  DS + L FWD++V L     HAKTRE ++CCMA+C+++ A L    I        
Sbjct  1708  --FGEDSSTFLSFWDRLVHLNSTMSHAKTRETILCCMAMCLRQFAKLLRGVILLDPKTQE  1765

Query  4561  EKVVVVNPSDPSKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQAL  4740
                  V   +   L+        FV +++  S  SE +N R+AAA++IVASGLL++A   
Sbjct  1766  HSTSFVRIDEGKNLASAILSASSFVSLVKNQSAPSETVNARRAAAEAIVASGLLEEANVF  1825

Query  4741  SPSVSNHQVPDGNKQK------------DALHLYAHKILDLWFTCMKLLEDEDDGLRKQL  4884
             +PS+SN  +   + +             + + LYA KILDLWF C++LLEDED  LR+ L
Sbjct  1826  APSLSNAYLSSEHDESHIEERYSNANVGEFISLYACKILDLWFVCIQLLEDEDTYLRQNL  1885

Query  4885  SLEVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATN  5064
             S  VQK I  G S ++      P+QV++VIE+SFE+L+S  GHWL Y+++L   V    N
Sbjct  1886  SNNVQKIIAKG-SANNLCDDSTPLQVDRVIELSFEYLTSLLGHWLKYIEYLLSLVLDTAN  1944

Query  5065  SACAVSIADPVRRVFDKEIDNHHEEKLLISQICCSHLEKLPVSKLTTEFRDNNICSVLQS  5244
             +    S  D VR++FDKEIDNHHEEKLLI QICCS ++KL  SK   E R   +   LQ+
Sbjct  1945  T--FNSRGDLVRQIFDKEIDNHHEEKLLICQICCSSIQKLLQSKYQVE-RATEVELFLQN  2001

Query  5245  WRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAED  5424
             WR  F +QL+S  + ++  +G  DWIGG+GNHKD F+ VY NLL  +AL+      + +D
Sbjct  2002  WRESFLRQLVSLTSGFLEKEGKTDWIGGIGNHKDVFISVYANLLGLYALAQSQSLEQLKD  2061

Query  5425  SKSMVPELL-ELGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDA  5601
              + M  + + +L   + PFLRNPLISNL+ LV KSH+            E     SA ++
Sbjct  2062  RQQMYFKCISDLDGVMTPFLRNPLISNLYSLVKKSHQMFNSPNKP----EDQVGSSAPES  2117

Query  5602  FDPYFLFR  5625
             FDPYFL R
Sbjct  2118  FDPYFLIR  2125



>emb|CBI22195.3| unnamed protein product [Vitis vinifera]
Length=1789

 Score =  1702 bits (4408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 886/1427 (62%), Positives = 1070/1427 (75%), Gaps = 65/1427 (5%)
 Frame = +1

Query  1393  QSLKHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPP-QGKSDS  1569
             +++  RAE+LF+FMKWLS FLFFSCYPSAPYERKIMAMEL+LIMLNVW ++PP QGK  +
Sbjct  367   EAVVSRAEDLFHFMKWLSSFLFFSCYPSAPYERKIMAMELILIMLNVWTVIPPSQGKCGA  426

Query  1570  YSSEISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCE  1749
              S E  +YPY+KG  LP+STLLLVGSIIDSWDRLRE+SFRILLHFPTP+PGISS E+V E
Sbjct  427   ISPESCVYPYNKGFTLPDSTLLLVGSIIDSWDRLRENSFRILLHFPTPLPGISSEEMVKE  486

Query  1750  AIIWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLE  1929
              IIWAKKL+CSPRVRESDAGAL  RLIFRKYVLELG+                       
Sbjct  487   VIIWAKKLICSPRVRESDAGALALRLIFRKYVLELGF-----------------------  523

Query  1930  FTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVA  2109
                  PVIEYI SLIDWL  AVEEGEKDLSEAC+ SFVHG+LLTLRYTFEE+DW+S  V 
Sbjct  524   -----PVIEYIKSLIDWLHVAVEEGEKDLSEACRNSFVHGILLTLRYTFEELDWNSNVVL  578

Query  2110  snissiklllekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSA  2289
              +IS ++ +LEK+L LV+RITSLALWVVSADAWYLP++M++M  D    +E P +MDV  
Sbjct  579   FSISEMRHVLEKLLELVVRITSLALWVVSADAWYLPEDMDDMVDDDTFLVEVPTDMDVPT  638

Query  2290  STPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPT---SDVPKSCS  2460
             S+ + + K +K  QD  P +QIVMVGCWLAMKEVSLLLGTIIRK+PLP+   SD  K+  
Sbjct  639   SSSEHDAKTSKLVQDIRPPEQIVMVGCWLAMKEVSLLLGTIIRKIPLPSNIPSDKSKAGD  698

Query  2461  QITDGTD---QLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCS  2631
                D +D     +SD++LDL+QLE IG HFLEVLLKMKHNGAIDKTRAGFTALCNRLLCS
Sbjct  699   HFADASDVPSMTTSDVMLDLKQLETIGKHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCS  758

Query  2632  NDPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKA  2811
             NDPRLC+LTE+WMEQLME+T +KGQ VDDLLRRSAGIPAAF A FLSEPEG PK+LLP +
Sbjct  759   NDPRLCRLTENWMEQLMEKTTAKGQIVDDLLRRSAGIPAAFMALFLSEPEGTPKKLLPHS  818

Query  2812  LRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAA---IEM-----ISKTRDEGVV  2967
             LRWLI+VA +SL D  + NS+ S+   ++ +      AA   +EM      SKTRDEGV+
Sbjct  819   LRWLIDVASQSLLDPTEANSTTSDLCKSLSTKSTQATAAALQLEMDVSQKASKTRDEGVI  878

Query  2968  PTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMI  3147
             PTVHAFNVL+AAFND NLATDTSGFSAEALI+SIRSFSS YWEVRNSACLAYTALVRRMI
Sbjct  879   PTVHAFNVLRAAFNDTNLATDTSGFSAEALIISIRSFSSPYWEVRNSACLAYTALVRRMI  938

Query  3148  GFLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHP  3327
             GFLNVQKRESARRALTGLEFFHRYP+LH FLFNELK+AT+L  + SSE+  SNLAKVVHP
Sbjct  939   GFLNVQKRESARRALTGLEFFHRYPSLHPFLFNELKVATDLLTDVSSEHSESNLAKVVHP  998

Query  3328  SLCPMLILLSRLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNE  3507
             SLCPMLILLSRLKPS ITSETGD  DPFLFMPFIR+CS Q+NLR+++LASRALTG+VSNE
Sbjct  999   SLCPMLILLSRLKPSTITSETGDALDPFLFMPFIRRCSTQSNLRVQVLASRALTGLVSNE  1058

Query  3508  KLPTVILNIASELPAI-----DNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRN  3672
             KLP V+L IASELP       D  S + + S  ++L +SFNSIHGMLLQLSSLLDTNCRN
Sbjct  1059  KLPVVLLAIASELPCTKEQMKDTRSSSFNTSNGTHL-SSFNSIHGMLLQLSSLLDTNCRN  1117

Query  3673  LADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCIS  3852
             LADFSKK+ IL DLI +L   SWIGSP+ CPCPILN SFL+VLD MLSIAR C+M K   
Sbjct  1118  LADFSKKDQILGDLIQILVMCSWIGSPRLCPCPILNGSFLRVLDQMLSIARICQMGKNFG  1177

Query  3853  VIWNLLWTLSSECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDL-IYL  4029
             +I N LW LSSECLD+ +S +P+Y+DPT  EL KQAA SYF C  Q SK+  EE   I  
Sbjct  1178  IICNFLWELSSECLDIESSHKPSYYDPTAVELYKQAAVSYFGCVLQASKEEGEEVFQISH  1237

Query  4030  RGPPPDSELFKESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESS  4209
             R  PP S L +  +   +  +  ERL+ S+S   YEVR AT+KWLL FL S  S   ES+
Sbjct  1238  RFSPPTSNLVQTPKMDSTFAKLPERLVLSMSSPSYEVRHATMKWLLQFLKSTGS-VRESN  1296

Query  4210  NKSQSEIKLL--WLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEK  4383
             ++S   + ++  W +   LQA LM+LL VE +HKC NYIL+I++T+N+ Q+ K   Q   
Sbjct  1297  DQSSDGVMIIHKW-AKTNLQATLMKLLTVENHHKCTNYILRILFTWNLLQFQKLSDQKCP  1355

Query  4384  PTF-VGNMDSDSVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGN  4560
              T  +G M+ DSV QFW+K+VSLY++ RH KTRE L+CCM +C+KR A LFTS + S   
Sbjct  1356  ETINIGGMNCDSVFQFWNKLVSLYELARHTKTREALICCMGICVKRFAGLFTSYVLSEVE  1415

Query  4561  EKVVV-VNPSDPSKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQA  4737
             +K  +    ++  K +   ECI+YFV +I++ S ASEP+NMRKAAA+S+V SGLL+QA+ 
Sbjct  1416  KKNAIDCKTNELEKWTHLYECINYFVSLIKQLSAASEPVNMRKAAAESMVVSGLLEQAEL  1475

Query  4738  LSPSVSNHQVPDGNKQ-----KDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQK  4902
             +  SV  + +P  + +      +A++++A +ILD+WFTC++LLEDED GLR+ LS++VQK
Sbjct  1476  IGSSVVCNYMPSESPRSCFEPNEAINMFADEILDIWFTCIRLLEDEDVGLRQSLSMDVQK  1535

Query  4903  CITSGKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVS  5082
             C  S + G  F + VVP QVEKVIE  FE LS  FGHW+ Y D+L  WV SA    C VS
Sbjct  1536  CFASNRFGKGFLACVVPSQVEKVIESCFEFLSLVFGHWIGYFDYLMRWVYSA--GTCVVS  1593

Query  5083  IADPVRRVFDKEIDNHHEEKLLISQICCSHLEKLPVSKLTTEFRDNN-ICSVLQSWRRRF  5259
               D VR VFDKEIDNHHEEKLLI QICCSHLEKL VSK      D   +   LQ WR RF
Sbjct  1594  GGDLVRHVFDKEIDNHHEEKLLICQICCSHLEKLLVSKPLVNLYDKAWLNEFLQHWRMRF  1653

Query  5260  CQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCI-LRGEAEDSKSM  5436
             CQQL+SF N ++  Q GV W+GGVGNHKDAFLP+Y N+L FHALSNC+ +RG   D  S+
Sbjct  1654  CQQLVSFANDHVRKQRGVSWVGGVGNHKDAFLPLYANMLGFHALSNCVFIRGGITDGGSL  1713

Query  5437  VPELLELGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEIS  5577
             + +++++GE I PFLRNPLI NL++LVVKSHE++       ++ ++S
Sbjct  1714  LSDVVKVGETIDPFLRNPLIQNLYLLVVKSHERMVSAISPSVLYQLS  1760



>dbj|BAC99561.1| putative death receptor interacting protein [Oryza sativa Japonica 
Group]
 dbj|BAD05700.1| putative death receptor interacting protein [Oryza sativa Japonica 
Group]
Length=2118

 Score =  1696 bits (4393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 977/1918 (51%), Positives = 1256/1918 (65%), Gaps = 160/1918 (8%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTA+ RTVLN+  + SN              S+ T+LY+GIL ELC  CE+P DSHFN
Sbjct  318   GILTAIPRTVLNMRQLHSN-------------GSLWTMLYNGILPELCKHCENPIDSHFN  364

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV QICLQQIKTS+          Y+P S +V  R+L+I+W+NLEDPLSQTVKQVH
Sbjct  365   FHALTVTQICLQQIKTSVLADFTDFSGDYEPFSRDVINRILRIIWSNLEDPLSQTVKQVH  424

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDL LDI+  +   +  E    FL  IASDLL L                        
Sbjct  425   LIFDLLLDIESCIPSGDPEENSKLFLFNIASDLLRLA-----------------------  461

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
                         AY+DDDVC AAT+FLKCFLE LRDE W  DG+E GY  +R  CL P+L
Sbjct  462   -----------YAYMDDDVCCAATSFLKCFLETLRDECWKDDGIEQGYDAFRFLCLPPLL  510

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL SG +KLRSNLNTYALP  +E+D DSIF MLGFI +G SA++ E+        D+ L
Sbjct  511   RGLVSGNSKLRSNLNTYALPAAIEVDADSIFAMLGFINVGPSAKAIEL--------DVAL  562

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTD-AGVCDSVVHVKGIEV  1077
               +Q +A LVSLLKVSR LAL+EGDID        L+   LS   A  CD+V+ ++GI V
Sbjct  563   KNDQCIAALVSLLKVSRNLALVEGDID--------LDPDVLSQQVANKCDAVISIRGINV  614

Query  1078  KIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQ  1257
              +PV + +LALTH ++SLRIDAAESLF+NPKT+SLPS+LELSL+++AVPLNMRC STAFQ
Sbjct  615   TVPVKWFVLALTHNEESLRIDAAESLFLNPKTSSLPSALELSLLKQAVPLNMRCSSTAFQ  674

Query  1258  MKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQ---SLKHRAENLFN  1428
             MKW SLFRKFF+RVRTAL+R +KQG W PS    LSG   +   D    +   RAE+LF 
Sbjct  675   MKWTSLFRKFFARVRTALDRQVKQGLWLPS---SLSGDKDSNSVDTVKATTIKRAEDLFQ  731

Query  1429  FMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKG  1608
             FMKWLS FLF SCYPS PYER+ +AMEL+L +L+VW +   +GK+D       LYPYS  
Sbjct  732   FMKWLSSFLFNSCYPSGPYERRTIAMELILTLLDVWPICRSEGKND-------LYPYSDS  784

Query  1609  LILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPR  1788
             + LP+ST+  VGSIIDSWDRLRE+SFRILL FPTP+PGISS   +   I WAKKLV SPR
Sbjct  785   ITLPDSTISFVGSIIDSWDRLRENSFRILLQFPTPLPGISSSTSIDSVIRWAKKLVLSPR  844

Query  1789  VRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITS  1968
             VRESDAGALTFRLIFRKYVLE G V+  S           S  ++ E T  +PV +YI+S
Sbjct  845   VRESDAGALTFRLIFRKYVLEFGCVLVFSKENDCLQCYTKSTNDDTELTSQNPVAQYISS  904

Query  1969  LIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissikllleki  2148
             LI WLCA VEEGEKDLSEACKKSFVHGVLLTLRYTF+E+DW++  V S I+ ++ L+EK+
Sbjct  905   LIQWLCAVVEEGEKDLSEACKKSFVHGVLLTLRYTFDELDWNTEVVQSCIAEMRCLVEKL  964

Query  2149  lalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAE  2328
             L L+MR+TSLALWVVS+DAWY+P ++++M  D + FL   I+ D   +  +      K+ 
Sbjct  965   LQLIMRVTSLALWVVSSDAWYMPYDVDDMIDDDS-FLSDIIDEDQPGTASEIAETNVKSG  1023

Query  2329  QDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLP-TSDVPKSCSQITDGTDQ--LSSDI  2499
              +  P + +VMVGCWLAMKEVSLL GTIIRK+PLP  S    S   + + T++  ++ DI
Sbjct  1024  HNGKPAEHVVMVGCWLAMKEVSLLFGTIIRKIPLPGCSHSNSSHGDLAENTEETGMTGDI  1083

Query  2500  VLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQL  2679
              LD+ QLE +GNHFL+VLLKMKHNGAIDKTRAG TALCNRLLCSND RLCK+TESWME L
Sbjct  1084  -LDVEQLEKMGNHFLQVLLKMKHNGAIDKTRAGLTALCNRLLCSNDSRLCKMTESWMELL  1142

Query  2680  MERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDkn  2859
             M+RTV+KGQTVDDLLRRSAGIPAAF A FL+EPEG PK+LLP+AL WLI  AK SL +  
Sbjct  1143  MDRTVAKGQTVDDLLRRSAGIPAAFIALFLAEPEGTPKKLLPRALEWLIEFAKTSLANFQ  1202

Query  2860  kensscsesssAI-------DSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDAN  3018
              +++   ++            S     V +   +SK+R+EGVVPTVH FNVL+AAFNDAN
Sbjct  1203  NDSNQKLDTEKDFLGEPCESQSETTAGVHSNGNLSKSRNEGVVPTVHVFNVLRAAFNDAN  1262

Query  3019  LATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTG  3198
             LATDTSGF AEA IV+I +FSS YWEVRN+ACLAYTALVRRM+GFLNV KRESAR     
Sbjct  1263  LATDTSGFCAEATIVAIHAFSSPYWEVRNAACLAYTALVRRMVGFLNVHKRESAR-----  1317

Query  3199  LEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPI  3378
                  RYP LH FL +EL +AT L  +G S NL S +AK +HPSLCP+LILLSRLKPSPI
Sbjct  1318  -----RYPALHPFLLSELNVATGLLADGISSNLGSQIAKAIHPSLCPILILLSRLKPSPI  1372

Query  3379  TSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAID  3558
             +  T D  DPFL +PFI++C+ Q+N R+R+LASRAL G+VSNE+L  V+ +I   LP   
Sbjct  1373  SRGTDDSLDPFLLLPFIQRCATQSNYRVRVLASRALIGLVSNERLQHVVGDILHNLPCA-  1431

Query  3559  NHSMTSDLS-------GLSNLNA-----SFNSIHGMLLQLSSLLDTNCRNLADFSKKEDI  3702
             +H +T+  +       G  NL       SFNSIHG+LLQLSSLLD N R L D +KK+ I
Sbjct  1432  SHEVTAHRALCLSADMGNGNLTLPAKSFSFNSIHGLLLQLSSLLDNNFRALTDSTKKDQI  1491

Query  3703  LSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLS  3882
             LS LI  L K SW+GS + C CP+++ S+L+VLD ML +ART + S     I  LLW LS
Sbjct  1492  LSQLIEALSKCSWLGSVKLCACPVVSTSYLRVLDLMLDVARTGK-SGHTDAIQILLWELS  1550

Query  3883  SECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAY--QTSKDVNEEDLIYLRGPPPDSEL  4056
              +CL+  TS   A+ DPT  ELR+QAA+SYF+C    +   + N+E+ + L+     S +
Sbjct  1551  YQCLNNGTSTHYAFHDPTQIELRQQAAASYFSCVGLPKRHDETNDEN-VQLQILDMTSSI  1609

Query  4057  FKESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKL  4236
               E   ++S+    + +   L D  Y+VRI  LK +L        + A+S+    S+  L
Sbjct  1610  -PEMPREVSLYELHKEIASCLVDPAYDVRITALKRIL--------QLAKSARSGDSKKFL  1660

Query  4237  LWLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQ-QYNKNCGQHEKPTFVGNMDSD  4413
                +   LQ ++++ +  E++ KC+ Y LKII+++NM+ Q+N               DS 
Sbjct  1661  HQWAKSNLQHVILKRIFEEEHPKCLYYNLKIIFSWNMECQFN------------SEEDSS  1708

Query  4414  SVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDP  4593
             + L FWD++V L     HAKTRE ++CCM +C+++ A +    + S  +E        D 
Sbjct  1709  TFLSFWDRLVHLNSTVSHAKTRETILCCMGMCMRQFAKMLRGLLDSKTHEHSTSFVRIDE  1768

Query  4594  SK-LSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVP  4770
              K LS        FV +++  S  SE +N R+AAA++I+ASGLL++A   +PS+SN  +P
Sbjct  1769  GKNLSTAILSASSFVNLVKNLSAPSETVNARRAAAEAIIASGLLEEANLFAPSLSNAYLP  1828

Query  4771  DGNKQK------------DALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITS  4914
               + +             + ++LY+ KILDLWF C++LLEDED  LR++L+  VQK I  
Sbjct  1829  SEHDENHIEEKCSNATVSELINLYSCKILDLWFICIQLLEDEDTYLRQKLANNVQKIIAK  1888

Query  4915  GKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADP  5094
             G S ++      P+QV++VIE+SFE+L+S  GHWL Y ++L   V    N+    S  D 
Sbjct  1889  G-SANNLCDDSTPLQVDRVIELSFEYLTSLLGHWLKYTEYLLRLVLDTANT--LNSRGDL  1945

Query  5095  VRRVFDKEIDNHHEEKLLISQICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLI  5274
             +R++FDKEIDNHHEEKLLI QICCS ++KL  SK   E     +   LQ+WR  F  QLI
Sbjct  1946  IRQIFDKEIDNHHEEKLLICQICCSSIQKLLQSKYLVE-TGAEVELFLQNWRESFLHQLI  2004

Query  5275  SFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKS-MVPELL  5451
             S  ++++  +G  DWIGG+GNHKD F+ VY NLL  +AL+      + +D  +  +    
Sbjct  2005  SLTSSFLEKEGKTDWIGGIGNHKDVFISVYANLLGLYALAQSQSLEQLKDRHTEYLKNFS  2064

Query  5452  ELGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             +L   I PFL+NPLISNL+ LV +SHE       +    +  G+ SA ++FDPYFL R
Sbjct  2065  DLDGVITPFLKNPLISNLYSLVKESHETFNSPKKQ---WDQVGS-SATESFDPYFLIR  2118



>gb|AAO72654.1| unknown [Oryza sativa Japonica Group]
Length=2123

 Score =  1691 bits (4380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 984/1918 (51%), Positives = 1258/1918 (66%), Gaps = 155/1918 (8%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTA+ RTVLN+  + SN              S+ T+LY+GIL ELC  CE+P DSHFN
Sbjct  318   GILTAIPRTVLNMRQLHSN-------------GSLWTMLYNGILPELCKHCENPIDSHFN  364

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTV QICLQQIKTS+          Y+P S +V  R+L+I+W+NLEDPLSQTVKQVH
Sbjct  365   FHALTVTQICLQQIKTSVLADFTDFSGDYEPFSRDVINRILRIIWSNLEDPLSQTVKQVH  424

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDL LDI+  +   +  E    FL  IASDLL LGPRCKGRYIPLASLTKRLGAKS+L
Sbjct  425   LIFDLLLDIESCIPSGDPEENSKLFLFNIASDLLRLGPRCKGRYIPLASLTKRLGAKSLL  484

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              +   LL +T  AY+DDDVC AAT+FLKCFLE LRDE W  DG+E GY  +R  CL P+L
Sbjct  485   KLKSNLLLETAYAYMDDDVCCAATSFLKCFLETLRDECWKDDGIEQGYDAFRFLCLPPLL  544

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL SG +KLRSNLNTYALP  +E+D DSIF MLGFI +G SA++ E+        D+ L
Sbjct  545   RGLVSGNSKLRSNLNTYALPAAIEVDADSIFAMLGFINVGPSAKAIEL--------DVAL  596

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTD-AGVCDSVVHVKGIEV  1077
               +Q +A LVSLLKVSR LAL+EGDID        L+   LS   A  CD+V+ ++GI V
Sbjct  597   KNDQCIAALVSLLKVSRNLALVEGDID--------LDPDVLSQQVANKCDAVISIRGINV  648

Query  1078  KIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQ  1257
              +PV + +LALTH ++SLRIDAAESLF+NPKT+SLPS+LELSL+++AVPLNMRC STAFQ
Sbjct  649   TVPVKWFVLALTHNEESLRIDAAESLFLNPKTSSLPSALELSLLKQAVPLNMRCSSTAFQ  708

Query  1258  MKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQ---SLKHRAENLFN  1428
             MKW SLFRKFF+RVRTAL+R +KQG W PS    LSG   +   D    +   RAE+LF 
Sbjct  709   MKWTSLFRKFFARVRTALDRQVKQGLWLPS---SLSGDKDSNSVDTVKATTIKRAEDLFQ  765

Query  1429  FMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKG  1608
             FMKWLS FLF SCYPS PYER+ +AMEL+L +L+VW +   +GK+D       LYPYS  
Sbjct  766   FMKWLSSFLFNSCYPSGPYERRTIAMELILTLLDVWPICRSEGKND-------LYPYSDS  818

Query  1609  LILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPR  1788
             + LP+ST+  VGSIIDSWDRLRE+SFRILL FPTP PGISS   +   I WAKKLV SPR
Sbjct  819   ITLPDSTISFVGSIIDSWDRLRENSFRILLQFPTPXPGISSSTSIDSVIRWAKKLVLSPR  878

Query  1789  VRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYI-T  1965
             VRESDA                                        E T   P    I  
Sbjct  879   VRESDA----------------------------------------ELTSXKPSCXNIFH  898

Query  1966  SLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllek  2145
              L  WL A VE GEKDLSEACKKSFVHGVLLTLRYTF+E+DW++  V S I+ ++ L+EK
Sbjct  899   HLFSWLXAVVEXGEKDLSEACKKSFVHGVLLTLRYTFDELDWNTEVVQSCIAEMRCLVEK  958

Query  2146  ilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKA  2325
             +L L+MR+TSLALWVVS+DAWY+P ++++M  D + FL   I+ D   +  +      K+
Sbjct  959   LLQLIMRVTSLALWVVSSDAWYMPYDVDDMIDDDS-FLSDIIDEDQPGTASEIAETNVKS  1017

Query  2326  EQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLP-TSDVPKSCSQITDGTDQ--LSSD  2496
               +  P + +VMVGCWLAMKEVSLL GTIIRK+PLP  S    S   + + T++  ++ D
Sbjct  1018  GHNGKPAEHVVMVGCWLAMKEVSLLFGTIIRKIPLPGCSHSNSSHGDLAENTEETGMTGD  1077

Query  2497  IVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQ  2676
             I LD+ QLE +GNHFL+VLLKMKHNGAIDKTRAG TALCNRLLCSND RLCK+TESWME 
Sbjct  1078  I-LDVEQLEKMGNHFLQVLLKMKHNGAIDKTRAGLTALCNRLLCSNDSRLCKMTESWMEL  1136

Query  2677  LMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDk  2856
             LM+RTV+KGQTVDDLLRRSAGIPAA  A FL+EPEG PK+LLP+AL WLI  AK SL + 
Sbjct  1137  LMDRTVAKGQTVDDLLRRSAGIPAAXXALFLAEPEGTPKKLLPRALEWLIEFAKTSLANF  1196

Query  2857  nkensscsesssAI-------DSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDA  3015
               +++   ++            S     V +   +SK+R+EGVVPTVH FNVL+AAFNDA
Sbjct  1197  QNDSNQKLDTEKDFLGEPCESQSETTAGVHSNGNLSKSRNEGVVPTVHVFNVLRAAFNDA  1256

Query  3016  NLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALT  3195
             NLATDTSGF AEA IV+I +FSS YWEVRN+ACLAYTALVRRM+GFLNV KRESARR+LT
Sbjct  1257  NLATDTSGFCAEATIVAIHAFSSPYWEVRNAACLAYTALVRRMVGFLNVHKRESARRSLT  1316

Query  3196  GLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSP  3375
             GLEFFHRYP LH FL +EL +AT L  +G S NL S +AK +HPSLCP+LILLSRLKPSP
Sbjct  1317  GLEFFHRYPALHPFLLSELNVATGLLADGISSNLGSQIAKAIHPSLCPILILLSRLKPSP  1376

Query  3376  ITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAI  3555
             I+  T D  DPF  +PFI++C+ Q+N R+R+LASRAL G+VSNE+L  V+ +I   LP  
Sbjct  1377  ISRGTDDSLDPFWLLPFIQRCATQSNYRVRVLASRALIGLVSNERLQHVVGDILHNLPCA  1436

Query  3556  DNHSMTSDLS-------GLSNLNA-----SFNSIHGMLLQLSSLLDTNCRNLADFSKKED  3699
              +H +T+  +       G  NL       SFNSIHG+LLQLSSLLD N R L D +KK+ 
Sbjct  1437  -SHEVTAHRALCLSADMGNGNLTLPAKSFSFNSIHGLLLQLSSLLDNNFRALTDSTKKDQ  1495

Query  3700  ILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTL  3879
             ILS LI  L K SW+GS + C CP+++ S+L+VLD ML +ART + S     I  LLW L
Sbjct  1496  ILSQLIEALSKCSWLGSVKLCACPVVSTSYLRVLDLMLDVARTGK-SGHTDAIQILLWEL  1554

Query  3880  SSECLDLYTSKRPAYFDPTIAELRKQAASSYFNC-AYQTSKDVNEEDLIYLRGPPPDSEL  4056
             S +CL+  TS   A+ DPT  ELR+QAA+SYF+C       D   ++ + L+     S +
Sbjct  1555  SYQCLNNGTSTHYAFHDPTQIELRQQAAASYFSCVGLPKRHDETNDENVQLQILDMTSSI  1614

Query  4057  FKESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKL  4236
               E   ++S+    + +   L D  Y+VRI  LK +L        + A+S+    S+  L
Sbjct  1615  -PEMPREVSLYELHKEIASCLVDPAYDVRITALKRIL--------QLAKSARSGDSKKFL  1665

Query  4237  LWLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQ-QYNKNCGQHEKPTFVGNMDSD  4413
                +   LQ ++++ +  E++ KC+ Y LKII+++NM+ Q+N               DS 
Sbjct  1666  HQWAKSNLQHVILKRIFEEEHPKCLYYNLKIIFSWNMECQFN------------SEEDSS  1713

Query  4414  SVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDP  4593
             + L FWD++V L     HAKTRE ++CCM +C+++ A +    + S  +E        D 
Sbjct  1714  TFLSFWDRLVHLNSTVSHAKTRETILCCMGMCMRQFAKMLRGLLDSKTHEHSTSFVRIDE  1773

Query  4594  SK-LSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVP  4770
              K LS        FV +++  S  SE +N R+AAA++I+ASGLL++A   +PS+SN  +P
Sbjct  1774  GKNLSTAILSASSFVNLVKNLSAPSETVNARRAAAEAIIASGLLEEANLFAPSLSNAYLP  1833

Query  4771  DGNKQK------------DALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITS  4914
               + +             + ++LY+ KILDLWF C++LLEDED  LR++L+  VQK I  
Sbjct  1834  SEHDENHIEEKCSNATVSELINLYSCKILDLWFICIQLLEDEDTYLRQKLANNVQKIIAK  1893

Query  4915  GKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADP  5094
             G S ++      P+QV++VIE+SFE+L+S  GHWL Y ++L   V    N+    S  D 
Sbjct  1894  G-SANNLCDDSTPLQVDRVIELSFEYLTSLLGHWLKYTEYLLRLVLDTANT--LNSRGDL  1950

Query  5095  VRRVFDKEIDNHHEEKLLISQICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLI  5274
             +R++FDKEIDNHHEEKLLI QICCS ++KL  SK   E     +   LQ+WR  F  QLI
Sbjct  1951  IRQIFDKEIDNHHEEKLLICQICCSSIQKLLQSKYLVE-TGAEVELFLQNWRESFLHQLI  2009

Query  5275  SFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKS-MVPELL  5451
             S  ++++  +G  DWIGG+GNHKD F+ VY NLL  +AL+      + +D  +  +    
Sbjct  2010  SLTSSFLEKEGKTDWIGGIGNHKDVFISVYANLLGLYALAQSQSLEQLKDRHTEYLKNFS  2069

Query  5452  ELGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             +L   I PFL+NPLISNL+ LV +SHE       +    +  G+ SA ++FDPYFL R
Sbjct  2070  DLDGVITPFLKNPLISNLYSLVKESHETFNSPKKQ---WDQVGS-SATESFDPYFLIR  2123



>gb|KHG16676.1| Thyroid adenoma-associated protein [Gossypium arboreum]
Length=1602

 Score =  1673 bits (4332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 889/1487 (60%), Positives = 1084/1487 (73%), Gaps = 45/1487 (3%)
 Frame = +1

Query  1264  WASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPL-NGEADQSLKHRAENLFNFMKW  1440
             W SLFRKFFSRVRTALER  KQG+W P +   +S   L  G  D ++  RAE LFNFM+W
Sbjct  128   WHSLFRKFFSRVRTALERQFKQGSWQPRMNNEISELCLCQGNEDNTVS-RAEELFNFMRW  186

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSS-EISLYPYSKGLIL  1617
             LSCFLFFSCYPSAPY+RKIMAMEL+ IM+NVW +LP   +S +  S E  LYPYS G+  
Sbjct  187   LSCFLFFSCYPSAPYKRKIMAMELIQIMINVWPVLPSSQESSASMSPESCLYPYSVGITS  246

Query  1618  PESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRE  1797
             PEST LLVGSIIDSWDRLRESSFRILLHFPTP+PGISS E+V + I WAKKLVCSPRVRE
Sbjct  247   PESTFLLVGSIIDSWDRLRESSFRILLHFPTPLPGISSDEMVQKVITWAKKLVCSPRVRE  306

Query  1798  SDAGALTFRLIFRKYVLELGWVVRVS----CNVVTQSPSGLSNGENLEFTPSSPVIEYIT  1965
             SDAGALT RL+FRKYVL+LGW VRVS    C+    SP    NG+  +     PV+EY+ 
Sbjct  307   SDAGALTLRLLFRKYVLDLGWRVRVSVSVVCSHSQNSPL---NGDYHKCPAIHPVMEYVK  363

Query  1966  SLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllek  2145
             SLI WL  AVEEGEKDL+EACK SFVHGVLL LRYTFEE+DW+S AV  +IS ++  LEK
Sbjct  364   SLIHWLDVAVEEGEKDLAEACKNSFVHGVLLALRYTFEELDWNSDAVLCSISDMRHALEK  423

Query  2146  ilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKA  2325
             +L LV+RITS+ALWVVSADAWYLP+++++M    A  L+ P EMD +  +   E K  K+
Sbjct  424   LLELVVRITSMALWVVSADAWYLPEDIDDMVDADAFLLDGPDEMDAALPSIKQEDKCTKS  483

Query  2326  EQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDI--  2499
              QD  P DQ+VMVGCWLAMKE+SLLLGTIIRK+PLP+     S        D + + +  
Sbjct  484   IQDARPSDQVVMVGCWLAMKELSLLLGTIIRKIPLPSYSCSGSMESGHPSYDSIDASVTA  543

Query  2500  ----VLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESW  2667
                 +LDL+QLE IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDP LCKLTESW
Sbjct  544   ISEGMLDLKQLEKIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPMLCKLTESW  603

Query  2668  MEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSL  2847
             MEQLM+RTV+KGQTVDDLLRRSAGIPAAFTA FL+EPEGAPK+LL +ALRWLI+VAK SL
Sbjct  604   MEQLMDRTVAKGQTVDDLLRRSAGIPAAFTALFLAEPEGAPKKLLLRALRWLIDVAKGSL  663

Query  2848  TDknke-------nsscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAF  3006
                ++          S ++S    DST+V +  A    SK RDEGVVPTVHAFNVL+AAF
Sbjct  664   LSPSETNCTNVSCQISSTKSDQETDSTLVTETIATVKTSKIRDEGVVPTVHAFNVLRAAF  723

Query  3007  NDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARR  3186
             ND NLA+DTSGF+AEALIVSIRSFSS YWE+RNSACLAYT+LVRRMIGFLNV KRESARR
Sbjct  724   NDTNLASDTSGFAAEALIVSIRSFSSPYWEIRNSACLAYTSLVRRMIGFLNVHKRESARR  783

Query  3187  ALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLK  3366
             ALTGLEFFHRYP LH F+FNELKIATEL  +  S    SNLAK VHPSLCPMLILLSRLK
Sbjct  784   ALTGLEFFHRYPLLHPFVFNELKIATELLGDALSGQTESNLAKAVHPSLCPMLILLSRLK  843

Query  3367  PSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASEL  3546
             PSPI SETGD  DPFLFMPFI KCS Q+NLR+RILASRALTG+VSNEKLPTV+LNIASEL
Sbjct  844   PSPIASETGDDLDPFLFMPFIMKCSTQSNLRVRILASRALTGLVSNEKLPTVLLNIASEL  903

Query  3547  PAIDNHSMTSDLS---GLSN--LNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSD  3711
             P  +N   +   S    L+N   + S+N IHG+LLQL SL+  NCRNLADFS+K+ IL D
Sbjct  904   PQAENQIASPVASIPLYLANGAHHVSYNLIHGLLLQLGSLVHVNCRNLADFSRKDQILGD  963

Query  3712  LIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSEC  3891
             L+ VL   SW  SP++CPCP+LNC+FL+VLD+MLS+A++C +SK +  I NLL  LS+EC
Sbjct  964   LMKVLAMCSWFASPKRCPCPLLNCTFLQVLDHMLSVAKSCHLSKNLFAIRNLLLELSTEC  1023

Query  3892  LDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESE  4071
             LD+  S    Y+DPTIAELR+QAASSYF+C +Q S +V EE     +  P +S LF+  E
Sbjct  1024  LDVEASYGFQYYDPTIAELRQQAASSYFSCLFQPSDEVGEEVFQIPKRSPLNSMLFQTHE  1083

Query  4072  TQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSN  4251
              + S   F ERLIRS SD+ YEVR+ TLKWL  FL S         + S + I   W + 
Sbjct  1084  VENS--GFLERLIRSFSDSSYEVRLVTLKWLHKFLKSRPGNEINYLSSSDTRIIQNW-TK  1140

Query  4252  IGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPT-FVGNMDSDSVLQF  4428
               LQ  LM+LL +EKNH+CM +IL+II+T+N+ ++ +   +    T +VG +D DSVLQ 
Sbjct  1141  ANLQPTLMKLLELEKNHRCMYHILRIIFTWNLLKFQELSEEKSDGTLYVGALDCDSVLQL  1200

Query  4429  WDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSV  4608
             WD+++SL K+TRHAKT+E+L+CC+A+C+++   LF+    +   +K    N S   + S 
Sbjct  1201  WDRLISLLKLTRHAKTQEILICCLAICVRQFIRLFSCFTLTDKGQKTAGYNESGQMERSA  1260

Query  4609  -FSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGN--  4779
              F ECI ++V +I+E S +SEP+NMRKAAA+S+ ASGLL+QA+ ++ SV N Q+   N  
Sbjct  1261  FFYECITFYVNLIKERSSSSEPVNMRKAAAESMFASGLLEQAEVIASSVINQQISSKNSF  1320

Query  4780  ---KQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVV  4950
                K +DA   YAH+IL++WFTC+KLLEDEDDG+R++ + ++QK ++   SG+   +   
Sbjct  1321  SCFKHQDAASTYAHQILEMWFTCIKLLEDEDDGIRQRAATDIQKFLSPKSSGTTSDTRGA  1380

Query  4951  PIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNH  5130
               QVEKVIE+SF+ LSS FGHW+ Y D L  WV  A N    +S  D VRRVFDKEIDNH
Sbjct  1381  RTQVEKVIELSFDRLSSIFGHWIVYFDCLLRWVLDAGNY--VISKGDLVRRVFDKEIDNH  1438

Query  5131  HEEKLLISQICCSHLEKLPVSK--LTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQ  5304
             HEEKLLISQICCSHLEKLP++K      F +  + + L  WR RF QQL+SF   +IG +
Sbjct  1439  HEEKLLISQICCSHLEKLPITKSWAGKSFDNEEVRNYLLDWRSRFFQQLVSFAKDHIG-K  1497

Query  5305  GGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEAIQPFLR  5484
              GVDWIGGVGNHKDAFLP+Y NLL F+A+SN I   E  D   ++ ++ ELG+AI PFL 
Sbjct  1498  LGVDWIGGVGNHKDAFLPLYANLLGFYAVSNFIFNLETIDGMHLLSDMSELGKAINPFLW  1557

Query  5485  NPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             NPLIS+L+ L+ + H+   G     +          WD FD +FL R
Sbjct  1558  NPLISSLYSLIDRLHDNKFGATTNCINARFGDGI--WDNFDRFFLLR  1602


 Score =   170 bits (431),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 102/139 (73%), Gaps = 1/139 (1%)
 Frame = +1

Query  28   VLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFNFHALTVMQI  207
            VLN  FVV  +  + + + GN   S KTILYDGIL ELCN+CE+PTDSHFNFHALTVM+I
Sbjct  2    VLNTHFVVYRETCNEIESHGNVACSGKTILYDGILPELCNYCENPTDSHFNFHALTVMKI  61

Query  208  CLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVHLIFDLFLDI  387
            CLQQIKT M        E Y P+ E++ T++LKI+WNNLEDPLSQTVKQVHLIFDLFLDI
Sbjct  62   CLQQIKTCMLANLTVASENYIPLLEDMETKMLKIIWNNLEDPLSQTVKQVHLIFDLFLDI  121

Query  388  QGTL-HWAEGSEKFCSFLR  441
            Q +L  W     KF S +R
Sbjct  122  QSSLCGWHSLFRKFFSRVR  140



>gb|KHG16677.1| Thyroid adenoma-associated protein [Gossypium arboreum]
Length=1447

 Score =  1632 bits (4227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 865/1448 (60%), Positives = 1057/1448 (73%), Gaps = 44/1448 (3%)
 Frame = +1

Query  1378  NGEADQSLKHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQG  1557
              G  D ++  RAE LFNFM+WLSCFLFFSCYPSAPY+RKIMAMEL+ IM+NVW +LP   
Sbjct  12    QGNEDNTVS-RAEELFNFMRWLSCFLFFSCYPSAPYKRKIMAMELIQIMINVWPVLPSSQ  70

Query  1558  KSDSYSS-EISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSP  1734
             +S +  S E  LYPYS G+  PEST LLVGSIIDSWDRLRESSFRILLHFPTP+PGISS 
Sbjct  71    ESSASMSPESCLYPYSVGITSPESTFLLVGSIIDSWDRLRESSFRILLHFPTPLPGISSD  130

Query  1735  ELVCEAIIWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVS----CNVVTQSPS  1902
             E+V + I WAKKLVCSPRVRESDAGALT RL+FRKYVL+LGW VRVS    C+    SP 
Sbjct  131   EMVQKVITWAKKLVCSPRVRESDAGALTLRLLFRKYVLDLGWRVRVSVSVVCSHSQNSPL  190

Query  1903  GLSNGENLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEE  2082
                NG+  +     PV+EY+ SLI WL  AVEEGEKDL+EACK SFVHGVLL LRYTFEE
Sbjct  191   ---NGDYHKCPAIHPVMEYVKSLIHWLDVAVEEGEKDLAEACKNSFVHGVLLALRYTFEE  247

Query  2083  MDWDSIAVAsnissiklllekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLE  2262
             +DW+S AV  +IS ++  LEK+L LV+RITS+ALWVVSADAWYLP+++++M    A  L+
Sbjct  248   LDWNSDAVLCSISDMRHALEKLLELVVRITSMALWVVSADAWYLPEDIDDMVDADAFLLD  307

Query  2263  RPIEMDVSASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSD  2442
              P EMD +  +   E K  K+ QD  P DQ+VMVGCWLAMKE+SLLLGTIIRK+PLP+  
Sbjct  308   GPDEMDAALPSIKQEDKCTKSIQDARPSDQVVMVGCWLAMKELSLLLGTIIRKIPLPSYS  367

Query  2443  VPKSCSQITDGTDQLSSDI------VLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFT  2604
                S        D + + +      +LDL+QLE IGNHFLEVLLKMKHNGAIDKTRAGFT
Sbjct  368   CSGSMESGHPSYDSIDASVTAISEGMLDLKQLEKIGNHFLEVLLKMKHNGAIDKTRAGFT  427

Query  2605  ALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEG  2784
             ALCNRLLCSNDP LCKLTESWMEQLM+RTV+KGQTVDDLLRRSAGIPAAFTA FL+EPEG
Sbjct  428   ALCNRLLCSNDPMLCKLTESWMEQLMDRTVAKGQTVDDLLRRSAGIPAAFTALFLAEPEG  487

Query  2785  APKRLLPKALRWLINVAKKSLTDknke-------nsscsesssAIDSTMVPDVAAIEMIS  2943
             APK+LL +ALRWLI+VAK SL   ++          S ++S    DST+V +  A    S
Sbjct  488   APKKLLLRALRWLIDVAKGSLLSPSETNCTNVSCQISSTKSDQETDSTLVTETIATVKTS  547

Query  2944  KTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAY  3123
             K RDEGVVPTVHAFNVL+AAFND NLA+DTSGF+AEALIVSIRSFSS YWE+RNSACLAY
Sbjct  548   KIRDEGVVPTVHAFNVLRAAFNDTNLASDTSGFAAEALIVSIRSFSSPYWEIRNSACLAY  607

Query  3124  TALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTS  3303
             T+LVRRMIGFLNV KRESARRALTGLEFFHRYP LH F+FNELKIATEL  +  S    S
Sbjct  608   TSLVRRMIGFLNVHKRESARRALTGLEFFHRYPLLHPFVFNELKIATELLGDALSGQTES  667

Query  3304  NLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRA  3483
             NLAK VHPSLCPMLILLSRLKPSPI SETGD  DPFLFMPFI KCS Q+NLR+RILASRA
Sbjct  668   NLAKAVHPSLCPMLILLSRLKPSPIASETGDDLDPFLFMPFIMKCSTQSNLRVRILASRA  727

Query  3484  LTGMVSNEKLPTVILNIASELPAIDNHSMTSDLS---GLSN--LNASFNSIHGMLLQLSS  3648
             LTG+VSNEKLPTV+LNIASELP  +N   +   S    L+N   + S+N IHG+LLQL S
Sbjct  728   LTGLVSNEKLPTVLLNIASELPQAENQIASPVASIPLYLANGAHHVSYNLIHGLLLQLGS  787

Query  3649  LLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIART  3828
             L+  NCRNLADFS+K+ IL DL+ VL   SW  SP++CPCP+LNC+FL+VLD+MLS+A++
Sbjct  788   LVHVNCRNLADFSRKDQILGDLMKVLAMCSWFASPKRCPCPLLNCTFLQVLDHMLSVAKS  847

Query  3829  CEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVN  4008
             C +SK +  I NLL  LS+ECLD+  S    Y+DPTIAELR+QAASSYF+C +Q S +V 
Sbjct  848   CHLSKNLFAIRNLLLELSTECLDVEASYGFQYYDPTIAELRQQAASSYFSCLFQPSDEVG  907

Query  4009  EEDLIYLRGPPPDSELFKESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPE  4188
             EE     +  P +S LF+  E + S   F ERLIRS SD+ YEVR+ TLKWL  FL S  
Sbjct  908   EEVFQIPKRSPLNSMLFQTHEVENS--GFLERLIRSFSDSSYEVRLVTLKWLHKFLKSRP  965

Query  4189  SRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNC  4368
                    + S + I   W +   LQ  LM+LL +EKNH+CM +IL+II+T+N+ ++ +  
Sbjct  966   GNEINYLSSSDTRIIQNW-TKANLQPTLMKLLELEKNHRCMYHILRIIFTWNLLKFQELS  1024

Query  4369  GQHEKPT-FVGNMDSDSVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSI  4545
              +    T +VG +D DSVLQ WD+++SL K+TRHAKT+E+L+CC+A+C+++   LF+   
Sbjct  1025  EEKSDGTLYVGALDCDSVLQLWDRLISLLKLTRHAKTQEILICCLAICVRQFIRLFSCFT  1084

Query  4546  CSLGNEKVVVVNPSDPSKLSV-FSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLL  4722
              +   +K    N S   + S  F ECI ++V +I+E S +SEP+NMRKAAA+S+ ASGLL
Sbjct  1085  LTDKGQKTAGYNESGQMERSAFFYECITFYVNLIKERSSSSEPVNMRKAAAESMFASGLL  1144

Query  4723  DQAQALSPSVSNHQVPDGN-----KQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLS  4887
             +QA+ ++ SV N Q+   N     K +DA   YAH+IL++WFTC+KLLEDEDDG+R++ +
Sbjct  1145  EQAEVIASSVINQQISSKNSFSCFKHQDAASTYAHQILEMWFTCIKLLEDEDDGIRQRAA  1204

Query  4888  LEVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNS  5067
              ++QK ++   SG+   +     QVEKVIE+SF+ LSS FGHW+ Y D L  WV  A N 
Sbjct  1205  TDIQKFLSPKSSGTTSDTRGARTQVEKVIELSFDRLSSIFGHWIVYFDCLLRWVLDAGNY  1264

Query  5068  ACAVSIADPVRRVFDKEIDNHHEEKLLISQICCSHLEKLPVSK--LTTEFRDNNICSVLQ  5241
                +S  D VRRVFDKEIDNHHEEKLLISQICCSHLEKLP++K      F +  + + L 
Sbjct  1265  --VISKGDLVRRVFDKEIDNHHEEKLLISQICCSHLEKLPITKSWAGKSFDNEEVRNYLL  1322

Query  5242  SWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAE  5421
              WR RF QQL+SF   +IG + GVDWIGGVGNHKDAFLP+Y NLL F+A+SN I   E  
Sbjct  1323  DWRSRFFQQLVSFAKDHIG-KLGVDWIGGVGNHKDAFLPLYANLLGFYAVSNFIFNLETI  1381

Query  5422  DSKSMVPELLELGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDA  5601
             D   ++ ++ ELG+AI PFL NPLIS+L+ L+ + H+   G     +          WD 
Sbjct  1382  DGMHLLSDMSELGKAINPFLWNPLISSLYSLIDRLHDNKFGATTNCINARFGDGI--WDN  1439

Query  5602  FDPYFLFR  5625
             FD +FL R
Sbjct  1440  FDRFFLLR  1447



>gb|KDP45495.1| hypothetical protein JCGZ_09744 [Jatropha curcas]
Length=1308

 Score =  1518 bits (3931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 801/1332 (60%), Positives = 988/1332 (74%), Gaps = 60/1332 (5%)
 Frame = +1

Query  1738  LVCEAIIWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVT-QSPSGLSN  1914
             +V + I WAK LVCSPRVRESDAGALT RLIFRKYVL+LGW+VR S +V+  Q   GL N
Sbjct  1     MVQKVIAWAKNLVCSPRVRESDAGALTLRLIFRKYVLDLGWIVRASADVICFQYKYGLVN  60

Query  1915  GENLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWD  2094
             G++       PV+EY+ SLIDWL  AVEEGE+DLSEACK SFVHGVLLTLRYTF+E+DW+
Sbjct  61    GDSQTINYRPPVVEYVRSLIDWLSDAVEEGERDLSEACKSSFVHGVLLTLRYTFDELDWN  120

Query  2095  SIAVAsnissiklllekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIE  2274
             S AV S+IS +++ LE +L LVMRITSLALWVVSADAWYLPD ++EM  D + +L   ++
Sbjct  121   SDAVMSSISEMRVALENLLGLVMRITSLALWVVSADAWYLPD-IDEMADDDS-YLMDEVD  178

Query  2275  MDVSASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSD----  2442
             M  S+   D +   +KA QD    +QIVMVGCWLAMKEVSLLLGTIIRK+PLP++     
Sbjct  179   MVRSSENGDSD---SKAGQDSRTSEQIVMVGCWLAMKEVSLLLGTIIRKIPLPSNSCLDA  235

Query  2443  VPKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRL  2622
             +    S   D +    S+ +LD+RQLE IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRL
Sbjct  236   LEAPVSGPIDASTLKISNAILDVRQLEEIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRL  295

Query  2623  LCSNDPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLL  2802
             LCSNDPRLCKLTESWMEQLM+RTVSKGQ VDDLLRRSAGIPAAF A FLSEPEGAPK+LL
Sbjct  296   LCSNDPRLCKLTESWMEQLMKRTVSKGQIVDDLLRRSAGIPAAFIALFLSEPEGAPKKLL  355

Query  2803  PKALRWLINVAKKSL--------TDknkensscsesssAIDSTMVPDVAAIEMISKTRDE  2958
             P+ALRWLI+VA  S          + N    S ++S   +DS    ++  +E  SK RDE
Sbjct  356   PRALRWLIDVANSSFLGPVDAKDANANSCKFSLTKSDQELDSAKPFEMHVMESTSKIRDE  415

Query  2959  GVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVR  3138
             GV+PTVHAFNVL+AAFND NLATDTSGF+AE+LIVSIRSFSS YWEVRNSACLAYTALVR
Sbjct  416   GVIPTVHAFNVLRAAFNDTNLATDTSGFAAESLIVSIRSFSSPYWEVRNSACLAYTALVR  475

Query  3139  RMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKV  3318
             RMIGFLNVQKRESARRALTGLEFFHRYP+LH F +NELK+AT+L ++ +  +  SNLAKV
Sbjct  476   RMIGFLNVQKRESARRALTGLEFFHRYPSLHPFFYNELKVATDLLMDTTLGHSGSNLAKV  535

Query  3319  VHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMV  3498
             VHPSLCPMLILLSRLKPS I SE+GD  DPFLFMPFIR+CS Q+NLRIR+LAS+AL G+V
Sbjct  536   VHPSLCPMLILLSRLKPSTIASESGDDLDPFLFMPFIRRCSTQSNLRIRVLASKALIGLV  595

Query  3499  SNEKLPTVILNIASELPAIDNHSMTSDLS------GLSNLNASFNSIHGMLLQLSSLLDT  3660
             SNEKLP V+LNIASELP +DN    ++ S           + SFN IHGMLLQLSSLLD 
Sbjct  596   SNEKLPIVLLNIASELPCMDNQITATNASCTMADPTCGTYHTSFNLIHGMLLQLSSLLDA  655

Query  3661  NCRNLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMS  3840
             NCRNLAD +KKE IL +LI VL   SWI +P+ CPCPILN SF++V+D++LSIAR+  MS
Sbjct  656   NCRNLADVAKKEKILGELIEVLSTRSWIANPKWCPCPILNASFVRVIDHILSIARSGNMS  715

Query  3841  KCISVIWNLLWTLSSECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDL  4020
             K    I +LL  LS+ CLD+  S   +Y+DPTIAELR+QAA SYF+C  Q SK+  EE+ 
Sbjct  716   KDFCTIRDLLLELSTNCLDVEDSYGLSYYDPTIAELREQAAISYFSCVLQVSKEEEEEEE  775

Query  4021  IYLRGP----PPDSELFKESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPE  4188
             + L+ P     P+S+L    ET +  T  QERLIRSLSD+ YEVR+ATLKWLL FL S E
Sbjct  776   V-LQMPHLHVSPESKLLNLPETDI-FTGLQERLIRSLSDSSYEVRLATLKWLLKFLKSVE  833

Query  4189  SRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNC  4368
             S ++E+    Q      W S+  LQ  +++LL  EKNH+CMNYIL+I+Y +N+ Q+ K  
Sbjct  834   S-SSETKTIQQ------WTSS-SLQETMLKLLDSEKNHRCMNYILRILYVWNLLQFKKLG  885

Query  4369  GQHEKPT-FVGNMDSDSVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSI  4545
              +    T ++G +D DS+ QFWDK++SLYK+ RH KTREM++CCMA+C+K+ A   TS +
Sbjct  886   DEKCADTSYIGTLDFDSMFQFWDKLISLYKLARHTKTREMIICCMAICVKQYASSLTSYV  945

Query  4546  CSLGNEKVVVVNPSDPSKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLD  4725
              +            +  + ++  +CI +FV V++EHS ASEP+NMRKAAA+SI+ASGLL+
Sbjct  946   LACVENPAGCCKSDELERSALLYKCISFFVNVVKEHSSASEPVNMRKAAAESIIASGLLE  1005

Query  4726  QAQALSPSVSNHQVP--DGN---KQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSL  4890
             QA+ +  SV N   P   GN   + K+A+++YA ++LD+WF C+KLLEDEDDG+R+ L++
Sbjct  1006  QAELIGSSVYNGGFPFKIGNVNFEPKEAINMYASQVLDIWFMCIKLLEDEDDGVRQMLAV  1065

Query  4891  EVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSA  5070
              VQKC +  +S S  ++G VP QVE+VIE+SFEHLSS FGHW++Y D+L +W+  A N  
Sbjct  1066  NVQKCFSLKRSSSSSNAGEVPTQVERVIELSFEHLSSIFGHWINYFDYLSNWILKAANY-  1124

Query  5071  CAVSIADPVRRVFDKEIDNHHEEKLLISQICCSHLEKLPVSKLTT-------EFRDNNIC  5229
               VS  D VRRVFDKEIDNHHEEKLLI QICCSHLEKLPV KL +       EF+     
Sbjct  1125  -VVSKGDLVRRVFDKEIDNHHEEKLLICQICCSHLEKLPVLKLLSAPAAIKQEFK-----  1178

Query  5230  SVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILR  5409
               L SWR +F  QLISF   ++  + GVDWIGG+GNHKDAFLP+Y NLL F+ALSNC   
Sbjct  1179  KFLDSWRMKFHNQLISFAQVHV-EKLGVDWIGGIGNHKDAFLPLYANLLGFYALSNCSFN  1237

Query  5410  GEAEDSKSMVPELLELGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYS  5589
             G+ ED  +++ +++ELG+ I PF RNPLISNL++LVVKS+EK  G   +H + + S   S
Sbjct  1238  GKVEDDTTLLADVVELGKIINPFFRNPLISNLYLLVVKSYEKKVGATSDHPIYK-SMDES  1296

Query  5590  AWDAFDPYFLFR  5625
             AW+ FDPYFL R
Sbjct  1297  AWNGFDPYFLLR  1308



>ref|XP_009589639.1| PREDICTED: thyroid adenoma-associated protein homolog, partial 
[Nicotiana tomentosiformis]
Length=1122

 Score =  1497 bits (3876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 748/1131 (66%), Positives = 889/1131 (79%), Gaps = 35/1131 (3%)
 Frame = +1

Query  2302  DEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTD  2481
             D+++  K  +D    +QIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDV +S  Q+   TD
Sbjct  4     DKVENTKVVRDGRQTEQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVSESGFQVVHETD  63

Query  2482  --QLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKL  2655
                + S  +LDL+QLE+IGN+FLEVLLKMKHNGAIDKTRAGFTALCNRLLCSND RLCKL
Sbjct  64    LSNMKSGAMLDLKQLEVIGNYFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDSRLCKL  123

Query  2656  TESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVA  2835
             TESWMEQLMERTV+KGQTVDDLLRRSAGIPAAF AFFLSEP+G PKRLLP+ALRWLI+VA
Sbjct  124   TESWMEQLMERTVAKGQTVDDLLRRSAGIPAAFIAFFLSEPQGTPKRLLPRALRWLIDVA  183

Query  2836  KKSLTDknkensscsesssAIDSTMVP--------DVAAIEMISKTRDEGVVPTVHAFNV  2991
              KSLTD  + NS  +++ +       P        D+   E ISK RDEGVVPTVHAFNV
Sbjct  184   NKSLTDHTEANSFSADACNGFVEAKSPANFSEVALDIYDAERISKIRDEGVVPTVHAFNV  243

Query  2992  LKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKR  3171
             L+ AFND NLATDTSGFSAEALI+SIR FSS +WE+RNSACLAYTALVRRM+GFLNV KR
Sbjct  244   LRVAFNDTNLATDTSGFSAEALIISIRCFSSPHWEIRNSACLAYTALVRRMVGFLNVHKR  303

Query  3172  ESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLIL  3351
              S RRA+TGLEFFHRYP LH FLFNELKIATE  L+GSSE+L S++AKVVHPSLCP+LIL
Sbjct  304   ASVRRAITGLEFFHRYPPLHLFLFNELKIATESLLDGSSEHLRSSMAKVVHPSLCPVLIL  363

Query  3352  LSRLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILN  3531
             LSRLKPSPI SE GDP DPFLFMP IRKCS+Q+NLRIR+ ASRALTG+VSNEKLP V+LN
Sbjct  364   LSRLKPSPIASEAGDPLDPFLFMPLIRKCSVQSNLRIRVFASRALTGLVSNEKLPFVLLN  423

Query  3532  IASELPAIDNHSMTSDLSGLSNL--NASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDIL  3705
             IASELP    H   SD S LS++  N+SFNS+HGMLLQL+SLLDTNCR+LAD SKK++IL
Sbjct  424   IASELPGAGEHVENSD-SSLSSIRVNSSFNSLHGMLLQLNSLLDTNCRDLADVSKKDNIL  482

Query  3706  SDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSS  3885
             ++LIH+L   SWIGSP++CPCPI+N   LKVLD+MLS+ARTC+MS  I VIW+LLW LSS
Sbjct  483   AELIHILASRSWIGSPEQCPCPIINSCILKVLDSMLSVARTCQMSDNIDVIWSLLWRLSS  542

Query  3886  ECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEED-LIYLRGPPPDSELFK  4062
             ECLDL  +  P YFDPTI+ELRKQAASSYFNC YQTSK+V EE  LI   GPP  S L K
Sbjct  543   ECLDLGVACAPTYFDPTISELRKQAASSYFNCVYQTSKEVAEEYLLIPSGGPPSGSNLSK  602

Query  4063  ESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLW  4242
              S  ++S +RFQERLIRS+SD  YEVRIATLKW LLFL SPE           +EIK   
Sbjct  603   ISVNEISFSRFQERLIRSISDTSYEVRIATLKWFLLFLKSPE----------YNEIKRSC  652

Query  4243  LSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPTFVGNMDSDSVL  4422
              +++ LQ  +M+LL ++ NHKC+NYILKIIY+++ Q+Y+ N  +   P F G+MDS+SVL
Sbjct  653   FTSVDLQTCVMKLLTLDNNHKCLNYILKIIYSWSQQEYHNNGEECADPKFFGDMDSESVL  712

Query  4423  QFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVN---PSDP  4593
             QFWDKVVSLYKVTRH+KTREML+CCM +CIK+ A   + S+  L N K    N   PSDP
Sbjct  713   QFWDKVVSLYKVTRHSKTREMLLCCMGICIKQFASSLSISVVDLQNVKAGEFNPHDPSDP  772

Query  4594  SKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPD  4773
             SKLSVF ECI Y+V++I++H+DASEP+NMR+AAA+S++ASGLLDQA+ + PSV N+Q+PD
Sbjct  773   SKLSVFYECISYYVDLIEQHTDASEPVNMRRAAAESMIASGLLDQAKVIGPSVYNNQIPD  832

Query  4774  GN-----KQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFS  4938
             GN     KQ+  +++YAHKILDLWF+C++LLEDED+ LR++L+L+VQ C+TS +S   F 
Sbjct  833   GNFCSSFKQEKVVNMYAHKILDLWFSCIRLLEDEDESLRRKLALDVQNCLTSKRSERSFV  892

Query  4939  SGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKE  5118
             +GVVP QVE+VIE SF+HLSS FGH LDYLDFLC  V  + N AC +S  D V+RVFDKE
Sbjct  893   TGVVPSQVEQVIERSFKHLSSIFGHCLDYLDFLCRRVLDSANHACFISEGDLVKRVFDKE  952

Query  5119  IDNHHEEKLLISQICCSHLEKLPVSK--LTTEFRDNNICSVLQSWRRRFCQQLISFGNAY  5292
             IDNHHEEKLLI QICC HLEKLP S+  L      + +   LQ+WRRRF Q+L+ F   Y
Sbjct  953   IDNHHEEKLLICQICCFHLEKLPASRFLLIEPCNVHEVKDFLQNWRRRFAQKLVLFAKDY  1012

Query  5293  IGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEAIQ  5472
             +  QGG DWIGGVGNHKDAFLP+Y NLLAF+ LSNCI +G+ +D K M+PE+ E+GEAIQ
Sbjct  1013  VVAQGGADWIGGVGNHKDAFLPLYANLLAFYGLSNCIFKGKQDDRKLMLPEVEEIGEAIQ  1072

Query  5473  PFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             PFL NP +SNLF LVVK H+K+ G        +I    SAWD+FD YFL R
Sbjct  1073  PFLSNPFLSNLFSLVVKLHDKMIGEGSCDFSQKIIDE-SAWDSFDRYFLLR  1122



>ref|XP_009771866.1| PREDICTED: uncharacterized protein LOC104222334, partial [Nicotiana 
sylvestris]
Length=1101

 Score =  1469 bits (3804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 738/1102 (67%), Positives = 867/1102 (79%), Gaps = 33/1102 (3%)
 Frame = +1

Query  2386  EVSLLLGTIIRKVPLPTSDVPKSCSQITDGTD--QLSSDIVLDLRQLEIIGNHFLEVLLK  2559
             +VSLLLGTIIRKVPLPTSDV +S  Q    TD   ++S  +LDL+QLE+IGNHFLEVLLK
Sbjct  11    QVSLLLGTIIRKVPLPTSDVSESGFQAVHETDLSNMTSGAMLDLKQLEVIGNHFLEVLLK  70

Query  2560  MKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAG  2739
             MKHNGAIDKTRAGFTALCNRLLCSND RLCKLTESWMEQLMERTV+KGQTVDDLLRRSAG
Sbjct  71    MKHNGAIDKTRAGFTALCNRLLCSNDSRLCKLTESWMEQLMERTVAKGQTVDDLLRRSAG  130

Query  2740  IPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscs--------esssA  2895
             IPAAF AFFLSEP+G PKRLLP+ALRWLI+VA KSLTD  + NS  +          S A
Sbjct  131   IPAAFIAFFLSEPQGTPKRLLPRALRWLIDVANKSLTDHTETNSFSADACNGFVEAKSPA  190

Query  2896  IDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRS  3075
               S + PD+   E ISK RDEGVVPTVHAFNVLK AFND NLATDTSGFSAEALI+SIR 
Sbjct  191   NFSEVAPDIYDAERISKIRDEGVVPTVHAFNVLKVAFNDTNLATDTSGFSAEALIISIRC  250

Query  3076  FSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFNELK  3255
             FSS +WE+RNSACLAYTALVRRMIGFLNV KR S RRA+TGLEFFHRYP LH+FLFNELK
Sbjct  251   FSSPHWEIRNSACLAYTALVRRMIGFLNVHKRASVRRAITGLEFFHRYPPLHSFLFNELK  310

Query  3256  IATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMPFIRK  3435
             IATE  L+GSSE+L S++AKVVHPSLCP+LILLSRLKPSPI SE GDP DPFLFMP IRK
Sbjct  311   IATESLLDGSSEHLRSSMAKVVHPSLCPVLILLSRLKPSPIASEAGDPQDPFLFMPLIRK  370

Query  3436  CSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDLSGLS-NLNASF  3612
             CS+Q+NLRIR+ ASRALTG+VSNEKLP V+LNIASELP    H   SD+S  S  +N+SF
Sbjct  371   CSVQSNLRIRVFASRALTGLVSNEKLPLVLLNIASELPGAGEHVENSDVSLSSIRVNSSF  430

Query  3613  NSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPILNCSFL  3792
             NS+HGMLLQL+SL+DTNCR+L D SKK++IL++LIH+L   S IGSP++CPCPI+N  FL
Sbjct  431   NSLHGMLLQLNSLIDTNCRDLPDVSKKDNILAELIHILASRSCIGSPEQCPCPIINSCFL  490

Query  3793  KVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPTIAELRKQAASSY  3972
             KVLD+MLS+ARTC+MSK I VIWNLLW LSSECLDL     P YFDPTI+ELRKQAASSY
Sbjct  491   KVLDSMLSVARTCQMSKNIDVIWNLLWRLSSECLDLGVVCAPTYFDPTISELRKQAASSY  550

Query  3973  FNCAYQTSKDVNEE-DLIYLRGPPPDSELFKESETQMSVTRFQERLIRSLSDALYEVRIA  4149
             FNC YQTSK+V EE  LI   GPP  S L K S  ++S +RFQ RLIRS+SD  YEVRIA
Sbjct  551   FNCVYQTSKEVAEEYPLIPSGGPPSGSNLSKISVNEISFSRFQGRLIRSISDTSYEVRIA  610

Query  4150  TLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEKNHKCMNYILKI  4329
             TLKW LLFL SPE           +EIK    +++ LQ  +M LL ++ NHKC+NYILKI
Sbjct  611   TLKWFLLFLKSPE----------YNEIKRSCFTSVDLQTSVMNLLTLDNNHKCLNYILKI  660

Query  4330  IYTYNMQQYNKNCGQHEKPTFVGNMDSDSVLQFWDKVVSLYKVTRHAKTREMLVCCMAVC  4509
             IY+++ Q+Y+ N  +   P F G+M S+SVLQFWDKVVSLYKVTRH+KTREML+CCM +C
Sbjct  661   IYSWSQQEYHNNGEECADPKFFGDMGSESVLQFWDKVVSLYKVTRHSKTREMLLCCMGIC  720

Query  4510  IKRLADLFTSSICSLGNEKVVVVN---PSDPSKLSVFSECIDYFVEVIQEHSDASEPINM  4680
             IK++A   + S+  L N K    N   PSDPSKLSVF ECI Y+V++I++H+DASEP+NM
Sbjct  721   IKQVASSLSISVVDLQNVKAGQFNPHDPSDPSKLSVFYECISYYVDLIEQHTDASEPVNM  780

Query  4681  RKAAAQSIVASGLLDQAQALSPSVSNHQVPDGN-----KQKDALHLYAHKILDLWFTCMK  4845
             R+AAA+S++ASGLLDQA+ + PSV N Q+PD N     KQ+  +++YAHKILDLWF+C+ 
Sbjct  781   RRAAAESMIASGLLDQAEVIGPSVYNSQIPDSNFCSPFKQEKVVNMYAHKILDLWFSCIT  840

Query  4846  LLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDY  5025
             LLEDED+ LR++L+L+VQ C+TS +S   F +GVVPIQVE+VIE SF+HLSS FGH LDY
Sbjct  841   LLEDEDENLRRKLALDVQNCLTSKRSERSFVTGVVPIQVEQVIERSFKHLSSIFGHCLDY  900

Query  5026  LDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNHHEEKLLISQICCSHLEKLPVSK--L  5199
             LDFLC  V  + N AC +S  D V+RVFDKEIDNHHEEKLLI QICC HLEKLP S+  L
Sbjct  901   LDFLCRRVLGSANHACFISEGDLVKRVFDKEIDNHHEEKLLICQICCFHLEKLPASRFLL  960

Query  5200  TTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLA  5379
                   + +   LQ+WRRRF Q+L+ F   Y+  QGG DWIGGVGNHKDAFLP+Y NLLA
Sbjct  961   VEPCNVHEVKDFLQNWRRRFAQKLVLFAKDYVVAQGGADWIGGVGNHKDAFLPLYANLLA  1020

Query  5380  FHALSNCILRGEAEDSKSMVPELLELGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEH  5559
             F+ALSNCI +G+ ED K M+PE+ E+GEAIQPFL NP +SNLF LVVK H+K+ G     
Sbjct  1021  FYALSNCIFKGKPEDRKLMLPEVQEIGEAIQPFLSNPFLSNLFSLVVKLHDKMIGEGSCD  1080

Query  5560  LVLEISGAYSAWDAFDPYFLFR  5625
                +I    SAWD+FDPYFL R
Sbjct  1081  FSQKIIDE-SAWDSFDPYFLLR  1101



>ref|XP_006431125.1| hypothetical protein CICLE_v100108892mg, partial [Citrus clementina]
 gb|ESR44365.1| hypothetical protein CICLE_v100108892mg, partial [Citrus clementina]
Length=1245

 Score =  1435 bits (3714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 756/1253 (60%), Positives = 927/1253 (74%), Gaps = 33/1253 (3%)
 Frame = +1

Query  1942  SPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnis  2121
             +PV+EYI SLIDWL  AV+EGE+DLSE+C+ SFVHG+LL LRYTFEE+DW+S AV S  S
Sbjct  1     APVVEYIKSLIDWLEVAVKEGERDLSESCENSFVHGILLALRYTFEELDWNSNAVLSGYS  60

Query  2122  siklllekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPD  2301
              +K  LEK+L LVMRITSLALWVVSADAW LP++M++M +D    L  P EMD    + +
Sbjct  61    EMKCALEKLLELVMRITSLALWVVSADAWCLPEDMDDMIIDDNLLLGVPEEMDEPLRSLE  120

Query  2302  DEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLP---TSDVPKSCSQITD  2472
             DE K +K  QD    +Q+VMVGCWLAMKEVSLLLGTIIRK+PLP   +SD   S S  +D
Sbjct  121   DEEKNSKPAQDVRTSEQVVMVGCWLAMKEVSLLLGTIIRKIPLPIHSSSDTVDSGSGTSD  180

Query  2473  GTDQL---SSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPR  2643
               D L   +SD +LDL+QLE IG+HFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSND R
Sbjct  181   AADDLLMTTSDAMLDLKQLEKIGSHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDLR  240

Query  2644  LCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWL  2823
             LC+LTESWMEQLMERTV+KGQ VDDLLRRSAGIPAAF A FL+EPEGAPK+LLP+ALRWL
Sbjct  241   LCRLTESWMEQLMERTVAKGQIVDDLLRRSAGIPAAFIALFLAEPEGAPKKLLPQALRWL  300

Query  2824  INVAKKSLTDknkensscse------sssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAF  2985
             I+VA +SL D  +   + +       S+   +S M PD+ A    SK RDEGVVPTVHAF
Sbjct  301   IDVANRSLLDLIENKGAKTTMCEFSHSNQETESAMPPDIYATWNSSKIRDEGVVPTVHAF  360

Query  2986  NVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQ  3165
             N+L+AAFND NLA DTS FSAEALI+SIRSFSS YWE+RNSACLAYTAL+RRM+GFLNVQ
Sbjct  361   NILRAAFNDTNLAADTSAFSAEALIISIRSFSSPYWEIRNSACLAYTALIRRMVGFLNVQ  420

Query  3166  KRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPML  3345
             KRESARRALTGLEFFHRYP+LH F+FNEL++ TEL    SS    SNLA VVHPSLCPML
Sbjct  421   KRESARRALTGLEFFHRYPSLHPFIFNELRVITELLGNASSGQSASNLANVVHPSLCPML  480

Query  3346  ILLSRLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVI  3525
             ILL RLKPS +  E+GD  DPFLFMPFIR+CS Q+NL++R+LASRALTG+V NEKLP V+
Sbjct  481   ILLCRLKPSALAGESGDDLDPFLFMPFIRRCSTQSNLKVRVLASRALTGLVPNEKLPDVL  540

Query  3526  LNIASELPAIDNHSMTSDLSGLSNLN-ASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDI  3702
             LNIASEL  ++  +  + +S L   + ASFN IHG+LLQL SLLD NCRNL DFSKK+ I
Sbjct  541   LNIASELLCVEGQNEAAPVSSLHGTHRASFNLIHGILLQLGSLLDANCRNLVDFSKKDQI  600

Query  3703  LSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLS  3882
             L DLI VLG  SWI +P++CPCPILN SFLKVLD+MLSIAR C  SK  S + NLL  LS
Sbjct  601   LGDLIKVLGNCSWIANPKRCPCPILNASFLKVLDHMLSIARACHTSKSFSTVRNLLLELS  660

Query  3883  SECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDL-IYLRGPPPDSELF  4059
             ++CLD+  S    Y+DPTI ELRK+AA+SYF+C +Q S++  EE L +  R  P DS L 
Sbjct  661   TDCLDVDASYGLTYYDPTITELRKKAANSYFSCVFQASEESGEEVLQMPQRCSPVDSTLS  720

Query  4060  KESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLL  4239
             K  + + + +   ERL+RSLSD+ YEVR++TLKWLL FL S ES   E    S  EIK +
Sbjct  721   KMPDMENTFSGLLERLVRSLSDSSYEVRLSTLKWLLKFLKSTES-DREVCELSSYEIKSI  779

Query  4240  --WLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNK-NCGQHEKPTFVGNMDS  4410
               W  N  LQA LM  L +EKN +C NY+L++++T+N+ Q+ K       +  FVG++D 
Sbjct  780   QNWTKN-NLQATLMSRLELEKNPRCTNYVLRLLFTWNLLQFQKLGSNVCTETIFVGSVDC  838

Query  4411  DSVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSD  4590
             DSV+QFWD+++S Y++TRHAK +E L+ CMA+CI+R A+LFTSSI     +K + ++ SD
Sbjct  839   DSVVQFWDRLMSSYELTRHAKIKESLINCMAICIRRFANLFTSSILVDARKKTIEISESD  898

Query  4591  P-SKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQV  4767
                + +    CI  FV +I  HS +SEP+NMRKAA  SIVASGLL+QA  +   VSN Q+
Sbjct  899   HLGRSAHLFACITAFVNIINRHSSSSEPVNMRKAATGSIVASGLLEQADLIGSYVSNRQI  958

Query  4768  PDGN-----KQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSH  4932
             P  N     + ++A ++YAH++L +WFTC+KLLEDEDDG+R++L+++VQKC +  + GS 
Sbjct  959   PSENLSLHFEPQEAGNMYAHQVLVIWFTCIKLLEDEDDGIRQRLAIDVQKCFSLRRFGS-  1017

Query  4933  FSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFD  5112
              SS  VP QVEKVIE+SFEHLSS FG W++Y D+LC WV  A +    VS  D VRRVFD
Sbjct  1018  -SSHGVPNQVEKVIELSFEHLSSIFGCWIEYFDYLCQWVLVAASH--VVSGGDLVRRVFD  1074

Query  5113  KEIDNHHEEKLLISQICCSHLEKLPVSK--LTTEFRDNNICSVLQSWRRRFCQQLISFGN  5286
             KEIDNHHEEKLLISQICCS LEK+P+ K  +      ++  + L  WR RF QQL+SF  
Sbjct  1075  KEIDNHHEEKLLISQICCSQLEKIPILKSWVADSLNKDHARNYLLGWRHRFSQQLMSFAK  1134

Query  5287  AYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEA  5466
              +     GVDWIGGVGNHKDAFLP+Y NLL F+ALS CI + EAED   ++ +++ELG  
Sbjct  1135  DHGRKYEGVDWIGGVGNHKDAFLPLYANLLGFYALSICIFKVEAEDGMHLLSDVVELGRI  1194

Query  5467  IQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             I PFLRNPL+ NL++LVVK HEK  G   +H V E   A   WD FDPYFL R
Sbjct  1195  ISPFLRNPLVGNLYLLVVKLHEKQTGATADHTV-EFR-ADMIWDGFDPYFLLR  1245



>ref|XP_001769710.1| predicted protein [Physcomitrella patens]
 gb|EDQ65511.1| predicted protein [Physcomitrella patens]
Length=2124

 Score =  1314 bits (3401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 791/1916 (41%), Positives = 1127/1916 (59%), Gaps = 169/1916 (9%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             G+LTA+ R +        N+    LG    +   + TILYDGIL  LC F E   DSHF 
Sbjct  333   GLLTALPRGISCGESTTMNE----LGCSTESAWKLWTILYDGILPALCTFSEGSVDSHFK  388

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FH +T +QICLQQ+  S+      +  GY+P+   + +R+L+IVWNN EDPL+QTVKQV 
Sbjct  389   FHTITALQICLQQVPASVHKV---MISGYEPLPSTMLSRILQIVWNNWEDPLTQTVKQVQ  445

Query  361   LIFDLFLDIQGTL--HWAEGSE-----KFCSFLRKIASDLLHLGPRCKGRYIPLASLTKR  519
              +FDL +D+Q     H   G           F+++IAS+LL  G   KG+Y+PLASL  R
Sbjct  446   AVFDLLVDVQFIFAQHGHNGDNDNVEASHGDFVKQIASNLLAEGRYRKGKYVPLASLAVR  505

Query  520   LGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWST-DGVEGGYIKYR  696
             +GA+ +L M+P LLFDT  A  DDDVC +A++FLK FLE L+++ WS+  GV  G + +R
Sbjct  506   IGAEKLLSMNPNLLFDTFHAQSDDDVCCSASSFLKTFLERLKEDCWSSFGGVNEGCLAFR  565

Query  697   AHCLLPILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCS--AESTEIFY  870
                + P+L+ L SG ++LR+NLNTYALPV + +D DS+ PML FI  G     + + + +
Sbjct  566   RLWIPPLLTVLLSGNSRLRTNLNTYALPVAMRIDPDSVIPMLAFILDGADKWGKRSNLSW  625

Query  871   PELDSRDIV---LGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGV  1041
              EL     +   L + QR+A L+S+LKV+R LALI GDID              + D G 
Sbjct  626   EELMGAPGLPSHLTMHQRIAALISVLKVARSLALIGGDID-------------QNFDTGS  672

Query  1042  CDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAV  1221
                +V V+   V++PV++L  ALTH+DDSLR+DAAE + +NPKT S+PS+LEL ++R ++
Sbjct  673   STVIVRVQNEIVQVPVSWLEQALTHLDDSLRVDAAELICLNPKTTSMPSALELKMLRLSI  732

Query  1222  PLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSL  1401
             PLNMRC ST+F+M+W SL +KFF+RVRTA  R  +     P L     G  +        
Sbjct  733   PLNMRCSSTSFRMRWTSLLKKFFNRVRTAAYRHHRLSN-EPRLHVSKDGVSI--------  783

Query  1402  KHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSE  1581
                   +  FM+ L+ +L  S YPSAPYERK MAMEL+  ++ VW   P +  + + S  
Sbjct  784   ----AEMQEFMQLLTQYLLSSLYPSAPYERKNMAMELLNAIIEVWSFSPEEKPTGTNSLI  839

Query  1582  ISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIW  1761
                 PY  GL+  E+TL++VG+I+DSWD+LRES+FRIL+ +PTP+PG+ S   +   + W
Sbjct  840   ADFSPYQAGLLSAEATLVVVGAIVDSWDKLRESAFRILVRYPTPLPGLESTTSIERILHW  899

Query  1762  AKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPS  1941
             AK LV SPRVRESDAGAL  RL+F KYVL+L                             
Sbjct  900   AKGLVSSPRVRESDAGALVLRLVFHKYVLDLA----------------------------  931

Query  1942  SPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnis  2121
               + EY+ SL DWL   + EG++DL +AC  SFVHGVLLTLRYT EE+ W S+AV   + 
Sbjct  932   --IAEYVESLNDWLEWGINEGDRDLLKACSHSFVHGVLLTLRYTMEELPWASVAVQVGVH  989

Query  2122  siklllekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPD  2301
              ++  L K+++L++R+TSL LWVV+A A  LP +M   T  G   L+  I+ ++   + +
Sbjct  990   RLRAALHKLISLLLRVTSLTLWVVAASALNLPPDMASDTSAG--MLDDMIDANIDEESFE  1047

Query  2302  DEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTD  2481
             D   +A       P++Q++MVGCWL+MKEVSLLLGTI R+VPL        C    + T 
Sbjct  1048  DGEGVA-------PVEQMIMVGCWLSMKEVSLLLGTIAREVPL------SECFSEEEKTR  1094

Query  2482  QL----SSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLC  2649
              L    ++  +L+  QLE +G HFL+VLL MKHNGAIDKTRAGF ALC+RLL S DPRL 
Sbjct  1095  SLVAAENTSGLLNAEQLEAMGAHFLQVLLAMKHNGAIDKTRAGFIALCDRLLRSPDPRLN  1154

Query  2650  KLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLIN  2829
             KL E+WM QL+ERT SKGQTVD+LLRRSAGIPAAF A FL+EP+GAPK+LLP A++WLI+
Sbjct  1155  KLPETWMHQLIERTGSKGQTVDNLLRRSAGIPAAFLALFLAEPDGAPKKLLPMAMKWLID  1214

Query  2830  VAKKSL--TDknkensscsesssAIDSTMVPDVAA----IEMISKTRDEGVVPTVHAFNV  2991
               KK +  + K    S+    S   D  +V D  A    ++   K RDEGVVPTVHAFN 
Sbjct  1215  TCKKFVFASTKASSESNDKHISRGEDLVLVVDNTADNLELQTKMKRRDEGVVPTVHAFNA  1274

Query  2992  LKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKR  3171
             ++ AF+D NLATDTSGF A+ LI +I++FS  YWEVRNSA LA+ ALV R IGFLNV KR
Sbjct  1275  MRVAFHDTNLATDTSGFCADGLITAIQAFSCPYWEVRNSATLAFAALVHRTIGFLNVYKR  1334

Query  3172  ESARRALTGLEFFHRYPTLHTFLFNELKIAT-ELFLEGSSENLTSNLAKVVHPSLCPMLI  3348
             ESARRA+TG EFFHR+PTLH FL  EL+ AT +L  +G        +   +HPSL P+LI
Sbjct  1335  ESARRAITGFEFFHRFPTLHPFLLQELRSATLQLQQDGDGGYQGHGMTSTLHPSLGPVLI  1394

Query  3349  LLSRLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVIL  3528
             +LSRLKPS I++  GD   P  F P++  C+   N  +R+LASRAL  +VS + LP V+L
Sbjct  1395  ILSRLKPSVISTGVGDWVSPSAFRPYVTSCATLENFHVRVLASRALAPLVSADDLPAVLL  1454

Query  3529  NIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILS  3708
              +A  LP   N           N+  S+N++HG+LLQ++ LL +NC  L D   ++ I++
Sbjct  1455  ELAKSLPNARN---------TPNIALSYNAMHGVLLQMTVLLTSNCSALPDLEMRQMIVT  1505

Query  3709  DLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTC-----EMSKCISVIWNLLW  3873
              L   + +H W+GS   CPC ++  +F  +L+ MLS+A+TC      M      +   L 
Sbjct  1506  KLFTEVEQHLWLGSIHHCPCHMVVGAFFCMLEAMLSVAKTCAQGVVSMETLTRNVQAHLL  1565

Query  3874  TLSSECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQT----SKDVNEEDLIYLRGPP  4041
              L +ECL+  T    ++ +     L ++A++ YF          S D       +  GP 
Sbjct  1566  HLCAECLEDETEGIASWNEAMQVLLCERASNLYFGTILSNLLLQSIDAKA---THSDGPE  1622

Query  4042  PDSELFKESETQM-SVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKS  4218
               ++ ++ S + M +V         +LS  +YEVR+ TLK L  F         E     
Sbjct  1623  QLNDSYRSSSSDMLAVKNLGLMFSSALSHRMYEVRLETLKVLKSFFFCLTQPITE-----  1677

Query  4219  QSEIKLLWLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHEKPTFVG  4398
                 ++ W+SN  LQ +L++ L +E +  C+  IL ++Y +    + KN    +  T   
Sbjct  1678  ----RIGWISNY-LQPLLVERLRIETHPGCVRRILHVLYAWR-SVFKKNSPAEDSNT---  1728

Query  4399  NMDSDSVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADL--FTSSICSLGNEKVV  4572
               DS S++  WD+V+ +YK ++HAKT+E+ + CM  C+  +     FTS      +E   
Sbjct  1729  AWDSSSLVT-WDRVLHIYKTSKHAKTKEVAMRCMGACLSSVLSYLRFTS------DEDCH  1781

Query  4573  VVNPSDPSKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSV  4752
             V + S   +L      +D ++ ++ +HS ASE  N R+A A++IVAS LLDQ  +++  +
Sbjct  1782  VADGSSTPEL--VRRAVDEWICLVNKHSAASESANFRRATAEAIVASSLLDQVPSVALFL  1839

Query  4753  SNHQVPDGNKQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQK--CITSGKSG  4926
             +      G++ + A   Y   +L +W  C+KLLEDED  LR+ L+L +     ++SG +G
Sbjct  1840  TKVSKVGGHRLEFA-EWYGKGLLQVWCVCVKLLEDEDPDLRQSLALSLLDVLALSSGTNG  1898

Query  4927  SHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATN-SACAVSIADPVRR  5103
             +   +  VP QVE+V++++F+ LSS FG W  Y   L  WV  + +  A  VS  D VRR
Sbjct  1899  NAHFNAAVPSQVERVVQLAFQWLSSHFGSWHVYWSVLAEWVLGSEDIDALLVSEVDLVRR  1958

Query  5104  VFDKEIDNHHEEKLLISQICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFG  5283
             +FDKEIDNHHEE+L+  Q+CC HL      +L   +   +  + +++WR+RF +Q+ S  
Sbjct  1959  LFDKEIDNHHEEELVFVQLCCLHL------RLLVGYDSLSSSAEVRAWRQRFLEQVKSCA  2012

Query  5284  NAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGE  5463
                +  Q  + W+GGV NH+DAF  VY  LL     +   +  +A+  K    +LLE+  
Sbjct  2013  ELTLRMQEKMPWVGGVTNHQDAFKMVYRRLLGLLIFAGPCISSQAQVLKD---QLLEISR  2069

Query  5464  AIQPFLRNPLISNLFVLVVKSHE----KIAGGAVEHLVLEISGAYSAWDAFDPYFL  5619
              ++    NPL+SN+   +++++E     I  G+  +     S   +  D F+P FL
Sbjct  2070  LLRQLPLNPLVSNVMYKILQAYETYDAAIDLGSANY---RASMGLAFCDKFEPLFL  2122



>ref|XP_010507456.1| PREDICTED: uncharacterized protein LOC104784082 [Camelina sativa]
Length=2002

 Score =  1208 bits (3126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 675/1250 (54%), Positives = 861/1250 (69%), Gaps = 73/1250 (6%)
 Frame = +1

Query  1912  NGENLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDW  2091
             NG      P  PVIEYI SLI WL  +V EGE+DLSEACK SFVHGVLL LRYTFEE+DW
Sbjct  787   NGLYQNSKPKYPVIEYIKSLIHWLDVSVMEGERDLSEACKNSFVHGVLLALRYTFEELDW  846

Query  2092  DSIAVAsnissiklllekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPI  2271
             +S A   ++S ++  LEK+L LV RIT+LALWVVSADA  LP++M+++  D   FL    
Sbjct  847   NSNA-GLSMSEMRKELEKLLKLVTRITTLALWVVSADALSLPEDMDDIIEDDG-FLSNVQ  904

Query  2272  EMDVSASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDV--  2445
             +   +  + + +    K   +    +Q+VMVGCWLAMKEVSLLLGTIIRK+PLPT  +  
Sbjct  905   DDAAAVLSEEHKSTFPKPVHEKIQSEQVVMVGCWLAMKEVSLLLGTIIRKIPLPTCSLRP  964

Query  2446  ---PKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCN  2616
                  S S     +   +S+++LDL+QLE IG+HFLEVLLKMKHNGAIDKTRAGFTALC+
Sbjct  965   LENGNSASAAPSDSVIENSELLLDLKQLEKIGDHFLEVLLKMKHNGAIDKTRAGFTALCH  1024

Query  2617  RLLCSNDPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKR  2796
             RLLCSNDPRLCKLTESWMEQLMERTV++GQTVDD+LRRSAGIPAAF A FLSEPEG+PK+
Sbjct  1025  RLLCSNDPRLCKLTESWMEQLMERTVARGQTVDDVLRRSAGIPAAFIALFLSEPEGSPKK  1084

Query  2797  LLPKALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTV  2976
             LLP+ALRWL+++A+K L D  ++  S       ++     D+ + E +SK RDEGVVPTV
Sbjct  1085  LLPQALRWLVSLAEKPLLDPMEQKGSNHM----VEEISSSDMHSSENLSKVRDEGVVPTV  1140

Query  2977  HAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFL  3156
             HAFNVLKAAFND NL+TDTSGFSAEA+IVSIRSFSS YWEVRNSA LAYTALVRRMIGFL
Sbjct  1141  HAFNVLKAAFNDTNLSTDTSGFSAEAMIVSIRSFSSQYWEVRNSATLAYTALVRRMIGFL  1200

Query  3157  NVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLC  3336
             NVQKR S RRALTGLEFFHRYP LH F+++ELK AT+L    +S    SNLA +VHPSL 
Sbjct  1201  NVQKRVSTRRALTGLEFFHRYPLLHPFIYSELKTATDLL--DTSGPSDSNLANLVHPSLW  1258

Query  3337  PMLILLSRLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLP  3516
             P+LILLSRLKPSPI SETGD  DPF+FMPFI KCS Q NLR+R+LASRAL G+VSNEKL 
Sbjct  1259  PILILLSRLKPSPIASETGDDLDPFVFMPFIMKCSTQRNLRVRVLASRALVGLVSNEKLQ  1318

Query  3517  TVILNIASELPAIDNHSMTSDLSGLSNL--NASFNSIHGMLLQLSSLLDTNCRNLADFSK  3690
             +V+L IAS LP              SN+    SFN +HG+LLQL +LLDTNCR+LAD SK
Sbjct  1319  SVLLQIASTLP--------------SNVAQGGSFNYLHGILLQLGNLLDTNCRDLADDSK  1364

Query  3691  KEDILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLL  3870
             K+ I+  LI+VL K +W+ SP  CPCPIL  SFL+VLD+M  I RT   SK +  I+ L 
Sbjct  1365  KDQIIGKLINVLSKCTWMASPLTCPCPILCTSFLRVLDHMRVIERTSSESKNLRDIYKLH  1424

Query  3871  WTLSSECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDS  4050
               LS+ CL+   S   +Y+DP+IAELR+QAA SYF C +Q S +  E   I  R   P+ 
Sbjct  1425  LDLSTNCLNTDASYGFSYYDPSIAELREQAAVSYFGCIFQPSDEAAEVFQITQR---PNL  1481

Query  4051  ELFKESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEI  4230
                ++           ERL+R LSD  YEVR+ATLKW L FL S +S  +ESS+      
Sbjct  1482  LRLQKVPEASDYPDLNERLLRCLSDQSYEVRLATLKWFLQFLKSEDSSFSESSSIWN---  1538

Query  4231  KLLWLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNC-GQHEKPTFVGNMD  4407
                W  N GLQ +L++LL  EKNHKC NYILKI++ +N+  + K+C G+  +  +VG+++
Sbjct  1539  ---WAKN-GLQLVLLELLDKEKNHKCENYILKILFQWNLLMFKKSCKGESVEGIYVGSLN  1594

Query  4408  SDSVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPS  4587
              D VL  W ++ SLY+ TR AK R  L+CC+A+C+K L  LF     S   E+       
Sbjct  1595  YDLVLHLWGRLTSLYESTRRAKIRGTLMCCLAICVKHLTGLFFHKNDSEKEEE-------  1647

Query  4588  DPSKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQV  4767
               S+     +C+ YFV +I+E S +SE +N+R A+A++I+ASG+L+QA+ + P   NHQ+
Sbjct  1648  --SRRGCVIDCVSYFVNMIKEKSLSSEQVNVRHASAEAIIASGILEQAKIVGPLALNHQI  1705

Query  4768  PDG--NKQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSS  4941
             P    +  + A ++YA++ILD+WFTC+KLLEDEDD +R +L+ +VQKC         F++
Sbjct  1706  PSEILSTFQKACNVYAYQILDMWFTCIKLLEDEDDIIRSKLATDVQKCF--------FTA  1757

Query  4942  GVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWV-QSATNSACAVSIADPVRRVFDKE  5118
               VP QV+KV+E+SF HLSS FGHW +Y  +L  WV  +A         +D VRRVFDKE
Sbjct  1758  MEVPTQVDKVLELSFNHLSSVFGHWNEYSQYLSKWVFNTADYLPPPKGGSDLVRRVFDKE  1817

Query  5119  IDNHHEEKLLISQICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIG  5298
             IDNHHEEKLLI Q  C HL+KLP+S  +         + L  WR +F  QL+SF   ++ 
Sbjct  1818  IDNHHEEKLLILQFGCYHLQKLPMSDFSL--------AQLLDWRSKFHNQLLSFAKDHVS  1869

Query  5299  TQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILR--GEAEDSKSMVPELLELGEAIQ  5472
              Q   +W+GGVGNHKD FLP+Y NLL  +  SNCI R   ++ D K++  +++ELG A++
Sbjct  1870  KQRE-NWVGGVGNHKDVFLPLYGNLLGLYVFSNCIFRFPTDSNDKKALCSDMVELGGALK  1928

Query  5473  PFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLF  5622
             PFLRNPL+SN+F +VV+ HE +   ++  L   +SG    W+ FDPYFL 
Sbjct  1929  PFLRNPLVSNMFRVVVRLHENLLDDSLVDLATVLSG--EIWEGFDPYFLL  1976


 Score =   550 bits (1416),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 292/500 (58%), Positives = 357/500 (71%), Gaps = 39/500 (8%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILT VSR +L                  N+D   +TILYDGIL ELC+ CE+P DSH N
Sbjct  322   GILTTVSRGIL----------VSSFAQLSNSDCDHRTILYDGILLELCDLCENPIDSHLN  371

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQIKTSM  TD  + E YD + + +  RVL+I+WNNLEDPLSQTVKQVH
Sbjct  372   FHALTVMQICLQQIKTSML-TD--LSEDYDLMPDSMTARVLRIIWNNLEDPLSQTVKQVH  428

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             L+FDL LDIQ T+H  +        L KI + LL LG RCKGRY+PLASLT+RLGAK+++
Sbjct  429   LMFDLLLDIQTTVHQTDDKVGIRESLLKIVNYLLRLGSRCKGRYVPLASLTRRLGAKTLM  488

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
             DMSP LLF+   AY+DDDVC A T+FLKCFLE LRDE W ++GV+ GY +YR HCL P L
Sbjct  489   DMSPNLLFEMANAYIDDDVCYAVTSFLKCFLEMLRDESWGSEGVDQGYARYREHCLPPFL  548

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
              GL+SG +KLRSNLNTYA+ VLLELDVDSIF +L +I IG S E T++ Y EL +  + L
Sbjct  549   YGLASGMSKLRSNLNTYAVQVLLELDVDSIFLLLAYISIGPSEEETKLNYTELSNMSMEL  608

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              VEQ+V VLVSLLKV R LA +EGDI+              STDA    ++V +KG+E+K
Sbjct  609   TVEQKVVVLVSLLKVCRTLAFLEGDIE-----------QKRSTDAF---AIVQIKGVELK  654

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +P+ +L +ALTH+D+S+R+DAAE+LF+NPK A LPS LEL LM++AVPLNMR  ST FQM
Sbjct  655   VPIEWLKMALTHVDESVRVDAAETLFLNPKNARLPSPLELYLMKEAVPLNMRSSSTGFQM  714

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSRVRT+LE+  K G+  P             ++D++   RAE+LF FM+W
Sbjct  715   KWTSLFRKFFSRVRTSLEKQYKHGSLQPL------------KSDENAVLRAESLFKFMRW  762

Query  1441  LSCFLFFSCYPSAPYERKIM  1500
             LS FLF SCYPSAPY RKIM
Sbjct  763   LSSFLFLSCYPSAPYRRKIM  782



>ref|XP_002967388.1| hypothetical protein SELMODRAFT_86703 [Selaginella moellendorffii]
 gb|EFJ31987.1| hypothetical protein SELMODRAFT_86703 [Selaginella moellendorffii]
Length=2042

 Score =  1177 bits (3044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 756/1923 (39%), Positives = 1079/1923 (56%), Gaps = 233/1923 (12%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFV----VSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTD  168
             G+LTA  R VLN   +    V  DG         ++  V T+LYDGIL  LC   E   D
Sbjct  305   GLLTAAPREVLNYCLLKKVTVEEDGRR------TSNLVVWTLLYDGILPALCAATESSFD  358

Query  169   SHFNFHALTVMQICLQQIKTSMQG--TDGYIEE-----------GYDPISEEVGTRVLKI  309
             SHF FH +T +QICLQQIK S+ G  T   I+E              P S  + +RV++I
Sbjct  359   SHFKFHGMTALQICLQQIKASILGNVTAAAIDELRSVKGAAFTAPATPFSPTMTSRVMQI  418

Query  310   VWNNLEDPLSQTVKQVHLIFDLFLDIQGTLHW-----AEGSEKFCSFLRKIASDLLHLGP  474
             +WNN EDPL+QTV+QV ++FDL  D+Q +        A+      SFL +IA+DLL +G 
Sbjct  419   IWNNWEDPLNQTVRQVQMVFDLLADLQSSSSSEGGETAQAQNGTQSFLHQIANDLLTVGG  478

Query  475   RCKGRYIPLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEY  654
               KGRY+PLA+L  RLGA+++L+M PGLLF T  A  DD VC AA++FLK FLE LRDE 
Sbjct  479   HRKGRYVPLATLALRLGAQTLLEMCPGLLFQTIHAMSDDGVCCAASSFLKLFLERLRDEC  538

Query  655   WSTDGVEGGYIKYRAHCLLPILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIG  834
             W+ +GV  G I++R   + P+++G+ +G  +LR NL+TYAL V LE+D DS+  MLGF+ 
Sbjct  539   WNNEGVTQGSIRFRQLWVPPMVAGVVAGNPRLRINLHTYALSVALEIDSDSLLQMLGFVL  598

Query  835   IGCSAESTEIFYPELDSRDIVLGV------EQRVAVLVSLLKVSRMLALIEGDIDWCEYS  996
              G +        P  +      G+       QRVA+ VSL+KV+R LALIE +I     S
Sbjct  599   DGLAVREV----PSWEDLRGAAGMPDFFTQNQRVALFVSLIKVARGLALIENEI---RAS  651

Query  997   SVALEVTDLSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTA  1176
               A E+T L            VKG+ V  P+++L L LTH+++ LR+D+AE + +NPKTA
Sbjct  652   GSASEMTFL------------VKGVAVYAPISFLELGLTHLEEGLRVDSAELICLNPKTA  699

Query  1177  SLPSSLELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIK  1356
              +PS  EL L+R A+PLNMRC STAF+MKW SL +KFFSRVR A +R +K        ++
Sbjct  700   VMPSPFELHLLRVAMPLNMRCSSTAFRMKWTSLLKKFFSRVRVATDRQMK--------LE  751

Query  1357  CLSGSPLNGE-ADQSLKHRAEN-------LFNFMKWLSCFLFFSCYPSAPYERKIMAMEL  1512
                G   NGE A+ +++ + ++       +  FM+WL+  L  S YPSAPYERK MAME+
Sbjct  752   SSKGGYRNGEQANGAIQRKLDSSVVTLAEMQAFMQWLTRLLVSSLYPSAPYERKYMAMEI  811

Query  1513  MLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRI  1692
             + ++L+VW        +D   S+ +  PY K L   + T++L+G+++DSWDRLRES+++I
Sbjct  812   LNVLLDVW------PTTDQLQSKKNFSPYGKELFSADYTMVLLGAVVDSWDRLRESAYKI  865

Query  1693  LLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRV  1872
             LL +PTP+PG+ + E V E + W K L  SPRVRESDAGAL  RLIFRKYV ELGW    
Sbjct  866   LLRYPTPLPGLEAQEKVAEVLQWGKVLANSPRVRESDAGALVLRLIFRKYVCELGW----  921

Query  1873  SCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGV  2052
                                            SL DWL A V EGE++L  ACK SFVHGV
Sbjct  922   ------------------------------RSLNDWLEAGVLEGERNLVTACKHSFVHGV  951

Query  2053  LLTLRYTFEEMDWDSIAVAsnissiklllekilalVMRITSLALWVVSADAWYLPD-EME  2229
             LLTLRYTF E+DW S  V +N++ ++   E++  L++++TSLALWVVS DA  L + E E
Sbjct  952   LLTLRYTFSELDWISDGVRANVAGLRRACERLFKLLLKVTSLALWVVSVDALNLKEKEYE  1011

Query  2230  EMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGT  2409
              +  D     + P+         DD +          P++Q+VMVGCWL+MKEVSLLLGT
Sbjct  1012  GLDED---VEDLPVSDSDDIEGDDDGIGGDDDASLLAPLEQMVMVGCWLSMKEVSLLLGT  1068

Query  2410  IIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKT  2589
             + R  PLP              + + S  I+L+  QLE IG HFL+VLL MKHNGAIDKT
Sbjct  1069  VARGAPLPGCSYNARTGNGVLQSLEESKIIMLESAQLEEIGQHFLQVLLAMKHNGAIDKT  1128

Query  2590  RAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFL  2769
             R GF ALCNRLL S+D RL K+ E WM+QLM+RTV K Q++DDLLRRSAGIPA+F A FL
Sbjct  1129  RVGFVALCNRLLLSSDTRLSKMPEIWMQQLMKRTVLKDQSLDDLLRRSAGIPASFLALFL  1188

Query  2770  SEPEGAPKRLLPKALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKT  2949
             SE +GAP++LLP  LRWLI+  K+ L                 DS+   D          
Sbjct  1189  SEHDGAPRKLLPMGLRWLIDNIKQFL-----------------DSSTSKD----------  1221

Query  2950  RDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTA  3129
                 VVP VHAFN L+  FND NL+TDTSGF AEALIV+I++F+S YW+VRNSA LA+TA
Sbjct  1222  ----VVPVVHAFNTLRVTFNDTNLSTDTSGFCAEALIVAIKAFASPYWQVRNSATLAFTA  1277

Query  3130  LVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNL  3309
             L+ R++GFLNV K+ +ARRA+TG EFF+RYP LH FL  EL+ AT    +G +++     
Sbjct  1278  LLHRIVGFLNVHKQATARRAITGFEFFNRYPALHPFLLEELECATMNLQQGVTQSR----  1333

Query  3310  AKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALT  3489
                +HPSL P+L++LSRL+PS + + T D   P  FMP + +C+ Q NL++R+LASRAL 
Sbjct  1334  ---LHPSLAPILVILSRLRPSIVNTRTDDWLSPSAFMPSVVRCATQCNLKLRVLASRALA  1390

Query  3490  GMVSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCR  3669
              +V+ E L  V+L +  +               LS     +N+IHG+LLQLSSLL +NC 
Sbjct  1391  PLVTAENLLNVLLELCCQ---------------LSKQPVRYNTIHGVLLQLSSLLKSNCT  1435

Query  3670  NLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCI  3849
              ++   ++  I+  +   + + + +G+  +  C I   +FL VL ++L +A  C+    +
Sbjct  1436  EVSQQEQQGQIVVQVFDRIKECTLLGTINRTSCFIAVAAFLGVLQDLLELAYQCQQVPSV  1495

Query  3850  SVIWN-----LLWTLSSECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEE  4014
                       LL   S       +S +P  +D T+ +L+  AA  YF+   +  +  N +
Sbjct  1496  RETMQQLRPVLLHLSSQSISHSDSSAKP--WDSTLVDLKGLAAYIYFSTILRGWQTSNAD  1553

Query  4015  DLIYLRGPPPDSELFKESETQM--SVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPE  4188
                         +   +S   M      F   L  +L+D +YEVR+ATLK L       +
Sbjct  1554  T------ASGQYQTLDQSAAAMTTDTKTFYTTLREALADKMYEVRLATLKAL-------K  1600

Query  4189  SRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNC  4368
             S + +  N++ + +    L    L+ +L + L  E + +C+  IL++   +N+       
Sbjct  1601  SFSTQQVNENFA-VAFTQLDARMLRGLLAERLYTELHPRCVKRILQVFLRWNL-------  1652

Query  4369  GQHEKPTFVGNMDSDSVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSIC  4548
                     VGN       + W+ ++ +Y  ++ +KTRE  V C+  C++ L       + 
Sbjct  1653  ------LAVGNDPQQDPFKIWNTLLGIYNTSKVSKTRESAVRCLGNCMQHL-------LV  1699

Query  4549  SLGNEKVVVVNPSDPSKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQ  4728
             S+  E  +V    D S   VF   ++ + ++I+ HS ASEP+N+R+A + +I++S  L++
Sbjct  1700  SMKAE--MVDRDLDDSDWEVFRGVLETWNDLIRRHSAASEPVNLRRAISSAIISSRCLEE  1757

Query  4729  AQALSPSVSNHQVPDGNKQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCI  4908
             ++ L  +     V         L  Y   +L +W   + LLEDED  LR+QL+L +Q  +
Sbjct  1758  SKWLRENTRMVAV------SPRLKWYRKIVLSVWSVTINLLEDEDIVLRQQLALALQDVM  1811

Query  4909  TSGKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSA-CAVSI  5085
                    H S   VP QVE+V+E S   L   F     + DFL  W+    +S    +  
Sbjct  1812  VPVFKAPHAS---VPAQVERVLETSLAFLKLQFQECDFFYDFLAGWILGDDSSRFGGLQN  1868

Query  5086  ADPVRRVFDKEIDNHHEEKLLISQICCSHLEK-LPVSKLTTEFRDNNICSVLQSWRRRFC  5262
              D VR++FDKE+DNHHEE+LL+ Q+CCSH+E  L   + +TEF        +  WR +F 
Sbjct  1869  TDLVRKLFDKELDNHHEEQLLVVQLCCSHIESFLDSPEHSTEF--------VTKWRGKFL  1920

Query  5263  QQLISFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDS--KSM  5436
              Q ++     +  Q    W+GG+ NH+D F  +Y  LL    LS     G +  S  +++
Sbjct  1921  DQAVACAKWCLELQRSTHWVGGITNHQDVFKHLYRTLLGLLVLSTPKTTGNSSLSSLQAL  1980

Query  5437  VPELLELGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYF  5616
                LLEL  ++     +P+ISNL   ++++ E+  G  +       S   S    F+P+F
Sbjct  1981  KGSLLEL-TSLNEVPLSPMISNLLSRLLQAVEQSTGMNLVADSFRASMHDSYCPDFEPFF  2039

Query  5617  LFR  5625
             L +
Sbjct  2040  LLK  2042



>gb|KGN59577.1| hypothetical protein Csa_3G827200 [Cucumis sativus]
Length=2038

 Score =  1163 bits (3009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/1120 (55%), Positives = 783/1120 (70%), Gaps = 43/1120 (4%)
 Frame = +1

Query  2347  DQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQL--SSDIVLDLRQL  2520
             D +V +     +  VSLLLGTI RKVPLP +    S S  +D  D +    + VLD++QL
Sbjct  935   DAVVCLDSVDKLPNVSLLLGTITRKVPLPAA----SDSFESDPNDSIMPRQEEVLDVKQL  990

Query  2521  EIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSK  2700
             ++IG+HFLEVLLKMKHNGAIDKTRAGFTALCNRLLCS+D RLCKLTESWM+QLMERT +K
Sbjct  991   KVIGDHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSDDQRLCKLTESWMDQLMERTTAK  1050

Query  2701  GQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscs  2880
             GQTVDDLLRRSAGIPAAF A FL+EPEG+PK+LLP+AL+WLI+VA++ L +  + +   S
Sbjct  1051  GQTVDDLLRRSAGIPAAFIALFLAEPEGSPKKLLPRALKWLIDVAERLLQNPIETDCKNS  1110

Query  2881  esssAIDSTMVPDVAAI--------EMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTS  3036
               S    + +  D   I        E  SK RDEGV+PTVHAFNVL+AAFND NLATDTS
Sbjct  1111  NFSKLPSTGLSQDTEPISTHETYPSEKASKIRDEGVIPTVHAFNVLRAAFNDTNLATDTS  1170

Query  3037  GFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHR  3216
             GFSA+A+IV IRSFSS YWEVRNSACLAYTALVRRMIGFLNV KRESARRALTGLEFFHR
Sbjct  1171  GFSAQAIIVCIRSFSSPYWEVRNSACLAYTALVRRMIGFLNVHKRESARRALTGLEFFHR  1230

Query  3217  YPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGD  3396
             YP LH FL  EL +ATE   +G S +  SNLAKVVHPSLCPMLILLSRLKPS I SE GD
Sbjct  1231  YPALHRFLLQELDVATESLDDGCSGDSKSNLAKVVHPSLCPMLILLSRLKPSTIGSEAGD  1290

Query  3397  PFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTS  3576
               DPFLFMPFIRKCS Q+NLRIRILASRALTG+VSNE LP+VILNIAS LP  D+ +M  
Sbjct  1291  DLDPFLFMPFIRKCSSQSNLRIRILASRALTGLVSNENLPSVILNIASGLPVDDSTTMGR  1350

Query  3577  D----LSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWI  3744
             +    L+  +    S+N IHG+LLQL SLLD NCRNL D  KK  IL+DL+ VL   SW+
Sbjct  1351  ESSILLATTTTQYTSYNRIHGILLQLISLLDINCRNLGDILKKSQILNDLVEVLAHCSWM  1410

Query  3745  GSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAY  3924
                  C CPIL+ S L+VL +MLSI R C  SK   VI NLL  LS+ CLD+ TS +  Y
Sbjct  1411  ARSSHCSCPILSTSMLQVLGHMLSIVRKCPRSKSFYVIRNLLLDLSTGCLDVETSHKLPY  1470

Query  3925  FDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQER  4104
             +DPT+AELR+QAA  YFNC  Q   + ++  L   +    D ++   +      ++ QER
Sbjct  1471  YDPTLAELRQQAAICYFNCVLQPFDEEDDATLQKSQRSQSDEDV-PATLMDYPFSQLQER  1529

Query  4105  LIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLL--WLSNIGLQAMLMQ  4278
             LIRSL D  YEVR++T+KWL  FL S E  +A   + S  EI+ +  W+    LQA+L +
Sbjct  1530  LIRSLQDPCYEVRLSTMKWLFKFLKSTE-YSAGLYDLSCHEIRTVDQWIKT-NLQALLTE  1587

Query  4279  LLAVEKNHKCMNYILKIIYTYNMQQYNK--NCGQHEKPTFVGNMDSDSVLQFWDKVVSLY  4452
             LL++EKN++C+ YILK ++ +NM Q+ K  N    E   ++G MD  SVLQFWDK++SLY
Sbjct  1588  LLSLEKNYRCLYYILKNLFAWNMSQFQKFGNGECTEDVVYIGKMDCGSVLQFWDKLISLY  1647

Query  4453  KVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDP--SKLSVFSECID  4626
             K+TRHAKTRE  + CM  CIKRLA  +++ I S   +     +P+    + L  F  CI 
Sbjct  1648  KLTRHAKTRENTIRCMGTCIKRLAVQYSACIVS---DATTTESPNGKISNDLDKFHSCIT  1704

Query  4627  YFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDG-----NKQKD  4791
              F ++I++HS ASEP+NMR AAA SI+ASGLL+QA+     V ++Q+P+      ++ ++
Sbjct  1705  LFTDLIKQHSAASEPVNMRTAAADSIIASGLLEQAEIFGDYVFDNQIPEATVNSHSELRE  1764

Query  4792  ALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKV  4971
               ++YAH+IL++W TC+ LLEDEDD +RK+L+ +VQK  +  ++    +S  VP QVE+V
Sbjct  1765  YANMYAHQILNMWSTCIMLLEDEDDDIRKRLAADVQKYFSLERTA---TSSDVPNQVEQV  1821

Query  4972  IEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNHHEEKLLI  5151
             I  SFE+LSS FGHW+ Y D+L +WV +  +    VS ADPVRRVFDKEIDNHHEEKLLI
Sbjct  1822  IGSSFEYLSSIFGHWVLYFDYLANWVLNTADY--TVSPADPVRRVFDKEIDNHHEEKLLI  1879

Query  5152  SQICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDWIGGV  5331
             SQ CC H+EKL  SKL   +      + L   R+RF  QLI F + Y+    G DWIGG 
Sbjct  1880  SQTCCFHMEKLSRSKLIALWDTQWFMNYLVGLRKRFFLQLIRFADEYMSKHSGFDWIGGA  1939

Query  5332  GNHKDAFLPVYVNLLAFHALSNCILRGEAE--DSKSMVPELLELGEAIQPFLRNPLISNL  5505
             GNHKDAFLP+Y NLL F+A+SNCI+ G+++    + ++ E++E G+ I PFLRNPLISNL
Sbjct  1940  GNHKDAFLPLYTNLLGFYAISNCIVNGKSKVVTMQPLITEVVETGKIINPFLRNPLISNL  1999

Query  5506  FVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             ++LV + HE+      +H + E  G  + W+ FDPYFL R
Sbjct  2000  YLLVTRIHEEAIDVNRDHNIPE-RGHEAIWEGFDPYFLLR  2038


 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/635 (65%), Positives = 491/635 (77%), Gaps = 17/635 (3%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPG--NNDSSVKTILYDGILSELCNFCEHPTDSH  174
             GILTA+ R VLNI F +     D  G+PG  N+ +SVKTILYDGIL ELCN+CE+PTDSH
Sbjct  315   GILTAIPRPVLNIPFSMVEG--DSNGHPGCLNSGNSVKTILYDGILPELCNYCENPTDSH  372

Query  175   FNFHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQ  354
             FNFH+LTV+QICLQQIKTS+          YDP+ EE+G+R+L I+W NL+DPLSQTVKQ
Sbjct  373   FNFHSLTVLQICLQQIKTSLVSNLTDTSCSYDPLPEEMGSRILSIMWTNLDDPLSQTVKQ  432

Query  355   VHLIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKS  534
             VHLIFDLFL+IQ +L W+EGSEK   FLRKIA DLL LG RCKGRY+PLASLTKRLGAK+
Sbjct  433   VHLIFDLFLEIQSSLCWSEGSEKIKLFLRKIAFDLLRLGSRCKGRYVPLASLTKRLGAKT  492

Query  535   ILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLP  714
             +LDMSP LL +T +AY+DDDVC A T+FLKCFLE LRDE WS+DG+EGGY  YR HCL P
Sbjct  493   LLDMSPSLLSETVQAYIDDDVCCAVTSFLKCFLEHLRDECWSSDGIEGGYAIYRGHCLPP  552

Query  715   ILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDI  894
             +L GL SG +KLRSNLNTYALPVL E+D+DSIFPML FI +  S+    I YP  +   +
Sbjct  553   VLHGLGSGISKLRSNLNTYALPVLFEVDLDSIFPMLAFISVWPSSRDNGILYPGNNQGSM  612

Query  895   VLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVAL----EVTDLSTDAGVCDSVVHV  1062
              L VEQRVA+ +SLLKVSR LALIEGDIDW E  S+      E+   S  A     +V V
Sbjct  613   ELRVEQRVAIFISLLKVSRSLALIEGDIDWLEKPSLEQQSIHEIEYFSRYA-----LVFV  667

Query  1063  KGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCC  1242
             KG++V+I V +LLLALTH+D++LR+DAAE LF+NPKT+SLPS LEL+L++KA+PLNMRC 
Sbjct  668   KGVKVEILVEWLLLALTHVDETLRVDAAEFLFLNPKTSSLPSHLELTLLKKAIPLNMRCT  727

Query  1243  STAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENL  1422
             STAFQMKW+SLFRKFFSRVRTALER  K G W P    C   S +    +Q +  RA++L
Sbjct  728   STAFQMKWSSLFRKFFSRVRTALERQFKLGNWIPLASCCNRESYMPNGNEQIVAGRADDL  787

Query  1423  FNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYS  1602
             F FMKWLSCFLFFSCYPSAPY RKIMAM+L L+MLNVW ++P + K +    E  L PY+
Sbjct  788   FQFMKWLSCFLFFSCYPSAPYRRKIMAMDLFLVMLNVWSIVPSKEKCN----ETLLLPYN  843

Query  1603  KGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCS  1782
             +G+ LP+S LLLV SIIDSWDRLRE+SFRILLHFPTP+PGIS   +V + I WAK LVCS
Sbjct  844   EGITLPDSVLLLVVSIIDSWDRLRENSFRILLHFPTPLPGISGEYMVGKIIKWAKVLVCS  903

Query  1783  PRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVV  1887
              RVRESDAGAL  RL+FRKYVL+LGW+VR S  VV
Sbjct  904   SRVRESDAGALALRLVFRKYVLDLGWIVRASDAVV  938



>ref|XP_002960324.1| hypothetical protein SELMODRAFT_74297 [Selaginella moellendorffii]
 gb|EFJ37863.1| hypothetical protein SELMODRAFT_74297 [Selaginella moellendorffii]
Length=2039

 Score =  1153 bits (2982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 752/1919 (39%), Positives = 1069/1919 (56%), Gaps = 242/1919 (13%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFV----VSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTD  168
             G+LTA  R VLN   +    V  DG         ++  V T+LYDGIL  LC   E   D
Sbjct  319   GLLTAAPREVLNYCLLKKVTVEEDGRR------TSNLVVWTLLYDGILPALCAATESSFD  372

Query  169   SHFNFHALTVMQICLQQIKTSMQG--TDGYIEE-----------GYDPISEEVGTRVLKI  309
             SHF FH +T +QICLQQIK S+ G  T   I+E              P S  + +RV++I
Sbjct  373   SHFKFHVMTALQICLQQIKASILGNVTAAAIDELRSVKGAAFTAPATPFSPTMTSRVMQI  432

Query  310   VWNNLEDPLSQTVKQVHLIFDLFLDIQGTLHWAEGSEKFC------SFLRKIASDLLHLG  471
             +WNN EDPL+QTV+QV ++FDL  D+Q +   +EG E         SFL +IA+DLL +G
Sbjct  433   IWNNWEDPLNQTVRQVQMVFDLLADLQSS-STSEGGETAQAQNGTQSFLHQIANDLLTVG  491

Query  472   PRCKGRYIPLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDE  651
                KGRY+PLA+L  RLGA+++L+M PGLLF T  A  DD VC AA++FLK FLE LRDE
Sbjct  492   GHRKGRYVPLATLALRLGAQTLLEMCPGLLFQTIHAMSDDGVCCAASSFLKLFLERLRDE  551

Query  652   YWSTDGVEGGYIKYRAHCLLPILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFI  831
              W+ +GV  G I++R   + P+++G+ +G  +LR NL+TYAL V LE+D DS+  MLGF+
Sbjct  552   CWNNEGVTQGSIRFRQLWVPPMVAGVVAGNPRLRINLHTYALSVGLEIDSDSLLQMLGFV  611

Query  832   GIGCSAESTEIFYPELDSRDI--VLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVA  1005
               G +      +     +  +   L   QRVA+ VSL+KV+R LAL+E +I     S  A
Sbjct  612   LDGLAVREVPSWEDLRGAAGMPDFLTQNQRVALFVSLIKVARGLALMENEI---RTSGSA  668

Query  1006  LEVTDLSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLP  1185
              E+T L            VKG+ V  P++ L LALTH+++ LR+D+AE + +NPKTA +P
Sbjct  669   SEMTFL------------VKGVAVYAPISLLELALTHLEEGLRVDSAELICLNPKTAVMP  716

Query  1186  SSLELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLS  1365
             S  EL L+R A+PLNMRC STAF+MKW SL +KFFSRVR A +R +K        ++   
Sbjct  717   SPFELHLLRVAMPLNMRCSSTAFRMKWTSLLKKFFSRVRVATDRQMK--------LESSK  768

Query  1366  GSPLNGEA---------DQSLKHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELML  1518
             G   NGE          D S+   AE +  FM+WL+  L  S YPSAPYERK MAME++ 
Sbjct  769   GGYRNGEQASGAIQRKLDSSVVTLAE-MQAFMQWLTRLLVSSLYPSAPYERKYMAMEILN  827

Query  1519  IMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILL  1698
             ++L+VW        +D   S+ +  PY K L   + T++L+G+++DSWDRLRES+++ILL
Sbjct  828   VLLDVW------PTTDQLQSKKNFSPYGKELFSADYTMVLLGAVVDSWDRLRESAYKILL  881

Query  1699  HFPTPIPGISSPELVCEAIIWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSC  1878
              +PTP+PG+ + E V E + W K L  SPRVRESDAGALT                    
Sbjct  882   RYPTPLPGLEAQEKVAEVLQWGKVLANSPRVRESDAGALT--------------------  921

Query  1879  NVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLL  2058
                 +  SG              ++ YI SL DWL A V EGE++L  ACK SFVHGVLL
Sbjct  922   ----KPVSG------------DQIVRYIESLNDWLEAGVLEGERNLVTACKHSFVHGVLL  965

Query  2059  TLRYTFEEMDWDSIAVAsnissiklllekilalVMRITSLALWVVSADAWYLPD-EMEEM  2235
             TLRYTF E+DW S  V +N++ ++   E++  L++++TSLALWVVS DA  L + E E +
Sbjct  966   TLRYTFSELDWISDGVRTNVAGLRTACERLFKLLLKVTSLALWVVSVDALNLKEKEYEGL  1025

Query  2236  TVDGACFLERPIEMDVSASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTII  2415
               D     +  +         DD +          P++Q+VMVGCWL+MKEVSLLLGT+ 
Sbjct  1026  DED---VEDLHVSDSDDIEGDDDGIGGDDDASLLAPLEQMVMVGCWLSMKEVSLLLGTVA  1082

Query  2416  RKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRA  2595
             R  PLP              + + S  I+L+  QLE IG HFL+VLL MKHNGAIDKTR 
Sbjct  1083  RGAPLPGCSYNARTGNGVLQSLEESKFIMLESAQLEEIGQHFLQVLLAMKHNGAIDKTRV  1142

Query  2596  GFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSE  2775
             GF ALCNRLL S+D RL K+ E WM+QLM+RTV K Q++DDLLRRSAGIPA+F A FLSE
Sbjct  1143  GFVALCNRLLLSSDTRLSKMPEIWMQQLMKRTVLKDQSLDDLLRRSAGIPASFLALFLSE  1202

Query  2776  PEGAPKRLLPKALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRD  2955
              +GAP++LLP  LRWLI+  K+ L                               S ++D
Sbjct  1203  HDGAPRKLLPMGLRWLIDNIKQFLNS-----------------------------STSKD  1233

Query  2956  EGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALV  3135
               VVP VHAFN L+  FND NL+TDTSGF AEALIV+I++F+S YW+VRNSA LA+TAL+
Sbjct  1234  --VVPVVHAFNTLRVTFNDTNLSTDTSGFCAEALIVAIKAFASPYWQVRNSATLAFTALL  1291

Query  3136  RRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAK  3315
              R++GFLNV K+ +ARRA+TG EFF+RYP LH FL  EL+ AT    +G +++       
Sbjct  1292  HRIVGFLNVHKQATARRAITGFEFFNRYPALHPFLLEELECATMNLQQGVTQSR------  1345

Query  3316  VVHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGM  3495
              +HPSL P+L++LSRL+PS + + T D   P  FMP + +C+ Q NL++R+LASRAL  +
Sbjct  1346  -LHPSLAPILVILSRLRPSIVNTRTDDWLSPSAFMPSVVRCATQCNLKLRVLASRALAPL  1404

Query  3496  VSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNL  3675
             V+ E L  V+L + S+               LS     +N+IHG+LLQLSSLL +NC  +
Sbjct  1405  VTAENLLNVLLELCSQ---------------LSKKPVRYNTIHGVLLQLSSLLKSNCTEV  1449

Query  3676  ADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISV  3855
             +   ++  I+  + + + + + +G+  +  C I+  +FL VL ++L +A  C+    +  
Sbjct  1450  SQQEQQGQIVVQVFNRIKECTLLGTINRTSCFIVVAAFLGVLQDLLELAYQCQQVPSVRE  1509

Query  3856  IWN-----LLWTLSSECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDL  4020
                     LL   S       +S +P  +D T+ +L+  AA  YF+              
Sbjct  1510  SMQQLQPVLLHLSSESVSHSDSSAKP--WDSTLVDLKGLAADIYFS--------------  1553

Query  4021  IYLRGPPPDSELFKESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTA  4200
               LRG    +      +T +S T F   L  +L+D +YEVR+ATLK L            
Sbjct  1554  TILRGWQTSNADIASGQTTVSKT-FYTTLREALADKMYEVRLATLKAL------------  1600

Query  4201  ESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEKNHKCMNYILKIIYTYNMQQYNKNCGQHE  4380
             +S +     +    L    L  +L + L  E + +C+  +L++   +N+           
Sbjct  1601  KSFSTQDFAVAFTQLDARILHGLLTERLYTELHPRCVKRLLQVFLRWNL-----------  1649

Query  4381  KPTFVGNMDSDSVLQFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGN  4560
                 V N       + W+ ++ +Y  ++ +KTRE  V C+  C++ L       + S+  
Sbjct  1650  --LAVDNDPQQDPFKIWNTLLGIYNTSKVSKTRESAVRCLGNCMQHL-------LVSMKA  1700

Query  4561  EKVVVVNPSDPSKLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQAL  4740
             +  +V    D S   VF   ++ + ++I+ HS ASEP+N+R+A + +I++S  L++++ L
Sbjct  1701  D--MVDRDLDDSDWEVFRGVLETWNDLIRRHSAASEPVNLRRAISSAIISSRCLEESKWL  1758

Query  4741  SPSVSNHQVPDGNKQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGK  4920
               +     V         L  Y   +L +W   + LLEDED  LR+QL+L +Q  +    
Sbjct  1759  RENTRMVAV------SPRLKWYRKIVLSVWSVTINLLEDEDIVLRQQLALALQDVMVPVF  1812

Query  4921  SGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSA-CAVSIADPV  5097
                H S   VP QVE+V+E S   L   F     + DFL  W+    +S    +   D V
Sbjct  1813  KAPHAS---VPAQVERVLETSLAFLRFQFQECDFFYDFLAGWILGDNSSRFGGLQNTDLV  1869

Query  5098  RRVFDKEIDNHHEEKLLISQICCSHLEK-LPVSKLTTEFRDNNICSVLQSWRRRFCQQLI  5274
             R++FDKE+DNHHEE+LL+ Q+CCSH+E  L   + +TEF        +  WR +F  Q +
Sbjct  1870  RKLFDKELDNHHEEQLLVVQLCCSHIESFLDSPEHSTEF--------VTKWRGKFLDQAV  1921

Query  5275  SFGNAYIGTQGGVDWIGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDS--KSMVPEL  5448
             +     +  Q    W+GG+ NH+D F  +Y  LL    LS     G +  S  +++   L
Sbjct  1922  ACAKWCLELQRSTHWVGGITNHQDVFKHLYRTLLGLLVLSTPKTTGNSSLSSLQALKGSL  1981

Query  5449  LELGEAIQPFLRNPLISNLFVLVVKSHEKIAGGAVEHLVLEISGAYSAWDAFDPYFLFR  5625
             LEL    +  L +P+ISNL   ++++ E   G  +       S   S    F+P+FL +
Sbjct  1982  LELTSLSEVPL-SPMISNLLSRLLQAVEHSTGMNLVADSFRASMHDSYCPDFEPFFLLK  2039



>ref|XP_009758417.1| PREDICTED: uncharacterized protein LOC104211113 [Nicotiana sylvestris]
Length=1097

 Score =  1043 bits (2698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 559/799 (70%), Positives = 636/799 (80%), Gaps = 16/799 (2%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             GILTAVSR VLNI F++SND          N+ S+K ILYDGIL ELCNFCE+P DSHFN
Sbjct  313   GILTAVSRIVLNIGFLISND----------NEESIKMILYDGILPELCNFCENPIDSHFN  362

Query  181   FHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVH  360
             FHALTVMQICLQQ+KTSM   +G  E  YDPISE++GTR+L+IVWNNLEDPLSQTVKQVH
Sbjct  363   FHALTVMQICLQQVKTSMLDKNGSREINYDPISEDIGTRLLQIVWNNLEDPLSQTVKQVH  422

Query  361   LIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSIL  540
             LIFDLFLDIQ +LHW EGS+ F  F+RK+A DLL LGPRCKGRY+PLASL KRLGA+++L
Sbjct  423   LIFDLFLDIQASLHWVEGSDTFKLFMRKVAFDLLRLGPRCKGRYVPLASLIKRLGARTLL  482

Query  541   DMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
              M P LLF+T KAY+DDDVC A TTFLKCFLECLRDEYWS+DGVE GY KYR HCL P+L
Sbjct  483   SMRPDLLFETIKAYIDDDVCCALTTFLKCFLECLRDEYWSSDGVESGYNKYRGHCLPPLL  542

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVL  900
             SGL SG +KLRSNLNTYALPV+LELDVD+IFPML FIGIGC  ++ E+F  ELD R +  
Sbjct  543   SGLVSGHSKLRSNLNTYALPVVLELDVDAIFPMLAFIGIGCGGDNGEVFLTELDFRGVTP  602

Query  901   GVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVK  1080
              +E+RVAVLVSL KVSR+LAL+EGDIDW   S  + E  +L+ +    D+V  +KGIEVK
Sbjct  603   ALEERVAVLVSLFKVSRLLALLEGDIDWSNNSLSSTEDMELNLENR--DAVACIKGIEVK  660

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +PV YL+LALTHID+SLRIDAAESLF+NPKTASLPSSLELSLM+ AVPLNMRCCSTAFQM
Sbjct  661   VPVKYLVLALTHIDESLRIDAAESLFVNPKTASLPSSLELSLMKVAVPLNMRCCSTAFQM  720

Query  1261  KWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKW  1440
             KW SLFRKFFSRVRTALER +KQG W P   K    + +        + RA+ LFNFMKW
Sbjct  721   KWTSLFRKFFSRVRTALERQVKQGGWQPLAHKDTRRNFVAKGTGDMFEDRADELFNFMKW  780

Query  1441  LSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHM-LPPQGKSDSYSSEISLYPYSKGLIL  1617
             LSCFLFFSCYPSAPYERK MAMEL+LIMLNVW + L  +G  D+ S +  LYPY+KGL+L
Sbjct  781   LSCFLFFSCYPSAPYERKTMAMELLLIMLNVWSIVLSKEGNIDAVSPQFCLYPYNKGLLL  840

Query  1618  PESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRE  1797
             PESTLLLVGSI+DSWDRLRESSFRILLHFPTP+PGI S   V EAI+WAKKLVCSPRVRE
Sbjct  841   PESTLLLVGSIVDSWDRLRESSFRILLHFPTPLPGIDSQVRVSEAIVWAKKLVCSPRVRE  900

Query  1798  SDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSP-SGLSNGENLEFTPSSPVIEYITSLI  1974
             SDAGALT RLIFRKYVL+LGWVV  S N V+  P   L NGEN     + P IEY+ SLI
Sbjct  901   SDAGALTLRLIFRKYVLDLGWVVNASSNDVSPQPLLKLLNGENKACKFAPPAIEYLRSLI  960

Query  1975  DWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekila  2154
             DWL A V+ GEKDLSEAC+ SFVHG LL LRYTFEE+DWDS AV  +IS +K++LEKIL 
Sbjct  961   DWLDAVVQVGEKDLSEACRDSFVHGALLALRYTFEELDWDSDAVVCSISEMKVVLEKILE  1020

Query  2155  lVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQD  2334
             LVMRITSLALWVVSADAWYLP +  E   D A  LE P EMD S ST  D+++  K  +D
Sbjct  1021  LVMRITSLALWVVSADAWYLP-DDMEEMDDDALLLEVPHEMDESLST-SDKVENTKVVRD  1078

Query  2335  DGPMDQIVMVGCWLAMKEV  2391
                 +QIVMVGCWLAMKEV
Sbjct  1079  GRQTEQIVMVGCWLAMKEV  1097



>ref|XP_006431126.1| hypothetical protein CICLE_v100108891mg, partial [Citrus clementina]
 gb|ESR44366.1| hypothetical protein CICLE_v100108891mg, partial [Citrus clementina]
Length=845

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/512 (66%), Positives = 400/512 (78%), Gaps = 5/512 (1%)
 Frame = +1

Query  1     GILTAVSRTVLN-IFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHF  177
             GILTAVSR VLN IFFV   D  +G     N D S KTILY+GIL ELC++CE+PTDSHF
Sbjct  338   GILTAVSRNVLNAIFFVSKEDLSNG---SENGDDSAKTILYNGILPELCSYCENPTDSHF  394

Query  178   NFHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQV  357
             NFHALTV+QICLQQIKTS+      +   YDPI E++GTR+L+I+WNNLEDPLSQTVKQV
Sbjct  395   NFHALTVLQICLQQIKTSILANLTNVSFDYDPIPEDMGTRILRIIWNNLEDPLSQTVKQV  454

Query  358   HLIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSI  537
             HL+FDLFLDI+ +L W  GSE+  SFL+KIASDLL LGPRCKGRY+PLA LTKRLGAK++
Sbjct  455   HLVFDLFLDIESSLRWDVGSERIKSFLQKIASDLLRLGPRCKGRYVPLALLTKRLGAKTL  514

Query  538   LDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPI  717
             L MSP LL +   AY+DDDVCSAAT+FLKCFLECLRDE WS++G+  GY  YR HCL P 
Sbjct  515   LGMSPDLLSEIVNAYIDDDVCSAATSFLKCFLECLRDECWSSNGISRGYAVYRGHCLPPF  574

Query  718   LSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIV  897
             L GL+SG +KLRSNLNTYALPVLL++DVDSIFPML F+ +  S E   + YPELD     
Sbjct  575   LYGLASGVSKLRSNLNTYALPVLLDMDVDSIFPMLAFVSVVPSEEENGLSYPELDCSSFE  634

Query  898   LGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEV  1077
             L VEQ+VAV VSLLKVSR LAL EGDID  + SSV    +   T+     ++V +KGI  
Sbjct  635   LKVEQQVAVFVSLLKVSRSLALAEGDIDLWKNSSVLRTGSKFVTEGSNLYALVCIKGINF  694

Query  1078  KIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQ  1257
             K+ V++L+LALTH D+ LR+DAAESLF+NPKTASLPS LEL+LM++AVPLNMR CSTAFQ
Sbjct  695   KVLVDWLVLALTHADELLRVDAAESLFLNPKTASLPSHLELTLMKEAVPLNMRSCSTAFQ  754

Query  1258  MKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMK  1437
             MKW SLFRKFFSRVRTALER  KQG+W P ++ C +          ++  +AENLF FM+
Sbjct  755   MKWTSLFRKFFSRVRTALERQFKQGSWRP-VVSCENSDRTLINGTDTVISKAENLFKFMR  813

Query  1438  WLSCFLFFSCYPSAPYERKIMAMELMLIMLNV  1533
             WLSCFLFFSCYPSAPY+RKIMAMEL+L M+N+
Sbjct  814   WLSCFLFFSCYPSAPYKRKIMAMELILTMMNI  845



>ref|XP_005644776.1| hypothetical protein COCSUDRAFT_48657 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20232.1| hypothetical protein COCSUDRAFT_48657 [Coccomyxa subellipsoidea 
C-169]
Length=2303

 Score =   533 bits (1372),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 383/1180 (32%), Positives = 578/1180 (49%), Gaps = 198/1180 (17%)
 Frame = +1

Query  304   KIVWNNLEDPLSQTVKQVHLIFDLFLDIQGTLHW--------AEGSEKFCSFLRKIASDL  459
             K  +   ++PL QTV+Q+H  FD  LDI+             A+      +FL   A ++
Sbjct  629   KHSYRTFKEPLQQTVRQIHSAFDALLDIEEVQQEQAAALGLSAQAGAATQAFLEDTAREI  688

Query  460   LHLGPRCKGRYIPLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLEC  639
             ++ G   KG+YIPL +LT RLGA  +L + P L+ +T  A   D VC AA   L+  L  
Sbjct  689   MNAGGHRKGKYIPLRALTSRLGATRLLLLQPALIRNTVNAMAGDAVCPAAAGLLEAVLGS  748

Query  640   LRDEYWSTDGVEGGYI-KYRAHCLLPILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFP  816
             LR E  +  G +   + ++R   L  +L  L+S   +L++N++ Y LPV L +D  S+  
Sbjct  749   LRHECLARSGSQDEAMGQWRDAWLPAVLGALTSANERLQTNVSVYGLPVPLCMDSGSLVV  808

Query  817   MLGFIGIGCSAESTEIFYPELDSRDIVLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYS  996
             +L             I  P   +       + +VA LV++LKV+R L L+  ++D     
Sbjct  809   LL-----------QRILDPAFATPAPGASPDGQVAALVAVLKVARQLQLVR-ELD-----  851

Query  997   SVALEVTDLSTDAGVCDSVVHVKG-IEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKT  1173
                                V V G   + IP   L  A+ H  + L +DA     ++PKT
Sbjct  852   ------------------AVQVPGHAALPIPEALLQRAIGHAHEGLLVDAMTLACVHPKT  893

Query  1174  ASLPSSLELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLI  1353
              ++P  LEL L+ + + L MRC ST+ + KW +L  K   RV T+   V+ +    P   
Sbjct  894   TAMPGPLELRLVARGLLLGMRCVSTSLRNKWTTLVGKLLRRVATSTHGVLHRWASRPD--  951

Query  1354  KCLSGSPLNGEADQSLKHRAENLFN------FMKWLSCFLFFSCYPSAPYERKIMAMELM  1515
                  +P  G AD +   RA +L        F +W+S  L  S YP AP+ERK +AM L+
Sbjct  952   -----AP--GNADPA--DRAHDLAGLRQQAAFTRWVSRALQGSLYPGAPFERKFLAMLLL  1002

Query  1516  LIMLNVWHM--------LPPQGKSDSYS--------SEISLYPYSKGLILPESTLLLVGS  1647
               +L VW+          P  G+ +  S            ++    G + P++ LL  GS
Sbjct  1003  NTLLAVWNTPDKAVRCSSPGIGQQNDGSLADLLRTADAQGVHLLCPGFLGPKTVLL--GS  1060

Query  1648  IIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRESDAGALTFRL  1827
             ++DSWD+LRE++   L+  P P+PG+ +P  V   + WA+KLV SPRVRESDAGA    L
Sbjct  1061  VVDSWDKLRETATEALMALPAPLPGLEAPAQVAALLQWARKLVASPRVRESDAGARLQSL  1120

Query  1828  IFRKYVLELGWVVRV----SCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDWLCAAV  1995
             +FRKYVL+L W V+V    S  V  Q     ++ E   F  +   + ++ SL D L A V
Sbjct  1121  VFRKYVLQLRWRVQVRPDGSAAVDNQRQLSEADAEEESFQAA---LAHLQSLADCLEADV  1177

Query  1996  EEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilalVMRITS  2175
              E E+D + AC+ S  HG LL+LRY   ++ W +        +    L ++ A + R+ S
Sbjct  1178  VESEEDFAAACRHSLAHGNLLSLRYLVPDIPWQA------AKAHPPRLRQMQAWIARVLS  1231

Query  2176  LALWVVSADAWYL--PDE---MEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQDDG  2340
             L L         L  P E   +  M VDG+      +E D      +++ ++A       
Sbjct  1232  LLLRAAETAQHPLSTPQETMAISAMDVDGSDMNFEDLEDDSDGEDSNNDAQLA-------  1284

Query  2341  PMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQL  2520
             P  Q+++ GCWL +KEV+LLLG + R+ PL   + P+S                 +  QL
Sbjct  1285  PRAQVIVTGCWLTLKEVALLLGCLAREAPLSRDEAPESS--------------FFEAVQL  1330

Query  2521  EIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSK  2700
               +G   +  +  +KHNGA++K +AGF AL  RLL    P L +L   W+  L+ER  + 
Sbjct  1331  GGMGERLIHCMGVIKHNGAVEKAQAGFIALSERLLREPAPALNRLPGRWLVALLERVGAP  1390

Query  2701  GQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscs  2880
             GQ  DD++RRS G+P AF A FL+EP G+ K LL   +  L+  A               
Sbjct  1391  GQGRDDIVRRSGGLPFAFVALFLAEPIGSHKTLLHTGMTELLRTA---------------  1435

Query  2881  esssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALI  3060
                   ++T +P+                P VHAFNVL+ AFND NLATD+SGF AE + 
Sbjct  1436  ------NATSLPE--------------PWPRVHAFNVLRLAFNDKNLATDSSGFFAEGVA  1475

Query  3061  VSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFL  3240
              +I   S+S WE+RNSA L +T+LV R +GF NV K E+ +RA+TG EFFHR+P LH++L
Sbjct  1476  AAIGGMSASEWEIRNSASLTFTSLVVRTVGFKNVLKGEAPKRAITGAEFFHRFPLLHSYL  1535

Query  3241  FNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFLFM  3420
              ++LK A       +++         +HPSL P+L+               D   P  F 
Sbjct  1536  LDQLKAAAAAMQSPAAK---------LHPSLYPILM---------------DLLTPAAFA  1571

Query  3421  PFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELP---AIDNHSMTSDLSGL  3591
             P ++  +    L +R LA+RAL  +++ E+L T ++ +   +P    I NH         
Sbjct  1572  PVVKAFASARPLAVRHLAARALAPLIAPEELCTTLMELLDGVPCQAPIANH---------  1622

Query  3592  SNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSD  3711
                    N +HG LLQ   LL+ N  + A  ++++D+++ 
Sbjct  1623  -------NEVHGRLLQTRLLLERNPAS-ATATERDDLINQ  1654


 Score = 68.9 bits (167),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 44/138 (32%), Positives = 61/138 (44%), Gaps = 4/138 (3%)
 Frame = +1

Query  4954  IQVEKVIEMSFEHLSSTFGHWLDYLDFLCHWVQSATNSACAVSIADP--VRRVFDKEIDN  5127
             + VE++   +F+ L    GH   +   L HWV              P  VR++FDKEIDN
Sbjct  2058  LHVEQIERQAFQFLGRCCGHLPAFQRQLMHWVYRPEGRGALEREWQPGAVRKLFDKEIDN  2117

Query  5128  HHEEKLLISQICCSHLEKLPVSKLTTEFRDNNICSVLQSWRRRFCQQLISFGNAYIGTQG  5307
             HHEE LL +Q+    L  L  S            + L +W  +  Q L           G
Sbjct  2118  HHEEPLLAAQLAAWQLRSLCSSLQGPALA--AFSAALTAWLLQVLQDLEETCGRLAEMHG  2175

Query  5308  GVDWIGGVGNHKDAFLPV  5361
              V W GG+ +H+DAF P+
Sbjct  2176  RVSWPGGLTHHQDAFAPL  2193



>ref|XP_001418331.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96624.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=1870

 Score =   426 bits (1094),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 374/1316 (28%), Positives = 600/1316 (46%), Gaps = 216/1316 (16%)
 Frame = +1

Query  28    VLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFNFHALTVMQI  207
             VL  F + ++D    L    + D+     ++  +L  +C F EH  D H  FHA+T +++
Sbjct  243   VLRGFIITADDA--ALARRRDGDA-----IFHDVLPAICEFIEHGDDVHHRFHAVTCLKV  295

Query  208   CLQQIKT--SMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVHLIFDLFL  381
              L+++K+  SM     +  + +D I+  + +R     W   ED    TV+++   F L L
Sbjct  296   ALEKMKSAASMGALKTFPRDAFDRIAFVIASR-----W---EDTFGHTVREIQTCFGLLL  347

Query  382   DIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSILDMSPGLL  561
             DI      A+    +  ++ ++ S  L      K +Y+ L  L  + GA  IL     LL
Sbjct  348   DIIVDSFEAQ----YDDYVDRVISRALRRPAEQKSKYLALRVLITKFGATRILTADLDLL  403

Query  562   FDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPILSGLSSGF  741
               T  A  +  +  AA++ L         E  S         K+R    LP ++   S  
Sbjct  404   SKTLDAMREASIAPAASSMLADLSSAYMSELKSIS-------KWR-EWWLPCVTRCVSAE  455

Query  742   AKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVLGVEQRVA  921
             +K R+ + TY LP+  + D +S+      +       S E    + D R+     +  +A
Sbjct  456   SKARAPIVTYVLPLFFKQDGESVIEFTKHL-------SNE---AKRDYRN-----DNLIA  500

Query  922   VLVSLLKVSRMLALIEGDIDWCEYSSV-ALEVTDLSTDAGVCDSVVHVKGIEVKIPVNYL  1098
              +VS+LKV+R L ++    D    + V A    D ST +   D +V          +++ 
Sbjct  501   AVVSVLKVARNLQMV----DPSRITVVRAAANGDASTPSYEVDQIV----------IDH-  545

Query  1099  LLALTHIDDSLRIDAAESLFINPK--TASLPSSLELSLMRKAVPLNMRCCSTAFQMKWAS  1272
               A+  +D + R+D  E L +  +  +A+LP S EL L+++ V  N+R  S +F+    +
Sbjct  546   --AMASVDKTARLDVLEWLCLEGRRGSATLPGSYELKLLKRMVSANLRGESVSFRSAIVT  603

Query  1273  LFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLK---HRAENLFNFMKWL  1443
             L  K F R+ T + + I Q            G   N   D  LK    RA  +  F+  +
Sbjct  604   LVSKVFVRMWTGVNQ-IGQKVRRRGEAAIKKGIVTNRAKDDPLKSDIERATEVHAFVAEI  662

Query  1444  SCFLFFSCYPSAPYERKIMAMELMLIMLNVW-----------HMLPPQGKSDSYSSEISL  1590
              C L  + YP AP+ER+  A+EL+ ++ + W           H     G     +  +  
Sbjct  663   VCVLIANVYPGAPFERRCTALELLNVIADTWKTADDFELTEKHGTVEHGHDVIIARRLLT  722

Query  1591  YPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKK  1770
              PY   +     T LL+G+++DSW++LR ++F +L   P P+ GI +PE++ + + WA +
Sbjct  723   SPYDAYMRDEAFTNLLLGALVDSWEKLRMTAFDLLRRHPAPLAGIETPEILAKRLEWALQ  782

Query  1771  LVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPV  1950
             L+ SPRVRES A AL  RL+ RKY  +L W  R+    VTQ      +  ++    S   
Sbjct  783   LLRSPRVRESGAAALLIRLLIRKYGFDLNW--RIHLGPVTQVVEHARDAADV--AKSGAT  838

Query  1951  IEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissik  2130
             I+ + SL D L   +   E+D+ +A ++S  HG +L  R+   E+D +     S    I+
Sbjct  839   IQVMESLCDLLEQDIALAERDVMKASQRSLAHGAVLLTRFALCEIDLNGKFDESTQKRIQ  898

Query  2131  lllekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEM  2310
                 +++AL  R T LAL  +S      PD +      GA   E      V     DD M
Sbjct  899   DSASRLMALAGRATDLALDFISQ-----PDAL------GATAEE------VKTLQHDDLM  941

Query  2311  KIAKAEQ-----DDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDG  2475
               A+        D  P  QI+   CWL +KE SLL G II                    
Sbjct  942   DDAEDVDDDASLDLAPKAQIITTACWLTVKETSLLTGEII-----------------ASS  984

Query  2476  TDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKL  2655
             TD  S D +      +  G   ++VL  +KH GA++KTR G TA+C+RL+ S+D  +  L
Sbjct  985   TDVFSFDAI------KSTGERLMKVLFAVKHTGALEKTRIGMTAVCSRLMRSDDAAMKAL  1038

Query  2656  TESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVA  2835
              + W+E L+++    GQ + D +RRSAG+P AF +  L+EP+G P+  L  AL  L+++A
Sbjct  1039  PQRWLEDLLDQLNRPGQGIRDRVRRSAGLPYAFMSILLAEPKGQPRLALDGALPRLLDIA  1098

Query  2836  KKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDA  3015
                ++                                      +P VHAFNV++  F D 
Sbjct  1099  SGVVSSD------------------------------------IPRVHAFNVIRVIFADR  1122

Query  3016  NLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKR-----ESA  3180
             +L  DT+ ++A  + V I +FSS  WE++N+A LA+ +L+ ++ G++N   R        
Sbjct  1123  DLTMDTTPYAARGVQVCIDAFSSPTWEIQNAATLAFASLLTKVCGYMNTVTRARHFTADG  1182

Query  3181  RRALTGLEFFHRYPTLHTFLFNELKIATELF-LEGSSENLTSNLAKVVHPSLCPMLILLS  3357
             R  +  +EFF R+PTL T+L  EL+ AT L  LE S +         VHPSL P+L LLS
Sbjct  1183  RHEVKFVEFFQRFPTLMTYLGAELEKATSLSCLETSLD---------VHPSLYPILALLS  1233

Query  3358  RLKPS-------PITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLP  3516
             RL+PS           + GD F    F+P +R C     L +R  A+RA+  ++ + +L 
Sbjct  1234  RLRPSLDKDKSAYTDGKCGDDF----FVPLVR-CMSGRYLAVRTAAARAMVPILPSTRLC  1288

Query  3517  TVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKE  3696
               I  I            T +L    NLNA    IHG LL    +++   R+   FS  +
Sbjct  1289  EYIDKI-----------FTFELVDKVNLNA----IHGALLCFLEVINEVRRSA--FS--D  1329

Query  3697  DILSDLIHVLGKHSWIGSPQ---KCPCPILNCSFLKVLDNMLSI---ARTCEMSKC  3846
             D+             +   +     PCP+++ ++L+  + +++I    R C  S C
Sbjct  1330  DVCWAAFSADASRRLVAFAECAVGAPCPMISATWLRCAEAIVAIENSKRKCARSNC  1385


 Score = 74.7 bits (182),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 72/296 (24%), Positives = 127/296 (43%), Gaps = 53/296 (18%)
 Frame = +1

Query  4621  IDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGNKQKDALH  4800
             +D F   +   S  ++    R+AA  ++    LL     L  ++ N +     +Q+ +  
Sbjct  1585  LDKFTRALSIGSAPAQSAETRRAAVDALARGDLL-----LYLNLENVK-----RQESSHD  1634

Query  4801  LYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGVVPIQVEKVIEM  4980
               A   L  W   + L+EDED  +R + S+ + + +      +H          E+ +  
Sbjct  1635  FPAQVALSTWKCALTLVEDEDVEIRAKASIAISRAVAPTVPSAH---------SEESLCD  1685

Query  4981  SFEHLSSTFGHWLDYLDFLCHWVQSATNS----ACAVSIADPVRRVFDKEIDNHHEEKLL  5148
             +F H+ S F    ++ D+     +   +     A  +S A  VRR+FDKE DN H E LL
Sbjct  1686  AFAHMHSNFAGLREFDDYCVQLARGLAHDEASFASVISNATSVRRLFDKEADNIHAEPLL  1745

Query  5149  ISQICCSHL-EKLPVSKLTTEFRD--NNICSVLQSWRRRFCQQLISFGNAYIGTQGGVDW  5319
             ++QI  +H  + L V +     RD    I  +L++ R                +   V W
Sbjct  1746  LAQIAATHASQTLDVERAREGLRDVTERIECMLRALR---------------ASPEDV-W  1789

Query  5320  IGGVGNHKDAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEAIQPFLRN  5487
             +GG+  H+  FLP+          SN IL G +  +K++  + L  GE+ +  +R+
Sbjct  1790  VGGIAGHEACFLPI----------SNAIL-GASVFAKALERQNLPSGESFRETMRS  1834



>emb|CEF98528.1| Armadillo-type fold [Ostreococcus tauri]
Length=1890

 Score =   419 bits (1077),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 349/1268 (28%), Positives = 590/1268 (47%), Gaps = 199/1268 (16%)
 Frame = +1

Query  115   LYDGILSELCNFCEHPTDSHFNFHALTVMQICLQQIKTSMQGTDGYIEEGYDPISEEVGT  294
             ++D +L  LC+  E   D H+ +HA++ ++  L+++K +M G       G   +  +   
Sbjct  314   IFDNVLPRLCSLIESAGDVHYRYHAVSCLRAVLEKVKDAMMG-------GSSVVPHDAFE  366

Query  295   RVLKIVWNNLEDPLSQTVKQVHLIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGP  474
             RV   + +  ED L+QTV++    F L LDI  ++   +       ++ +I    +    
Sbjct  367   RVASTISSLWEDSLTQTVREGQTCFRLLLDIAPSVR-GDAETHDIDYVDRIVERTMQRPV  425

Query  475   RCKGRYIPLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEY  654
               K +Y+ L  L +++GA+ IL   P +L +T  A     + SAA+T L         E 
Sbjct  426   EQKSKYLALQVLVEKVGARRILAAEPNVLANTLGAMRQTAISSAASTALDDLSAVYLKEL  485

Query  655   WSTDGVEGGYIKYRAHCLLPILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIG  834
              S D       K+R    LPI+    S     R+ + TY LP+ ++ D++SIF +     
Sbjct  486   ASVD-------KWR-QWWLPIVK--ESILVDDRATVVTYVLPIFIKRDIESIFDL-----  530

Query  835   IGCSAESTEIFYPELDSR--DIVLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVAL  1008
                    T+    E + +  DI L      + +VS+LKV+R L L++ D           
Sbjct  531   -------TKCLVDEANEKKNDIRL-----CSAVVSVLKVARSLQLVDPD-----------  567

Query  1009  EVTDLSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPK----TA  1176
                 +   AG  D        E  +  N +  A+   D S R+D  E L +  +    T 
Sbjct  568   --HIVVIRAGKNDR-------EYAVEQNVIERAMVCADKSTRLDVLEWLCLEGRKGQATV  618

Query  1177  SLPSSLELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIK  1356
             +LP   EL L+++ +  N++  + AF+    +   K F+R+   +  V  Q         
Sbjct  619   ALPGEYELELLQRMIASNLKGETVAFRNALVTSVSKVFARIWVGVNHV-GQKLRRRGEAA  677

Query  1357  CLSGSPLNGEADQSLKH--RAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLN  1530
               +G+   GE D    H  +A+    FM  +   LF + YP APYER+  A+EL+  ++ 
Sbjct  678   LKNGAQKVGEVDALKAHVQKAQRAHVFMSDIVRVLFSNLYPGAPYERRCTALELLNSVVE  737

Query  1531  VWHMLPP-QGKSDSY--SSEISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILLH  1701
              W       G+++    + ++   PYS  +     T LL+G+++DSW+++R ++F++L  
Sbjct  738   SWKSYGDISGRNNDLIIAKQLLSSPYSVFMQDEAYTSLLMGALVDSWEKMRMTAFKLLRR  797

Query  1702  FPTPIPGISSPELVCEAIIWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCN  1881
               +P+ GI +PE + + + WA +L+ SPRVRES A AL  RL+  KY+ EL W + +S +
Sbjct  798   HASPLAGIETPEKLAKQLEWALELLHSPRVRESGAAALMIRLLIHKYIFELNWNIELSPH  857

Query  1882  V-VTQSPSGLSNGENLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLL  2058
             V V Q       GEN + T     ++ +  L D L   +   E+D+ E C++   HG +L
Sbjct  858   VRVAQG----HQGENRDSTN----LQVLKMLCDLLEQDIYAAEQDIIEGCRRCLAHGAIL  909

Query  2059  TLRYTFEEMDWDSIAVAsnissiklllekilalVMRITSLALWVVSADAWYLPDEMEEMT  2238
               +YT  ++++            +  + +++ L+ R T +AL  +S      PD +    
Sbjct  910   LAKYTLCDLNFK----GDTREHTQDAMNRMMTLMERATHMALDFISQ-----PDAL----  956

Query  2239  VDGACFLERPIEMDVSASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIR  2418
               GA   E  ++ D  ++  DD  ++     D  P  QI+   CWL +KE+SLL G ++ 
Sbjct  957   --GATAEEVILQSDDQSNINDDMEELL----DLAPKAQIITTACWLTVKEISLLTGEVM-  1009

Query  2419  KVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAG  2598
                              D  D  S D+V      + +G   + VL  +KH G + +TR G
Sbjct  1010  --------------SAPDTADLFSFDVV------KAVGERLISVLFTVKHTGVLARTRIG  1049

Query  2599  FTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEP  2778
              TALC  L+ ++   L  L E+W+  L ++     Q + D +RRSAG+P AF A  L+EP
Sbjct  1050  LTALCACLMRNSSNALKALPETWLNGLFDQLNRPEQGIRDRVRRSAGLPYAFMAILLAEP  1109

Query  2779  EGAPKRLLPKALRWLINVA--KKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTR  2952
             +G P+  L  AL  L+++A  + S +D                                 
Sbjct  1110  KGQPRVALESALPKLLDIACGETSTSD---------------------------------  1136

Query  2953  DEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTAL  3132
                 +P VHAFNV++  F D +L+ DT+  ++  + V I +FSS  WE++N+A LAY++L
Sbjct  1137  ----IPRVHAFNVVRVIFADKDLSVDTTTHASRGVQVCIDAFSSQTWEIKNAATLAYSSL  1192

Query  3133  VRRMIGFLNVQKRE-----SARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENL  3297
             + ++ G++N   R+       R  +   +F  RYPTL   L  EL++AT          L
Sbjct  1193  LTKVCGYINTVTRQRMFTSDGRHEVKLADFARRYPTLMGHLLRELEVAT--------ATL  1244

Query  3298  TSNLAKVVHPSLCPMLILLSRLKPS--PITSETGDPFDPFLFMPFIRKCSLQNNLRIRIL  3471
                 A  VHPSL P+L L SRL+PS       +GD      F+  IR+C     L +R +
Sbjct  1245  HLPTAVDVHPSLYPILALFSRLRPSLERDLHSSGDK-----FIATIRRCVSGKYLAVRTM  1299

Query  3472  ASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSL  3651
             A+RAL  ++S+ +L   I +I               L   S +    N++HG LL +  +
Sbjct  1300  AARALVPLLSSTRLCEYIEDI---------------LELRSLVAPGLNAVHGALLCVLEI  1344

Query  3652  LDTNCRNLADFSKKEDIL-SDLIHVLGKH--SWIGSPQKCPCPILNCSFLKVLDNMLSIA  3822
             ++     +   +  ED+  SD +  + +   S+ G       P+++ ++L+  +  LS+A
Sbjct  1345  IN----EVRSSTYAEDVCWSDFVDGVSRRLISFAGIAVTSRSPLISATWLRCAEATLSVA  1400

Query  3823  RTCEMSKC  3846
              +C+  KC
Sbjct  1401  NSCQ--KC  1406



>ref|XP_003289307.1| hypothetical protein DICPUDRAFT_153668 [Dictyostelium purpureum]
 gb|EGC34153.1| hypothetical protein DICPUDRAFT_153668 [Dictyostelium purpureum]
Length=2048

 Score =   408 bits (1048),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 433/1803 (24%), Positives = 791/1803 (44%), Gaps = 296/1803 (16%)
 Frame = +1

Query  34    NIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFNFHALTVMQICL  213
             NI+  ++   Y+ L     N++    I+Y GI    C +     D H  F +L    +CL
Sbjct  343   NIYSSLTKPIYNKL-----NENIFLNIIYKGI----CEYSIGSVDQHNRFISLEYFDLCL  393

Query  214   QQIK---TSMQGTDGYIEE-----------GYDPISEEVGTRVLKIVWNNLEDPLSQTVK  351
              +IK     ++    + +E            Y+   +      L++VW N E  ++    
Sbjct  394   SKIKEWLVILEQEKTFKKEDLIQNIFPNLNNYEDFFKNFFNMGLELVWRNWESTINNIST  453

Query  352   QVHLIFDLFLDIQGTLHWA-----EGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTK  516
                 +FDL L    T+H+        +     F++ I   L+      K +YI L  + +
Sbjct  454   LATEVFDLLL----TIHFKCCDVNTDNSNSSLFIKNITIRLIDEDWYQKNKYILLKYILE  509

Query  517   RLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDG-----VEGG  681
             R+GA  ++++    L +   A +D  +C++   FL+ F+E L+ ++  T+       EG 
Sbjct  510   RVGAIFMINLRGNFLKNIFSAMIDHTICNSVRVFLELFIEQLKLDFKPTNEPNMEVKEGE  569

Query  682   YIKYRAHCLLPILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTE  861
               K   + + P+L  L+   +   S +  YALPVLL++  +S+F +L  +    S  + +
Sbjct  570   LTKIEQYWIYPLLEVLTETDSVTSSRIIVYALPVLLKVFPESLFKILDILINRSSGANQD  629

Query  862   IFYPELDSRDIVLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGV  1041
             +F       +I   +  R+++  +LL  SR L+LI+G     +Y  +  +          
Sbjct  630   LF------NNINYNIRLRISL--ALLNSSRQLSLIDGRKLQSKYYDLIEK----------  671

Query  1042  CDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAV  1221
                                  +L + D+SLR+   E + ++PK     +  EL L++  +
Sbjct  672   ---------------------SLQNQDESLRLLGLELVCVSPKQTERVTIRELKLIKNFI  710

Query  1222  PLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIK-QGTWHPSLIKCLSGSPLNGEADQS  1398
              LN++  S   + +  S   +F+ R+R +  +V + Q   + S+ K       N  AD  
Sbjct  711   LLNLKGSSPFIRNQSLSTLFRFWLRLRESCCKVFRAQSNTNISIEK----DDANASADDR  766

Query  1399  LKHRAENLFNFMKWLSCFLF-FSCYPSAPYERKIMAMELMLIMLNVWHML---PPQGKSD  1566
                  E+L +++ W SC LF ++ YP AP+ RK++ +E     +++W       P+ KS 
Sbjct  767   Y-MTIEDLIDYINW-SCQLFTYNIYPDAPFPRKMLPLEAFSQFVDIWSSKCNNTPEKKSL  824

Query  1567  ----SYSSEISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSP  1734
                  Y  + S+  YS+     EST +LV ++ D++DR RE S  ILL FP+P+PG+ S 
Sbjct  825   FEFLEYVEKKSVLLYSR-----ESTEILVNNLWDNYDRCREVSTDILLKFPSPLPGMESE  879

Query  1735  ELVCEAIIWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSN  1914
             E +   ++WA KL CSP+ RE D GA   +L  +KYV+  G V     +  T +P   + 
Sbjct  880   EKIIPFLLWAVKLACSPKARECDTGAFALKLYLKKYVIPNGLVPIFHSS--TTNPVTFTT  937

Query  1915  GENLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWD  2094
               ++    ++ ++E+I+ ++  L +      K L EA K + +HG++L+LRY   E+ + 
Sbjct  938   HSDI----NTAILEFISQILRILKSQTRIANKSLLEAAKFAPMHGLILSLRYVLAEISFQ  993

Query  2095  SIAVAsnissiklllekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIE  2274
              I            L   +  +M++ S  +  V AD     +   +  ++    L   + 
Sbjct  994   DINKNPEQKKQWKNLVAEIIELMKLVSGIVLRVVADLAPEGNNPNQAKLEQNDNLPNSLP  1053

Query  2275  MDV--------------SASTPDDEMKI-------------------AKAEQD-DGPMDQ  2352
               V              S S  D+E +                    AK+ Q+  G + Q
Sbjct  1054  SGVIYDDDERLANNFASSVSMADEEFEDNEDQNDEEEEEGGDLSEEAAKSGQNLQGGVGQ  1113

Query  2353  IVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEIIG  2532
             I+ V  W   K++SL+LGTI+ +V +P+ +   S S IT              +Q+E IG
Sbjct  1114  IITVCSWQCTKQISLVLGTILDRVDMPSKESEDSQSIITT-------------QQIEDIG  1160

Query  2533  NHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQTV  2712
             + F  +LL+ +H GAI+KT  GF  LC+ L+ S++ RL  L   W+  L ER   K Q++
Sbjct  1161  DQFFTILLQSRHKGAIEKTYLGFQVLCSTLMKSSNTRLNCLPSKWINFLFERV--KEQSL  1218

Query  2713  DDLLRRSAGIPAAFTAFFLSEPEGAPK--RLLPKALRWLINVAKKSLTDknkensscses  2886
               + RRSAG+P AF      E     +   LL + +  L+ +A    TD           
Sbjct  1219  -QITRRSAGLPFAFIGILTGESTSHLRVHHLLHQVMENLLTLAGN--TD-----------  1264

Query  2887  ssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVS  3066
               A DS         E  +       +P VH+ N+LK+ F    +  +   + A  LI  
Sbjct  1265  -EAFDSN--------EPNNNVEKNIYLPQVHSINILKSIFRAKAIIQELDQYLARTLITV  1315

Query  3067  IRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFN  3246
             I++FSS  W VRNSA +A++ LV R+IG   ++   S     T   FF R P++++FL +
Sbjct  1316  IKAFSSKSWSVRNSATMAFSVLVDRIIGTKKLKADNSIINTTTFYHFFSRMPSVYSFLLD  1375

Query  3247  ELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMPF  3426
               K +    L    EN      K++  S+  +L+L SRL+PS I     DP  P  F+P 
Sbjct  1376  YFKRS----LTFIKENTLIEEGKIIQSSVYAILVLFSRLQPSNI-DHPNDPLAPAAFVPL  1430

Query  3427  IRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNA  3606
             I +C   +N  +R +++RAL  ++S  +L   + ++  +L    N   T      SN+N 
Sbjct  1431  ISQCCQFSNYMVRQISARALVPLISTIELIPFVRDLLKKL----NFETTDK----SNINT  1482

Query  3607  SFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPILNCS  3786
               N +HG+LLQ+  L+  +   +    +++ I + +   + +  WI   +  P   +  S
Sbjct  1483  --NKVHGILLQIYHLVKGHLPTINPKEREQTISTIVSEFIPEMLWITESKTLPLGFIFYS  1540

Query  3787  FL--------KVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPTIA  3942
              L         +L+N   I     + K  S++    +     CL ++ +   +  +  + 
Sbjct  1541  ILIELQKNSSNLLENQQEIISPI-IEKSKSILLTNKFDTKVTCLPMFYTWIESISEFVLV  1599

Query  3943  ELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQERLIRSLS  4122
             +L++Q       C   T+ +  ++                          + E L++   
Sbjct  1600  DLKRQ-------CKNDTTAEQRKQ--------------------------YNEILMKLFL  1626

Query  4123  DALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEKNH  4302
              +LYE++I T+K+LL               K+Q  +  + L    LQ  +++++  + N 
Sbjct  1627  HSLYEIKIFTMKFLL---------------KNQKIVNQV-LDQQELQNQIIRIILNDPNI  1670

Query  4303  KCMNYILKIIYTYNMQQYNKNCGQHEKPTFVGNMDSDSVLQFWDKVVSLYKVTRHAKTRE  4482
              C     K++   ++    +N          G  ++ S + F++ + +      ++  +E
Sbjct  1671  NCRKKAFKLLSFLSLPLSIENIE--------GTNNTQSNINFYELLCNTIWGQSNSMKKE  1722

Query  4483  MLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECIDYFVEVIQEHSDA  4662
              ++      +K+      +   SL  +++ V               +D +V++++E S  
Sbjct  1723  SII-IFGHYLKQFYQQRITENISLNEQQIKV---------------LDNWVKMVKEFSQI  1766

Query  4663  SEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGNKQKDALHLYAHKILDLWFTCM  4842
              +P+ +R+A  ++I A G L   +    S+ N              L +   ++ WF   
Sbjct  1767  HQPLELRQAITEAIEACGDLIFTKL---SIDN-------------QLLSKVAIESWFALS  1810

Query  4843  KLLEDEDDGLRKQLSLEVQKCITSGKSGSHFS---SGVVPIQVEKVIEMSFEHLSSTFGH  5013
              L++D+D+ LR   ++   + I   K+ S  +   S +V ++  K +E  F +L+  F +
Sbjct  1811  LLIDDDDEPLRDFTAILASRVIYLVKNPSSSTINDSEIVIMEGSKCLEEIFSNLTLQFSN  1870

Query  5014  WLDYLDFLCHWVQSATNSACAVSIAD--PVRRVFDKEIDNHHEEKLLISQICCSHLEKLP  5187
             + DY+  L  +V     +   +   D    + +FDKE DN+ EE+L+  Q+    +E++ 
Sbjct  1871  YNDYI--LSRYVDILNINKKNIFNEDFQNSKVLFDKEKDNYFEEQLVKIQLINQQIERMD  1928

Query  5188  VSK  5196
              SK
Sbjct  1929  QSK  1931



>gb|EXX78916.1| Trm732p [Rhizophagus irregularis DAOM 197198w]
Length=2046

 Score =   372 bits (956),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 411/1756 (23%), Positives = 765/1756 (44%), Gaps = 253/1756 (14%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             G+L+ + R VL   F +S      +    +NDS+ KT+ +   LS + NFC++  +S   
Sbjct  376   GLLSNLDRKVL--IFPLSGKFQFKISILRSNDSNPKTLHHILFLS-IANFCDNALNSQTK  432

Query  181   FHALTVMQICLQQIKTSMQG--TDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQ  354
               A   M + LQ+ + +++   T    +     ++ EV  +++  V +N EDP+     +
Sbjct  433   VLAFETMGLWLQETENTLRNDETSKLYDNNNSILNSEVLEKLMSYVLDNWEDPVDAIQFK  492

Query  355   VHLIFDLFLDIQGTLHWAEGSEKFCS-FLRKIASDLLHLGPRCKGRYIPLASLTKRLGAK  531
             V  IF+  LDI       E S +F + +L  + + LL +    K +Y  L  L  R+G  
Sbjct  493   VKTIFEKLLDIISLKSQLEQSAEFYNDYLVNLLNQLLIMDQYRKVKYSLLLLLLPRVGTV  552

Query  532   SILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAH---  702
              IL + P  +  T +   +  +   A+  +  FL+   +E +S++  +    K       
Sbjct  553   KILSIQPEFVSKTLEVLHNLVIAPRASAMMVTFLDLHLEELFSSEFRDITIKKDEKREEI  612

Query  703   -------CLLPILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTE  861
                     L PI  GLSS    LR N+  + L  L +    S + ++            +
Sbjct  613   VNEWIDLWLTPICQGLSSSDDILRKNIGAFILQPLFKAKSSSFWRII------------D  660

Query  862   IFYPELDSRDIVLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGV  1041
             I        + +     R+  L+ +LKV R L  ++G++             + S D   
Sbjct  661   ILQNNKHGNEFINNERYRLNALIMVLKVGRSLDFVDGNM-----------FIENSIDT--  707

Query  1042  CDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAV  1221
                  + K I +++    L  A+ H+D +LRID    +  + K  S  +S EL+L++   
Sbjct  708   -----NRKNIRLQL----LRDAIYHLDLNLRIDVLGLICESRKLTSEITSTELALLKSFF  758

Query  1222  PLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSL  1401
              LN+   S  F+ K      KFF+++R  L    K    H   ++    S   G+A   +
Sbjct  759   QLNLNSTSPEFRQKLFGHLNKFFAKLRGNLYNQWKNYQSHMKYVESHKDSR-TGDAHSEI  817

Query  1402  KHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHM--LP-PQGKSDSY  1572
             K + +N  +F+ WL   L  S YP A ++R   A++  +I++  + +   P P+G    +
Sbjct  818   KQKIDNTRSFLNWLIELLTASLYPGASFQRVSSALKTFVILIKTFGIENTPLPEGFVAQH  877

Query  1573  SSEISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEA  1752
                   +P+   L    +T L++  +++ +D  R  ++ IL  FP+P+PGI S + V + 
Sbjct  878   CRTPE-FPFQLSLASARNTKLILHCLMNPFDENRTLAYEILQEFPSPLPGIESKDNVQKI  936

Query  1753  IIWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEF  1932
             + WA + + S R  ESD+GA+ FRLIF KYVL L     +  +V  +    L + + ++ 
Sbjct  937   LFWALQSMTSTRAGESDSGAMIFRLIFSKYVLNLN----LDLDVEIKQSERLEDYKKVDI  992

Query  1933  TPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAs  2112
                 P I +   L   L   +    ++L  A +K  +HG LL L+Y F+E+D++S+ V +
Sbjct  993   ----PSINFTRKLFSLLKKQINIASENLLLASQKFPMHGTLLALQYIFKELDYNSLEVKN  1048

Query  2113  nissiklllekilalVMRITSLALWVVS--ADAWYLP---DEMEEMTVDGACFLERPIEM  2277
             N+   +      ++L+ ++  + L V+S  +    +P    EMEEM  +    L+     
Sbjct  1049  NLEEWRDTHSHAISLINKVCQIVLEVLSNPSPEGNVPASFQEMEEMIDELVLNLDE----  1104

Query  2278  DVSASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSC  2457
                   PD E        + GP  Q+++  CW A+KE S LL  I+ + P+       S 
Sbjct  1105  -----DPDRE--------EGGPKHQVILSCCWRAVKEASSLLAIILSRAPI-------SV  1144

Query  2458  SQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSND  2637
             S  T+ +       +LD  ++   G+ F  +L  ++H GA      G+ A+C+RLL S+ 
Sbjct  1145  SLETNFS-------ILDYEKIRKGGDLFRTLLTSIRHRGAFSAVYPGYVAVCSRLLSSSQ  1197

Query  2638  PRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALR  2817
              +  +L + W+E  +   ++   ++    RRSAG+P    A    EP    K LLP  ++
Sbjct  1198  VKFVELPKMWLEDNINNIMANSVSIT---RRSAGLPLCILAIISGEPSNC-KVLLPWTIK  1253

Query  2818  WLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLK  2997
              LI +  ++ +D         +    IDS                       VHAFN+L+
Sbjct  1254  TLIEIGSQAPSD---------DFDQTIDSHQ---------------------VHAFNILR  1283

Query  2998  AAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRES  3177
             + F DA L TD   + ++  I++I+ FSS  W VRN + + ++ L++R  G    +    
Sbjct  1284  SIFMDAKLGTDVLPYVSDGFILAIKGFSSPSWAVRNCSVMLFSTLLQRTFGVRKTKDEYH  1343

Query  3178  ARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLS  3357
             +   LT  EFF R+P L+ FL +ELKIA +  ++ +  + ++     VHP L P+L LLS
Sbjct  1344  SINKLTRREFFSRFPQLYPFLLDELKIAVDQLIKSTKVSQST-----VHPGLYPILTLLS  1398

Query  3358  RLKPSPITSE----TGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVI  3525
             RL PS +       T +PF   +              + R +A+RA+  ++ +  L    
Sbjct  1399  RLHPSLMDGSSSVLTMNPFVSLVLSCSSSPIH-----KTREIAARAIVPLIPSNDLIVTC  1453

Query  3526  LNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCR-NLADFSKKEDI  3702
               + +E             S +SN     N +HG L+Q+  LL  + R N+A+F   +D 
Sbjct  1454  SKLINE-------------SVMSNQ----NELHGRLIQVQYLLRGHLRSNVANFDIMKDF  1496

Query  3703  LSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLS  3882
             L ++  +     +        C I    +L +L   +       + +       L+  + 
Sbjct  1497  LVNMPPIFKSKIYFAFKNNS-CNITRYLYLDILYEFVIDGNWIFIEQNEEKRLELIVLME  1555

Query  3883  SECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFK  4062
                L+L    R   FD +++++R          +   ++D+ E     +R     + +  
Sbjct  1556  DNFLEL----RQLIFDMSLSDMR----------SINKNQDIYEVGYYLVRQQM--TRIII  1599

Query  4063  ESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLW  4242
             +S T    +     +I  LSD+ YEVR+  L+ L+ F NS + R              + 
Sbjct  1600  KSLTSQDNSEHSSIIIDILSDSDYEVRLVGLEMLIAFFNSSKYRE-------------IC  1646

Query  4243  LSNIGLQAMLMQLLAVEKNHK-CMNYILKIIYTYNMQQYNKNCGQHEKPTFVGNMDSDSV  4419
             +  + LQ  +++++  E+ ++ C    ++++   +         ++  P  + N   D  
Sbjct  1647  IDKLMLQCKIIKMIFQEEPYQNCFQRAVELLTLID--------SENPFPKLISNNSLDFG  1698

Query  4420  L-QFWDKVVSLYKVTRHAKTREMLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPS  4596
             L +FW K+++  +    +   E ++  +   + ++                   + S P 
Sbjct  1699  LEEFWKKLLNYMEHVESSTKTEAILPLLGSLLSQIWQ-----------------DDSLPG  1741

Query  4597  KLSVFSECIDYFVEVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDG  4776
                  SE ++ + + I++++     + +R+A   S+              S+   + P+ 
Sbjct  1742  NFK--SESLNQWCKYIEKNTKPEVTLTLREATTASLKLF-----------SIYLFKEPNL  1788

Query  4777  NKQKDALHLYAHKILDLWFTCMKLLEDEDDGLRKQLSLEVQKCITSGKSGSHFSSGV-VP  4953
              K +D       +I+ L+   ++L +D+D  LR   +L + +           +SG+  P
Sbjct  1789  FKNED-----TQQIITLYLVLVRLAQDDDIDLRHSAALMISE-----------ASGLEAP  1832

Query  4954  IQVEKVIEMSFEHLSSTFGHWLD-YLDFLCHWVQSATNSACAVSIADPVRRVFDKEIDNH  5130
             +  ++  E+ FE+++ ++   L  Y+  L     S        +  +P+R +F  E  N 
Sbjct  1833  VDCDRAREICFEYMTKSYSKSLYLYVSLLQTITGSDKPDEVINAETNPIRILFVVENPNI  1892

Query  5131  HEEKLLISQICCSHLE  5178
             ++E L+  Q+   HL+
Sbjct  1893  YKEDLIDIQLAYKHLK  1908



>gb|ESA02798.1| hypothetical protein GLOINDRAFT_248231 [Rhizophagus irregularis 
DAOM 181602]
Length=1530

 Score =   358 bits (919),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 359/1419 (25%), Positives = 634/1419 (45%), Gaps = 181/1419 (13%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             G+L+ + R VL   F +S      +    +NDS+ KT+ +   LS + NFC++  +S   
Sbjct  254   GLLSNLDRKVL--IFPLSGKFQFKISILRSNDSNPKTLHHILFLS-IANFCDNALNSQTK  310

Query  181   FHALTVMQICLQQIKTSMQG--TDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQ  354
               A   M + LQ+ + +++   T    +     ++ EV  +++  V +N EDP+     +
Sbjct  311   VLAFETMGLWLQETENTLRNDETSKLYDNNNSILNSEVLEKLMSYVLDNWEDPVDAIQFK  370

Query  355   VHLIFDLFLDIQGTLHWAEGSEKFCS-FLRKIASDLLHLGPRCKGRYIPLASLTKRLGAK  531
             V  IF+  LDI       E S +F + +L  + + LL +    K +Y  L  L  R+G  
Sbjct  371   VKTIFEKLLDIISLKSQLEQSAEFYNDYLVNLLNQLLIMDQYRKVKYSLLLLLLPRVGTV  430

Query  532   SILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAH---  702
              IL + P  +  T +   +  +   A+  +  FL+   +E +S++  +    K       
Sbjct  431   KILSIQPEFVSKTLEVLHNLVIAPRASAMMVTFLDLHLEELFSSEFRDITIKKDEKREEI  490

Query  703   -------CLLPILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTE  861
                     L PI  GLSS    LR N+  + L  L +    S + ++            +
Sbjct  491   VNEWIDLWLTPICQGLSSSDDILRKNIGAFILQPLFKAKSSSFWRII------------D  538

Query  862   IFYPELDSRDIVLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGV  1041
             I        + +     R+  L+ +LKV R L  ++G++         +E    S D   
Sbjct  539   ILQNNKHGNEFINNERYRLNALIMVLKVGRSLDFVDGNM--------FIESKQDSIDT--  588

Query  1042  CDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAV  1221
                  + K I +++    L  A+ H+D +LRID    +  + K  S  +S EL+L++   
Sbjct  589   -----NRKNIRLQL----LRDAIYHLDLNLRIDVLGLICESRKLTSEITSTELALLKSFF  639

Query  1222  PLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSL  1401
              LN+   S  F+ K      KFF+++R  L    K    H   ++    S   G+A   +
Sbjct  640   QLNLNSTSPEFRQKLFGHLNKFFAKLRGNLYNQWKNYQSHMKYVESHKDSR-TGDAHSEI  698

Query  1402  KHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHM--LP-PQGKSDSY  1572
             K + +N  +F+ WL   L  S YP A ++R   A++  +I++  + +   P P+G    +
Sbjct  699   KQKIDNTRSFLNWLIELLTASLYPGASFQRVSSALKTFVILIKTFGIENTPLPEGFVAQH  758

Query  1573  SSEISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEA  1752
                   +P+   L    +T L++  +++ +D  R  ++ IL  FP+P+PGI S + V + 
Sbjct  759   CRTPE-FPFQLSLASARNTKLILHCLMNPFDENRTLAYEILQEFPSPLPGIESKDNVQKI  817

Query  1753  IIWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEF  1932
             + WA + + S R  ESD+GA+ FRLIF KYVL L     +  +V  +    L + + ++ 
Sbjct  818   LFWALQSMTSTRAGESDSGAMIFRLIFSKYVLNLN----LDLDVEIKQSERLEDYKKVDI  873

Query  1933  TPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAs  2112
                 P I +   L   L   +    ++L  A +K  +HG LL L+Y F+E+D++S+ V +
Sbjct  874   ----PSINFTRKLFSLLKKQINIASENLLLASQKFPMHGTLLALQYIFKELDYNSLEVKN  929

Query  2113  nissiklllekilalVMRITSLALWVVS--ADAWYLP---DEMEEMTVDGACFLERPIEM  2277
             N+   +      ++L+ ++  + L V+S  +    +P    EMEEM +D     E  + +
Sbjct  930   NLEEWRDTHSHAISLINKVCQIVLEVLSNPSPEGNVPASFQEMEEM-ID-----ELVLNL  983

Query  2278  DVSASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSC  2457
             D     PD E        + GP  Q+++  CW A+KE S LL  I+ + P+  S      
Sbjct  984   D---EDPDRE--------EGGPKHQVILSCCWRAVKEASSLLAIILSRAPISVS------  1026

Query  2458  SQITDGTDQLSSDI-VLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSN  2634
                      L ++  +LD  ++   G+ F  +L  ++H GA      G+ A+C+RLL S+
Sbjct  1027  ---------LETNFSILDYEKIRKGGDLFRTLLTSIRHRGAFSAVYPGYVAVCSRLLSSS  1077

Query  2635  DPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKAL  2814
               +  +L + W+E  +   ++   ++    RRSAG+P    A    EP    K LLP  +
Sbjct  1078  QVKFVELPKMWLEDNINNIMANSVSIT---RRSAGLPLCILAIISGEPSNC-KVLLPWTI  1133

Query  2815  RWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVL  2994
             + LI +  ++ +D         +    IDS                       VHAFN+L
Sbjct  1134  KTLIEIGSQAPSD---------DFDQTIDSHQ---------------------VHAFNIL  1163

Query  2995  KAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRE  3174
             ++ F DA L TD   + ++  I++I+ FSS  W VRN + + ++ L++R  G    +   
Sbjct  1164  RSIFMDAKLGTDVLPYVSDGFILAIKGFSSPSWAVRNCSVMLFSTLLQRTFGVRKTKDEY  1223

Query  3175  SARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILL  3354
              +   LT  EFF R+P L+ FL +ELKIA +  ++ +  + ++     VHP L P+L LL
Sbjct  1224  HSINKLTRREFFSRFPQLYPFLLDELKIAVDQLIKSTKVSQST-----VHPGLYPILTLL  1278

Query  3355  SRLKPSPITSE----TGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTV  3522
             SRL PS +       T +PF   +              + R +A+RA+  ++ +  L   
Sbjct  1279  SRLHPSLMDGSSSVLTMNPFVSLVLSCSSSPIH-----KTREIAARAIVPLIPSNDLIVT  1333

Query  3523  ILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCR-NLADFSKKED  3699
                + +E             S +SN     N +HG L+Q+  LL  + R N+A+F   +D
Sbjct  1334  CSKLINE-------------SVMSNQ----NELHGRLIQVQYLLRGHLRSNVANFDIMKD  1376

Query  3700  ILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTL  3879
              L ++  +     +        C I    +L +L   +       + +       L+  +
Sbjct  1377  FLVNMPPIFKSKIYFAFKNNS-CNITRYLYLDILYEFVIDGNWIFIEQNEEKRLELIVLM  1435

Query  3880  SSECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELF  4059
                 L+L    R   FD +++++R          +   ++D+ E     +R     + + 
Sbjct  1436  EDNFLEL----RQLIFDMSLSDMR----------SINKNQDIYEVGYYLVRQQM--TRII  1479

Query  4060  KESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFL  4176
              +S T    +     +I  LSD+ YEVR+  L+ L+ FL
Sbjct  1480  IKSLTSQDNSEHSSIIIDILSDSDYEVRLVGLEMLIAFL  1518



>gb|EXX78917.1| Trm732p [Rhizophagus irregularis DAOM 197198w]
Length=2033

 Score =   360 bits (925),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 358/1425 (25%), Positives = 633/1425 (44%), Gaps = 184/1425 (13%)
 Frame = +1

Query  1     GILTAVSRTVLNIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFN  180
             G+L+ + R VL   F +S      +    +NDS+ KT+ +   LS + NFC++  +S   
Sbjct  376   GLLSNLDRKVL--IFPLSGKFQFKISILRSNDSNPKTLHHILFLS-IANFCDNALNSQTK  432

Query  181   FHALTVMQICLQQIKTSMQG--TDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQ  354
               A   M + LQ+ + +++   T    +     ++ EV  +++  V +N EDP+     +
Sbjct  433   VLAFETMGLWLQETENTLRNDETSKLYDNNNSILNSEVLEKLMSYVLDNWEDPVDAIQFK  492

Query  355   VHLIFDLFLDIQGTLHWAEGSEKFCS-FLRKIASDLLHLGPRCKGRYIPLASLTKRLGAK  531
             V  IF+  LDI       E S +F + +L  + + LL +    K +Y  L  L  R+G  
Sbjct  493   VKTIFEKLLDIISLKSQLEQSAEFYNDYLVNLLNQLLIMDQYRKVKYSLLLLLLPRVGTV  552

Query  532   SILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAH---  702
              IL + P  +  T +   +  +   A+  +  FL+   +E +S++  +    K       
Sbjct  553   KILSIQPEFVSKTLEVLHNLVIAPRASAMMVTFLDLHLEELFSSEFRDITIKKDEKREEI  612

Query  703   -------CLLPILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTE  861
                     L PI  GLSS    LR N+  + L  L +    S + ++            +
Sbjct  613   VNEWIDLWLTPICQGLSSSDDILRKNIGAFILQPLFKAKSSSFWRII------------D  660

Query  862   IFYPELDSRDIVLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGV  1041
             I        + +     R+  L+ +LKV R L  ++G++             + S D   
Sbjct  661   ILQNNKHGNEFINNERYRLNALIMVLKVGRSLDFVDGNM-----------FIENSIDT--  707

Query  1042  CDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAV  1221
                  + K I +++    L  A+ H+D +LRID    +  + K  S  +S EL+L++   
Sbjct  708   -----NRKNIRLQL----LRDAIYHLDLNLRIDVLGLICESRKLTSEITSTELALLKSFF  758

Query  1222  PLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSL  1401
              LN+   S  F+ K      KFF+++R  L    K    H   ++    S   G+A   +
Sbjct  759   QLNLNSTSPEFRQKLFGHLNKFFAKLRGNLYNQWKNYQSHMKYVESHKDSR-TGDAHSEI  817

Query  1402  KHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHM--LP-PQGKSDSY  1572
             K + +N  +F+ WL   L  S YP A ++R   A++  +I++  + +   P P+G    +
Sbjct  818   KQKIDNTRSFLNWLIELLTASLYPGASFQRVSSALKTFVILIKTFGIENTPLPEGFVAQH  877

Query  1573  SSEISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEA  1752
                   +P+   L    +T L++  +++ +D  R  ++ IL  FP+P+PGI S + V + 
Sbjct  878   CRTPE-FPFQLSLASARNTKLILHCLMNPFDENRTLAYEILQEFPSPLPGIESKDNVQKI  936

Query  1753  IIWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEF  1932
             + WA + + S R  ESD+GA+ FRLIF KYVL L     +  +V  +    L + + ++ 
Sbjct  937   LFWALQSMTSTRAGESDSGAMIFRLIFSKYVLNLN----LDLDVEIKQSERLEDYKKVDI  992

Query  1933  TPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAs  2112
                 P I +   L   L   +    ++L  A +K  +HG LL L+Y F+E+D++S+ V +
Sbjct  993   ----PSINFTRKLFSLLKKQINIASENLLLASQKFPMHGTLLALQYIFKELDYNSLEVKN  1048

Query  2113  nissiklllekilalVMRITSLALWVVS--ADAWYLP---DEMEEMTVDGACFLERPIEM  2277
             N+   +      ++L+ ++  + L V+S  +    +P    EMEEM  +    L+     
Sbjct  1049  NLEEWRDTHSHAISLINKVCQIVLEVLSNPSPEGNVPASFQEMEEMIDELVLNLDE----  1104

Query  2278  DVSASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSC  2457
                   PD E        + GP  Q+++  CW A+KE S LL  I+ + P+  S      
Sbjct  1105  -----DPDRE--------EGGPKHQVILSCCWRAVKEASSLLAIILSRAPISVS------  1145

Query  2458  SQITDGTDQLSSDI-VLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSN  2634
                      L ++  +LD  ++   G+ F  +L  ++H GA      G+ A+C+RLL S+
Sbjct  1146  ---------LETNFSILDYEKIRKGGDLFRTLLTSIRHRGAFSAVYPGYVAVCSRLLSSS  1196

Query  2635  DPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKAL  2814
               +  +L + W+E  +   ++   ++    RRSAG+P    A    EP    K LLP  +
Sbjct  1197  QVKFVELPKMWLEDNINNIMANSVSIT---RRSAGLPLCILAIISGEPSNC-KVLLPWTI  1252

Query  2815  RWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVL  2994
             + LI +  ++ +D         +    IDS                       VHAFN+L
Sbjct  1253  KTLIEIGSQAPSD---------DFDQTIDSHQ---------------------VHAFNIL  1282

Query  2995  KAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRE  3174
             ++ F DA L TD   + ++  I++I+ FSS  W VRN + + ++ L++R  G    +   
Sbjct  1283  RSIFMDAKLGTDVLPYVSDGFILAIKGFSSPSWAVRNCSVMLFSTLLQRTFGVRKTKDEY  1342

Query  3175  SARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILL  3354
              +   LT  EFF R+P L+ FL +ELKIA +  ++ +  + ++     VHP L P+L LL
Sbjct  1343  HSINKLTRREFFSRFPQLYPFLLDELKIAVDQLIKSTKVSQST-----VHPGLYPILTLL  1397

Query  3355  SRLKPSPITSE----TGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTV  3522
             SRL PS +       T +PF   +              + R +A+RA+  ++ +  L   
Sbjct  1398  SRLHPSLMDGSSSVLTMNPFVSLVLSCSSSPIH-----KTREIAARAIVPLIPSNDLIVT  1452

Query  3523  ILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCR-NLADFSKKED  3699
                + +E             S +SN     N +HG L+Q+  LL  + R N+A+F   +D
Sbjct  1453  CSKLINE-------------SVMSNQ----NELHGRLIQVQYLLRGHLRSNVANFDIMKD  1495

Query  3700  ILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTL  3879
              L ++  +     +        C I    +L +L   +       + +       L+  +
Sbjct  1496  FLVNMPPIFKSKIYFAFKNNS-CNITRYLYLDILYEFVIDGNWIFIEQNEEKRLELIVLM  1554

Query  3880  SSECLDLYTSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELF  4059
                 L+L    R   FD +++++R          +   ++D+ E     +R     + + 
Sbjct  1555  EDNFLEL----RQLIFDMSLSDMR----------SINKNQDIYEVGYYLVRQQM--TRII  1598

Query  4060  KESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESR  4194
              +S T    +     +I  LSD+ YEVR+  L+ L+ F NS + R
Sbjct  1599  IKSLTSQDNSEHSSIIIDILSDSDYEVRLVGLEMLIAFFNSSKYR  1643



>ref|XP_002675266.1| predicted protein [Naegleria gruberi]
 gb|EFC42522.1| predicted protein [Naegleria gruberi]
Length=1848

 Score =   331 bits (848),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 369/1504 (25%), Positives = 635/1504 (42%), Gaps = 262/1504 (17%)
 Frame = +1

Query  1105  ALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQMKWASLFRK  1284
              L H D  +R+DA E + ++ K  +LP+  EL+++ K   LN+R C ++F+  +     +
Sbjct  571   GLIHNDHDIRLDAFELITVSTKKLALPTEQELAIIIKFARLNLRGCKSSFRFGFGDAIER  630

Query  1285  FFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLK-------HRAENLFNFMKWL  1443
             F  RV     R+      + +L   L  S   G   Q  +       H    L  F+   
Sbjct  631   FIKRVNEICVRIFASHQKNQTLNHLLDVSTPEGNMPQKKREELNKDRHSYRILMEFLYDY  690

Query  1444  SCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILPE  1623
             +  +  S YP  P+ER ++A++    +L+ + +       +   +   +      L    
Sbjct  691   ATEVINSLYPGCPHERLLVALDCYKSLLDTFSLNNSIDVFNPSDTNRVVSWKRIHLTSSN  750

Query  1624  STLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRESD  1803
             S L L+ ++   WD++R   + +L  F  P+ G  +PE V      A  L+ SPR+RESD
Sbjct  751   SVLTLLNTLGSCWDKVRVVIYDLLASFMAPLTGFETPEKVKVIANNAFDLIKSPRLRESD  810

Query  1804  AGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDWL  1983
             AGAL +R+IF+KYV ELGW V +    VT                 SP + +   L+  L
Sbjct  811   AGALLYRIIFKKYVCELGWEVFLDKEPVTS-------------CSVSPQLSFCKKLVALL  857

Query  1984  CAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilalVM  2163
                 E   +++    K S + G+L TL Y   ++D+                        
Sbjct  858   KEKTENCAQNIFNITKDSALVGILQTLIYVISDVDFTK----------------------  895

Query  2164  RITSLALWVVSADAWYLPDE----MEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQ  2331
               T+++ W      +    E    +    + GA  L+   +  V+ +  D    I   E 
Sbjct  896   ERTTISEWREWMTEFLGILEKACLLSVKIIAGAPLLDENEDNSVAMNNVDCRGHIFFGED  955

Query  2332  DDGPMD-QIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLD  2508
             ++   D   + V  WLA+K  S+L+  I+  V L     P S S      D+LS D ++ 
Sbjct  956   EEVSGDTHSLTVNSWLAVKSSSMLISVIVHHVEL----YPDSHSN-----DKLSKDSIIT  1006

Query  2509  LRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMER  2688
               Q+E +G   L +LL  KHNGAI+K+  GF  LC RL+    P L  + E W   L++ 
Sbjct  1007  FDQIEKLGKMLLNILLTTKHNGAIEKSAVGFNILCKRLMSCGIPELVNIPEKWTRYLLD-  1065

Query  2689  TVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknken  2868
              + K  T   ++RRSAG+P  F +   SEP   P++LLP+ +++L+NVA           
Sbjct  1066  GIGKDDTFS-MMRRSAGLPWTFASIMKSEPTFLPRKLLPETMQYLLNVALNQ--------  1116

Query  2869  sscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSA  3048
                                     S  +   VV   +A NVL+  F+DA L      F  
Sbjct  1117  ------------------------SNYKTSQVV---NALNVLRFLFHDAQLGPYVQQFVE  1149

Query  3049  EALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTL  3228
             + LI+S++ F S+ W ++NS+ + YTAL+ R +G       +S +   TG E+F RYP L
Sbjct  1150  DGLIISLKGFGSTIWAIKNSSLMMYTALLHRSLG-----DNDSIK---TGTEYFSRYPRL  1201

Query  3229  HTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDP  3408
              TFL  +L   T+       EN      +++HPSL PML+LLSRL+PS   S   +    
Sbjct  1202  RTFLLEQLNTVTD-------ENREHK--RILHPSLYPMLLLLSRLRPSLDESTETEANSV  1252

Query  3409  FLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDLSG  3588
               F+PF++KCS   +   R + +RAL  ++ +  +   IL+  + LP     ++      
Sbjct  1253  SQFIPFVKKCSAMIHHMARSIGARALEPLIPSSMVKEYILDTINALPKTVEETIHQ----  1308

Query  3589  LSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQKCPC  3768
                     N +HG+L QL+  + T+ + + +    E    D ++ L  +S+IG+ Q   C
Sbjct  1309  --------NELHGVLFQLNRFVTTSFKAMEN---SEQFALDCLNKLA-NSFIGTIQN-RC  1355

Query  3769  PILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPTIAEL  3948
                   F ++++N+L + +     + +  +WN              S    + + T    
Sbjct  1356  FATRSLFYEIINNLLQMCKNIP-QETLETLWN-------------NSVNSVFLESTSTNG  1401

Query  3949  RKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQERLIRSLSDA  4128
             +      +FN     S  + E  L++ +    D                   ++  L+ +
Sbjct  1402  QPAKQEMFFN----NSTFIVELYLLFRKDVDED------------------LVVNLLNFS  1439

Query  4129  LYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEKNHKC  4308
               +VR AT K+L       E    ++ +   +  K+  L  + L+  L +    E + +C
Sbjct  1440  AMDVRRATFKYLY-----KEEHVVQALSGVNAHAKIENLRPLILEHALFR----ETDVEC  1490

Query  4309  MNYILKIIYTYNMQQYNKN-CGQHEKPTFVGNMDSDSVLQ-FWDKVVSLYKVTRHAKTRE  4482
               + L  +    +  YNK   GQ  K   V +   D+V      ++V LY    +    +
Sbjct  1491  ARFGLASL----VNLYNKAPAGQLTKDLSVMSSYLDNVFDAVPTRLVYLYVNETNTVLHQ  1546

Query  4483  MLVCCMAVCIKRLADLFTSSICSLGNEKVVVVNPSDPSKLSVFSECIDYFVEVIQEHSDA  4662
             +++  + + I       + +I S          P +P         +  +++++   SD 
Sbjct  1547  LVIALLGIFI-------SGTIES---------QPENP--------LVKKWLKIVCHASDP  1582

Query  4663  SEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGNKQKDALHLYAHKILDLWFTCM  4842
             +   ++R A   SIV+SG+L        ++S + +     Q             +W   +
Sbjct  1583  ARQSHVRAACLDSIVSSGIL--------TISANDLKSAGNQ-----------FSVWTALI  1623

Query  4843  KLLEDEDDGLRKQLSLEVQKCITS--GKSGSHFSSGVVPIQVEKVIEMSFEHLSSTFGHW  5016
              LL+DEDD +R + +L V   I     K  +   +    +Q E V+E SF  +S  +G  
Sbjct  1624  TLLQDEDDIIRSRAALIVSPLIFGFEHKGTTSKQAKCAELQREYVLERSFAFISHHYGKL  1683

Query  5017  LDYLDFL--CHWVQSATNSA-CAVSIADPVRR------VFDKEIDNHHEEKLLISQICCS  5169
              +  ++L  C  ++ A N    +V +  P +       +F+KE DN   E+L ISQ+   
Sbjct  1684  TECHNYLVSCIQLEEAINEENNSVEVVLPFKTTDEEVMLFEKEEDNVFTEELAISQLGSY  1743

Query  5170  HLEKLPVSKLTTEFRDNNICSVLQSWRRR--FCQQLISFGNAYIGTQGGVDWIGGVGNHK  5343
             +L KL +S   +EFR      VLQ    +  F  +++S        Q G+ W+G      
Sbjct  1744  YLNKLDIS---SEFRQ----QVLQKLEGQLLFVLKILSERRK---QQIGLFWVGNFSFQP  1793

Query  5344  DAFLPVYVNLLAFHALSNCILRGEAEDSKSMVPELLELGEAIQPFLRNPLISNLFVLVVK  5523
               F+ +   +LA + L    +                  E ++PF  N  I+ +  ++  
Sbjct  1794  TVFIIIAKLVLAINTLGYFDI------------------EKLRPFFENQEINEIHRILSD  1835

Query  5524  SHEK  5535
             SH +
Sbjct  1836  SHYR  1839



>gb|EIE91343.1| hypothetical protein RO3G_16054 [Rhizopus delemar RA 99-880]
Length=2257

 Score =   323 bits (829),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 308/1206 (26%), Positives = 517/1206 (43%), Gaps = 179/1206 (15%)
 Frame = +1

Query  148   FCEHPT-DSHFNFHALTVMQICLQQIKTSMQGTDGYI--EEGYDPISEEVGTRVLKIVWN  318
             FC  P+ DS         M   LQQ K  M+G    +  +    PI  +   +++  VW+
Sbjct  806   FCGTPSLDSSCKVVTFESMATWLQQTKGIMEGCQDKVSMDLASGPIEPKSMDKLIHYVWD  865

Query  319   NLEDPLSQTVKQVHLIFDLFLDI-QGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYI  495
             + +DP+     +V  IF+L L + Q    +    + +  F+  +  ++L +    K +Y 
Sbjct  866   HWDDPIDSIQHKVRTIFELSLSLMQLKSTFYNEKDAYNIFVNNLLRNMLTMDWHRKVKYA  925

Query  496   PLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVE  675
              L  L +++     LD  P L+     A     +C   T FL  FL      Y       
Sbjct  926   LLNMLVEKIHTDIFLDAEPRLIERCLLAMDSLILCPQITYFLLTFL------YRRIQDTI  979

Query  676   GGYIKYRAHC----------------------LLPILSGLSSGFAKLRSNLNTYALPVLL  789
              GY K++ H                         P+L  L+S    LR N N + L  L 
Sbjct  980   PGYEKFKGHNGKIKYDINSNSRDAIDRWIELWASPLLQCLTSPSELLRKNANGFLLQPLF  1039

Query  790   ELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVLGVEQRVAVLVSLLKVSRMLALIE  969
             ++   S + M+  +          +  P    +D  L +  R+   +++LK  R L +++
Sbjct  1040  KITPQSFWYMINIL--------QNLQDPRW--KDNNLNMNYRLNAFIAVLKSGRGLDIVD  1089

Query  970   GDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAE  1149
             G+       +  LE T+ ST                KI V+ L LA+ H D  +RID   
Sbjct  1090  GN-------TYTLESTNEST----------------KISVDTLKLAIYHSDHQVRIDVLG  1126

Query  1150  SLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQ  1329
              L  + K  +  +S+EL +++  +PLN+   +  F+ +  +   KF +R+R+ L    +Q
Sbjct  1127  LLCESRKATAEITSIELDMIKLFLPLNLNSTAPEFRQQMCAHLTKFLTRLRSNLYSQYRQ  1186

Query  1330  ----GTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKWLSCFLFFSCYPSAPYERKI  1497
                  T   +  K  + +P          ++A+N   F+ WL  F+  S YP A Y+R  
Sbjct  1187  YKLSQTDENAATKKSNHTPTVSANILECINQAKN---FLFWLCDFITKSLYPGASYQRIA  1243

Query  1498  MAMELMLIMLNVWHM--LPPQGKSDSYSSEISLYPYSKGLILPESTLLLVGSIIDSWDRL  1671
               + ++ I++ ++ +  LPP    + ++ +   +P+   +     + LL+   ++ +D  
Sbjct  1244  TTLRILSIIIKIFGVTELPP---IEGFADQQPDFPFQIPVANARLSKLLINIFMNPYDFN  1300

Query  1672  RESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRESDAGALTFRLIFRKYVLE  1851
             R  +F IL  FP+P+PGI S   V   + W    V S R  ESD+GA+ FRLIF+KYV+ 
Sbjct  1301  RVQAFDILTQFPSPLPGIESKNDVQNLLWWGLNNVVSTRAGESDSGAMVFRLIFKKYVVN  1360

Query  1852  LGWVV---RVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSE  2022
             LG+ +   +   +V  +    LSN            + +   L+D L   V   +++L  
Sbjct  1361  LGFDLNPEQRKVDVAKKPSKDLSN--------KCAAVVFTEKLLDLLEMQVTTAKQNLLL  1412

Query  2023  ACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilalVMRITSLALWVVSAD  2202
             A ++  +HG LL L+Y F E+D+DS  V  N +  K +        MR   L      A 
Sbjct  1413  AAQQHPMHGTLLALQYVFRELDYDSSTVQKNFNDWKKVH-------MRAIQLIEAACDAG  1465

Query  2203  AWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAM  2382
                L D   E  V      +  IE  +S    +D + +   +   GP  Q+++  CW A+
Sbjct  1466  MDVLSDPSPEGNVPSDYRDDENIEDPLS----NDNIDLDGDDSLSGPKHQVILSCCWRAV  1521

Query  2383  KEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKM  2562
             KE S LL  ++   P+               + + S   +   + L   G  F  +L  +
Sbjct  1522  KEASSLLQVMVSGAPV---------------SPEASDKTIFTHQDLVKAGELFHNLLTSI  1566

Query  2563  KHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGI  2742
             +H GA       + +L  +LL S++  + +L   W+++ ++   S   ++    RRSAG+
Sbjct  1567  RHRGAFSSVYPAYVSLNTKLLTSSNLAISRLPSQWLQKDLDGLTSSNISI---TRRSAGL  1623

Query  2743  PAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscsesssAIDSTMVPDV  2922
             P    A   SE +   + LL KA+R L+ +A +                        P  
Sbjct  1624  PLCILAIVSSE-QSIKRELLDKAMRHLMALASEE-----------------------PPK  1659

Query  2923  AAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVR  3102
              A + I        +P VHA+N++++ F D+ L      + +    ++I  FSS  W +R
Sbjct  1660  DADQRID-------LPQVHAYNIMRSIFMDSKLGGHVLEYVSRGFSLAISGFSSFSWAIR  1712

Query  3103  NSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEG  3282
             N + + ++ L++R  G    +   S    LTG EFF RYP LH +L  ELKIA +  L  
Sbjct  1713  NCSVMLFSTLLQRTFGTKKTKDEHSHVNTLTGREFFVRYPDLHPYLLKELKIAVDQLLNN  1772

Query  3283  SSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFL--FMPFIRKCSLQNNL  3456
             ++       A  VHP L P+L LLSR+KPS    E  D  +  L  F+P +  C+     
Sbjct  1773  AT-------AASVHPGLYPILTLLSRMKPS---VEEDDEKETILTPFIPLVMPCATSTIY  1822

Query  3457  RIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLL  3636
             + R +A+RAL  +V +      ++  A  L    +             N + N IHG L+
Sbjct  1823  KTREMAARALVPLVLD------VVPTAKRLIEFSD-------------NMTQNEIHGRLV  1863

Query  3637  QLSSLL  3654
             Q   LL
Sbjct  1864  QAQFLL  1869



>emb|CEG75233.1| hypothetical protein RMATCC62417_10309 [Rhizopus microsporus]
Length=1912

 Score =   323 bits (828),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 304/1193 (25%), Positives = 517/1193 (43%), Gaps = 169/1193 (14%)
 Frame = +1

Query  148   FCEHPT-DSHFNFHALTVMQICLQQIKTSMQGTD--GYIEEGYDPISEEVGTRVLKIVWN  318
             FC+ P  D+         M   LQQ K  M+       I+    PI  +   R++  VW+
Sbjct  382   FCQTPNLDASCKVVVFESMATWLQQTKEIMEHNKEKHIIDSISGPIHSKNMDRLIYYVWD  441

Query  319   NLEDPLSQTVKQVHLIFDLFLDI-QGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYI  495
             + +DP+     +V  IF+L L + Q   ++      +  FL  +  +++ +    K +Y 
Sbjct  442   HWDDPIDSIQHKVRSIFELVLSLMQIKSNFYNQDHTYNEFLHHLLKNMISMDWHKKVKYA  501

Query  496   PLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFL-ECLRDEYWSTDGV  672
              L  L +++   + L + P L+    +A     +C   T FL  FL   ++D     +  
Sbjct  502   LLNMLVEKVETDTFLKVEPRLIEKCLQAMDSLILCPQITYFLLTFLYRRIQDTIPGHEKF  561

Query  673   EG--GYIKYRA---HCL--------LPILSGLSSGFAKLRSNLNTYALPVLLELDVDSIF  813
              G  G IKY A   H +        LP+L  L+S F  +R N + + L  L ++   S +
Sbjct  562   NGHNGKIKYDANSKHAVDEWIALWALPLLQSLTSSFELVRKNASGFLLQPLFKVSSQSFW  621

Query  814   PMLGFIGIGCSAESTEIFYPELDSRDIVLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEY  993
              ++  +     +   E    + DSR        R+   +++LK +R L +I+G+      
Sbjct  622   FLVNILQDVHDSRWKE---DKFDSR-------FRLNAFIAVLKSARALDIIDGN---AYA  668

Query  994   SSVALEVTDLSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKT  1173
             S   LE T                    +IP++ L LA+ H D  +RID    L  + K 
Sbjct  669   SEPTLEKT--------------------RIPIDVLKLAVHHNDPQVRIDVLGLLCESRKA  708

Query  1174  ASLPSSLELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLI  1353
              +  + +EL +++  +PLNM   +  F+ +  +   K   R+R  L       + + +  
Sbjct  709   TAEITFIELDMVKTFLPLNMNSTAPEFRQQMCAHLTKLLVRLRGNLY------SQYRAYK  762

Query  1354  KCLSGSPLNGEADQS-LKHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLN  1530
                +     G +D + +  R E   +F+ WL  F+  S YP A Y+R   A+ ++ I++ 
Sbjct  763   LSEAKDAKKGASDTTDIMARIEQGRSFLFWLCDFISESLYPGASYQRVATALRMLSILVK  822

Query  1531  VWHM--LPP-QGKSDSYSSEISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILLH  1701
              + +  LPP +G +D        +P+   L     + LL+   ++ +D  R  +F IL  
Sbjct  823   TFGVTELPPIEGFTDRQPE----FPFQLPLATARLSKLLINVFMNPYDFNRVQAFDILNQ  878

Query  1702  FPTPIPGISSPELVCEAIIWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCN  1881
             FP+P+PGI S   V   + W    V S R  ESD+GA+ FRLIF+KYV+ LG+ +    +
Sbjct  879   FPSPLPGIESKHDVQNLLWWGLNNVVSTRANESDSGAMIFRLIFKKYVVHLGFDLNPEQD  938

Query  1882  VVTQSPSGLSNGENLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLT  2061
              + +S              +S  + +   L+D L   V   + +L  A ++  +HG LL 
Sbjct  939   RLHESKFN---------EKTSAAVIFTERLLDLLERQVAVAKSNLLLAAQQHPMHGTLLA  989

Query  2062  LRYTFEEMDWDSIAVAsnissiklllekilalVMRITSLALWVVSADAWYLPDEMEEMTV  2241
             L+Y F E+D+ S     N    K           ++   A++++        D + + + 
Sbjct  990   LQYVFSELDYRSDTAQKNFVDWK-----------KVHKRAVYLIKEACDAALDVLSDPSP  1038

Query  2242  DGACFLERPIEMDVSASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRK  2421
             +G   L      D+     D+ ++    +   GP  QI++  CW A+KE S LL  +I  
Sbjct  1039  EGNLPLNYQETDDMDEQLLDESLE----DTTSGPKHQIILSCCWRAVKEASSLLQVMISN  1094

Query  2422  VPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGF  2601
             VP+ + D               +++ +  L  L   G  F  +L  ++H GA       +
Sbjct  1095  VPIASQD---------------ATNTIFTLEDLVDAGELFHSLLTNIRHRGAFSSVYPAY  1139

Query  2602  TALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPE  2781
              +L  +LL   D  + +L   W++  ++   S   ++    RRSAG+P    A   SE +
Sbjct  1140  VSLNMKLLAVKDLSISQLPSRWLQNDLDGLTSSNISIT---RRSAGLPLCILAVLSSE-Q  1195

Query  2782  GAPKRLLPKALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEG  2961
                + LL  A++ L+ +A +                        P   A + I       
Sbjct  1196  SIKRELLASAMKQLMALASQE-----------------------PPRDADQRID------  1226

Query  2962  VVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRR  3141
              +P VHA+N++++ F D+ L      + ++   ++I  FSS  W +RN + + ++ L++R
Sbjct  1227  -LPQVHAYNIMRSIFMDSKLGNHVLEYVSKGFSLAISGFSSFSWAIRNCSVMLFSTLLQR  1285

Query  3142  MIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVV  3321
               G    +   S    LTG EFF R+P LH +L  ELK+A E  L   +       A  V
Sbjct  1286  TFGTKKTKDEHSHVNTLTGREFFVRFPDLHPYLLKELKVAVEHLLNNPT-------AASV  1338

Query  3322  HPSLCPMLILLSRLKPSPITSETGDPFDPFL--FMPFIRKCSLQNNLRIRILASRALTGM  3495
             HP L PML LLSR+KPS    E  D  D  L  F+P +  C+     + R +A+RAL  +
Sbjct  1339  HPGLYPMLTLLSRMKPS---LEKEDEQDNVLAPFIPLVMPCAASAIYKTREMAARALVPL  1395

Query  3496  VSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLL  3654
             V                   D + + + L  L + N + N IHG LLQ+  +L
Sbjct  1396  VH------------------DVNGVITQLMELGD-NLTQNQIHGRLLQVKFIL  1429



>gb|EPB85887.1| hypothetical protein HMPREF1544_07303 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=2017

 Score =   320 bits (819),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 315/1241 (25%), Positives = 523/1241 (42%), Gaps = 222/1241 (18%)
 Frame = +1

Query  148   FCEHPT-DSHFNFHALTVMQICLQQIKTSMQG--TD---GYIEEGYDPISEEVGTRVLKI  309
             FC     DS     A   M   LQQ K  M+   TD   G ++    PI  +    +++ 
Sbjct  387   FCARADLDSACKVIAFESMATWLQQTKEIMEKCTTDNDTGMMDAVSGPIEPKNINMLIQY  446

Query  310   VWNNLEDPLSQTVKQVHLIFDL---FLDIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRC  480
             VW++ +DP+     +V  +F+L    L+I+ T +  +     C  +  +  +LL +    
Sbjct  447   VWDHWDDPIDSIQHKVRTMFELSIATLEIKTTFYQQQDQYHQC--VHALLKNLLAMDWHR  504

Query  481   KGRYIPLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWS  660
             K +Y  L  L +++     L   P L+     A     +C   T F+  FL      Y  
Sbjct  505   KVKYALLNMLVEKVHTDVFLRAEPRLMEKCLFAMDSLILCPQITFFILAFL------YRR  558

Query  661   TDGVEGGYIKYRAHC----------------------LLPILSGLSSGFAKLRSNLNTYA  774
                   GY K++ H                       +LP+L  L++    LR N + + 
Sbjct  559   VQDTIPGYEKFKGHNGKIKDTQDEATKQAIDQWIQLWVLPLLQCLTAPSELLRKNASGFL  618

Query  775   LPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDS---RDIVLGVEQRVAVLVSLLKV  945
             L  L ++   + + M+G +              +++S    D  L   +R+   +++LK 
Sbjct  619   LQPLFKMSSQAFWYMIGVL-------------EDMESPLWHDGQLAPARRLNAFIAVLKS  665

Query  946   SRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDD  1125
              R L +++G                    A V DS       + +I ++ L LA+ H D 
Sbjct  666   GRGLDIVDGT-------------------AYVVDS-----KEKNQISIDTLKLAIYHSDA  701

Query  1126  SLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRT  1305
              +R+D    L  + K  +  ++ EL +++  +PLNM   +  F+ +  +   K   R+R 
Sbjct  702   QVRMDVLGLLCESRKATAHVTNTELDMLQLFIPLNMNSTAPEFRQQMCAHLSKMLLRLRG  761

Query  1306  ALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLF------NFMKWLSCFLFFSC  1467
              L     Q   + SL+          + D +L    + L        F+ WL   +  S 
Sbjct  762   NL---YSQYRNYKSLLIYADKCTQQNKRDDALLDAQDILVGIDQAKTFLYWLCDHVAESL  818

Query  1468  YPSAPYERKIMAMELMLIMLNVWHM--LPPQGKSDSYSSEISLYPYSKGLILPESTLLLV  1641
             YP A Y+R   A+ ++ I + V+ +  LP     + ++ +   +P++    +P + L L 
Sbjct  819   YPGASYQRVATALRILNITIKVFGVTELPA---IEGFTDQQPDFPFT----MPIANLRLC  871

Query  1642  GSIID----SWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRESDAG  1809
              +++D     +D  R  +F IL  FP+P+PG+ +   V + + W    V S R  ESD+G
Sbjct  872   KTLVDVFMNPYDFNRVQAFEILCQFPSPLPGMEAKSDVQDLLWWGLNNVVSTRAGESDSG  931

Query  1810  ALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDWLCA  1989
             A+ FRL+F KYV+ELG+ +    N  T + +   N  +   T S     +   L+D L  
Sbjct  932   AMVFRLVFTKYVMELGFDLSPEQNAATVAST---NKVSAATTVSDAANVFTERLLDLLEK  988

Query  1990  AVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilalVMRI  2169
              V   + +L  A ++  +HG LL L+Y F+EMD+ S A+                     
Sbjct  989   QVHVAKSNLLLASQQHPMHGTLLALQYVFQEMDYKSTAIK--------------------  1028

Query  2170  TSLALWV-VSADAWYLPDEMEEMTVDGACFLERPIEMDVS--ASTPDDEMK---------  2313
              + A W    A A  L  E         C    P+  D S   + P D  +         
Sbjct  1029  NNFAQWTKTHARAIALIHE--------TCHTVMPVLSDASPEGNVPTDYRQGDDEEEEEE  1080

Query  2314  IAKAEQD---DGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQ  2484
                 +QD    GP  Q+++  CW A+KE S LL  II K P                + +
Sbjct  1081  EEALDQDGDASGPKHQVILSCCWRAVKEASSLLQVIIAKAP---------------ASAE  1125

Query  2485  LSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTES  2664
              S D +L  + L   G  F  +L  ++H GA       + +L  RLL S+DP + +L   
Sbjct  1126  PSKDAILTHQDLVKSGQLFHHLLTHIRHRGAFSAVYPAYVSLNTRLLTSHDPSIAQLPAE  1185

Query  2665  WMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKS  2844
             W+++ ++   S   ++    RRSAG+P    A   SEP    K+LL KA+ +L+ +A + 
Sbjct  1186  WLQENLDSLTSSNISIT---RRSAGLPLCILAIVSSEP-SVKKKLLNKAITYLMQLASQE  1241

Query  2845  LTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLA  3024
                                    P + A + I        +P VHA+N+++  F D+ L 
Sbjct  1242  -----------------------PPIDADQRID-------LPQVHAYNIMRTIFMDSKLG  1271

Query  3025  TDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLE  3204
             T    ++++   ++I  FSS  W +RN + + ++ L++R  G    +   S    LTG E
Sbjct  1272  THVLEYASQGFSLAINGFSSHSWAIRNCSVMLFSTLLQRTFGTKKTRDEHSHVNTLTGRE  1331

Query  3205  FFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITS  3384
             FF R+P LH +L  EL +A +  L+ +       LA  VHP L P+L LLSR++PS    
Sbjct  1332  FFVRFPDLHPYLLKELGVAVDQLLQNA-------LAASVHPGLYPILTLLSRMQPSTTQD  1384

Query  3385  ETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNH  3564
              T        F+P +  C+     + R +A+RAL  +V  + +PTV      +L  I N 
Sbjct  1385  ATEGETVLTPFIPLVMPCAASAIYKTREMAARALVPLVL-DVVPTV-----KQLMCISN-  1437

Query  3565  SMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFS  3687
                           + N I G LLQ+  LL  +  +LA  S
Sbjct  1438  ------------TTTQNEIQGRLLQVQFLLRGHATHLAHAS  1466



>emb|CEI96536.1| hypothetical protein RMCBS344292_10695 [Rhizopus microsporus]
Length=1994

 Score =   320 bits (819),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 307/1202 (26%), Positives = 520/1202 (43%), Gaps = 187/1202 (16%)
 Frame = +1

Query  148   FCEHPT-DSHFNFHALTVMQICLQQIKTSMQ--GTDGYIEEGYDPISEEVGTRVLKIVWN  318
             FC+ P  D+         M   LQQ K  M+       I+    PI  +   R++  VW+
Sbjct  382   FCQTPNLDASCKVVVFESMATWLQQTKEIMECNKEKHIIDSISGPIHSKNMDRLIYYVWD  441

Query  319   NLEDPLSQTVKQVHLIFDLFLDI-QGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYI  495
             + +DP+     +V  IF+L L + Q   ++      +  FL  +  +++++    K +Y 
Sbjct  442   HWDDPIDSIQHKVRSIFELVLSLMQIKSNFYNQDHTYNEFLHHLLKNMINMDWHKKVKYA  501

Query  496   PLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFL-ECLRDEYWSTDGV  672
              L  L +++   + L + P L+    +A     +C   T FL  FL   ++D     +  
Sbjct  502   LLNMLVEKVETDTFLKVEPRLIEKCLQAMDSLILCPQITYFLLTFLYRRIQDTIPGHEKF  561

Query  673   EG--GYIKYRAHC-----------LLPILSGLSSGFAKLRSNLNTYALPVLLELDVDSIF  813
              G  G +KY ++             LP+L  L+S F  +R N++ + L  L ++   S +
Sbjct  562   NGHNGKVKYDSNSKHAADEWIALWALPLLQSLTSSFELVRKNVSGFLLQPLFKVSSQSFW  621

Query  814   PMLGFI-GIGCSAESTEIFYPELDSRDIVLGVEQRVAVLVSLLKVSRMLALIEGDIDWCE  990
              ++  +  +  S      F P             R+   +++LK +R L +I+G+     
Sbjct  622   FLVNILQDVHDSRWKEGKFDPRF-----------RLNAFIAVLKSARALDIIDGN---AY  667

Query  991   YSSVALEVTDLSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPK  1170
              S   LE T                    KIP++ L LA+ H D  +RID    L  + K
Sbjct  668   TSEPTLEKT--------------------KIPIDVLKLAVHHSDPQVRIDVLGLLCESRK  707

Query  1171  TASLPSSLELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSL  1350
               +  + +EL +++  +PLNM   +  F+ +  +   K + R+R  L       + + + 
Sbjct  708   ATAEVTFIELDMVKMFLPLNMNSTAPEFRQQMCAHLTKLWVRLRGNLY------SQYRAY  761

Query  1351  IKCLSGSPLNGEADQS-LKHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIML  1527
                 +     G +D + +  R E   +F+ WL  F+  S YP A Y+R   A+ ++ I++
Sbjct  762   KLSETKDAKKGASDATDIMARIEQGRSFLFWLCDFISDSLYPGASYQRVATALRMLSILV  821

Query  1528  NVWHM--LPP-QGKSDSYSSEISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILL  1698
               + +  LPP +G +D        +P+   L     + LL+   ++ +D  R  +F IL 
Sbjct  822   KTFGVTELPPIEGFTDRQPE----FPFQLPLATARLSKLLINVFMNPYDFNRVQAFDILN  877

Query  1699  HFPTPIPGISSPELVCEAIIWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSC  1878
              FP+P+PGI S   V   + W    V S R  +SD+GA+ FRLIF+KYV+ LG+ +    
Sbjct  878   QFPSPLPGIESKLDVQNLLWWGLNNVVSTRANQSDSGAMVFRLIFKKYVVHLGFDL----  933

Query  1879  NVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLL  2058
                  +P      E+     +S  + +   L+D L   V   + +L  A ++  +HG LL
Sbjct  934   -----NPEQGKLHESKFNEKTSAAVIFTERLLDLLERQVAIAKSNLLLAAQQHPMHGTLL  988

Query  2059  TLRYTFEEMDWDSIAVAsnissiklllekilalVMRITSLALWVVSADA--------WYL  2214
              L+Y F E+D+ S  V  +    K + ++ + L+      AL V+S  +        +  
Sbjct  989   ALQYVFSELDYRSDTVQKHFVDWKRVHKRAVCLIKEACDAALDVLSDPSPEGNLPLNYQE  1048

Query  2215  PDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVS  2394
              D+M+E  +D +        +D +AS               GP  QI++  CW A+KE S
Sbjct  1049  TDDMDEQLLDES--------LDDTAS---------------GPKHQIILSCCWRAVKEAS  1085

Query  2395  LLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNG  2574
              LL  +I  VP+ + D   +   + D  D                G  F  +L  ++H G
Sbjct  1086  SLLQVMISNVPITSQDATHTIFTLEDLVDA---------------GELFHGLLTNIRHRG  1130

Query  2575  AIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAF  2754
             A       + +L  +LL   D  + +L   W++  ++   S   ++    RRSAG+P   
Sbjct  1131  AFSSVYPAYVSLNMKLLAVKDLSISQLPSRWLQNDLDGLTSSNISIT---RRSAGLPLCI  1187

Query  2755  TAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIE  2934
              A   SE +   + LL  A++ L+ +A +                        P   A +
Sbjct  1188  LAVLSSE-QSIKRELLASAMKQLMALASQE-----------------------PPKDADQ  1223

Query  2935  MISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSAC  3114
              I        +P VHA+N++++ F D+ L      + +    ++I  FSS  W +RN + 
Sbjct  1224  RID-------LPQVHAYNIMRSIFMDSKLGNHVLEYVSNGFSLAISGFSSFSWAIRNCSV  1276

Query  3115  LAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSEN  3294
             + ++ L++R  G    +   S    LTG EFF R+P LH +L  ELK+A E  L   +  
Sbjct  1277  MLFSTLLQRTFGTKKTKDEHSHVNTLTGREFFVRFPDLHPYLLKELKVAVEHLLNNPT--  1334

Query  3295  LTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFL--FMPFIRKCSLQNNLRIRI  3468
                  A  VHP L PML LLSR+KPS    E  D  D  L  F+P +  C+     + R 
Sbjct  1335  -----AASVHPGLYPMLTLLSRMKPS---LEKEDEQDNVLAPFIPLVMPCAASAIYKTRE  1386

Query  3469  LASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSS  3648
             +A+RAL  +V                   D + + + L  L + N + N IHG LLQ+  
Sbjct  1387  MAARALVPLVH------------------DVNGVITQLMELGD-NLTQNQIHGRLLQVKF  1427

Query  3649  LL  3654
             +L
Sbjct  1428  IL  1429



>emb|CEG71050.1| hypothetical protein RMATCC62417_06844 [Rhizopus microsporus]
Length=1991

 Score =   319 bits (818),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 305/1193 (26%), Positives = 518/1193 (43%), Gaps = 169/1193 (14%)
 Frame = +1

Query  148   FCEHPT-DSHFNFHALTVMQICLQQIKTSMQGTD--GYIEEGYDPISEEVGTRVLKIVWN  318
             FC+ P  D+         M   LQQ K  M+       I+    PI  +   R++  VW+
Sbjct  382   FCQTPNLDASCKVVVFESMATWLQQTKEIMEHNKEKHIIDSVSGPIHSKNMDRLIYYVWD  441

Query  319   NLEDPLSQTVKQVHLIFDLFLDI-QGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYI  495
             + +DP+     +V  IF+L L + Q   ++      +  FL  +  +++++    K +Y 
Sbjct  442   HWDDPIDSIQHKVRSIFELVLSLMQIKSNFYNQDHTYNEFLHHLLKNMINMDWHKKVKYA  501

Query  496   PLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFL-ECLRDEYWSTDGV  672
              L  L +++   + L   P L+    +A     +C   T FL  FL   ++D     +  
Sbjct  502   LLNMLVEKVETDTFLKAEPRLIEKCLQAMDSLILCPQITYFLLTFLYRRIQDTIPGHEKF  561

Query  673   EG--GYIKYRA---HCL--------LPILSGLSSGFAKLRSNLNTYALPVLLELDVDSIF  813
              G  G +KY +   H +        LP+L  L+S    +R N + + L  L ++   S +
Sbjct  562   NGHNGKVKYDSNSKHAVDEWIALWALPLLQSLTSSVELVRKNASGFLLQPLFKVSSQSFW  621

Query  814   PMLGFIGIGCSAESTEIFYPELDSRDIVLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEY  993
              ++  +     +   E    + DSR        R+   +++LK +R L +I+G+      
Sbjct  622   FLVNILQDVHDSRWKE---DKFDSR-------FRLNAFIAVLKSARALDIIDGN---AYT  668

Query  994   SSVALEVTDLSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKT  1173
             S   LE T                    KIP++ L LA+ H D  +RID    L  + K 
Sbjct  669   SEPTLEKT--------------------KIPIDVLKLAVHHSDPQVRIDVLGLLCESRKA  708

Query  1174  ASLPSSLELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLI  1353
              +  + +EL +++  +PLNM   +  F+ +  +   K + R+R  L       + + +  
Sbjct  709   TAEVTFIELDMVKMFLPLNMNSTAPEFRQQMCAHLTKLWVRLRGNLY------SQYRAYK  762

Query  1354  KCLSGSPLNGEADQS-LKHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLN  1530
                +     G +D + +  R E   +F+ WL  F+  S YP A Y+R   A+ ++ I++ 
Sbjct  763   LSETKDAKKGASDATDIMARIEQGRSFLFWLCDFISDSLYPGASYQRVATALRMLSILVK  822

Query  1531  VWHM--LPP-QGKSDSYSSEISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILLH  1701
              + +  LPP +G +D        +P+   L     + LL+   ++ +D  R  +F IL  
Sbjct  823   TFGVTELPPIEGFTDRQPE----FPFQLPLATARLSKLLINVFMNPYDFNRVQAFDILNQ  878

Query  1702  FPTPIPGISSPELVCEAIIWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCN  1881
             FP+P+PGI S   V   + W    V S R  ESD+GA+ FRLIF+KYV+ LG+ +     
Sbjct  879   FPSPLPGIESKLDVQNLLWWGLNNVVSTRANESDSGAMVFRLIFKKYVVHLGFDL-----  933

Query  1882  VVTQSPSGLSNGENLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLT  2061
                 +P      E+     +S  + +   L+D L   V   + +L  A ++  +HG LL 
Sbjct  934   ----NPEQGKLHESTFNEKTSAAVIFTERLLDLLERQVAVAKSNLLLAAQQHPMHGTLLA  989

Query  2062  LRYTFEEMDWDSIAVAsnissiklllekilalVMRITSLALWVVSADAWYLPDEMEEMTV  2241
             L+Y F E+D+ S  V  +    K + ++ + L+      AL           D + + + 
Sbjct  990   LQYVFSELDYRSDTVQKHFVDWKKVHKRAVCLIKEACDAAL-----------DVLSDPSP  1038

Query  2242  DGACFLERPIEMDVSASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRK  2421
             +G   L      D+     D+ ++    +   GP  QI++  CW A+KE S LL  +I  
Sbjct  1039  EGNLPLNYQETDDMDEQLLDESLE----DTTSGPKHQIILSCCWRAVKEASSLLQVMISN  1094

Query  2422  VPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGF  2601
             VP+ + D   +   + D  D                G  F  +L  ++H GA       +
Sbjct  1095  VPITSQDAIHTIFTLEDLVDA---------------GELFHSLLTNIRHRGAFSSVYPAY  1139

Query  2602  TALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPE  2781
              +L  +LL   D  + +L   W++  ++   S   ++    RRSAG+P    A   SE +
Sbjct  1140  VSLNMKLLAVKDLSISQLPSRWLQNDLDGLTSTNISIT---RRSAGLPLCILAVLSSE-Q  1195

Query  2782  GAPKRLLPKALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEG  2961
                + LL  A++ L+ +A +                        P   A + I       
Sbjct  1196  SIKRELLASAMKQLMALAGQE-----------------------PPKDADQRID------  1226

Query  2962  VVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRR  3141
              +P VHA+N++++ F D+ L      + ++   ++I  FSS  W +RN + + ++ L++R
Sbjct  1227  -LPQVHAYNIMRSIFMDSKLGNHVLEYVSKGFSLAISGFSSFSWAIRNCSVMLFSTLLQR  1285

Query  3142  MIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVV  3321
               G    +   S    LTG EFF R+P LH +L  ELK+A E  L   +       A  V
Sbjct  1286  TFGTKKTKDEHSHVNTLTGREFFVRFPELHPYLLKELKVAVEHLLSNPT-------AASV  1338

Query  3322  HPSLCPMLILLSRLKPSPITSETGDPFDPFL--FMPFIRKCSLQNNLRIRILASRALTGM  3495
             HP L PML LLSR+KPS    E G+  D  L  F+P +  C+     + R +A+RAL  +
Sbjct  1339  HPGLYPMLTLLSRMKPS---LEKGEEQDNVLAPFIPLVMPCAASAIYKTREMAARALVPL  1395

Query  3496  VSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLL  3654
             V                   D + + + L  L + N + N IHG LLQ+  +L
Sbjct  1396  VH------------------DVNGVITQLMELGD-NLTQNQIHGRLLQVKFIL  1429



>emb|CDH51745.1| thyroid adenoma-associated protein homolog [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=2037

 Score =   312 bits (799),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 302/1175 (26%), Positives = 510/1175 (43%), Gaps = 176/1175 (15%)
 Frame = +1

Query  274   ISEEVGTRVLKIVWNNLEDPLSQTVKQVHLIFDLFLDI-QGTLHWAEGSEKFCSFLRKIA  450
             ++E    +++  VW++ +DP+     +V  IF+  LDI +    +A        +L ++ 
Sbjct  478   LNENNTDQLIHYVWDHWDDPIDAIQHKVKTIFETTLDILEVKAQYANTQGAHKEYLLRLL  537

Query  451   SDLLHLGPRCKGRYIPLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCF  630
              +L+ +    K +Y  L  L  ++G+ +ILD+ P  ++   +A     +    T  +  F
Sbjct  538   RNLMRMDAHRKVKYALLNILVPKVGSDAILDVEPDFMWKCMRAMDSLVLSPQITGLILAF  597

Query  631   LECLRDEYWSTDGVEGGYIKYRAH------------CLLP-ILSGLSSGFAKLRSNLNTY  771
             L    +E       +G   + + +               P +L  L+S    LR N  ++
Sbjct  598   LYRRIEETMPGVKFKGQNTRLQENEDTKPAISNWIELWAPSVLRALTSSSEVLRKNNGSF  657

Query  772   ALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVLGVEQRVAVLVSLLKVSR  951
              L  L ++   S + ++  +              + D+ D V+  + R+   +++LKV R
Sbjct  658   VLQPLFKICKGSFWYLMERL--------------QSDAEDPVIDPKWRLHAFIAVLKVGR  703

Query  952   MLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDDSL  1131
              L +++GD    + S     VTD                   KI V+ L LA+ H D  +
Sbjct  704   SLDIVDGDAYVLDKS-----VTD-----------------PRKISVDTLNLAVCHADPLV  741

Query  1132  RIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTAL  1311
             R+D    L  + K  S  + +E+ ++RK +PLNM   S  F+  + +   + F R+R  L
Sbjct  742   RLDVLGLLCESRKGTSTITKVEMDILRKFIPLNMNSTSPEFRQMFCAYLSRLFLRMRGNL  801

Query  1312  ERVIKQGTWHPSLIKCLSGSPLNGEADQS-------LKHRAENLFNFMKWLSCFLFFSCY  1470
                 +      + +  + G   N +  Q        ++   E+  +F+ WL   +  S Y
Sbjct  802   YAQFRNYKASKAYVAKM-GEDDNQDKVQKAELEAMEMRSNIEHGKSFLFWLQDLICTSLY  860

Query  1471  PSAPYERKIMAMELMLIMLNVWHM--LPPQGKSDSYSSEISLYPYSKGLILPESTLLLVG  1644
             P A Y+R   A+ L+ IM++ + +  LP     D +++    +P+   +  P  T +L+ 
Sbjct  861   PGASYQRVATALRLLSIMISTFGVSELP---MPDGFATRPE-FPFQIPIGTPRMTKVLID  916

Query  1645  SIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRESDAGALTFR  1824
             ++++ +D  R  +  IL  FP P+PG+ S +     + W    V S R  ESD+GA+ FR
Sbjct  917   TLMNPYDFNRVQALEILHQFPNPLPGVESWQEAQHLLWWGLDNVTSTRAGESDSGAMVFR  976

Query  1825  LIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDWLCAAVEEG  2004
             LIF KYV++LG+ +    N   Q  +           P    + +   L+D L   VE  
Sbjct  977   LIFNKYVMQLGYDLYPERNSRAQKDTA----------PDLAPVVFTERLLDLLVKQVEAA  1026

Query  2005  EKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilalVMRITSLAL  2184
             + +L  A ++  +HG LL L+Y F E+D+ + AV S     K           ++   AL
Sbjct  1027  KDNLLVAAQQHPMHGTLLALQYVFRELDYRNPAVVSKFDEWK-----------QVHGRAL  1075

Query  2185  WVVSADAWYLPDEMEEMTVDG---ACFLERPIEMDVSASTPDDEMKIAKAEQDDGPMDQI  2355
              ++ A    + D +   + +G   A F E      +  +  D         +  GP  QI
Sbjct  1076  KMIHAVCDAVMDVLSNPSPEGNVPASFRE------MEEAIDDLIDDDNDGGEGSGPKHQI  1129

Query  2356  VMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEIIGN  2535
             ++  CW A+KE S LL  II + P+  SD     S I   TD   S ++L          
Sbjct  1130  ILSCCWRAVKEASSLLEVIISRAPM--SD---DGSAIITSTDMKESGVLLR---------  1175

Query  2536  HFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQTVD  2715
                 +L  ++H GA       + +L  RLL SND  + +    W+E+ ++   +   ++ 
Sbjct  1176  ---SLLTTIRHRGAFSAVFPAYVSLNTRLLDSNDRAITQQPSVWLEENLDSLTASNISIT  1232

Query  2716  DLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscsesssA  2895
                RRSAG+P    A  +S      K LL K ++ L  +A +                  
Sbjct  1233  ---RRSAGLPLCILA-IVSSQRSTKKTLLNKTMQRLFKLAFQE-----------------  1271

Query  2896  IDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRS  3075
                   P   A + I        +P VHA+N+L+  F DA +A     ++A+   ++I  
Sbjct  1272  ------PPADADQRID-------LPQVHAYNILRTMFMDAKVAQSVLIYAADGFCLAING  1318

Query  3076  FSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFNELK  3255
             FSSS W +RN A + ++ L++R  G    +   S    LTG EFF RYP LH +L  EL 
Sbjct  1319  FSSSSWAIRNCAVMLFSTLLQRTFGTKKTKDEHSNVNKLTGREFFTRYPQLHAYLLQELN  1378

Query  3256  IATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDPF-LFMPFIR  3432
              A E  L  ++          VHP L P+L LLSRL PS +  +  D       F+P + 
Sbjct  1379  AAIEQLLNNTA-------GASVHPGLYPILTLLSRLHPSVM--DGSDQVTAMSAFVPLVM  1429

Query  3433  KCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASF  3612
              C++ +  + R +A+RAL  ++ +  L   IL +  ++P                 +   
Sbjct  1430  TCAVSSIYKTREMAARALVPLIPSSDLVERILELL-DMPQ----------------DTCQ  1472

Query  3613  NSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLI  3717
             N IHG LLQ+  LL    R  A     +DIL+DLI
Sbjct  1473  NEIHGRLLQVQFLL----RGHAYHPSLKDILTDLI  1503



>emb|CDS03199.1| hypothetical protein LRAMOSA00601 [Absidia idahoensis var. thermophila]
Length=1981

 Score =   311 bits (797),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 328/1323 (25%), Positives = 562/1323 (42%), Gaps = 223/1323 (17%)
 Frame = +1

Query  325   EDPLSQTVKQVHLIFDLFLDI-QGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPL  501
             E+   Q +  V  IF+  LDI +    +A   +    +L ++  +L+ +    K +Y  L
Sbjct  438   ENNTDQLIHYVKTIFETTLDILEVKSQYANTQDAHKEYLLRLLKNLMRMDAHRKVKYALL  497

Query  502   ASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGG  681
              +L  ++G+ +ILD  P  ++   +A     +    T  +  FL    +E       +G 
Sbjct  498   NTLVPKVGSDAILDAEPDFMWKCLRAMDSLVISPQITGLILAFLYRRIEETIPGIKFKGQ  557

Query  682   YIKYRAH-----CLL--------PILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPML  822
               + + +      +L         +L  L+S    +R N  ++ L  L ++   S + ++
Sbjct  558   NTRLQENQDNKPAILNWIELWAPSVLRALTSPSEIIRKNTGSFVLQPLFKICKGSFWYLM  617

Query  823   GFIGIGCSAESTEIFYPELDSRDIVLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSV  1002
               +              + D  D ++  + R+   +++LKV R L +++GD    + S  
Sbjct  618   ERL--------------QSDVEDPIIDPKWRLHAFIAVLKVGRSLDIVDGDAYVLDKS--  661

Query  1003  ALEVTDLSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASL  1182
                VTD                   KI VN L LA+ H D  +R+D    L  + K  S 
Sbjct  662   ---VTD-----------------PRKISVNTLNLAVYHADPLVRLDVLGLLCESRKGTST  701

Query  1183  PSSLELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCL  1362
              + +E+ ++RK +PLNM   S  F+  + +   + F R+R  L    +      + +  +
Sbjct  702   VTKVEMDILRKFIPLNMNSTSPEFRQMFCAYLSRLFLRMRGNLYAQFRNYKSCKAYVTKM  761

Query  1363  SGSPLNGEADQS-------LKHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLI  1521
              G   N +  Q        ++   E+  +F+ WL   +  S YP A Y+R   A+ L+ I
Sbjct  762   -GQDDNQDKVQKAELEAMEMRSNIEHGKSFLYWLQDLICTSLYPGASYQRVATALRLLNI  820

Query  1522  MLNVWHM--LPPQGKSDSYSSEISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRIL  1695
             M++ + +  LP     D +++    +P+   +  P  T +L+ ++++ +D  R  +  IL
Sbjct  821   MISTFGVTELP---MPDGFATRPE-FPFQIPIGTPRMTKILIDTLMNPYDFNRVQALEIL  876

Query  1696  LHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVS  1875
               FP P+PG+ S +     + W    V S R  ESD+GA+ FRLIF KYV++LG+ +   
Sbjct  877   HQFPNPLPGVESWQEAQHLLWWGLDNVTSTRAGESDSGAMVFRLIFNKYVMQLGYDL---  933

Query  1876  CNVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVL  2055
                    P   S  +       +PV+ +   L+D L   VE  + +L  A ++  +HG L
Sbjct  934   ------YPERSSQAQKDTAPELAPVV-FTGRLLDLLVKQVEAAKDNLLVAAQQHPMHGTL  986

Query  2056  LTLRYTFEEMDWDSIAVAsnissiklllekilalVMRITSLALWVVS--ADAWYLPDEME  2229
             L L+Y F E+D+ + AV +     K +  + L +V  +    + V+S  +    +P    
Sbjct  987   LALQYVFRELDYRNPAVMAKFEEWKQVHGRALKMVHSVCDAVMDVLSNPSPEGNVPASFR  1046

Query  2230  EMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGT  2409
             EM                 A     +    +  +  GP  Q+++  CW A+KE S LL  
Sbjct  1047  EME---------------EAIDDLIDDDDDEGGEGTGPKHQVILSCCWRAVKEASSLLEV  1091

Query  2410  IIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKT  2589
             II + P+         S I    D   S ++L              +L  ++H GA    
Sbjct  1092  IISRAPMSDDQ-----SAIITSKDMKESGVLLR------------SLLTTIRHRGAFSAV  1134

Query  2590  RAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFL  2769
                + +L  RLL SND  + +    W+E+ ++   +   ++    RRSAG+P    A   
Sbjct  1135  FPAYVSLNTRLLDSNDRAITQQPSIWLEENLDSLTASNISIT---RRSAGLPLCILAIVS  1191

Query  2770  SEPEGAPKRLLPKALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKT  2949
             SE     K LL K ++ L  +A +                        P   A + I   
Sbjct  1192  SE-RSTKKTLLNKTMQRLFKLAFQE-----------------------PPADADQRID--  1225

Query  2950  RDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTA  3129
                  +P VHA+N+L+  F DA +A     ++A+   ++I  FSSS W +RN A + ++ 
Sbjct  1226  -----LPQVHAYNILRTMFMDAKVAQSVLIYAADGFCLAINGFSSSSWAIRNCAVMLFST  1280

Query  3130  LVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNL  3309
             L++R  G    +   S    LTG EFF RYP LH +L  EL  A E  L  ++       
Sbjct  1281  LLQRTFGTKKTKDEHSNVNKLTGREFFTRYPQLHAYLLQELNAAIEQLLNNTA-------  1333

Query  3310  AKVVHPSLCPMLILLSRLKPSPITSETGDPFDPF-LFMPFIRKCSLQNNLRIRILASRAL  3486
                VHP L P+L LLSRL PS +  +  D       F+P +  C++ +  + R +A+RAL
Sbjct  1334  GASVHPGLYPILTLLSRLHPSVM--DGSDQVTAMSAFVPLVMTCAVSSIFKTREMAARAL  1391

Query  3487  TGMVSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNC  3666
               ++ +  L   IL +  ++P                 +   N IHG LLQ+  LL    
Sbjct  1392  VPLIPSSDLVERILELL-DMPQ----------------DTCQNEIHGRLLQVQFLL----  1430

Query  3667  RNLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKC  3846
             R  A     +D+L+DLI            ++ P  I+           L + R+  M++ 
Sbjct  1431  RGHAYHPSLKDVLTDLI------------KRVPTAIV-----------LLLQRSKSMNR-  1466

Query  3847  ISVIWNLLWTLSS----ECLDLYTSKRPAYFD--PTIAELRKQAASSYFNCAYQTSKDVN  4008
               V + LL  + +    EC  +   + PA+     +IAE+  Q   +       T  D +
Sbjct  1467  --VAYALLLDICNEFFFECNWMRVDREPAFTQELESIAEIELQTLRT-------TLIDQS  1517

Query  4009  EEDLIYLRGPPP--DSELFKESETQM----SVTRFQERLIRS-----LSDALYEVRIATL  4155
              E +   RGPP    + L ++S  ++    ++  ++E L  S     L D  YEVR+  +
Sbjct  1518  LEQIGEPRGPPTLIGNYLARQSMARIIVISALKHYRESLKVSDTLFLLDDPDYEVRLMAM  1577

Query  4156  KWL  4164
               L
Sbjct  1578  NLL  1580



>ref|XP_002955504.1| hypothetical protein VOLCADRAFT_96436 [Volvox carteri f. nagariensis]
 gb|EFJ43357.1| hypothetical protein VOLCADRAFT_96436 [Volvox carteri f. nagariensis]
Length=2925

 Score =   309 bits (792),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 253/890 (28%), Positives = 391/890 (44%), Gaps = 182/890 (20%)
 Frame = +1

Query  1594  PYSKGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKL  1773
             PY   L+   +  LL+ + +DSWD+LR+++   L+  PTP+PG+SS   +   + WA  L
Sbjct  1172  PYCPELLSSNTVALLLAAAVDSWDKLRQAASSCLMRLPTPLPGLSSVAQLTPLLAWAAGL  1231

Query  1774  VCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQS------------------P  1899
             + SPR RESDAGA   ++++ KYV   GW +++                          P
Sbjct  1232  LNSPRARESDAGARLIKILYGKYVAGCGWRLQLHPKPRALPPPPPPAATAQHPQHYNPHP  1291

Query  1900  SGLSNGENLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFE  2079
                S     +  P + V++++ +++D + + V    +DL+ AC++S  HG LL LRY  E
Sbjct  1292  DRGSVPVIADPQPYAAVLDFLDAVLDLVNSQVAAAREDLAAACRRSLAHGPLLLLRYVVE  1351

Query  2080  EMDWDSI-AVAsnissiklllekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACF  2256
             ++ W ++ A  + +++      K LA    +  LAL V+S                    
Sbjct  1352  DVPWGAVCASPAGLAAAAGWAAKALAAAEELVGLALPVLS--------------------  1391

Query  2257  LERPIEMDVSASTPDDEMKIAK----------------------AEQDDGPMDQIVMVGC  2370
               RP E +V A   D  M  A+                       + D GP  Q+++  C
Sbjct  1392  --RPQERNVGAEEVDTTMMAAREEEGEDEGGSGDDGDAGEGEEGDDGDLGPESQVIITAC  1449

Query  2371  WLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQ------------------ITDGTDQLSSD  2496
             W  +KEVSL+L T++R +PLPTS    + +                   I + T   +S 
Sbjct  1450  WTTVKEVSLVLATMVRHMPLPTSASANTTTAATSTTSAAAAASTSTSSIIANNTTASNSS  1509

Query  2497  IVLDLR-----QLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTE  2661
                        QL  +G   L +L +MKHNGA+DKT    TA+  RLL  +   L  L  
Sbjct  1510  SRSSSSILSCDQLRQVGELLLRLLFEMKHNGAVDKTALALTAVSERLLRGSASELNGLPR  1569

Query  2662  SWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKK  2841
              W+E  + R ++  QT DD++RRSAG+P AF A F +EP  APK LL + +  L+ VA  
Sbjct  1570  PWLEACIRRVLAPNQTRDDIVRRSAGLPFAFGALFHAEPGNAPKTLLARGMNALLAVAAA  1629

Query  2842  SLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANL  3021
             + T             +A ++T   D   + ++       V P VHAFN L+ AFND NL
Sbjct  1630  AST-----AGPYLSYLAAAETTE--DGERVVVVDGYEVRQVWPVVHAFNCLRHAFNDGNL  1682

Query  3022  ATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGL  3201
             + DTSG+ A A+   +R+  S  WE+RNSA L +TAL  R++GF N    ES R+A++G 
Sbjct  1683  SVDTSGYFAPAIQACLRALRSPAWEIRNSAMLCFTALTARVLGFKNDSHGESCRKAVSGT  1742

Query  3202  EFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVV-------HPSLCPMLILLSR  3360
             EFF RYP LH FL  +L+ A     E ++    +             HP L P+LI+LSR
Sbjct  1743  EFFQRYPALHGFLLAQLREAATELEEAAAAAAVAAGGASASFAPANPHPGLYPVLIILSR  1802

Query  3361  LKPSPITSETGD-----------------------------------------------P  3399
             LKPS I ++ G                                                 
Sbjct  1803  LKPSHIRNDGGSYSTPLKQQQQEEEGERQEEDQSGGGAPAAAAAAAPVGAASAVTTYMGA  1862

Query  3400  FDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPA---------  3552
               P  F P +R+C+      +R LA+RAL  +V+ + +P ++  +   +PA         
Sbjct  1863  LTPVAFTPLVRRCATAAPYAVRRLAARALGPLVAAQDVPALLQQLLESIPAEPSSGGGAA  1922

Query  3553  --IDNHSMTSDLSGLSNLNASFNSIHGMLLQ-------------------LSSLLDTNCR  3669
                        + G +N NA    +HG LLQ                    S  ++ +  
Sbjct  1923  AAAAAVGSVRTVVGSTNANA----LHGALLQSAALLETAAAARPGGGGANPSVTINADGG  1978

Query  3670  NLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSI  3819
             +     +  D+L+  +  L + +W+  P +  C  L C  L+     LS+
Sbjct  1979  HGGSGVEGVDVLTVALPHLARGAWLADP-RVGCSALGCGLLQAASAALSL  2027


 Score = 70.5 bits (171),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 92/243 (38%), Gaps = 63/243 (26%)
 Frame = +1

Query  112  ILYDGILSELCNFCEHPTDSHFNFHALTVMQICLQQI-----------------------  222
             L DG LS  C+      D+HF FHA  V+  C+ ++                       
Sbjct  480  FLVDGALSYGCSSIRDAPDAHFKFHAACVLCFCVSKVLDSWQQFQQLQQQQQQQQEQEQQ  539

Query  223  ----------------------KTSMQGTDGYI--EEGYDPISEEVGT------------  294
                                  +  +    G +  EE   P+    GT            
Sbjct  540  EQEQQQQQQQQQERHADDEPPNQEPINAGSGEVAAEEAGVPLKAAAGTAPLQPALLHTES  599

Query  295  --RVLKIVWNNLEDPLSQTVKQVHLIFDLFLDIQGTL-HWAEGS-EKFCSFLRKIASDLL  462
              +++ ++W NL++PL+QT +Q+   F L L++     H+  G       F R++   LL
Sbjct  600  LNQLMGLMWANLDEPLAQTARQLQDAFQLLLEVLSCQDHYRPGVLPPLDLFRRQVVGQLL  659

Query  463  HLGPRCKGRYIPLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECL  642
             +    KGRY PL  + +R  A  +L   P L+ +   A   D   SAA++FLK  L   
Sbjct  660  AVPYNRKGRYAPLGCMAERGCALGMLRDHPSLIPEALMAMESDTTASAASSFLKTLLAAA  719

Query  643  RDE  651
            R E
Sbjct  720  RTE  722



>emb|CEI94382.1| hypothetical protein RMCBS344292_08593 [Rhizopus microsporus]
Length=2023

 Score =   304 bits (779),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 308/1225 (25%), Positives = 516/1225 (42%), Gaps = 201/1225 (16%)
 Frame = +1

Query  148   FCEHPT-DSHFNFHALTVMQICLQQIKTSMQ--GTDGYIEEGYDPISEEVGTRVLKIVWN  318
             FC+ P  D+         M   LQQ K  M+       I+    PI  +   R++  VW+
Sbjct  382   FCQTPNLDASCKVVVFESMATWLQQTKEIMECNKEKHIIDSISGPIHSKNMDRLIYYVWD  441

Query  319   NLEDPLSQTVKQVHLIFDLFLDI-QGTLHWAEGSEKFCSFLR------------------  441
             + +DP+     +V  IF+L L + Q   ++      +  FL                   
Sbjct  442   HWDDPIDSIQHKVRSIFELVLSLMQIKSNFYNQDHTYNEFLHHLLKNMINMDWHKKVKYA  501

Query  442   -------KIASDLLHLGPRC-------KGRYIPLASLTKRLGAKSILDMSPGLLFDTTKA  579
                    K+ +D  HL           K +Y  L  L +++   + L + P L+    +A
Sbjct  502   LLNMLVEKVETDTHHLLKNMINMDWHKKVKYALLNMLVEKVETDTFLKVEPRLIEKCLQA  561

Query  580   YVDDDVCSAATTFLKCFL-ECLRDEYWSTDGVEG--GYIKYRA---HCL--------LPI  717
                  +C   T FL  FL   ++D     +   G  G +KY +   H +        LP+
Sbjct  562   MDSLILCPQITYFLLTFLYRRIQDTIPGHEKFNGHNGKVKYDSNSKHAVDEWIALWALPL  621

Query  718   LSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIV  897
             L  L+S    +R N + + L  L ++   S + ++  +     +   E    + DSR   
Sbjct  622   LQSLTSSVELVRKNASGFLLQPLFKVSSQSFWFLVNILQDVHDSRWKE---DKFDSR---  675

Query  898   LGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEV  1077
                  R+   +++LK +R L +I+G+      S   LE T                    
Sbjct  676   ----FRLNAFIAVLKSARALDIIDGN---AYTSEPTLEKT--------------------  708

Query  1078  KIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQ  1257
             KIP++ L LA+ H D  +RID    L  + K  +  + +EL +++  +PLNM   +  F+
Sbjct  709   KIPIDVLKLAVHHSDPQVRIDVLGLLCESRKATAEVTFIELDMVKMFLPLNMNSTAPEFR  768

Query  1258  MKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQS-LKHRAENLFNFM  1434
              +  +   K + R+R  L    +      +           G +D + +  R E   +F+
Sbjct  769   QQMCAHLTKLWVRLRGNLYSQYRAYKLFET------KDAKKGASDATDIMARIEQGRSFL  822

Query  1435  KWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHM--LPP-QGKSDSYSSEISLYPYSK  1605
              WL  F+  S YP A Y+R   A+ ++ I++  + +  LPP +G +D        +P+  
Sbjct  823   FWLCDFISDSLYPGASYQRVATALRMLSILVKTFGVTELPPIEGFTDRQPE----FPFQL  878

Query  1606  GLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSP  1785
              L     + LL+   ++ +D  R  +F IL  FP+P+PGI S   V   + W    V S 
Sbjct  879   PLATARLSKLLINVFMNPYDFNRVQAFDILNQFPSPLPGIESKLDVQNLLWWGLNNVVST  938

Query  1786  RVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYIT  1965
             R  ESD+GA+ FRLIF+KYV+ LG+ +         +P      E+     +S  + +  
Sbjct  939   RANESDSGAMVFRLIFKKYVVHLGFDL---------NPEQGKLHESTFNEKTSAAVIFTE  989

Query  1966  SLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllek  2145
              L+D L   V   + +L  A ++  +HG LL L+Y F E+D+ S     +    K + ++
Sbjct  990   RLLDLLERQVAVAKSNLLLAAQQHPMHGTLLALQYVFSELDYRSDTAQKHFVDWKKVHKR  1049

Query  2146  ilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKA  2325
              + L+      AL           D + + + +G   L      D+     D+ ++    
Sbjct  1050  AVCLIKEACDAAL-----------DVLSDPSPEGNLPLNYQETDDMDEQLLDESLE----  1094

Query  2326  EQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVL  2505
             +   GP  QI++  CW A+KE S LL  +I  VP+ + D   +   + D  D        
Sbjct  1095  DTTSGPKHQIILSCCWRAVKEASSLLQVMISNVPITSQDAIHTIFTLEDLVDA-------  1147

Query  2506  DLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLME  2685
                     G  F  +L  ++H GA       + +L  +LL   D  + +L   W++  ++
Sbjct  1148  --------GELFHSLLTNIRHRGAFSSVYPAYVSLNMKLLAVKDLSISQLPSRWLQNDLD  1199

Query  2686  RTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknke  2865
                S   ++    RRSAG+P    A   SE +   + LL  A++ L+ +A +        
Sbjct  1200  GLTSTNISIT---RRSAGLPLCILAVLSSE-QSIKRELLASAMKQLMALAGQE-------  1248

Query  2866  nsscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFS  3045
                             P   A + I        +P VHA+N++++ F D+ L      + 
Sbjct  1249  ----------------PPKDADQRID-------LPQVHAYNIMRSIFMDSKLGNHVLEYV  1285

Query  3046  AEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPT  3225
             ++   ++I  FSS  W +RN + + ++ L++R  G    +   S    LTG EFF R+P 
Sbjct  1286  SKGFSLAISGFSSFSWAIRNCSVMLFSTLLQRTFGTKKTKDEHSHVNTLTGREFFVRFPE  1345

Query  3226  LHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFD  3405
             LH +L  ELK+A E  L   +       A  VHP L PML LLSR+KPS    E G+  D
Sbjct  1346  LHPYLLKELKVAVEHLLNNPT-------AASVHPGLYPMLTLLSRMKPS---LEKGEEQD  1395

Query  3406  PFL--FMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSD  3579
               L  F+P +  C+     + R +A+RAL  +V                   D + + + 
Sbjct  1396  NVLAPFIPLVMPCAASAIYKTREMAARALVPLVH------------------DVNGVITQ  1437

Query  3580  LSGLSNLNASFNSIHGMLLQLSSLL  3654
             L  L + N + N IHG LLQ+  +L
Sbjct  1438  LMELGD-NLTQNQIHGRLLQVKFIL  1461



>ref|XP_004353093.1| HEAT repeat domain containing protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR23565.1| HEAT repeat domain containing protein [Acanthamoeba castellanii 
str. Neff]
Length=2211

 Score =   301 bits (772),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 254/902 (28%), Positives = 424/902 (47%), Gaps = 146/902 (16%)
 Frame = +1

Query  1066  GIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCS  1245
             G  + IP + + +AL H D+ LR DA E + +  KT   P+  EL +M+  + +N++  S
Sbjct  839   GFHLPIP-SLVRIALGHSDEELRNDALELICLGKKTIESPTYFELDMMKYYLWVNIKASS  897

Query  1246  TAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLF  1425
              + +        KF  R++  +    +Q   H  + + L      GE+ + L      + 
Sbjct  898   QSLRQGAIPRIGKFLQRLKDCVYH--EQKKKHEQIKRKLPPIEDEGESVEVL------VT  949

Query  1426  NFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSK  1605
             +F+KW   F+ F+ YPS  Y+RK  A+ L   +LNV+       K   Y    S   Y+ 
Sbjct  950   DFLKWYQSFISFALYPSGSYQRKSTAVALYRELLNVFGA----DKEGDYGKLSSWDAYA-  1004

Query  1606  GLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSP  1785
                 P ST  LV ++ D  D +R S+  +L  FP+P+PG S P  V   + WA  ++ SP
Sbjct  1005  ----PVSTAALVLTLWDDIDSMRHSASTVLAAFPSPLPGFSDPAKVASLMRWALWMMNSP  1060

Query  1786  RVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVI-EYI  1962
             R RE+D G L FRLI  KYVL LGW ++VS   VT   +   +    EF PS     E I
Sbjct  1061  RTRETDTGCLVFRLILTKYVLPLGWYIQVSEESVTPHLAHSPSFNPHEFAPSQFFFSETI  1120

Query  1963  TSLIDWL-CAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAV----------A  2109
             + L   + CA+V     DL  A +++ +HG LL +RY  +++++ ++            +
Sbjct  1121  SQLERHIACASV-----DLVGASQRTPIHGPLLAIRYMIQDVNFKALKANVDASTDGGGS  1175

Query  2110  snissiklllekilalVMRITSLALWVVSA-------DAWYLPDEMEEMTVDGACFLERP  2268
               I+  +LLL+++LA + + T+L L +VSA        A  +P+E E   V G    E  
Sbjct  1176  KQIADWRLLLDRLLACLRKATNLVLPIVSAISPEGLTSAQTIPEEYE---VSGVIEGESD  1232

Query  2269  IEMDVSASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVP  2448
             IE                      P  Q + V  WL++KEV LLLG+++  VP       
Sbjct  1233  IEYGT-------------------PQGQYLAVCAWLSIKEVGLLLGSLVNAVP-------  1266

Query  2449  KSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLC  2628
                             +V+    ++  G+ F+ ++L  +H GA++K+  GF  L   LL 
Sbjct  1267  ----------------VVMAEEGIKEAGDLFMHIMLSSRHRGALEKSYLGFQLLSENLLS  1310

Query  2629  SNDPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEP------EGAP  2790
                P L  L  +W++ L++  V +      + RRSAG+P  F A   +E        G  
Sbjct  1311  CAHPGLYSLPGTWIQHLLK--VIENDDFKSITRRSAGLPYCFCAILRAETIVLGRRRGGV  1368

Query  2791  KRLLPKALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVP  2970
             K L+ +A++ L+ +A    T   ++  +    S  ++S +                G   
Sbjct  1369  KVLIAQAMQALLRIASGGDT---RQLETQDAKSEGVESVI----------------GEQA  1409

Query  2971  TVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIG  3150
              VHA NVLKA F D+ L  D   + ++A+I+++  ++S+ W +RNS+ + ++ +V R++ 
Sbjct  1410  QVHALNVLKALFRDSCLRLDVIPYLSDAIIIALNGYTSTSWGIRNSSTMNFSTIVERVVA  1469

Query  3151  FLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPS  3330
                V+  +S + A T  +FF R+P L+ FL    K   ++ L    +N       +++ S
Sbjct  1470  PKLVRDEQSKKNAATFPQFFSRFPRLYPFLLQ--KFQEQITLSEKRDN------AIMYSS  1521

Query  3331  LCPMLILLSRLKPSPITSETGDP-----------FDPFLFMPFIRKCSLQNNLRIRILAS  3477
             + PML+LLSRL P  + +   +              P  F+P + KCS  +N ++R +A+
Sbjct  1522  IYPMLVLLSRLMPFMLKTNKANKKVKPGEGSRPQLSPEAFIPLVAKCSANSNFKVREMAA  1581

Query  3478  RALTGMVSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLD  3657
             RAL  +V  E +   I ++ + +P   +H+   D           N  HG LLQ+  +L+
Sbjct  1582  RALVPLVPPEHVAAFITSLFASIP---DHAAGID----------HNLAHGTLLQIRHILE  1628

Query  3658  TN  3663
              +
Sbjct  1629  AH  1630


 Score = 62.4 bits (150),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 62/270 (23%), Positives = 106/270 (39%), Gaps = 27/270 (10%)
 Frame = +1

Query  67   DGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFNFHALTVMQICLQQIKTSMQGTD  246
            D +  PG       TIL+D + S+LC  C    +      A   +   LQ +K  +  + 
Sbjct  441  DAITTPGRERKV--TILWDFLFSDLCRICGTGGEILTRRFAFQTLADILQTMKELLAASA  498

Query  247  ---------GYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVHLIFDLFLDI----  387
                     G  +   D   +++   +L +VW N  D     V+QV  IF+  LD+    
Sbjct  499  PSLSPDTVMGPFQATPDLFFDDLQVAILDLVWLNWNDSSESIVQQVSKIFEYLLDVYDIL  558

Query  388  QGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSILDMSPGLLFD  567
            +  L  +   E +  F   +   LLH+    K +Y  +  L  RLGA  I  +      +
Sbjct  559  KSVLLASARREHYEHFFTALVERLLHVEDHIKAKYTTIQLLLNRLGAHRIFMIKQDFFIN  618

Query  568  TTKAYVDDDVCSAATTFLKCFLECL----RDEYWSTDGV---EGGYIKYRAHCLLPILSG  726
              ++  +    +AA+  ++ FL  L    +  +   +G    E    + R   + P +  
Sbjct  619  MLRSVKEPTARNAASRVVESFLGSLFAERKKAHEHDEGSAANEAALTECRQVWVGPTVEL  678

Query  727  LSSGFAKLRSNLNTYALPVLLELDVDSIFP  816
            L S     R  +  YALP +L     ++FP
Sbjct  679  LCSAEKSERQGMVLYALPSIL-----AVFP  703



>gb|KFH73676.1| hypothetical protein MVEG_00890 [Mortierella verticillata NRRL 
6337]
Length=2072

 Score =   284 bits (727),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 238/889 (27%), Positives = 403/889 (45%), Gaps = 110/889 (12%)
 Frame = +1

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             I ++ L  A+ H    +RID    L  + ++ +  +S+E  L+++ +PLN+      F+ 
Sbjct  736   IDISILRSAMHHASSDIRIDVLGILCESRRSTTPVASVEYELLKQFLPLNLNAVVPDFRQ  795

Query  1261  KWASLFRKFFSRVRT---ALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNF  1431
             K  S   KF  RVR     L R I +   H S+ K         +     + +      F
Sbjct  796   KLYSHLTKFLFRVRGNCYVLAREIAR--LHTSVGKKNLSEKDAADMIDEREIKVGETKAF  853

Query  1432  MKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHM----LPPQGKSDSYSSEISLYPY  1599
             ++WL   +F S YP A ++R   ++ L+ +++  + +    LPP  K +    EIS +P+
Sbjct  854   LEWLLEHIFSSMYPGASFQRVSTSLRLLGMIIKTFGIETTPLPPGSKPN----EISRFPF  909

Query  1600  SKGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVC  1779
                +   E T +L+G +++ +D  R  +  IL+ F  P  G SS + V   + W    + 
Sbjct  910   QLPIASEEHTKILLGCLLNPFDHCRSQALEILMSFKAPFTGYSSKDSVDGLVRWGLDWLK  969

Query  1780  SPRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEY  1959
             S R  ESD+G L  + IF KY +ELGW + +        P    +         +P + +
Sbjct  970   STRAGESDSGGLVLQTIFVKYAIELGWDIEL--------PHERLDSVTFAKETDNPAVNF  1021

Query  1960  ITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklll  2139
                L + L   +E+ + +  +A     +HG L+ LRY F  +D+ S  V ++ +  + + 
Sbjct  1022  TIRLQNLLRMQLEKAKLNQLDAAHNHPMHGTLIGLRYLFSSIDYASPLVTNHRALWQSVH  1081

Query  2140  ekilalVMRITSLALWVVS--ADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMK  2313
               ++ LV  + S+ + V+S  +    +P    EM        E  I+  +S+S  D+   
Sbjct  1082  ADMMELVENVCSIVMGVLSNPSPEGNIPATFTEM--------EESIDAVISSSGSDE---  1130

Query  2314  IAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSS  2493
                 EQ  GP  Q+++  CW A+KE S L+  ++ K  L              G+  L  
Sbjct  1131  ---FEQSGGPNHQVILSYCWRAIKESSALMELVLSKATL--------------GSSTLKV  1173

Query  2494  DIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWME  2673
             D +L+ R L+  G  F  +L  ++H GA       + +LC RLL S DP L  L   W+E
Sbjct  1174  DGILEPRALDRAGALFRRLLTTIRHPGAFSSVFPAYISLCTRLLNSEDPALAPLPRVWLE  1233

Query  2674  QLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTD  2853
             + ++  +S   +V    RRSAG+P    A   +E     + LLP  +R ++ +A K ++ 
Sbjct  1234  ENLDAILSDAISVT---RRSAGLPLCILAIVNAELSDNRRTLLPMVMRRVMAIAVKPVS-  1289

Query  2854  knkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDT  3033
                           +D+    D               +P +HA NVL+  F DA L+T  
Sbjct  1290  --------------VDANQQVD---------------LPQIHAMNVLRRLFMDAKLSTSV  1320

Query  3034  SGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFH  3213
               +  + L +SIR+F S  W VRN   + ++ L+ R+ G   V+    A   +T  E F 
Sbjct  1321  LPYVGQGLELSIRAFMSPSWAVRNCGVMLFSTLLHRVFGAKRVRDEHLAINGITSRELFA  1380

Query  3214  RYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETG  3393
             R   L  FL ++L++A    L   S          VHP L P+L LLSRL+PS + +++ 
Sbjct  1381  RLEGLCGFLQSQLEVAVGQLLGAESSQ------DRVHPGLYPVLTLLSRLQPS-LHADSA  1433

Query  3394  DPFDPFL--FMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHS  3567
             D  D  +  F+  +R+C+     + R +A+RAL  +V++  L  +I++I           
Sbjct  1434  DAVDGGMAAFVTLVRRCAASAIWKTREMAARALIPLVASRDLMDLIVDI-----------  1482

Query  3568  MTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNC--RNLADFSKKEDILS  3708
                 L G        N IHG+L+Q+  LL  +     +AD   + D ++
Sbjct  1483  ----LQGCMKSPIIQNEIHGLLVQVQFLLRGHLLGEGVADREVRRDFVT  1527



>ref|XP_003061897.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53609.1| predicted protein [Micromonas pusilla CCMP1545]
Length=1454

 Score =   275 bits (702),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 250/787 (32%), Positives = 374/787 (48%), Gaps = 93/787 (12%)
 Frame = +1

Query  667   GVEGG--YIKYRAHCLLPILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIG  840
             G  GG     +RA  + P+L  +  G  + R    TYALP LL+ D  SI P+L  +   
Sbjct  693   GRGGGKAVTAWRAWWVPPLLKTML-GEGRARVGAVTYALPPLLKRDGASIVPLLKHL---  748

Query  841   CSAESTEIFYPELDSRDIVLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTD  1020
                   E     L+  D     E+R   LV+LL+ +R  AL++         +    V+ 
Sbjct  749   ----VDEKPPRGLNESDDAAWSERRSGALVALLRAARARALLD--------PACVARVSP  796

Query  1021  LSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLEL  1200
             +   AG  D      G   ++P   L  A+   D   R DA E + ++ +TASLP  LEL
Sbjct  797   VVFAAGGYD------GPSFEVPRELLERAVVCRDARTRCDALELVCLDGRTASLPGDLEL  850

Query  1201  SLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTALER---VIKQ--------GTWHPS  1347
              L++ A+P  +R  S AF+    S+ R   +RV+T   R   +I+Q        G   P 
Sbjct  851   DLLKSALPGCLRGDSAAFRNALGSMLRGLLARVKTGQLRAAVMIRQISRRRAVFGDEKPP  910

Query  1348  LIKCLSG---SPLNGEADQSLKHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELML  1518
                   G   +    E   +   RA     + KWL   L  S YP APYERK  A++L+ 
Sbjct  911   DDVRYGGKGAAAFTPEEADAFILRAVACEKWTKWLVRALLASAYPGAPYERKFTALDLLN  970

Query  1519  IMLNVWHMLPPQGKSD------SYSSEISLYPYSKG------------------LILPES  1626
              ++  W +   +G  D      S S++ ++   + G                   +  + 
Sbjct  971   AVVETWGVA--EGGEDRAQHERSESTKRAMEKAAAGDPAAELAARALEASPYLPCLREDC  1028

Query  1627  TLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRESDA  1806
             T  L+G+ +DSWD+LR S+F +L   P P+ G  +P  +   + WA KL+ SPR RESDA
Sbjct  1029  TTSLLGAAVDSWDKLRASAFSLLQRHPAPLAGAETPTALESRLRWALKLLRSPRARESDA  1088

Query  1807  GALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDWLC  1986
              A   RL+FRKY L+LGW V+++      +P+  +   +   T ++ V++ +  LI+  C
Sbjct  1089  AAQLTRLLFRKYALDLGWDVKLAPVPSATTPAEGATRASAGAT-ATRVLDNMCDLIENEC  1147

Query  1987  AAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilalVMR  2166
                E  EKD+  AC++S  HG LL  RY   E+ + + +V    + +K  L ++L+L+ R
Sbjct  1148  ---ELAEKDMMTACRQSLAHGALLATRYVLAEIPFVAASV-EESAEMKACLARLLSLLER  1203

Query  2167  ITSLALWVVSADAWYL-PDEMEEMTVD-------------GACFLERPIEMDVSASTPDD  2304
             +T +AL  +S  +  L   E  E+  D              A       + D    + DD
Sbjct  1204  VTGVALSSISTPSGALIAAESREINPDTLGGGSDQGAAAAAAAAAGGAYDDDDDDVSGDD  1263

Query  2305  EMKIAKAEQDDG-----PMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTS-----DVPKS  2454
             ++     + +DG     P  Q ++  CWL MKEVSLL G + R VPLP       D    
Sbjct  1264  DLDADVDQSEDGGVTLAPKAQTIVTACWLTMKEVSLLTGELARVVPLPGGANRHGDGGDG  1323

Query  2455  CSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSN  2634
                      + +   +LD  QL+  G   +  +L MKHNGAI+KTR G   L  RLL S+
Sbjct  1324  GGGGDGDAARDADAGLLDPSQLKAAGERLIRTILVMKHNGAIEKTRVGLACLGERLLRSS  1383

Query  2635  DPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKAL  2814
                L +L  +W+E L ER  + GQ V DL+RRSAGIPA F A F +EP G P+ LL  A+
Sbjct  1384  RRELSELPGAWLEALFERLRAPGQGVADLIRRSAGIPAGFMAVFSAEPPGVPRALLHDAM  1443

Query  2815  RWLINVA  2835
             R L+++A
Sbjct  1444  RRLLDIA  1450


 Score =   119 bits (299),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 97/185 (52%), Gaps = 12/185 (6%)
 Frame = +1

Query  109  TILYDGILSELCNFCEHPTDSHFNFHALTVMQICLQQIKT--SMQGTDGYIEEGYDPISE  282
            T+LYDG L  +C+  E P DSH+ FHA   ++  LQ+     + +  D         +S+
Sbjct  441  TLLYDGALPAVCDAMEKPRDSHYKFHASAALKASLQRASAIATAEVADATATASV-VMSD  499

Query  283  EVGTRVLKIVWNNLEDPLSQTVKQVHLIFDLFLDIQGTLHWAEGSEKFC---------SF  435
            ++  RVL I+W N EDPLSQTVK+V   F+  LD++        +             +F
Sbjct  500  KLSDRVLGILWANWEDPLSQTVKEVQAAFEHLLDVKSIFDRRRANANANANTKTPHDDAF  559

Query  436  LRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATT  615
            L      LL+ G  CKGRY+PL+  T+RLGA+ +L ++P LL +T  A  DD V  AA T
Sbjct  560  LIAATRQLLNKGAHCKGRYVPLSVATRRLGARRLLAVAPELLAETLDAMRDDSVSCAAGT  619

Query  616  FLKCF  630
             +   
Sbjct  620  LVAAL  624



>ref|XP_002903897.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY54952.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=2026

 Score =   227 bits (579),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 296/1236 (24%), Positives = 506/1236 (41%), Gaps = 216/1236 (17%)
 Frame = +1

Query  88    NNDSSVKTILYDGILSELCNFCEHPTDSH--FNFHALTVM----QICLQQIKTSMQGTDG  249
             ++DS  +  + D I + +  FC+  + +   F F  L          LQQ K     +D 
Sbjct  381   DDDSKTEQSVLDAIFTGVQQFCDQESYNTRLFAFQVLEAFLRRAVTILQQQKKDRDSSDK  440

Query  250   YIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVHLIFDLFLDIQGTLHWAEGSEKFC  429
             Y       ++ E  T +   V  N E P S+ V Q   +  +F  I   +H+   SE F 
Sbjct  441   YPA----ALAVETLTNLTTAVLLNWEHP-SKKVNQ--FMATVFAHI---VHYFVLSEGFQ  490

Query  430   SFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAA  609
              +   I S L+ L P  + +Y  L  L    GAK +L  SP LL     A    D  + A
Sbjct  491   DWSDAILSRLVELPPTSRAKYGSLTLLVAEAGAKPVLQASPALLSSLLSAVGQKDYAAPA  550

Query  610   TTFLKCFLECLRD------EYWSTDGVEGGYIKYRAHCLLPILSGLSSGFAKLRSNLNTY  771
                L  F + L D          TD  +     +R   L  ++  L S  A LRS +  Y
Sbjct  551   AANL--FAQILDDLSGGNKSKKKTD--DESVAAWRELWLPDVVKVLLSSDANLRSRVAMY  606

Query  772   ALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVLGVEQRVAVLVSLLKVSR  951
              +P+LL+ D D +  ++  + +  + E       + D+ D+ L                 
Sbjct  607   VIPLLLKKDSDCVPVLIKRLQVEATKEQ------DGDAADVAL-----------------  643

Query  952   MLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDDSL  1131
                       W E     LEV   +      + +V V   E++         L H     
Sbjct  644   ----------WAE-----LEVLKFARKKMAPEKLVGVSMHEIE-------RGLRHAKTET  681

Query  1132  RIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTAL  1311
             R  A ++L  + K+ S+PS  EL L++  + +N +    A +M      +    R++  +
Sbjct  682   RGTAFDALCASLKSTSMPSDDELRLVKCYLVVNGKEIGPAGRMNTLIGLKTVLIRIKETM  741

Query  1312  ERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAEN----LFNFMKWLSCFLFFSCYPSA  1479
                                  L G+   S +H   +      +F  W+  F+  S YP A
Sbjct  742   R--------------------LAGKKSVSSEHAGRDELAAAVSFKHWVELFVVSSVYPGA  781

Query  1480  PYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILPESTLLLVGSIIDS  1659
               +R  + +E++L+ + ++ +     +S+S S           L   +    L+  +I +
Sbjct  782   LPQRLTLGLEVLLLYVQLFGL-----ESESPSL----------LRTGQMVTTLLNMLISA  826

Query  1660  WDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRESDAGALTFRLIFRK  1839
             WD +R  +F +L  +P  +PG S+PE +   + WA  L  SPR RESDAGA+  RL+F+K
Sbjct  827   WDSIRSLAFTVLDLYPDELPGYSTPEELRTLVDWAVGLCGSPRQRESDAGAMFIRLLFQK  886

Query  1840  ---YVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDWLCAAVEEGEK  2010
                 +   G  ++ S    T++ S            ++P + ++  L   + + +E    
Sbjct  887   CSAAMQRYGLTLQQSERTATEASS------------TNPDVAFVLQLTQVILSRIEALSP  934

Query  2011  DLSEACKKSFVHGVLLTLRYTFEEMDWDSIAV--AsnissiklllekilalVMRITSLAL  2184
                   +   VHG LL+L Y  + +D+D+++   A++  +    +   +   MR  SLA 
Sbjct  935   AEIRRGESPLVHGFLLSLHYVLDNIDFDTLSSSDAAHWPAAMTQIFAAIHQSMR-ASLA-  992

Query  2185  WVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKI-----------AKAEQ  2331
               V  DA     + E      A F     E+   A T    +++              E+
Sbjct  993   --VVGDATSGAGDKEL----SASFAGVVGEVSAVAKTSSSALRVDCRGHLIVENGDGLEE  1046

Query  2332  DDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDL  2511
             +DG  +Q  +VG WLA +E   +L  ++R+VPLP+S+   +   +T  T +++       
Sbjct  1047  EDGNAEQRAVVGSWLAARECGAILELLMRRVPLPSSN--STSDSVTFFTAEMA-------  1097

Query  2512  RQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLC--KLTESWMEQLME  2685
                +  G   L  L ++KH GA+      F  +C   L   +  L    L   W ++L+E
Sbjct  1098  ---QRGGETLLNSLFELKHKGAVATAYQAFEGVCRAFLAHGEQSLVLGGLPARWADRLLE  1154

Query  2686  RTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknke  2865
             R     Q    +LRRS+G   +F A   +EP  +   +LPK +  L+ +A +        
Sbjct  1155  RLERSEQHF--ILRRSSGFAFSFVAILRAEPRNSAAVILPKVMSTLLRLAGE--------  1204

Query  2866  nsscsesssAIDSTMVPDVAAIEMISKTRDEGVV--PTVHAFNVLKAAFNDANLATDTSG  3039
                              D  A E     ++   +    VHA N+LK    D  LA D + 
Sbjct  1205  -----------------DTDAAERRDTHQEHHSLWRARVHALNILKLICQDGVLAEDVAR  1247

Query  3040  FSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRY  3219
             +  +   +++R F    W VRNS+ + + A  +R IG   +    + ++  +  + F R+
Sbjct  1248  YVVDMFELAVRGFDCGSWAVRNSSMMLFAAATQRAIGDKRIADGGTHQQVASD-DVFSRF  1306

Query  3220  PTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSP-----ITS  3384
               L  FL  EL   T+L    +++  +S L     P L P+L+ LSRL+P       +  
Sbjct  1307  QQLRGFLAREL---TKLL---TADKKSSALGGAAPPGLYPLLLFLSRLRPGDEDDQRVAD  1360

Query  3385  ETGDPFDP---FLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELP--  3549
                 P D      F+P + KC+ Q  + IR +A++ +  +VS+     V+  + +ELP  
Sbjct  1361  APASPCDGSGLASFVPLVIKCASQPTMAIRHMAAKVVASIVSDADAAYVLSMLCAELPQG  1420

Query  3550  --AIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSL  3651
               +  + S TS +        S N +HG+L Q+  L
Sbjct  1421  VRSAKDQSATSPM--------SHNYVHGILAQIRHL  1448



>ref|XP_005105742.1| PREDICTED: thyroid adenoma-associated protein homolog [Aplysia 
californica]
Length=1961

 Score =   226 bits (577),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 273/1084 (25%), Positives = 475/1084 (44%), Gaps = 165/1084 (15%)
 Frame = +1

Query  1105  ALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQMKWASLFRK  1284
             AL  +D+ +R+DA   +  N KT    +S E  +++  +P N+   S AF+    +L +K
Sbjct  544   ALCSLDEQIRLDAFALVIENHKTTEAITSFEFEMIKFFLPTNLNNQSPAFRQAVVALMKK  603

Query  1285  FFSRVRT---ALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKWLSCFL  1455
             FF RV+    AL R++K+             SP +           +N  +F+ WLS  L
Sbjct  604   FFFRVKESCGALNRLVKKSD---------KLSPAHASR--------QNYQDFLDWLSGHL  646

Query  1456  FFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYS-----SEISLYPYSKGLILP  1620
                 YP + +  +  ++ ++ +M   +       +SD YS     S+  L+         
Sbjct  647   LGCLYPGSAFAYRTCSLAILSLMTTFF-----STESDGYSLPSFLSDTHLHT--------  693

Query  1621  ESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRES  1800
                  L+  + D+++  ++ + +IL  + T +  + +P+ + EA++ +  L CS R ++ 
Sbjct  694   -----LLECLSDTFEENKKEALKILTAYMTQVGPVWNPDQLREALVSSMTLACSTRPQDC  748

Query  1801  DAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGL-SNGENLEFTPSSPVIEYITSLID  1977
                A  F  + R+  L          + +  S S L ++        SSP +  +  L+ 
Sbjct  749   GTAAYFFLTLMRQQQLHPD---TFDLSQLLPSISHLWASSSIPSSMTSSPKLFLLPVLVS  805

Query  1978  WLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilal  2157
              L   +   +  L  A     ++  L  +R+   E+D+ ++     + S++  +  ++  
Sbjct  806   LLNDQIAVAQHSLITAAANRPMYPTLHCIRFILHELDFRTL-TPEMLPSVRDFIASLIHS  864

Query  2158  VMRITSLALWVV--SADAWYLPDEM---EEMTVDGACFLERPIEMDVSAST---------  2295
              + ++++   VV  S+    +P++      + V GA     PI  D+S ++         
Sbjct  865   CLNLSTVVSPVVQNSSPEGNVPEDAILGPGLNVGGAL----PIAEDLSKASQDSLSTPSL  920

Query  2296  PDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDG  2475
             P+ E  +  +      M + ++V CW ++KEVSL LG +  ++P+           +   
Sbjct  921   PNLEQSVELSRALVESMPEYLVVCCWRSIKEVSLTLGKMCLQIPVT----------LILE  970

Query  2476  TDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKL  2655
              ++  S  +L L Q+  IG+HF + LL+  H GA +   AGF  LC  L     P   +L
Sbjct  971   KEKEGSLSLLTLDQVLTIGDHFTQQLLESIHRGAFELAYAGFQLLCQMLWSHPAPAFHQL  1030

Query  2656  TESWMEQLMERTVSKGQTVDDL-LRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINV  2832
                W+ Q+M    SK         RRSAG+P    A   SEP    ++     ++ L+ +
Sbjct  1031  PAQWLSQVMADIQSKDPNSRLCSTRRSAGVPFFVQAIASSEPSTTGRKCFHGVMKELLAI  1090

Query  2833  AKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFND  3012
             A                         +PD    E  ++T D      VH+ N+L+A F D
Sbjct  1091  A-------------------------LPDDNQREG-TETDD----AQVHSLNILRALFRD  1120

Query  3013  ANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESA---R  3183
             A L  D   ++A+ L  ++  F S  W VRNSA L  +AL+ RM G +   K E+A   +
Sbjct  1121  ARLGEDVVPYTADGLKAAVLGFKSDEWAVRNSATLLLSALMTRMFG-VKRSKDETAMSKK  1179

Query  3184  RALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRL  3363
                TG  FFHRYP+L+ FL +EL+ AT         N+ S+    +HPSL P+L++L RL
Sbjct  1180  NCQTGRLFFHRYPSLYPFLLSELEAAT--------ANVGSSSGLHLHPSLYPVLLVLGRL  1231

Query  3364  KPSPITSETGD-PFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIAS  3540
              PS  T E  D       F+P++ KC+    L+ R++A+RAL  +       T +++I+S
Sbjct  1232  FPS--TLEGSDTSLSLAAFIPYVLKCAASPVLKTRLIAARALRPLARK----TQVIDISS  1285

Query  3541  ELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSK--KEDILSDL  3714
              L A  N  ++ D     N     + IHG LLQL+ L+      +  F++  K   L+ L
Sbjct  1286  HLMA--NVPVSPDCQAQPN-----SYIHGSLLQLTELVPL----VKSFNQNLKSSFLTSL  1334

Query  3715  IHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCI--SVIWNLLWTLSS-  3885
             + +L    WI S     C +   + L+   ++L I ++  +S      ++ + +  +S+ 
Sbjct  1335  VPLLLDRVWILSSTN-KCFVTRQAGLEFASSLLDIGKSLSVSVPFVDELLGHFVQAISAD  1393

Query  3886  -ECLDL-YTSKRPAYFDPTIAELRKQAAS------SYFNCAYQTS---KDVNEEDLIYLR  4032
              +CL    T+ R   + P   E +K  A       S  N  +Q +     V +EDL   +
Sbjct  1394  HDCLSHSSTTLREMTWQPWFYEYQKTQARLCLKYLSVLNTPFQNNLVQSSVTKEDLSLRQ  1453

Query  4033  GPPPDSE-----------LFKESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLN  4179
                 +S              + S   MS+T     +   L  + YEVR+  L  LL  L 
Sbjct  1454  ENIANSRKNCLSEISNKAYVRNSSGSMSLTLSVSSIKNLLGSSFYEVRLEVLDALLEVLK  1513

Query  4180  SPES  4191
             + ES
Sbjct  1514  NSES  1517



>ref|XP_010730915.1| PREDICTED: thyroid adenoma-associated protein homolog [Larimichthys 
crocea]
Length=1359

 Score =   216 bits (550),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 296/1267 (23%), Positives = 507/1267 (40%), Gaps = 232/1267 (18%)
 Frame = +1

Query  94    DSSVKTILYDGILSELCNFCEHPTDSHFNFHALTVMQICLQQIKTSMQGTDGYIEEGYDP  273
             D++   +L  G+   +C  CE   D H+   A  V  + L+++K S+            P
Sbjct  278   DATQTCLLLKGLFPLVCALCEEKLDCHY--FAFEVFTLWLKKVKESLADIWKMTGVRLLP  335

Query  274   ISEEVGTRVLKIVWNNLEDPLSQTVKQVHLIFDLFLDIQGTLHWAEGSEKFCSFLRKIAS  453
                 +   ++ I+W N E P+    + V   F L LDI     +    E+FC   + +  
Sbjct  336   DDGSLQQELIHIIWTNAESPVEGVSEFVRSAFSLLLDI-----YKMDCEQFCDTKKILYC  390

Query  454   DLLH----LGPRCKGRYIPLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFL  621
              LL     L    K RY  L +L   LG   +LD    +     K    + +   A+   
Sbjct  391   TLLQRIIKLPWEAKARYHRLCALLPYLGTDMVLDQYAEIPSHLLKCLSTNHLSPCASELY  450

Query  622   KCFLECLRDEYW-----STDGVEGGYIKYRAHCLLPIL-SGLSSGFAKLRSNLNTYALPV  783
             KC ++  R E       S    E       A    P+L   L+S    L++N +T+ LP 
Sbjct  451   KCLIQQQRRELCGGSQKSALQTELDLANQWAKRWQPVLHEALTSDVTLLQNNSSTHLLPC  510

Query  784   LLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVLGVEQRVAVLVSLLKVSRMLAL  963
               ++   ++ P+L          S + F P         G     A ++S  +       
Sbjct  511   TFQVFPSAVDPLLA---------SLDPFAP---------GHLHAWACIMSSYRA------  546

Query  964   IEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDA  1143
             + G   W    S ALE                            L LAL   DD +R+ A
Sbjct  547   LTGGSPWALQGSSALET---------------------------LQLALGSADDKVRLAA  579

Query  1144  AESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTALERVI  1323
                L  +PKT   P++ E+S+MRK +P N+ C S+ F+    +  +KF  R+R      +
Sbjct  580   LNLLCCSPKTKDTPTTEEMSIMRKFIPQNLNCESSPFRQHLQAGVKKFLVRIRDGCLAHV  639

Query  1324  KQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMA  1503
             K             G   N E  Q L    E    F+ WL    +    P   Y+RK  A
Sbjct  640   KHKGK-------KKGDATNSEMAQDL---LEQGIGFVDWLDQLPYSYLAPGHSYQRKKTA  689

Query  1504  MELMLIML----NVWHMLPPQGKSDSYSSEISLYPYSKG---LILPESTLLLVGSIIDSW  1662
             + L+  +L    + W     +G+  +    +      +G    +     L+L+  + DS 
Sbjct  690   LLLLSAVLETCTDTWSPDKKKGQPPANMGSLINCARQRGQWDFVCRTKQLVLISCLEDST  749

Query  1663  DRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRESDAGALTFRLIFRKY  1842
             + +RE S  +LL F    P     ++     +  K+L+CSPRV+E+  GAL  +++ +K 
Sbjct  750   NEIRELSAGLLLRF---FPPCFPDDIAAVLFMRTKQLLCSPRVQEAQMGALMMKVLLQKS  806

Query  1843  VLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDWLCAAVEE----GEK  2010
               +        C++   S + +S+G N E           + ++ +L   +EE     + 
Sbjct  807   QDQ-----HEDCSL--NSRATISSGSNPE----------ASCMVKFLVKELEEHYLTAKA  849

Query  2011  DLSEACKKSFVHGVLLTLRYTFEEMD---WDSIAVAsnissiklllekilalVMRITSLA  2181
             D+  A +   +HGVL  L+    E     +D++           L  ++L+L+  I+ L 
Sbjct  850   DMMLAARTKPIHGVLSALQRCLLEAHGSVYDTL--------DHSLTTEVLSLLENISLLL  901

Query  2182  LWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQDDGPMDQIVM  2361
             L V+  D      EM+            P   D+  +      + +   Q DG  D+ V+
Sbjct  902   LGVLYGDLDACATEMD----------APPSFCDMGNAITSLIAQASDGGQGDG--DECVL  949

Query  2362  VG---------CWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLR  2514
             +          CW+++KE+ + LG+++ K+   +   P  C              +L   
Sbjct  950   LSEEHSLVLTCCWVSLKEIGIFLGSLVEKI--LSESKPNKC--------------LLTKE  993

Query  2515  QLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTV  2694
              L      F  +LLK +H GA++    GFT  C  LL S++  L  +    ++Q ++   
Sbjct  994   DLTRASKVFKNILLKCRHWGAVEGCCIGFTKFCASLLSSSEAALRDIPAHMLKQGLQVVQ  1053

Query  2695  SKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkenss  2874
             S   T   + RR+AG+P        +      K LL ++++ L+  AK  L         
Sbjct  1054  SPRST--SVTRRAAGLPMLILCVLAAGEASKAKPLLAQSMQTLLETAKTPLP--------  1103

Query  2875  csesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEA  3054
                                E   +T D   +P V A + L+A    + L      F+   
Sbjct  1104  -------------------ENWDQTLD---LPQVCAVHTLQALVRGSGLGAAVLQFAPAV  1141

Query  3055  LIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESA------RRALTGLEFFHR  3216
              I+S+   SS  W +RN+A   Y++L  RM+G     +R S+      +  ++ L FF  
Sbjct  1142  AILSLTLLSSPCWAMRNAALQLYSSLCSRMLG-----QRPSSEDGGPTQHGMSPLAFFFH  1196

Query  3217  YPTLHTFLFNELKIATELFLEGSSENLT--SNLAKV-VHPSLCPMLILLSRLKPSPITSE  3387
             YP L  FL  EL+        G++++L   SN AK+ + PSL P+L LL++L+P  +   
Sbjct  1197  YPALQPFLLGELR--------GAAQDLQGPSNEAKLHLQPSLYPVLTLLAQLQPG-VQDS  1247

Query  3388  TGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHS  3567
             T    D   F+P + + S      +R++AS+AL  M    +   +++ +++ LP+     
Sbjct  1248  TETLSD---FLPPLLELSASPIYSVRVMASKALVAMTPPSEYMNILIKLSTHLPSPRE--  1302

Query  3568  MTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIG  3747
                            N +HG LLQ+ ++L+   R L   S     L +++  +    W+ 
Sbjct  1303  -----------CCCHNRLHGQLLQIKAVLE---RALCTVSAPSSDLFEVLSRVDASLWLA  1348

Query  3748  S-PQKCP  3765
             +  Q+CP
Sbjct  1349  TEAQRCP  1355



>ref|XP_009524859.1| hypothetical protein PHYSODRAFT_557895 [Phytophthora sojae]
 gb|EGZ22142.1| hypothetical protein PHYSODRAFT_557895 [Phytophthora sojae]
Length=2080

 Score =   217 bits (552),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 229/929 (25%), Positives = 383/929 (41%), Gaps = 141/929 (15%)
 Frame = +1

Query  1075  VKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAF  1254
             V + +N +   L H     R  A ++L  + K+ S+P+  EL L++  + +N +    A 
Sbjct  685   VGMSMNEIERGLRHAKVETRGTAFDALCASLKSTSMPTDDELRLVKYYLVVNGKEIGPAG  744

Query  1255  QMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFM  1434
             +M      +    R++  L R+  +    P+        P     D      A     F 
Sbjct  745   RMNTLIGLKTVLIRIKETL-RLASKNQTKPN--------PTASARDDYAAAVA-----FK  790

Query  1435  KWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLI  1614
             +W+  F+  S YP A  +R  + +E++L+ + ++        +D   +E    P    L+
Sbjct  791   QWVELFVVTSVYPGALPQRLTLGLEVLLLYVQLFGF-----GNDEAPTE---KPARSLLL  842

Query  1615  LPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVR  1794
               +    L+  +I +WD +R  +F +L  +P  +PG S+ E +   + WA  L  SPR R
Sbjct  843   TGQMVTTLLNMLISAWDSIRSLAFTVLDLYPDELPGYSTREELRTLVDWAVGLCGSPRQR  902

Query  1795  ESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLI  1974
             ESDAGA+  RL+F+K     G + R        S  G      ++ +  SP + ++  L 
Sbjct  903   ESDAGAMFIRLLFQKCS---GSIQRFGLTFQRDSERG--RDVVIDASSKSPEVAFVLQLT  957

Query  1975  DWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSI--AVAsnissikllleki  2148
               + + VE          +   VHG LL+L Y  E + +D +  + A+        +   
Sbjct  958   QVILSRVEALSPAEIRRGESPLVHGFLLSLHYVLENVAFDKLSDSEAAEWPHAMTQIFTA  1017

Query  2149  lalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIA---  2319
             +   MR  SLA   V  DA     + EE++   A F     E+   A T +  +++    
Sbjct  1018  IHQSMR-ASLA---VVGDATSGAGD-EELS---ASFAGVVGEVSAVAKTSNSALRVDCRG  1069

Query  2320  -----------KAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSD-VPKSCSQ  2463
                          E+DDG  +Q  +VG WLA +E   +L  ++R+VPLP+S+  P S S 
Sbjct  1070  HLIVENGEGGLDGEEDDGNAEQRAVVGSWLAARECGAILELLMRRVPLPSSNAAPGSVSY  1129

Query  2464  ITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLC--SND  2637
              T    Q               G   L  L ++KH GA+      F  +C   L     +
Sbjct  1130  FTVEMAQRG-------------GETLLNSLFELKHKGAVATAYQAFEGVCRAFLAHGEQN  1176

Query  2638  PRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALR  2817
               L  L   W ++L+ER     Q    +LRRS+G   +F A   +EP  +   +LPK + 
Sbjct  1177  AELGGLPARWADRLLERLERSEQHF--ILRRSSGFAFSFVAILRAEPRNSAAVILPKVMS  1234

Query  2818  WLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVV--PTVHAFNV  2991
              L+ +A +                         D  A E     ++   +    VHA N+
Sbjct  1235  TLLRLAGE-------------------------DTDAAEKRDTHQEHHSLWRARVHALNI  1269

Query  2992  LKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKR  3171
             LK    D  LA D + +  + L +++R F    W VRNS+ + + A  +R IG   +   
Sbjct  1270  LKLICQDGVLAEDVARYIVDMLELAVRGFDCGSWAVRNSSMMLFAATTQRAIGDKRIAD-  1328

Query  3172  ESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLIL  3351
                R+ ++  + F R+  L  FL  EL       L  S    +  L     P L P+L+ 
Sbjct  1329  GGTRQQVSIDDVFSRFQQLRGFLARELS-----RLLASDSKPSGTLGGAAPPGLYPLLLF  1383

Query  3352  LSRLKPSP-----ITSETGDPFDP---FLFMPFIRKCSLQNNLRIRILASRALTGMVSNE  3507
             LSRL+P       +      P D      F+P   KC+ Q  + IR +A++ +  +VS+ 
Sbjct  1384  LSRLRPGDEDDQRVADAPASPCDGSGLASFVPLAMKCASQPTMAIRHMAAKVVASIVSDA  1443

Query  3508  KLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFS  3687
                TV+  +  +LP       + D  G+S+     N +HG+L Q+               
Sbjct  1444  DAATVLSMLCEKLP--QGVRSSKDPKGVSH-----NYVHGVLAQIR--------------  1482

Query  3688  KKEDILSDLIHVLGKHSWIGSPQKCPCPI  3774
                       H++ K+ ++G  Q+   PI
Sbjct  1483  ----------HLMTKYLFVGDTQRKSTPI  1501



>dbj|GAM25031.1| hypothetical protein SAMD00019534_082060 [Acytostelium subglobosum 
LB1]
Length=2118

 Score =   216 bits (549),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 174/673 (26%), Positives = 298/673 (44%), Gaps = 80/673 (12%)
 Frame = +1

Query  2323  AEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIV  2502
             ++Q  G   QI+ V  WL+MK++SL LGTI+ +V  P S             D    D +
Sbjct  1154  SDQLKGSAGQIITVCSWLSMKQLSLCLGTILDRVKFPAS------------MDSKPEDTL  1201

Query  2503  LDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLM  2682
             L + Q+  IG  F+ +LL  +H GAI+K   GF  LC+RL+ S  P L  L  SW+E L 
Sbjct  1202  LSVEQISEIGKSFVHILLNTRHKGAIEKAYLGFQVLCSRLMGSTHPTLYALPASWIESLF  1261

Query  2683  ERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPK---RLLPKALRWLINVAKKSLTD  2853
             +R   +  ++    RRSAG+P AFT     E     K    LL   +  L+ +A      
Sbjct  1262  KRVQEQSLSIT---RRSAGLPFAFTGLLTGESTHQKKIAGPLLQSVISQLLKLANGG---  1315

Query  2854  knkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDT  3033
                            D T   D+  IE +     +  +P VH+ N+L++ F +  +  + 
Sbjct  1316  ---------------DDTDNKDI--IEEVGAAEKKVYLPQVHSINILRSIFRNKTMTNEL  1358

Query  3034  SGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFH  3213
                 +E ++  +R++SS  W VRN+A +A++ +V +++G   V+   S     T   FF 
Sbjct  1359  DQHFSETMMAIVRAYSSPSWSVRNAATMAFSTMVDKIVGVKKVRDETSHLNTTTFHYFFG  1418

Query  3214  RYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETG  3393
               P LH FL      + +       + L S+  +++  S+  +L+L +RL+PS + S   
Sbjct  1419  HMPALHPFLLEHFGRSLDAINAAKGQALGSD--QILQSSIYAILVLFARLQPSNM-SNPA  1475

Query  3394  DPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMT  3573
             D   P  F+P+I +C   +N  +R +A+RAL   +++  +          LP I N  + 
Sbjct  1476  DTLSPTPFIPYISQCCSFSNFMVRQIAARALVPFIASRDV----------LPFISN--LV  1523

Query  3574  SDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSP  3753
               +   S     FN IHG+LLQ+  LL  +  ++    ++E ++   +  L    WI + 
Sbjct  1524  DSIKSPSEAAGDFNMIHGVLLQIYHLLHAHIPSVHSIKEREAMVVAAVLALRPTLWIVNQ  1583

Query  3754  QKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDP  3933
             +  P   +       L+  L           +++   L   +    L L  S + A    
Sbjct  1584  RIVPLAYVIILIFNDLNTYLQHIDLSAQDGLVTI--TLQEIIQQALLALRMSHKSAC---  1638

Query  3934  TIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQERLIR  4113
                E      S+Y   A   +  ++  D I ++ P P  +L      +M+V    ++LI 
Sbjct  1639  DHKEFSLPLFSAYIKEAGYIA--LHTIDTILVKQPEPPRDL------KMTVQESAQQLIS  1690

Query  4114  SLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVE  4293
              L  + YE+R+ T+K+LL  ++                IK   +  + +Q +++ +L  E
Sbjct  1691  MLMHSEYEIRLETIKYLLRNIDDI--------------IKCEVVDRLAIQKLMLHMLDSE  1736

Query  4294  KNHKCMNYILKII  4332
              N  C    L+I+
Sbjct  1737  TNLPCRKRALRIL  1749


 Score =   186 bits (472),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 178/710 (25%), Positives = 309/710 (44%), Gaps = 110/710 (15%)
 Frame = +1

Query  91    NDSSVKTILYDGILSELCNFCEHPTDSHFNFHALTVMQI-------CLQQIKTSMQGTDG  249
             ND++ +++  + I   LC+ C    D      +L  + +        L Q+      +  
Sbjct  375   NDTANESLFLNHIYLALCDSCTSAVDVFGRVASLEYLHLWYETLLALLNQLSQPTLQSIV  434

Query  250   YIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVHLIFDLFLDIQ-------------  390
             +IE  YD   ++   R L I+++N E  +S    Q++ IFD  LD+              
Sbjct  435   HIE--YDLFFKDYLNRALDIIFSNWESTISSVPTQLNDIFDCLLDVHYRCTAGGASGTGS  492

Query  391   ------GTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSILDMSP  552
                   G L   + S    +F+  I   L+      KG+Y  L S+  R GA  +  +  
Sbjct  493   SSASTHGQL---KESGTAPAFIPDITCRLIDEPWSQKGKYALLKSIVDREGALFMFTLRG  549

Query  553   GLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWS---TDGVEGGYIK-----YRAHC-  705
               L D   A  D  +C++A  FL+  +E L+ E       D    G +K      +  C 
Sbjct  550   NFLRDVLVAMSDHTICNSAKGFLEQLMEALKKEVSKRIRADSRLQGDVKKQDDAIQEECE  609

Query  706   ---LLPILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPE  876
                L+P+L+ L+       + +  Y  P  L++   S+  +L  +      +ST     +
Sbjct  610   LFWLVPLLNVLTEADDASCAKIIMYGTPSFLKVFPQSLVSILDVLN----KDSTN---RQ  662

Query  877   LDSRDIVLGVEQRVAVLVSL--LKVSRMLALIE-GDIDWCEYSSVALEVTDLSTDAGVCD  1047
             L S    L ++  V++ +SL  L  +R L+++E G+I    Y+++               
Sbjct  663   LTSATQHLVIDNNVSLRISLSVLNTARQLSILELGEILKNNYNTIKR-------------  709

Query  1048  SVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPL  1227
                                +L H DDSLR+   E + ++PK    P+ +E+ L++K + L
Sbjct  710   -------------------SLYHQDDSLRMIGLELVCVSPKNTERPTRVEIRLLKKFLSL  750

Query  1228  NMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQS---  1398
              ++  S   +    S+  KF+ R+R +  +V +    + S  K  +G  L GEA Q    
Sbjct  751   ALKSSSPFIRNHTNSILEKFWFRLRESYSKVFRTTQVNKS--KGFAG--LAGEAAQKEAE  806

Query  1399  LKHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSS  1578
             L    E L +F+ W +     S YP APY RK++ ++     ++ W +       + +S 
Sbjct  807   LYMSNEELSDFLNWCASLFIASLYPGAPYPRKMLPLDAFSNFIDAWSV-------EQFSE  859

Query  1579  EISLYPYSKGL------ILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPEL  1740
             ++++ P  K L         ++TL+L+ ++ D +DR RE +  +LL FP+P+PG S    
Sbjct  860   KVAVLPLLKWLQERSTVFSSQNTLILLHNLWDQYDRCREVASSVLLRFPSPLPGFSEERP  919

Query  1741  VCEAIIWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGE  1920
             +   ++W  KL CSP+ RE D GA+  RL   KYV     V         Q P  LS+  
Sbjct  920   IQALVMWGLKLACSPKARECDTGAMVLRLYMDKYVKRGVCVPTFDVTTSDQPPVVLSS--  977

Query  1921  NLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRY  2070
                  P+  +I +I  +   L + V     +L EA K + +HG++L++RY
Sbjct  978   ---MPPNDAIIHFIRQITRVLRSQVSVANHNLLEAAKCAPMHGLILSIRY  1024



>ref|XP_002590488.1| hypothetical protein BRAFLDRAFT_124496 [Branchiostoma floridae]
 gb|EEN46499.1| hypothetical protein BRAFLDRAFT_124496 [Branchiostoma floridae]
Length=1823

 Score =   214 bits (544),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 218/922 (24%), Positives = 396/922 (43%), Gaps = 118/922 (13%)
 Frame = +1

Query  1105  ALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQMKWASLFRK  1284
             ALTH  D +R+ +   L  + K         LSL+   +  N+   S +F+ +  S  +K
Sbjct  548   ALTHSKDQVRLSSLSLLSESHKQTDPIPGPRLSLVLHFLKYNLNSQSPSFRQQTCSSLKK  607

Query  1285  FFSRVRT---ALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKWLSCFL  1455
              F  VR    A +R ++Q     +   C +  P   + +Q LK   E    F+  +   L
Sbjct  608   LFICVRDSSFAAQRSLRQQKKKSA---CETSPPETPQTEQQLKQYKE----FLGKVFEML  660

Query  1456  FFSCYPSAPYERKIMAMELMLIMLN--VWHMLPPQGKSDSYSSEISLYPYSKGLILPEST  1629
             F      A + RK+  + L+ +ML   ++H         S  S   ++P S  +      
Sbjct  661   FQGIGVGASFARKVTCLSLLSVMLQNLLYHT--------SSESIAEVFPLST-MFTSRHF  711

Query  1630  LLLVGSIIDSWDRLRESSFR----ILLHFPTPIPGISSPELVCEAIIWA--KKLVCSPRV  1791
              LL+  + D+++  ++        +L + P     +   + +C A+++   + L+ S   
Sbjct  712   HLLLECLADTYEPNKQLGLELLTVVLKNAPNSSVHLKENDPLC-AVLYGICETLMESVNP  770

Query  1792  RESDAGALTFRLIFRKYVLELGWVVRVSCN------VVTQSPSGLSNGENLEFTPSSPVI  1953
              +S   A   RL+ +  V    W +    N      V   S S  S  ++++        
Sbjct  771   HDSVTAAYILRLLLQHSVDVKEWSLNTGENSDQTLKVAEPSHSTASLEQDVKDHIMINTC  830

Query  1954  EYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissikl  2133
               + SL+  L   VE  +KDL E      ++GV+  +R    ++D  S+       ++  
Sbjct  831   NILASLVGKLKPLVEHSKKDLLEVAANCPIYGVIHCIRSLLADVDMTSLVPKLEWGNLLD  890

Query  2134  llekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPI-EMDVSASTPDDEM  2310
              +  +   V  I S  +   +A   Y+P+        GA  ++  + ++ +   + DD  
Sbjct  891   KIVDVCCEVSSIVS-PIVQTAAPEGYIPE--------GATLVDAAVTQVSLKPVSEDD--  939

Query  2311  KIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPL-PTSDVPKSCSQITDGTDQL  2487
                 +++      Q +++ CW ++ E+SLL G   +K P+    D P+            
Sbjct  940   --TTSQEPSSVSSQALLICCWRSLMEISLLFGQFAQKAPMYQEDDDPQG-----------  986

Query  2488  SSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESW  2667
                 VL + Q+  IG++F   LL+ +H GA +K + GF  LC+RL  S  P L KL   W
Sbjct  987   ----VLSVNQVLKIGHYFTTQLLEARHLGAFEKGKDGFIKLCHRLWRSEIPDLRKLPCDW  1042

Query  2668  MEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSL  2847
             ++ L+        +     RRSAG+P  F     +EPE   +  L  ++  L+       
Sbjct  1043  LKGLLTSLQDYNDSSLCATRRSAGLPLFFECVLTTEPEEHQQAQLKSSMEQLL-------  1095

Query  2848  TDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLAT  3027
                                       A  +   T  +  VP VHA N+LKA F +  +  
Sbjct  1096  ------------------------SLASSLPLPTDSKHTVPVVHALNILKALFRNTKIGE  1131

Query  3028  DTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEF  3207
                 +  + + V+I  F S  W +RN++ L ++ L+ R+ G    +   + R  ++G EF
Sbjct  1132  HIFPYIVDGVKVTILGFGSEVWAIRNASTLLFSILMTRIFGVKRGKDEHARRNCMSGREF  1191

Query  3208  FHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSE  3387
             F R+P+LH+FL ++L++A E      S       +  +HPSL P+LI+L++L PSP+   
Sbjct  1192  FARFPSLHSFLLDQLQLAVERIQSCDS-------SVDLHPSLYPVLIMLAKLYPSPMDGA  1244

Query  3388  TGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHS  3567
             +    +   F+P ++KC+    ++ R +A++AL  ++      + I  +  ++       
Sbjct  1245  SS-ALNMSAFVPLVQKCAHSTVMKTRAMAAQALLPLIPAAHAASTIGKLLRQI-------  1296

Query  3568  MTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIG  3747
                D S +       NS+HG+LLQ   L+ T CR       +ED+ S++   L   SWIG
Sbjct  1297  --KDASRIPQ-----NSVHGILLQAQGLIKTYCRKDVPGVTQEDLESEVYPSLQSLSWIG  1349

Query  3748  SPQKCPCPILNCSFLKVLDNML  3813
             S +  PC +    ++  ++ ++
Sbjct  1350  S-RSNPCAVTRALYIATVEFLI  1370



>ref|XP_001631173.1| predicted protein [Nematostella vectensis]
 gb|EDO39110.1| predicted protein [Nematostella vectensis]
Length=923

 Score =   210 bits (535),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 258/1078 (24%), Positives = 446/1078 (41%), Gaps = 186/1078 (17%)
 Frame = +1

Query  262   GYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVHLIFDLFLDIQGTLHWAEGSEKFCSFLR  441
             G  PI +    ++L +VW+N + P          IF+  + +  ++     +E    FL 
Sbjct  3     GLSPIPQ----KLLSLVWSNWDHPTEGVRHVTKAIFENVVAVHVSVSTYVPTED--RFLE  56

Query  442   KIASDLLHLGPRCKGRYIPLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFL  621
              +A  L+      +G+Y PL  +   LGAK IL   PGL      A  D ++   A  F+
Sbjct  57    CLAELLIDQDWHVRGKYGPLCCIASVLGAKCILGRHPGLPSKVLAAMNDKNIAPHAMDFI  116

Query  622   K--CFL---ECLRDEYWSTDGVEGGYIKYR--AHCLLPILSGLSSGFAKLRSNLNTYALP  780
             +   F+   E +  E    D  E  YI+     +C   I   + S        L  + LP
Sbjct  117   EKMSFIHKEELISSEKSLNDWFEVWYIRRTKWQNCAGRIFCMVCS--------LLQHCLP  168

Query  781   VLLELDVDSIFPMLGFIGIGCSAESTEIFYPELDSRDIVLGVEQRVAVLVSLLKVSRMLA  960
              LL+                C  ES  I   +L S        + V  LV+ LK +R L 
Sbjct  169   KLLK----------------CCPESLHIMITQLQSAGTRC---ENVKALVTCLKTARSLG  209

Query  961   LIE-GDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDDSLRI  1137
             L++  +  W E   ++          GV             + V+ L  AL H DD  R+
Sbjct  210   LVKVNEESWTEREVMS------DVWGGV-------------VSVDVLQKALCHTDDQCRL  250

Query  1138  DAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTALER  1317
             DA   L  +P+T    S  ++ L++  + LN+   S +F+ + A+L +K   R+R  +  
Sbjct  251   DALGLLCDSPRTTESVSVTDMRLLKTFLQLNINSQSPSFRQQSAALLKKLLLRMREGVRL  310

Query  1318  VIKQGTWHPSLIKCLSGSPLNGEADQSL---KHRAENLFNFMKWLSCFLFFSCYPSAPYE  1488
              ++                 N + D+++   K++      F++W S  LF S +P A + 
Sbjct  311   SVR-----------------NLDRDKNIELHKYKLHAYTRFLQWYSNLLFSSLFPGASFA  353

Query  1489  RKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILPESTLLLVGSIIDSWDR  1668
             R   ++  + ++ +++        +DS S   S + +   ++ P +   L+    D++D 
Sbjct  354   RLTTSLHGLKLLASIF--------TDSDSKYGSFHFHD--VMHPCNIRGLMKCFSDTYDV  403

Query  1669  LRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRESDAGALTFRLIFRKYVL  1848
              ++ ++ +L   P       S E +   ++  ++LV SPR  ++   ++  +++  + ++
Sbjct  404   NKQLAYDLLTSCPRDFLPFQSAESLEPLLLMVEQLVTSPRAVDASTASVYLKILVDRCMV  463

Query  1849  EL--GWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSE  2022
              L       +S N + Q  +                   +++L+  L +      + L  
Sbjct  464   PLYPESATEISDNPLNQRQA----------------FSVLSALLSTLTSQASVANESLVL  507

Query  2023  ACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilalVMRITSLALWVVSAD  2202
             A  ++ +HG +  LR     ++  ++  A +   +   L   L +V  +    +   S +
Sbjct  508   AAARAPMHGAVFCLRTLLTHVNLRNVESAGSWKHLVSRLLTELFVVAELVFPVVTSSSPE  567

Query  2203  AWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQ--------DDGPMDQIV  2358
                + D +    +  A    +    +    TP      +K              P  Q +
Sbjct  568   GHVIDDSINGNLLSYA-LTSKARPCNTITKTPVSPATNSKLHYFLFKMMFPVFTPSSQAL  626

Query  2359  MVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEIIGNH  2538
             +V CW  MKEV+LLLG +++               I+D +  L++D      Q++ IG+ 
Sbjct  627   LVCCWRTMKEVALLLGDLVQ--------------NISDDSGLLTAD------QVKRIGDF  666

Query  2539  FLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQTVDD  2718
             F  VLL  KH GA +    GF  LC  L    D  L  L  +W++ LM   +S     D 
Sbjct  667   FTAVLLTSKHRGAFELAYTGFMKLCEVLWRCRDADLRGLPLAWLDGLMS-DISTTVPSDF  725

Query  2719  L--LRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscsesss  2892
             L   RRSAG+P     FF                   + V K+S             S  
Sbjct  726   LSGTRRSAGVP-----FF-------------------VQVVKQS----------SPASLC  751

Query  2893  AIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIR  3072
             ++    +   A++ +      +  +P VH+ N+++A + D  L  D S F A+ LI SI 
Sbjct  752   SLCLLDLLHAASLPVEPSLPQDSSLPQVHSRNIIRALYRDTRLGEDVSPFVADGLIASIS  811

Query  3073  SFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFNEL  3252
              F+SS W VRNS+ L ++ALV R+ G    +   S R  +TG EFF RYP++H FL   L
Sbjct  812   GFTSSSWAVRNSSTLLFSALVTRVFGVAKAKDDHSRRNCMTGREFFSRYPSMHPFLLKHL  871

Query  3253  KIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPI----TSETGDPFDPFL  3414
             + ATE       E++T      +HP L P+L+LLSRL PS +    ++    PF P++
Sbjct  872   EKATEFL--NREESVT------LHPCLYPVLVLLSRLYPSSMDGVDSTLNMSPFIPYV  921



>gb|ETM43301.1| hypothetical protein L914_11195, partial [Phytophthora parasitica]
Length=2054

 Score =   210 bits (534),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 223/892 (25%), Positives = 372/892 (42%), Gaps = 136/892 (15%)
 Frame = +1

Query  1075  VKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAF  1254
             V + ++ +   L H     R  A ++L  + K+ S+PS  EL L++  + +N +    A 
Sbjct  687   VGVSMHEIERGLRHAKTETRGTAFDALCASLKSTSMPSDDELRLVKYYLAVNGKEIGPAG  746

Query  1255  QMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFM  1434
             +M      +    R++  +    K                 N       +       +F 
Sbjct  747   RMNTLIGLKTVLIRIKETMRLASK-----------------NASKSGQARDEYAAAVSFK  789

Query  1435  KWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLI  1614
              W+  F+  S YP A  +R  + +E++L+ + ++ +   Q  S               L+
Sbjct  790   HWVELFIVASVYPGALPQRLTLGLEVLLLYVQLFGLETDQCPS--------------LLL  835

Query  1615  LPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVR  1794
               +    L+  +I +WD +R  +F IL  +P  +PG SS E +   + WA  L  SPR R
Sbjct  836   TGQMVTTLLNMLISAWDSIRSLAFTILDLYPDELPGYSSREELRILVDWAVGLCGSPRQR  895

Query  1795  ESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLE----------FTPSS  1944
             ESDAGA+  RL+F+K            C+   Q   GL+   +LE            P  
Sbjct  896   ESDAGAMFIRLLFQK------------CSAAIQR-FGLTFQRSLEPENTATEVSSVNPDV  942

Query  1945  PVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsniss  2124
               +  +T +I     A+   E    E+     VHG LL+L Y  + +D+ +++  S+ ++
Sbjct  943   SFVLQLTQVILSRIGALSSAEIHRGES---PLVHGFLLSLHYVLDNVDFSTLS--SSEAA  997

Query  2125  iklllekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDD  2304
                     +   + ++  A   V  DA     + EE++   A F     E+   A T   
Sbjct  998   QWPSAMTQIFTAIHLSMRASLAVVGDATSGAGD-EELS---ASFAGVVGEVSAVAKTTSS  1053

Query  2305  EMKIA-----------KAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPK  2451
              +++              +++DG  +Q  +VG WLA +E   +L  ++R+VPLPTS+ P 
Sbjct  1054  ALRVDCRGHLIVEKGDGLDEEDGNAEQRAVVGSWLAARECGAILELLMRRVPLPTSN-PA  1112

Query  2452  SCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCS  2631
             S S IT  T        +D+ Q    G   L  L ++KH GA+      F  +C   L  
Sbjct  1113  SDS-ITYFT--------VDMAQRG--GETLLNSLFELKHKGAVATAYQAFEGVCRAFLAH  1161

Query  2632  ND--PRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLP  2805
              +  P L  L   W ++L+ER     Q    +LRRS+G   +F A   +EP  +   +LP
Sbjct  1162  GEKNPVLGGLPARWADRLLERLERSEQHF--ILRRSSGFAFSFVAILRAEPRNSAAVILP  1219

Query  2806  KALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVV--PTVH  2979
             K +  L+ +A +                         D  A E     ++   +    VH
Sbjct  1220  KVMSTLLRLAGE-------------------------DTDAAEKRDTHQEHHSLWRARVH  1254

Query  2980  AFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLN  3159
             A N+LK    D  LA D + +  +   +++R F    W VRNS+ + + A  +R IG   
Sbjct  1255  ALNILKLICQDGVLAEDVARYVVDMFELAVRGFDCGSWAVRNSSMMLFAATTQRAIGDKR  1314

Query  3160  VQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCP  3339
             +      R+ +   + F R+  L  FL  EL   T L    + +  +S L     P L P
Sbjct  1315  IAD-GGTRQQVASDDVFSRFQQLRGFLAREL---TRLL---ADDKKSSALGGAAPPGLYP  1367

Query  3340  MLILLSRLKPSP-----ITSETGDPFDP---FLFMPFIRKCSLQNNLRIRILASRALTGM  3495
             +L+ LSRL+P       +      P D      F+P + KC+ Q  + IR +A++ +  +
Sbjct  1368  LLLFLSRLRPGDEDDQRVADAPASPCDGTGLASFVPLVMKCASQPTMAIRHMAAKVVASI  1427

Query  3496  VSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSL  3651
             VSN     V+  + + LP       T D S    +  S N +HG+L Q+  L
Sbjct  1428  VSNADAAYVLSMLCARLP--QGVRSTEDQSTAKPM--SHNYVHGILAQIRHL  1475



>ref|XP_004366355.1| hypothetical protein DFA_03945 [Dictyostelium fasciculatum]
 gb|EGG18451.1| hypothetical protein DFA_03945 [Dictyostelium fasciculatum]
Length=2127

 Score =   210 bits (534),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 141/494 (29%), Positives = 242/494 (49%), Gaps = 38/494 (8%)
 Frame = +1

Query  2296  PDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDG  2475
             P ++   A  +   G   QI+ V  WL+MKE+SLLLG I+  V  P     +  +  +  
Sbjct  1172  PQEQKTSAAVDILKGSTGQIITVCAWLSMKELSLLLGAILDGVSFPAKTAAEDSNNSSSN  1231

Query  2476  TDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKL  2655
               +L     + ++Q++ IG+ FL +LL  +H GAI+K   GF  LC+RL+ +  P L  L
Sbjct  1232  NIEL-----ISVQQIKDIGSAFLHILLNTRHKGAIEKAYLGFEILCSRLMGTTHPELYTL  1286

Query  2656  TESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVA  2835
               SW++QL  R   + Q+++ + RRSAG+P  FT     E     + + P     L+N  
Sbjct  1287  PSSWIDQLFRRV--REQSLN-ITRRSAGLPYTFTGLLAGESHHQKRMIGP-----LLNQV  1338

Query  2836  KKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDA  3015
              +SL            S    D ++ P+  A   I        +P VH+ N+L++ F ++
Sbjct  1339  LQSLLKLANGEEGTVPSPQD-DGSIAPEQWAERNI-------YLPQVHSINILRSIFRNS  1390

Query  3016  NLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALT  3195
             ++  +   + A+ LI  I+++SS  W VRN+A +A++ +V +++G   V++  S     T
Sbjct  1391  SITNEVDSYFAQTLITIIKAYSSKSWSVRNAATMAFSTMVDKLVGVKRVREESSVLNTTT  1450

Query  3196  GLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSP  3375
                FF   P++H FL    K + E  ++GS+E       +V+  S+  +L+L SRL+PS 
Sbjct  1451  FHYFFSHLPSVHPFLLGHFKRSLE-SMDGSAE------GRVLQSSIYAILVLFSRLQPST  1503

Query  3376  ITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAI  3555
             +T  T D   P  F+P+I KC   +N  +R +A+RAL   +   ++ + + +I  +L   
Sbjct  1504  MTIPT-DSLSPAPFVPYISKCCTFSNFMVRQIAARALVPFIPTPQVISFVQDIVDKL---  1559

Query  3556  DNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKH  3735
              N    S           +N +HG+LLQ+  L+  +  N A  + +       + ++   
Sbjct  1560  -NTQAKSQ-----EEKKDYNQMHGILLQMYHLVKDHLPNFAATTDRVAFAKQALQIVKSL  1613

Query  3736  SWIGSPQKCPCPIL  3777
              WI   +  P   L
Sbjct  1614  DWILEARIAPLAYL  1627


 Score =   132 bits (331),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 91/349 (26%), Positives = 174/349 (50%), Gaps = 30/349 (9%)
 Frame = +1

Query  1090  NYLLL--ALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQMK  1263
             NY L+  +L++ D+ LR+   E + ++PK    P+ +E+ L ++ + +N++  S   + +
Sbjct  713   NYDLVKKSLSNEDEYLRMLGLELICLSPKMTECPTKVEIDLFKQFLTINLKSSSPYIRSR  772

Query  1264  WASLFRKFFSRVRTALERVIKQ-------GTWHPSLIKCLSGSPLNGEADQSLKHRAENL  1422
                +  KF+ R+R +  ++ ++        + HP+     + S    E  Q L       
Sbjct  773   TNGILEKFWIRIRDSYAKIYREMEKKKAYDSKHPTTNNQDTSSTSTQEDQQYLT--IPEF  830

Query  1423  FNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYS  1602
               F+ W    L  S YP APY RK++ ++ +   L +W +      S+S  + I L  + 
Sbjct  831   IQFISWCGSRLVLSIYPGAPYPRKMLPLDTLYSFLGIWGI-----SSESKPATIPLLQH-  884

Query  1603  KGLILPESTL-------LLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIW  1761
                +  ESTL       +++ ++ D +DR RESS  IL  FP+P+PG+ + E +   + W
Sbjct  885   ---VQRESTLFSADNCRVVIHNLWDQYDRCRESSANILKQFPSPLPGLETEEKIKPLVHW  941

Query  1762  AKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPS  1941
             A +L CSP+ RE D+GA   ++  +KYV+     +    N  + + S L   +    +P 
Sbjct  942   AIRLACSPKARECDSGAHFLKIFVQKYVIPQS--IAPVFNGSSTTASDLVTFKKCS-SPE  998

Query  1942  SPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMD  2088
               V+  ++ ++  L + V     +L ++ + + +HG++LTLRY   ++D
Sbjct  999   DAVLVTVSQIVRVLRSQVMIATNNLLDSARFAPMHGLILTLRYMILQVD  1047



>gb|ETO72018.1| hypothetical protein F444_11746 [Phytophthora parasitica P1976]
Length=1951

 Score =   209 bits (533),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 223/890 (25%), Positives = 374/890 (42%), Gaps = 132/890 (15%)
 Frame = +1

Query  1075  VKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAF  1254
             V + ++ +   L H     R  A ++L  + K+ S+PS  EL L++  + +N +    A 
Sbjct  584   VGVSMHEIERGLRHAKTETRGTAFDALCASLKSTSMPSDDELRLVKYYLAVNGKEIGPAG  643

Query  1255  QMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFM  1434
             +M      +    R++  +    K  +              +G+A    +       +F 
Sbjct  644   RMNTLIGLKTVLIRIKETMRLASKNASK-------------SGQA----RDEYAAAVSFK  686

Query  1435  KWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLI  1614
              W+  F+  S YP A  +R  + +E++L+ + ++ +   Q  S               L+
Sbjct  687   HWVELFIVASVYPGALPQRLTLGLEVLLLYVQLFGLETDQCPS--------------LLL  732

Query  1615  LPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVR  1794
               +    L+  +I +WD +R  +F IL  +P  +PG SS E +   + WA  L  SPR R
Sbjct  733   TGQMVTTLLNMLISAWDSIRSLAFTILDLYPDELPGYSSREELRILVDWAVGLCGSPRQR  792

Query  1795  ESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLE----------FTPSS  1944
             ESDAGA+  RL+F+K            C+   Q   GL+   +LE            P  
Sbjct  793   ESDAGAMFIRLLFQK------------CSAAIQR-FGLTFQRSLEPENTATEVSSVNPDV  839

Query  1945  PVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsniss  2124
               +  +T +I     A+   E    E+     VHG LL+L Y  + +D+ +++  S+ ++
Sbjct  840   SFVLQLTQVILSRIGALSSAEIHRGES---PLVHGFLLSLHYVLDNVDFSTLS--SSEAA  894

Query  2125  iklllekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDD  2304
                     +   + ++  A   V  DA     + EE++   A F     E+   A T   
Sbjct  895   QWPSAMTQIFTAIHLSMRASLAVVGDATSGAGD-EELS---ASFAGVVGEVSAVAKTTSS  950

Query  2305  EMKIA-----------KAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPK  2451
              +++              +++DG  +Q  +VG WLA +E   +L  ++R+VPLPTS+ P 
Sbjct  951   ALRVDCRGHLIVEKGDGLDEEDGNAEQRAVVGSWLAARECGAILELLMRRVPLPTSN-PA  1009

Query  2452  SCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCS  2631
             S S IT  T        +D+ Q    G   L  L ++KH GA+      F  +C   L  
Sbjct  1010  SDS-ITYFT--------VDMAQRG--GETLLNSLFELKHKGAVATAYQAFEGVCRAFLAH  1058

Query  2632  ND--PRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLP  2805
              +  P L  L   W ++L+ER     Q    +LRRS+G   +F A   +EP  +   +LP
Sbjct  1059  GEKNPVLGGLPARWADRLLERLERSEQHF--ILRRSSGFAFSFVAILRAEPRNSAAVILP  1116

Query  2806  KALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAF  2985
             K +  L+ +A +                         D A  +   +         VHA 
Sbjct  1117  KVMSTLLRLAGED-----------------------TDAAEKQDTHQEHHSLWRARVHAL  1153

Query  2986  NVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQ  3165
             N+LK    D  LA D + +  +   +++R F    W VRNS+ + + A  +R IG   + 
Sbjct  1154  NILKLICQDGVLAEDVARYVVDMFELAVRGFDCGSWAVRNSSMMLFAAATQRAIGDKRIA  1213

Query  3166  KRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPML  3345
                  R+ +   + F R+  L  FL  EL   T L    + +  +S L     P L P+L
Sbjct  1214  D-GGTRQQVASDDVFSRFQQLRGFLAREL---TRLL---ADDKKSSALGGAAPPGLYPLL  1266

Query  3346  ILLSRLKPSP-----ITSETGDPFDP---FLFMPFIRKCSLQNNLRIRILASRALTGMVS  3501
             + LSRL+P       +      P D      F+P + KC+ Q  + IR +A++ +  +VS
Sbjct  1267  LFLSRLRPGDEDDQRVADAPASPCDGTGLASFVPLVMKCASQPTMAIRHMAAKVVASIVS  1326

Query  3502  NEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSL  3651
             N     V+  + + LP       T D S    +  S N +HG+L Q+  L
Sbjct  1327  NADAAYVLSMLCARLP--QGVRSTEDQSTAKPM--SHNYVHGILAQIRHL  1372



>gb|ETL90017.1| hypothetical protein L917_11156, partial [Phytophthora parasitica]
Length=2054

 Score =   209 bits (533),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 224/892 (25%), Positives = 376/892 (42%), Gaps = 136/892 (15%)
 Frame = +1

Query  1075  VKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAF  1254
             V + ++ +   L H     R  A ++L  + K+ S+PS  EL L++  + +N +    A 
Sbjct  687   VGVSMHEIERGLRHAKTETRGTAFDALCASLKSTSMPSDDELRLVKYYLAVNGKEIGPAG  746

Query  1255  QMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFM  1434
             +M      +    R++  +    K  +              +G+A    +       +F 
Sbjct  747   RMNTLIGLKTVLIRIKETMRLASKNASK-------------SGQA----RDEYAAAVSFK  789

Query  1435  KWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLI  1614
              W+  F+  S YP A  +R  + +E++L+ + ++ +   Q  S               L+
Sbjct  790   HWVELFIVASVYPGALPQRLTLGLEVLLLYVQLFGLETDQCPS--------------LLL  835

Query  1615  LPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVR  1794
               +    L+  +I +WD +R  +F IL  +P  +PG SS E +   + WA  L  SPR R
Sbjct  836   TGQMVTTLLNMLISAWDSIRSLAFTILDLYPDELPGYSSREELRILVDWAVGLCGSPRQR  895

Query  1795  ESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLE----------FTPSS  1944
             ESDAGA+  RL+F+K            C+   Q   GL+   +LE            P  
Sbjct  896   ESDAGAMFIRLLFQK------------CSAAIQR-FGLTFQRSLEPENTATEVSSVNPDV  942

Query  1945  PVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsniss  2124
               +  +T +I     A+   E    E+     VHG LL+L Y  + +D+ +++  S+ ++
Sbjct  943   SFVLQLTQVILSRIGALSSAEIHRGES---PLVHGFLLSLHYVLDNVDFSTLS--SSEAA  997

Query  2125  iklllekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDD  2304
                     +   + ++  A   V  DA     + EE++   A F     E+   A T   
Sbjct  998   QWPSAMTQIFTAIHLSMRASLAVVGDATSGAGD-EELS---ASFAGVVGEVSAVAKTTSS  1053

Query  2305  EMKIA-----------KAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPK  2451
              +++              +++DG  +Q  +VG WLA +E   +L  ++R+VPLPTS+ P 
Sbjct  1054  ALRVDCRGHLIVENGDGLDEEDGNAEQRAVVGSWLAARECGAILELLMRRVPLPTSN-PA  1112

Query  2452  SCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCS  2631
             S S IT  T        +D+ Q    G   L  L ++KH GA+      F  +C   L  
Sbjct  1113  SDS-ITYFT--------VDMAQRG--GETLLNSLFELKHKGAVATAYQAFEGVCRAFLAH  1161

Query  2632  ND--PRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLP  2805
              +  P L  L   W ++L+ER     Q    +LRRS+G   +F A   +EP  +   +LP
Sbjct  1162  GEKNPVLGGLPARWADRLLERLERSEQHF--ILRRSSGFAFSFVAILRAEPRNSAAVILP  1219

Query  2806  KALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVV--PTVH  2979
             K +  L+ +A +                         D  A E     ++   +    VH
Sbjct  1220  KVMSTLLRLAGE-------------------------DTDAAEKRDTHQEHHSLWRARVH  1254

Query  2980  AFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLN  3159
             A N+LK    D  LA D + +  +   +++R F    W VRNS+ + + A  +R IG   
Sbjct  1255  ALNILKLICQDGVLAEDVARYVVDMFELAVRGFDCGSWAVRNSSMMLFAAATQRAIGDKR  1314

Query  3160  VQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCP  3339
             +      R+ +   + F R+  L  FL  EL   T L    + +  +S L     P L P
Sbjct  1315  IAD-GGTRQQVASDDVFSRFQQLRGFLAREL---TRLL---ADDKKSSALGGAAPPGLYP  1367

Query  3340  MLILLSRLKPSP-----ITSETGDPFDP---FLFMPFIRKCSLQNNLRIRILASRALTGM  3495
             +L+ LSRL+P       +      P D      F+P + KC+ Q  + IR +A++ +  +
Sbjct  1368  LLLFLSRLRPGDEDDQRVADAPASPCDGTGLASFVPLVMKCASQPTMAIRHMAAKVVASI  1427

Query  3496  VSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSL  3651
             VSN     V+  + + LP       T D S    +  S N +HG+L Q+  L
Sbjct  1428  VSNADAAYVLSMLCARLP--QGVRSTEDQSTAKPM--SHNYVHGILAQIRHL  1475



>ref|XP_008907822.1| hypothetical protein PPTG_12866 [Phytophthora parasitica INRA-310]
 gb|ETN06854.1| hypothetical protein PPTG_12866 [Phytophthora parasitica INRA-310]
Length=2045

 Score =   209 bits (532),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 223/892 (25%), Positives = 372/892 (42%), Gaps = 136/892 (15%)
 Frame = +1

Query  1075  VKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAF  1254
             V + ++ +   L H     R  A ++L  + K+ S+PS  EL L++  + +N +    A 
Sbjct  678   VGVSMHEIERGLRHAKTETRGTAFDALCASLKSTSMPSDDELRLVKYYLAVNGKEIGPAG  737

Query  1255  QMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFM  1434
             +M      +    R++  +    K                 N       +       +F 
Sbjct  738   RMNTLIGLKTVLIRIKETMRLASK-----------------NASKSGQARDEYAAAVSFK  780

Query  1435  KWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLI  1614
              W+  F+  S YP A  +R  + +E++L+ + ++ +   Q  S               L+
Sbjct  781   HWVELFIVASVYPGALPQRLTLGLEVLLLYVQLFGLETDQCPS--------------LLL  826

Query  1615  LPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVR  1794
               +    L+  +I +WD +R  +F IL  +P  +PG SS E +   + WA  L  SPR R
Sbjct  827   TGQMVTTLLNMLISAWDSIRSLAFTILDLYPDELPGYSSREELRILVDWAVGLCGSPRQR  886

Query  1795  ESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLE----------FTPSS  1944
             ESDAGA+  RL+F+K            C+   Q   GL+   +LE            P  
Sbjct  887   ESDAGAMFIRLLFQK------------CSAAIQR-FGLTFQRSLEPENTATEVSSVNPDV  933

Query  1945  PVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsniss  2124
               +  +T +I     A+   E    E+     VHG LL+L Y  + +D+ +++  S+ ++
Sbjct  934   SFVLQLTQVILSRIGALSSAEIHRGES---PLVHGFLLSLHYVLDNVDFSTLS--SSEAA  988

Query  2125  iklllekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDD  2304
                     +   + ++  A   V  DA     + EE++   A F     E+   A T   
Sbjct  989   QWPSAMTQIFTAIHLSMRASLAVVGDATSGAGD-EELS---ASFAGVVGEVSAVAKTTSS  1044

Query  2305  EMKIA-----------KAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPK  2451
              +++              +++DG  +Q  +VG WLA +E   +L  ++R+VPLPTS+ P 
Sbjct  1045  ALRVDCRGHLIIENGDGLDEEDGNAEQRAVVGSWLAARECGAILELLMRRVPLPTSN-PA  1103

Query  2452  SCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCS  2631
             S S IT  T        +D+ Q    G   L  L ++KH GA+      F  +C   L  
Sbjct  1104  SDS-ITYFT--------VDMAQRG--GETLLNSLFELKHKGAVATAYQAFEGVCRAFLAH  1152

Query  2632  ND--PRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLP  2805
              +  P L  L   W ++L+ER     Q    +LRRS+G   +F A   +EP  +   +LP
Sbjct  1153  GEKNPVLGGLPARWADRLLERLERSEQHF--ILRRSSGFAFSFVAILRAEPRNSAAVILP  1210

Query  2806  KALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVV--PTVH  2979
             K +  L+ +A +                         D  A E     ++   +    VH
Sbjct  1211  KVMSTLLRLAGE-------------------------DTDAAEKRDTHQEHHSLWRARVH  1245

Query  2980  AFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLN  3159
             A N+LK    D  LA D + +  +   +++R F    W VRNS+ + + A  +R IG   
Sbjct  1246  ALNILKLICQDGVLAEDVARYVVDMFELAVRGFDCGSWAVRNSSMMLFAAATQRAIGDKR  1305

Query  3160  VQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCP  3339
             +      R+ +   + F R+  L  FL  EL   T L    + +  +S L     P L P
Sbjct  1306  IAD-GGTRQQVASDDVFSRFQQLRGFLAREL---TRLL---ADDKKSSALGGAAPPGLYP  1358

Query  3340  MLILLSRLKPSP-----ITSETGDPFDP---FLFMPFIRKCSLQNNLRIRILASRALTGM  3495
             +L+ LSRL+P       +      P D      F+P + KC+ Q  + IR +A++ +  +
Sbjct  1359  LLLFLSRLRPGDEDDQRVADAPASPCDGTGLASFVPLVMKCASQPTMAIRHMAAKVVASI  1418

Query  3496  VSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSL  3651
             VSN     V+  + + LP       T D S    +  S N +HG+L Q+  L
Sbjct  1419  VSNADAAYVLSMLCARLP--QGVRSTEDQSTAKPM--SHNYVHGILAQIRHL  1466



>gb|ETI43354.1| hypothetical protein F443_11673, partial [Phytophthora parasitica 
P1569]
Length=2054

 Score =   209 bits (532),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 224/892 (25%), Positives = 376/892 (42%), Gaps = 136/892 (15%)
 Frame = +1

Query  1075  VKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAF  1254
             V + ++ +   L H     R  A ++L  + K+ S+PS  EL L++  + +N +    A 
Sbjct  687   VGVSMHEIERGLRHAKTETRGTAFDALCASLKSTSMPSDDELRLVKYYLAVNGKEIGPAG  746

Query  1255  QMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFM  1434
             +M      +    R++  +    K  +              +G+A    +       +F 
Sbjct  747   RMNTLIGLKTVLIRIKETMRLASKNAS-------------KSGQA----RDEYAAAVSFK  789

Query  1435  KWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLI  1614
              W+  F+  S YP A  +R  + +E++L+ + ++ +   Q  S               L+
Sbjct  790   HWVELFIVASVYPGALPQRLTLGLEVLLLYVQLFGLETDQCPS--------------LLL  835

Query  1615  LPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVR  1794
               +    L+  +I +WD +R  +F IL  +P  +PG SS E +   + WA  L  SPR R
Sbjct  836   TGQMVTTLLNMLISAWDSIRSLAFTILDLYPDELPGYSSREELRILVDWAVGLCGSPRQR  895

Query  1795  ESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLE----------FTPSS  1944
             ESDAGA+  RL+F+K            C+   Q   GL+   +LE            P  
Sbjct  896   ESDAGAMFIRLLFQK------------CSAAIQR-FGLTFQRSLEPENTATEVSSVNPDV  942

Query  1945  PVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsniss  2124
               +  +T +I     A+   E    E+     VHG LL+L Y  + +D+ +++  S+ ++
Sbjct  943   SFVLQLTQVILSRIGALSSAEIHRGES---PLVHGFLLSLHYVLDNVDFSTLS--SSEAA  997

Query  2125  iklllekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDD  2304
                     +   + ++  A   V  DA     + EE++   A F     E+   A T   
Sbjct  998   QWPSAMTQIFTAIHLSMRASLAVVGDATSGAGD-EELS---ASFAGVVGEVSAVAKTTSS  1053

Query  2305  EMKIA-----------KAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPK  2451
              +++              +++DG  +Q  +VG WLA +E   +L  ++R+VPLPTS+ P 
Sbjct  1054  ALRVDCRGHLIVEKGDGLDEEDGNAEQRAVVGSWLAARECGAILELLMRRVPLPTSN-PA  1112

Query  2452  SCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCS  2631
             S S IT  T        +D+ Q    G   L  L ++KH GA+      F  +C   L  
Sbjct  1113  SDS-ITYFT--------VDMAQRG--GETLLNSLFELKHKGAVATAYQAFEGVCRAFLAH  1161

Query  2632  ND--PRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLP  2805
              +  P L  L   W ++L+ER     Q    +LRRS+G   +F A   +EP  +   +LP
Sbjct  1162  GEKNPVLGGLPARWADRLLERLERSEQHF--ILRRSSGFAFSFVAILRAEPRNSAAVILP  1219

Query  2806  KALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVV--PTVH  2979
             K +  L+ +A +                         D  A E     ++   +    VH
Sbjct  1220  KVMSTLLRLAGE-------------------------DTDAAEKRDTHQEHHSLWRARVH  1254

Query  2980  AFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLN  3159
             A N+LK    D  LA D + +  +   +++R F    W VRNS+ + + A  +R IG   
Sbjct  1255  ALNILKLICQDGVLAEDVARYVVDMFELAVRGFDCGSWAVRNSSMMLFAAATQRAIGDKR  1314

Query  3160  VQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCP  3339
             +      R+ +   + F R+  L  FL  EL   T L    + +  +S L     P L P
Sbjct  1315  IAD-GGTRQQVASDDVFSRFQQLRGFLAREL---TRLL---ADDKKSSALGGAAPPGLYP  1367

Query  3340  MLILLSRLKPSP-----ITSETGDPFDP---FLFMPFIRKCSLQNNLRIRILASRALTGM  3495
             +L+ LSRL+P       +      P D      F+P + KC+ Q  + IR +A++ +  +
Sbjct  1368  LLLFLSRLRPGDEDDQRVADAPASPCDGTGLASFVPLVMKCASQPTMAIRHMAAKVVASI  1427

Query  3496  VSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSL  3651
             VSN     V+  + + LP       T D S    +  S N +HG+L Q+  L
Sbjct  1428  VSNADAAYVLSMLCARLP--QGVRSTEDQSTAKPM--SHNYVHGILAQIRHL  1475



>gb|ETK83427.1| hypothetical protein L915_11356, partial [Phytophthora parasitica]
 gb|ETL36836.1| hypothetical protein L916_11259, partial [Phytophthora parasitica]
Length=2054

 Score =   209 bits (531),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 223/890 (25%), Positives = 374/890 (42%), Gaps = 132/890 (15%)
 Frame = +1

Query  1075  VKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAF  1254
             V + ++ +   L H     R  A ++L  + K+ S+PS  EL L++  + +N +    A 
Sbjct  687   VGVSMHEIERGLRHAKTETRGTAFDALCASLKSTSMPSDDELRLVKYYLAVNGKEIGPAG  746

Query  1255  QMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFM  1434
             +M      +    R++  +    K  +              +G+A    +       +F 
Sbjct  747   RMNTLIGLKTVLIRIKETMRLASKNASK-------------SGQA----RDEYAAAVSFK  789

Query  1435  KWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLI  1614
              W+  F+  S YP A  +R  + +E++L+ + ++ +   Q  S               L+
Sbjct  790   HWVELFIVASVYPGALPQRLTLGLEVLLLYVQLFGLETDQCPS--------------LLL  835

Query  1615  LPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVR  1794
               +    L+  +I +WD +R  +F IL  +P  +PG SS E +   + WA  L  SPR R
Sbjct  836   TGQMVTTLLNMLISAWDSIRSLAFTILDLYPDELPGYSSREELRILVDWAVGLCGSPRQR  895

Query  1795  ESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLE----------FTPSS  1944
             ESDAGA+  RL+F+K            C+   Q   GL+   +LE            P  
Sbjct  896   ESDAGAMFTRLLFQK------------CSAAIQR-FGLTFQRSLEPENTATEVSSVNPDV  942

Query  1945  PVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsniss  2124
               +  +T +I     A+   E    E+     VHG LL+L Y  + +D+ +++  S+ ++
Sbjct  943   SFVLQLTQVILSRIGALSSAEIHRGES---PLVHGFLLSLHYVLDNVDFSTLS--SSEAA  997

Query  2125  iklllekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDD  2304
                     +   + ++  A   V  DA     + EE++   A F     E+   A T   
Sbjct  998   QWPSAMTQIFTAIHLSMRASLAVVGDATSGAGD-EELS---ASFAGVVGEVSAVAKTTSS  1053

Query  2305  EMKIA-----------KAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPK  2451
              +++              +++DG  +Q  +VG WLA +E   +L  ++R+VPLPTS+ P 
Sbjct  1054  ALRVDCRGHLIVENGDGLDEEDGNAEQRAVVGSWLAARECGAILEFLMRRVPLPTSN-PA  1112

Query  2452  SCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCS  2631
             S S IT  T        +D+ Q    G   L  L ++KH GA+      F  +C   L  
Sbjct  1113  SDS-ITYFT--------VDMAQRG--GETLLNSLFELKHKGAVATAYQAFEGVCRAFLAH  1161

Query  2632  ND--PRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLP  2805
              +  P L  L   W ++L+ER     Q    +LRRS+G   +F A   +EP  +   +LP
Sbjct  1162  GEKNPVLGGLPARWADRLLERLERSEQHF--ILRRSSGFAFSFVAILRAEPRNSAAVILP  1219

Query  2806  KALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAF  2985
             K +  L+ +A +                         D A  +   +         VHA 
Sbjct  1220  KVMSTLLRLAGED-----------------------TDAAEKQDTHQEHHSLWRARVHAL  1256

Query  2986  NVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQ  3165
             N+LK    D  LA D + +  +   +++R F    W VRNS+ + + A  +R IG   + 
Sbjct  1257  NILKLICQDGVLAEDVARYVVDMFELAVRGFDCGSWAVRNSSMMLFAAATQRAIGDKRIA  1316

Query  3166  KRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPML  3345
                  R+ +   + F R+  L  FL  EL   T L    + +  +S L     P L P+L
Sbjct  1317  D-GGTRQQVASDDVFSRFQQLRGFLAREL---TRLL---ADDKKSSALGGAAPPGLYPLL  1369

Query  3346  ILLSRLKPSP-----ITSETGDPFDP---FLFMPFIRKCSLQNNLRIRILASRALTGMVS  3501
             + LSRL+P       +      P D      F+P + KC+ Q  + IR +A++ +  +VS
Sbjct  1370  LFLSRLRPGDEDDQRVADAPASPCDGTGLASFVPLVMKCASQPTMAIRHMAAKVVASIVS  1429

Query  3502  NEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSL  3651
             N     V+  + + LP       T D S    +  S N +HG+L Q+  L
Sbjct  1430  NADAAYVLSMLCARLP--QGVRSTEDQSTAKPM--SHNYVHGILAQIRHL  1475



>gb|ETP13148.1| hypothetical protein F441_11597 [Phytophthora parasitica CJ01A1]
Length=2045

 Score =   209 bits (531),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 222/890 (25%), Positives = 370/890 (42%), Gaps = 132/890 (15%)
 Frame = +1

Query  1075  VKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAF  1254
             V + ++ +   L H     R  A ++L  + K+ S+PS  EL L++  + +N +    A 
Sbjct  678   VGVSMHEIERGLRHAKTETRGTAFDALCASLKSTSMPSDDELRLVKYYLAVNGKEIGPAG  737

Query  1255  QMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFM  1434
             +M      +    R++  +    K                 N       +       +F 
Sbjct  738   RMNTLIGLKTVLIRIKETMRLASK-----------------NASKSGQARDEYAAAVSFK  780

Query  1435  KWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLI  1614
              W+  F+  S YP A  +R  + +E++L+ + ++ +   Q  S               L+
Sbjct  781   HWVELFIVASVYPGALPQRLTLGLEVLLLYVQLFGLETDQCPS--------------LLL  826

Query  1615  LPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVR  1794
               +    L+  +I +WD +R  +F IL  +P  +PG SS E +   + WA  L  SPR R
Sbjct  827   TGQMVTTLLNMLISAWDSIRSLAFTILDLYPDELPGYSSREELRILVDWAVGLCGSPRQR  886

Query  1795  ESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLE----------FTPSS  1944
             ESDAGA+  RL+F+K            C+   Q   GL+   +LE            P  
Sbjct  887   ESDAGAMFTRLLFQK------------CSAAIQR-FGLTFQRSLEPENTATEVSSVNPDV  933

Query  1945  PVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsniss  2124
               +  +T +I     A+   E    E+     VHG LL+L Y  + +D+ +++  S+ ++
Sbjct  934   SFVLQLTQVILSRIGALSSAEIHRGES---PLVHGFLLSLHYVLDNVDFSTLS--SSEAA  988

Query  2125  iklllekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDD  2304
                     +   + ++  A   V  DA     + EE++   A F     E+   A T   
Sbjct  989   QWPSAMTQIFTAIHLSMRASLAVVGDATSGAGD-EELS---ASFAGVVGEVSAVAKTTSS  1044

Query  2305  EMKIA-----------KAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPK  2451
              +++              +++DG  +Q  +VG WLA +E   +L  ++R+VPLPTS+ P 
Sbjct  1045  ALRVDCRGHLIVENGDGLDEEDGNAEQRAVVGSWLAARECGAILEFLMRRVPLPTSN-PA  1103

Query  2452  SCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCS  2631
             S S IT  T        +D+ Q    G   L  L ++KH GA+      F  +C   L  
Sbjct  1104  SDS-ITYFT--------VDMAQRG--GETLLNSLFELKHKGAVATAYQAFEGVCRAFLAH  1152

Query  2632  ND--PRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLP  2805
              +  P L  L   W ++L+ER     Q    +LRRS+G   +F A   +EP  +   +LP
Sbjct  1153  GEKNPVLGGLPARWADRLLERLERSEQHF--ILRRSSGFAFSFVAILRAEPRNSAAVILP  1210

Query  2806  KALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAF  2985
             K +  L+ +A +                         D A  +   +         VHA 
Sbjct  1211  KVMSTLLRLAGED-----------------------TDAAEKQDTHQEHHSLWRARVHAL  1247

Query  2986  NVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQ  3165
             N+LK    D  LA D + +  +   +++R F    W VRNS+ + + A  +R IG   + 
Sbjct  1248  NILKLICQDGVLAEDVARYVVDMFELAVRGFDCGSWAVRNSSMMLFAAATQRAIGDKRIA  1307

Query  3166  KRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPML  3345
                  R+ +   + F R+  L  FL  EL   T L    + +  +S L     P L P+L
Sbjct  1308  D-GGTRQQVASDDVFSRFQQLRGFLAREL---TRLL---ADDKKSSALGGAAPPGLYPLL  1360

Query  3346  ILLSRLKPSP-----ITSETGDPFDP---FLFMPFIRKCSLQNNLRIRILASRALTGMVS  3501
             + LSRL+P       +      P D      F+P + KC+ Q  + IR +A++ +  +VS
Sbjct  1361  LFLSRLRPGDEDDQRVADAPASPCDGTGLASFVPLVMKCASQPTMAIRHMAAKVVASIVS  1420

Query  3502  NEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSL  3651
             N     V+  + + LP       T D S    +  S N +HG+L Q+  L
Sbjct  1421  NADAAYVLSMLCARLP--QGVRSTEDQSTAKPM--SHNYVHGILAQIRHL  1466



>gb|ETP41224.1| hypothetical protein F442_11564 [Phytophthora parasitica P10297]
Length=2045

 Score =   206 bits (525),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 221/887 (25%), Positives = 369/887 (42%), Gaps = 126/887 (14%)
 Frame = +1

Query  1075  VKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAF  1254
             V + ++ +   L H     R  A ++L  + K+ S+PS  EL L++  + +N +    A 
Sbjct  678   VGVSMHEIERGLRHAKTETRGTAFDALCASLKSTSMPSDDELRLVKYYLAVNGKEIGPAG  737

Query  1255  QMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFM  1434
             +M      +    R++  +    K                 N       +       +F 
Sbjct  738   RMNTLIGLKTVLIRIKETMRLASK-----------------NASKSGQARDEYAAAVSFK  780

Query  1435  KWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLI  1614
              W+  F+  S YP A  +R  + +E++L+ + ++ +   Q  S               L+
Sbjct  781   HWVELFIVASVYPGALPQRLTLGLEVLLLYVQLFGLETDQCPS--------------LLL  826

Query  1615  LPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCSPRVR  1794
               +    L+  +I +WD +R  +F IL  +P  +PG SS E +   + WA  L  SPR R
Sbjct  827   TGQMVTTLLNMLISAWDSIRSLAFTILDLYPDELPGYSSREELRILVDWAVGLCGSPRQR  886

Query  1795  ESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLE----------FTPSS  1944
             ESDAGA+  RL+F+K            C+   Q   GL+   +LE            P  
Sbjct  887   ESDAGAMFIRLLFQK------------CSAAIQR-FGLTFQRSLEPENTATEVSSVNPDV  933

Query  1945  PVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsniss  2124
               +  +T +I     A+   E    E+     VHG LL+L Y  + +D+ +++ +     
Sbjct  934   SFVLQLTQVILSRIGALSSAEIHRGES---PLVHGFLLSLHYVLDNVDFSTLSSSEAAQW  990

Query  2125  iklllekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDD  2304
                + +   A+ + + + +L VV        DE    +  G       +    S+    D
Sbjct  991   PSAMTQIFTAIHLSMRA-SLAVVGDATSGAGDEELSASFAGVVGEVSAVAKITSSVLRVD  1049

Query  2305  ---EMKIAKAE---QDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQI  2466
                 + + K +   ++DG  +Q  +VG WLA +E   +L  ++R+VPLPTS+ P S S I
Sbjct  1050  CRGHLIVEKGDGLDEEDGNAEQRAVVGSWLAARECGAILELLMRRVPLPTSN-PASDS-I  1107

Query  2467  TDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSND--P  2640
             T  T        +D+ Q    G   L  L ++KH GA+      F  +C   L   +  P
Sbjct  1108  TYFT--------VDMAQRG--GETLLNSLFELKHKGAVATAYQAFEGVCRAFLAHGEKNP  1157

Query  2641  RLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRW  2820
              L  L   W ++L+ER     Q    +LRRS+G   +F A   +EP  +   +LPK +  
Sbjct  1158  VLGGLPARWADRLLERLERSEQHF--ILRRSSGFAFSFVAILRAEPRNSAAVILPKVMST  1215

Query  2821  LINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVV--PTVHAFNVL  2994
             L+ +A +                         D  A E     ++   +    VHA N+L
Sbjct  1216  LLRLAGE-------------------------DTDAAEKRDTHQEHHSLWRARVHALNIL  1250

Query  2995  KAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRE  3174
             K    D  LA D + +  +   +++R F    W VRNS+ + + A  +R IG   +    
Sbjct  1251  KLICQDGVLAEDVARYVVDMFELAVRGFDCGSWAVRNSSMMLFAAATQRAIGDKRIAD-G  1309

Query  3175  SARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILL  3354
               R+ +   + F R+  L  FL  EL   T L    + +  +S L     P L P+L+ L
Sbjct  1310  GTRQQVASDDVFSRFQQLRGFLAREL---TRLL---ADDKKSSALGGAAPPGLYPLLLFL  1363

Query  3355  SRLKPSP-----ITSETGDPFDP---FLFMPFIRKCSLQNNLRIRILASRALTGMVSNEK  3510
             SRL+P       +      P D      F+P + KC+ Q  + IR +A++ +  +VSN  
Sbjct  1364  SRLRPGDEDDQRVADAPASPCDGTGLASFVPLVMKCASQPTMAIRHMAAKVVASIVSNAD  1423

Query  3511  LPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSL  3651
                V+  + + LP       T D S    +  S N +HG+L Q+  L
Sbjct  1424  AAYVLSMLCARLP--QGVRSTEDQSTAKPM--SHNYVHGILAQIRHL  1466



>ref|XP_006811596.1| PREDICTED: thyroid adenoma-associated protein homolog [Saccoglossus 
kowalevskii]
Length=1835

 Score =   205 bits (521),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 275/1147 (24%), Positives = 483/1147 (42%), Gaps = 242/1147 (21%)
 Frame = +1

Query  286   VGTRVLKIVWNNLEDPLSQTVKQVHLIFDLFLDIQGTLHWAEGSEKFCSFLRKIASDLLH  465
             +  ++L  VW N E  +     QV +IFD  ++    +H+    E    F   I   L++
Sbjct  411   ISKKLLHYVWENSEHTIEGMRYQVKIIFDNIIE----MHFKVDCED-SKFFYGIFQHLMN  465

Query  466   LGPRCKGRYIPLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLR  645
                  + +Y  LA++   LG+  +LD+ P L  D   A  +  V   A+   +  L+  +
Sbjct  466   TSWHVRSKYSFLATMVTYLGSNRMLDLCPTLPRDILNAVDEQTVAPYASDLYERLLQTHK  525

Query  646   DEYWSTDGVEGGYIKYRAHCLLPILSGLSSGFAKLRSNLNT-----YALPVLLELDVDSI  810
              E            +++A  +LP+L  L       R N NT     Y LP +L+      
Sbjct  526   KE-------SDEDTRWKAVWILPVLEMLQ------RKNYNTTLITQYCLPRILKR-----  567

Query  811   FPMLGFIGIGCSAESTEIFYPELDSRDIVLGVEQRVAVLVSLLKVSRMLALIEGDIDWCE  990
                          E  E     +   +     ++ +AVL++ LKV+R   L+  +  W +
Sbjct  568   -----------CPECLEYIQMHMKPSN-----QENLAVLITCLKVARCQGLL--NTKWND  609

Query  991   YSSVALEVTDLSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPK  1170
                      D++   G+             I V+ L  AL H D+ L + A   +  N K
Sbjct  610   ---------DITCWHGI-------------ISVSSLQQALCHHDNKLSLQALSLICDNTK  647

Query  1171  TASLPSSLELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSL  1350
             T    +S +  L++  + +NM+  S A +    S  +KF  R+  +   + KQ       
Sbjct  648   TTESITSTDFQLIKTFLEVNMKAQSPADRHYIISDIKKFLCRIHESGLMLWKQR------  701

Query  1351  IKCLSGSPLNGEADQSLKHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLN  1530
                      N +  QS   + E   +F++WL  FL  + YP A + R+ +A+ ++ +M +
Sbjct  702   ---------NKDGCQS---QLELYKDFLEWLFSFLLNNLYPDACHPRRALALSVLNLMND  749

Query  1531  VWHMLPPQGKSDSYSSEI-SLYPYSKGLILPESTLLLVGSII----DSWDRLRESSFRIL  1695
             ++          S+SS+  SL     G I  + T   V +I+    DS+ + RE + +++
Sbjct  750   IF----------SHSSQGGSLNGVQFGFI-DQLTTNHVQTILECLNDSYSKNREMALQLI  798

Query  1696  LHFPTPIPGISSPELVCEAIIWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVS  1875
                PT    +S+  L    +  AK      + + S  GA    L+++             
Sbjct  799   KCSPTTAQKVSN--LYEMGLDLAK----GNKPQNSIVGANILCLVYQ-------------  839

Query  1876  CNVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVL  2055
             C +  +SP                  + +  L+ +L   +E G+  L +A  K  ++G+L
Sbjct  840   CGI--ESPE-----------------QILQDLLVYLREQIEIGKCSLLKAAAKYPIYGLL  880

Query  2056  LTLRYTFEEMDWDSIAVAsnissiklllekilalVMRITSLALWVV--SADAWYLP-DEM  2226
               +R   +E+       +S+   I   L+ ++ L +  +S+   VV  S+   YLP DE 
Sbjct  881   YCVRTLLKELS------SSHTRIIDNYLDCLIELCLDASSIVSPVVCNSSPEGYLPVDEQ  934

Query  2227  EEMTVDGACFL----ERPIEMDVSASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVS  2394
             ++ +++         E+  + D   S  ++E    +         Q+V++ CW+ MKEVS
Sbjct  935   KDASLEHLVLRGNDKEQNEDGDDKTSRNEEEDDKEEEGDSHTVTPQMVLICCWITMKEVS  994

Query  2395  LLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNG  2574
             LLLG                  Q+T   +  +   +L ++Q++ +G+ F+++L+K +H G
Sbjct  995   LLLG------------------QLTQFKNS-NKKTLLSVQQMKTLGDFFMDILMKARHRG  1035

Query  2575  AIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQTVDDLL--RRSAGIPA  2748
             A + +  GF  LC+ L  S    L  L   W++ L+       + +  L   RRSAGIP 
Sbjct  1036  AFELSYTGFEQLCHLLWRSEVKELNSLPVKWLQILLTEIQCTNE-ISQLCATRRSAGIPF  1094

Query  2749  AFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAA  2928
             AF A   +E      R  P     +I +   SL                           
Sbjct  1095  AFQAILNAECMVQKDR--PNFKHVMIQLLDLSL---------------------------  1125

Query  2929  IEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNS  3108
                  ++ ++     VH+ N+L A + D+ L  D   F A+ +  +I  F+S  W VRNS
Sbjct  1126  ----GQSVNDDTFAQVHSLNILCALYKDSELGEDVFPFIADGVKAAILGFNSELWGVRNS  1181

Query  3109  ACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSS  3288
             + + + AL+ R+ G    +   S +  L+G EFF R+P+LH+FL  ++KI         S
Sbjct  1182  SMMLFNALITRIFGVKRTKDEHSKKNQLSGREFFSRFPSLHSFLLKQIKIV--------S  1233

Query  3289  ENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFL----FMPFIRKCSLQNNL  3456
             ++ TS     +  S   +L+L+SRL      S T D  D  L    F+P+I+KC   +  
Sbjct  1234  QDTTS-----LQQSQFAILLLMSRL-----YSSTFDGIDSNLSLSEFVPYIQKCCSCSVW  1283

Query  3457  RIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLL  3636
             + R +A+R L  +     +  ++ ++   LP       TSD      L  S N+IHG+LL
Sbjct  1284  KTRTMAARTLASICPTSAINALLTSLIVSLP-------TSDC-----LQLSHNTIHGVLL  1331

Query  3637  QLSSLLD  3657
             Q+  +L+
Sbjct  1332  QIYHVLE  1338



>ref|XP_797130.3| PREDICTED: thyroid adenoma-associated protein homolog [Strongylocentrotus 
purpuratus]
Length=1906

 Score =   205 bits (521),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 275/1164 (24%), Positives = 484/1164 (42%), Gaps = 190/1164 (16%)
 Frame = +1

Query  481   KGRYIPLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWS  660
             +G+Y PL  + +  GA +++++ PG+L        +  + + +   ++      + E   
Sbjct  341   RGKYGPLGCIFEMEGASNVINLYPGVLKQLLAVMGEHAMATHSCEVIEKLFNQHKRELQH  400

Query  661   TDGVEGGYIKYRAHCLLPILSGLS--SGFAKLRSNLNTYALPVLLELDVDSIFPMLGFI-  831
             T+G     + +    ++PIL+ LS  +  +K +  +  Y +P LL+       P L FI 
Sbjct  401   TEG--NSSLLWNETWVVPILAVLSDQTKPSKQKGFIIDYLIPKLLKCSP----PSLAFII  454

Query  832   --------------GIGCSAESTEIFYPELDSRDIVLGVEQ---------RVAVLVSLLK  942
                             G  +++  +    + S++   G  +         ++  L+S LK
Sbjct  455   QHLSSQEPFNAPRMKEGNPSQTQPLTADAVRSKECFHGNHESSSSSCDGGKLGALLSCLK  514

Query  943   VSRMLALIEG--DIDWCEYSSVALEVTDLST-----------DAGVCDSVVHV-KGIEVK  1080
              +R L L++   D D  +       V +                G  D    + KG+   
Sbjct  515   TARSLGLLKSGQDADTTKKEKRQERVEESRKVEEEKKEEGLDSRGKEDEEARLWKGL---  571

Query  1081  IPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQM  1260
             +PV  L  AL+H  D +RID    L  + KT    S ++LSL+  ++PLN+   S +F+ 
Sbjct  572   VPVRLLCQALSHSTDQIRIDTIGLLCDSNKTTEDVSEIDLSLLIFSLPLNLNNPSPSFRQ  631

Query  1261  KWASLFRKFFSRVRTALERVIKQGT-------WHPSLIKCLSGSPLNGEADQSLKHRAEN  1419
             +  S  +K   R+R +   + K+         +H  L+               LK++   
Sbjct  632   QLISHIKKLLFRLRESGRILFKKSQRAQDLQDYHSRLL---------------LKYK---  673

Query  1420  LFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPY  1599
               +F+ WL   +F S  P   Y  +  +++     L   H         +++S I+    
Sbjct  674   --DFLDWLCSVMFHSLRPGFGYACRATSLQ----ALTAIHA--------TFTSSINGLFA  719

Query  1600  SKGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVC  1779
             +  L       L+V  ++D+++  R  +F +L   P  I G+ SP+ + +    A  L  
Sbjct  720   TSTLWSTSRVNLMVTRLMDNYESNRVMAFDLLASLPQAILGLESPKKLQDRYRVAYDLAI  779

Query  1780  SPRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVT---QSPSGLSNGENLEFTPSSPV  1950
             S +    +  A  FRL+ R+    L   +  + NV     QS S L    ++E    S  
Sbjct  780   SNKPYNCETAAYVFRLLIRQVQPSLYTGLSTTTNVEAMEYQSQSRLDARSSIE----SNT  835

Query  1951  IEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissik  2130
             +  +  L + L   VE   + L E   +  ++GVL  LR    + D  ++          
Sbjct  836   LWVMQELCNALEEQVEVARESLLETAVQGPMYGVLHCLRILLGDTDLKTLP---------  886

Query  2131  lllekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEM  2310
               +     +V R+  L   V    A  + +   E  +      E+  E +  A +  + +
Sbjct  887   -KVAAWKCVVTRLIQLCFDVADVAATVVCNSTPEGFIPSEQKQEKEEEGECGARSKLETL  945

Query  2311  KIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLS  2490
              +           Q+++V CW +MKEVSLLLG + ++ P+   D                
Sbjct  946   HVTP---------QMILVCCWRSMKEVSLLLGELSQRTPMEDED---------------R  981

Query  2491  SDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWM  2670
               +V  L Q++ IG  F+++L K KH GA +   AGF  L  R+  S    +  L + W+
Sbjct  982   EGLVTSL-QVKSIGTFFMKLLRKSKHRGAFELAYAGFIKLSTRIW-SEPSSIHGLPQRWL  1039

Query  2671  EQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLT  2850
              +L++  ++  +++    RRSAGIP A  A    EP+   K      +  L+N+A     
Sbjct  1040  SELLQE-ITSNKSMLCATRRSAGIPFAIQALVGPEPKELGKPCFQNTMATLLNLA-----  1093

Query  2851  DknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATD  3030
                                          +  + +E     VHA N+L+A F D  L+ +
Sbjct  1094  -----------------------------LQPSENEDQTARVHALNILRALFRDTKLSQE  1124

Query  3031  TSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFF  3210
                F    +  +I  F++ +W VRNSA + ++AL+ R+ G    +   + +  +TG EFF
Sbjct  1125  VLPFIGNGVKAAILGFAAKFWAVRNSATMLFSALISRIFGVKRARDELARKNCMTGTEFF  1184

Query  3211  HRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSP-ITSE  3387
              R+PTLH FL  + + A E      +EN +     V+HPSL P L+LLSRL PSP  T+ 
Sbjct  1185  SRFPTLHGFLLEQFQQAQE------AENTSKPGVTVLHPSLFPSLLLLSRLYPSPNDTNN  1238

Query  3388  TGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHS  3567
             +     PFL  P++ +       + R +A+ AL  +V   +L   + ++   L    NH 
Sbjct  1239  SNMSMTPFL--PYVIRAGCSAVHKTRSIAATALVPLVPPNQLVHTLHHLIDMLLGAANHP  1296

Query  3568  MTSDLSGLSNLNASFNSIHGMLLQLSSLLD--TNCRNLADFSKKEDILSDLIHVLGKHSW  3741
                            N+IHG+L+Q+  LL+  T   NL   S  +DI S ++    +  W
Sbjct  1297  PPHP-----------NAIHGILMQIHCLLEKYTKDTNLP-HSILDDITSTVLPRFHQLMW  1344

Query  3742  IGSPQKCPCPILNCSFLKVLDNML  3813
             + S Q     I   +F+ +L +  
Sbjct  1345  LTSRQN-KSYITQAAFIAILKDFF  1367



>ref|XP_643661.1| hypothetical protein DDB_G0275399 [Dictyostelium discoideum AX4]
 gb|EAL69765.1| hypothetical protein DDB_G0275399 [Dictyostelium discoideum AX4]
Length=2176

 Score =   204 bits (518),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 188/730 (26%), Positives = 330/730 (45%), Gaps = 106/730 (15%)
 Frame = +1

Query  34    NIFFVVSNDGYDGLGNPGNNDSSVKTILYDGILSELCNFCEHPTDSHFNFHALTVMQICL  213
             NIF  ++N  Y+       N++    ++Y GI     ++C    D H  F +L  + +C+
Sbjct  360   NIFSSLTNSIYNN-----QNENIFLNLIYKGI----SDYCGGTVDQHNRFISLEYLHLCI  410

Query  214   QQIKTSMQGTDGY-IE------------EGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQ  354
              +IK  +  ++   IE            E Y+          L IVW N E  +      
Sbjct  411   LKIKEWLNNSESKNIEKKQLIKSVFPSCENYETFFNSYFLIGLDIVWKNWESSVQNISGL  470

Query  355   VHLIFDLFLDIQ----GTLHWAEGSE-KFCSFLRKIASDLLHLGPRCKGRYIPLASLTKR  519
              + IFD  L I       ++   G+  K   F+  I + L+      K +YI L  + ++
Sbjct  471   SNDIFDELLIIHYKCCDDINNKSGNNLKSNLFINSITTKLIDEDWYQKNKYILLKYVLEK  530

Query  520   LGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGG------  681
             +G   ++++    L +   A +D  +C++   FL+ F+E L+ +Y  T+  E G      
Sbjct  531   VGPIYMIELRGNFLKNIFSAMIDHTICNSVKVFLELFIEELKKDYLLTNKEEVGPTTTTT  590

Query  682   ------YIKYRAHCLLPILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFI---G  834
                     +   + + P+L  L+       S +  YALP LL++  +S+F +L  +   G
Sbjct  591   TTTNQELNRIEKYWIYPLLEVLTETDTVTSSRIIVYALPSLLKVFPESLFKILNILINQG  650

Query  835   IGCSAESTEIFYPELDS-RDIVLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALE  1011
              G      +    EL+  R+I   +  R+ + ++LL  SR L+LI+G     +Y S+  +
Sbjct  651   GGGVGGDDDDQDNELNKFRNINYNI--RIRISLALLNSSRQLSLIDGRELQSKYHSIIEK  708

Query  1012  VTDLSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSS  1191
                                            +L + D+SLR+   E + ++PK     + 
Sbjct  709   -------------------------------SLENEDESLRLLGLELICVSPKQTERITI  737

Query  1192  LELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGS  1371
              EL+L++  + LN++  S   + +  S   +F+ R+R +  +V +  T           +
Sbjct  738   CELNLIKNFILLNLKGNSPFIRNQSLSTLYRFWIRLRESCCKVFRAST----------NT  787

Query  1372  PLNGEAD----QSLKHRAENLFNFMKWLSCFLF-FSCYPSAPYERKIMAMELMLIMLNVW  1536
              +N E D    Q      E+L  ++ W SC LF ++ YP AP+ RK++ +E     +++W
Sbjct  788   NINIEKDDPTSQDRYITIEDLIEYINW-SCQLFAYNLYPDAPFSRKMLPLEAFSEFVDIW  846

Query  1537  HMLPPQGKSD-----SYSSEISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILLH  1701
                  Q K        Y  E S+  YSK      ST +L+ ++ DS+DR RE S  IL+ 
Sbjct  847   SSKGGQEKKSLQEFLIYIEEKSVLLYSKS-----STDILINNLWDSYDRCRELSTDILMK  901

Query  1702  FPTPIPGISSPELVCEAIIWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCN  1881
             FP+P+PG+ S E +   ++WA KL CSP+ RE D GA   +L  +KYV     +V +  +
Sbjct  902   FPSPLPGMESDEKIISFLLWAVKLACSPKARECDTGAYALKLYLKKYVFGADGLVPI-FH  960

Query  1882  VVTQSPSGLSNGENLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLT  2061
               T +P   +    ++   S    E+IT ++  L +  +   KDL EA K + +HG++L+
Sbjct  961   SSTTTPVTFT---KIQGNNSKAAFEFITQILRILKSQTKLASKDLLEAAKFAPMHGLILS  1017

Query  2062  LRYTFEEMDW  2091
             LRY   E+++
Sbjct  1018  LRYIINEINF  1027


 Score =   192 bits (487),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 142/458 (31%), Positives = 221/458 (48%), Gaps = 47/458 (10%)
 Frame = +1

Query  2314  IAKAEQD-DGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLS  2490
             I K+EQ+  G + QI+ V  W   K++SL+LGTI+ KV +PTSD       IT       
Sbjct  1144  IGKSEQNLKGGIGQIITVCSWQCTKQISLILGTILDKVEMPTSDEDDEVCMITT------  1197

Query  2491  SDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWM  2670
                    +Q+E IG+ F  +LL+ +H GAI+KT  GF  LC  L+ S + +L  L  +W+
Sbjct  1198  -------KQIEEIGHQFFTILLQSRHKGAIEKTYLGFQVLCATLMKSTNTKLSSLPSTWI  1250

Query  2671  EQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPK--RLLPKALRWLINVAKKS  2844
               L ER   K Q++  + RRSAG+P AF      E     +   LL   +  L+ +A  S
Sbjct  1251  GFLFERV--KEQSLQ-ITRRSAGLPFAFIGILTGESTTNQRVNHLLNHVMDNLLKLASGS  1307

Query  2845  LTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLA  3024
               D+             I++T   D  +   ++       +P VH+ N+LK+ F    + 
Sbjct  1308  DFDE------------NINNTENQDDQS--NLNSIEKNIYLPQVHSINILKSIFRARAII  1353

Query  3025  TDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLE  3204
              +   + A  LI  I++FSS  W VRNSA +A++ LV R+IG   ++   +     T   
Sbjct  1354  QELDQYLAVTLICVIKAFSSKSWSVRNSATMAFSVLVDRIIGTKKLKADSTIINTTTFYH  1413

Query  3205  FFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITS  3384
             FF R P ++ FL    K + +   E S         K++  ++  +L+L SRL+PS I  
Sbjct  1414  FFSRMPIVYPFLLEYFKNSLQFIKETSP---LVEEGKIIQSTVYAILVLFSRLQPSNI-D  1469

Query  3385  ETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAID--  3558
                D   P  F+P I +C   +N  +R +++RAL  ++S  +L   I ++ ++L  I   
Sbjct  1470  HPNDLLAPAQFVPLISQCCQFSNYMVRQISARALVPLISTIELIPFIRDLINKLNEIKQQ  1529

Query  3559  ------NHSMTSDLSGLSNLNASFNSIHGMLLQLSSLL  3654
                              S LN  +N IHG+LLQ+  LL
Sbjct  1530  QQQQQQQQQQQQQQDNQSKLN--YNKIHGILLQIYHLL  1565



>ref|XP_009049392.1| hypothetical protein LOTGIDRAFT_112768, partial [Lottia gigantea]
 gb|ESO99953.1| hypothetical protein LOTGIDRAFT_112768, partial [Lottia gigantea]
Length=986

 Score =   201 bits (510),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 256/1073 (24%), Positives = 454/1073 (42%), Gaps = 176/1073 (16%)
 Frame = +1

Query  283   EVGTRVLKIVWNNLEDPLSQTVKQVHLIFDLFLDIQGTLHWAEGSE-KFCSFLRKIASDL  459
             E+   +L+ +WN+++D L    +   + FD  L     L  ++GS+ +   ++ K+  ++
Sbjct  68    ELVQNILEYIWNSVDDSLDAVRQNARIAFDQILKTHILL--SKGSDIETDPWISKLIKEV  125

Query  460   LHLGPRCK-GRYIPLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLE  636
             L + P CK G+Y PL+ L   LGA  ++   P +       Y+   +   A   L C+  
Sbjct  126   LDI-PWCKRGKYAPLSCLVGNLGASRLIQHCPNI-----TNYI---IHQLADHTLACYCS  176

Query  637   CLRDEYWSTDGVE---GGYIKYRAHCLLPILSGLSSGFAKLRSNLNTYALPVLLELDVDS  807
                ++ +++  +E       ++    + P++ GL       ++++  Y LP L+    D 
Sbjct  177   EFYEKLYTSHKLELSPEKSFEWFKIWVNPVIEGLCLNCKSTKNHILQYLLPKLMSFSNDI  236

Query  808   IFPMLGFIGIGCSAESTEIFYPELDSRDIVLGVEQRVAVLVSLLKVSRMLALIEGDIDWC  987
             +  M+ +                L +RD     +  +  L+  L+  R L L++      
Sbjct  237   LQYMIEY----------------LSNRDS--QSQGTLGALIMCLRRGRSLGLLD------  272

Query  988   EYSSVALEVTDLSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINP  1167
                       D  +D  +   VVH+         + L  AL  +D+ +R+DA   +  N 
Sbjct  273   ----------DQKSDEKMWCGVVHM---------DVLKYALCSLDEQIRLDAFSLMCENK  313

Query  1168  KTASLPSSLELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPS  1347
             KT+    SLE  L++  +P N+   + +F+    +  +KF +R+  +   +I+Q      
Sbjct  314   KTSKPIKSLEFELVKLFIPNNLNNQAPSFRQHMTAYSKKFCNRINDSQNSLIRQMEKSRK  373

Query  1348  LIKCLSGSPLNGEADQSLKHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIML  1527
             +           E  + L+       NF+KWL   LF   YP A +  +   ++L+  ++
Sbjct  374   V-----------EEKKQLQEELLKYKNFLKWLQSCLFQCLYPGAAFAMRTSCLKLLRTLM  422

Query  1528  NVWHMLPPQGKSDSYSSEISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILLHF-  1704
             +V  + PP       SSE + + ++         + L+  I D+++  +  + +I  ++ 
Sbjct  423   DV--LYPP-------SSEQTFHFFAD--FTSSHLVTLLECIADTFEDNKIEALKIFTNYV  471

Query  1705  PTPIPGISSPELVCEAIIWAKKLVCSPRVRESDAGALTFRL---------IFRKYVLELG  1857
                   +   + + E      KL  S R ++S A A   R          + + Y L+L 
Sbjct  472   KCSDSSVIDHQQLKELFDTCVKLSVSTRPQDSTASAYLARCLLQIDGIADVMKGYKLDLK  531

Query  1858  WVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKS  2037
              +   + N       G+ + E     P S  ++++  L+  L    E  +K L  A    
Sbjct  532   ILKNGTKN-------GIDSSE-----PHSNYLQFVLLLLLSLQDQTEFAKKGLVLAAANR  579

Query  2038  FVHGVLLTLRYTFEEMDWDSIAVAsnissiklllekilalVMRITSLALWVVSADAWYLP  2217
              ++  +  +RY   ++   S + +S+       L K+   V  I S  +           
Sbjct  580   PIYPTIHCIRYILGDIKLKSCSNSSSWKHCFKNLVKVCLEVAEIVSPVV----------Q  629

Query  2218  DEMEEMTVDGACFLERPIEMDVSASTPDDE---MKIAKAEQDDGPMDQIVMVGCWLAMKE  2388
             D   E  V         +  D  A T +D    ++  K+E+    M + ++V CW ++KE
Sbjct  630   DSSPEGNVPAEAIRGPGLNFDAIAQTDEDRDLMLEAEKSEKTVTLMPEYLVVCCWRSIKE  689

Query  2389  VSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKH  2568
             VSLLLG I  KV +         ++I +    LS D      Q++ +G++F+  LL+ KH
Sbjct  690   VSLLLGEICLKVSIE--------NEIHNEQGLLSFD------QIQDVGSYFITQLLQSKH  735

Query  2569  NGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVS-KGQTVDDLLRRSAGIP  2745
              GA +   AGF  L  RL  S   +L +L   W+++L+E      G T     RRSAGIP
Sbjct  736   RGAFELAYAGFVMLTERLWKSPLDKLNRLPLVWLDKLLEDIAQDDGTTGLCSTRRSAGIP  795

Query  2746  AAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVA  2925
                 A   +EPE    +   KA+  L+ ++    +                 +T  P   
Sbjct  796   FYVQALLGTEPEVNDHKSFQKAMTILLKLSMNESSPC---------------TTNNP---  837

Query  2926  AIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRN  3105
                           P VHA N+LK  F D  L    S + ++ LI +I  F S +W VRN
Sbjct  838   --------------PRVHALNILKVLFKDNKLGDFVSPYISDGLIAAILGFKSKFWSVRN  883

Query  3106  SACLAYTALVRRMIGFLNVQKRE---SARRALTGLEFFHRYPTLHTFLFNELKIATELFL  3276
             S+ L  ++L+ R+ G + V + +   S +  LTG  FF ++P L+ FL +E K AT    
Sbjct  884   SSTLLLSSLMTRIFG-VKVSRDDSDLSRKNCLTGRAFFQKFPKLYDFLLSEFKSAT----  938

Query  3277  EGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMPFIRK  3435
                 ENL+S     +HPSL P+L++L RL PS +   T    +   F+P + K
Sbjct  939   ----ENLSSVDGIHLHPSLYPVLMVLGRLYPSAMEG-TDTNLNLAAFVPLVIK  986



>ref|XP_005845847.1| hypothetical protein CHLNCDRAFT_136334 [Chlorella variabilis]
 gb|EFN53745.1| hypothetical protein CHLNCDRAFT_136334 [Chlorella variabilis]
Length=2539

 Score =   202 bits (515),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 173/607 (29%), Positives = 260/607 (43%), Gaps = 92/607 (15%)
 Frame = +1

Query  1957  YITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissikll  2136
             ++ S    L   VE  + D+  AC+     G LL LRY      W  +A     +     
Sbjct  1184  FLESACRLLQRRVELAQADMLGACRGGLAQGALLALRYAVPHFPWKRLAERQAAAEAGGE  1243

Query  2137  lekilal------VMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTP  2298
               +  A       V R+  L  + VS     +  + +   +D A      + +D  ++  
Sbjct  1244  DGQQPAARDWRGLVARLLDLT-YAVSDLTLPILSKPQNQNMDAADVDADDVALDEESAEL  1302

Query  2299  DDEMKIAKAEQDD--GPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITD  2472
             ++  +  +    D  GP  QI+  GCW + KE  LLLG ++R +P+              
Sbjct  1303  EESAEQQEGSSADALGPRAQIINTGCWQSSKECGLLLGNLVRALPI--------------  1348

Query  2473  GTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCK  2652
                      +LD  QL  + +HF  +L  +KH+GA+DKT+ GFTALC RLL   DP L  
Sbjct  1349  ----QGPAALLDACQLSRMASHFTHLLCALKHSGAVDKTQQGFTALCERLLQLEDPALRA  1404

Query  2653  LTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINV  2832
             L +  ++QL+      GQ   D++RRSAG+P    + F SEP  + K LL + +  L+  
Sbjct  1405  LPQRCLQQLLAFARRPGQGSGDIVRRSAGLPFGVVSIFYSEPNSSQKVLLHRGMAELLRT  1464

Query  2833  AKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFND  3012
             A                                    +       P VHA N L+ AF D
Sbjct  1465  AADE---------------------------------RQYAANAWPRVHALNCLRMAFQD  1491

Query  3013  ANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRE--SARR  3186
             A LA D S + A A+  ++   ++  WEVRN+A L YTAL+ R++GF N   +   +A+R
Sbjct  1492  AYLAVDVSAYLAPAMQTAVLGMAAPQWEVRNAASLCYTALLVRVLGFRNSAGKGTVAAKR  1551

Query  3187  ALTGLEFFHRYPTLHTFLFNELKIATELF-----------LEGSSENLTSNLAKVVHPSL  3333
             A T  +FF R+P LH FL  +L  ATE                   +  +     +HPSL
Sbjct  1552  APTAADFFARHPQLHPFLLRQLAAATEALDGGAAAAGSIGGASGPGSSGAGGVGGMHPSL  1611

Query  3334  CPMLILLSRLKPSPITSETGDP---------FDPFLFMPFIRKCSLQNNLRIRILASRAL  3486
              P+L+LLSRL+ S     +G             P  F P I++C+    L +R LA+ AL
Sbjct  1612  FPVLVLLSRLRASQHNRLSGSSGSSGLVEARLSPAAFAPLIQRCAGSGTLAVRRLAAAAL  1671

Query  3487  TGMVSNEKLP----------TVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLL  3636
               +V  E+ P             +  A+   A       +           FN++HG LL
Sbjct  1672  PPLVPPEQRPAAAAALGEAVARGVAAAAAAAAAAAGGAPASQPQPQQQRPPFNALHGQLL  1731

Query  3637  QLSSLLD  3657
             QL +LL+
Sbjct  1732  QLRALLE  1738


 Score = 79.7 bits (195),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 75/271 (28%), Positives = 128/271 (47%), Gaps = 24/271 (9%)
 Frame = +1

Query  1060  VKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRC  1239
             V+G+  +     LL A+   D+ LR+DA   +  +P+    PS LEL +  +A     RC
Sbjct  854   VEGLGAEAVRAALLAAVRSADECLRVDALTLVCSHPRATEPPSDLELEVAAEA---PCRC  910

Query  1240  CSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAEN  1419
              ST+ + K  +   K   R R A+  ++ +             +P   +A  +       
Sbjct  911   PSTSLKHKTLAQLGKLLMRQRGAVAAILARKP-----------APPGSDAAAAAARAVAA  959

Query  1420  LFNFMKWLSCFLFFSCYPSA---PYERKIMAMELMLIMLNVWH-MLPPQGKSDSYSSEIS  1587
                ++ WL   L  S YP A    ++R  MA+EL+  +L  +  +L P     ++    +
Sbjct  960   QQRWLHWLGGTLLDSLYPGACGATHQRSCMALELLAQLLGAFGDLLNPAVAPPAWCLLFA  1019

Query  1588  -LYP-----YSKGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCE  1749
              L P     +    +   +  LL+ + +DSW+RLRE++  +LL  P+P+PG ++P  +  
Sbjct  1020  TLRPAQFDAFGPRFLTQGTVQLLMAAALDSWERLREAAAAVLLRLPSPLPGFATPAALAP  1079

Query  1750  AIIWAKKLVCSPRVRESDAGALTFRLIFRKY  1842
              +  A +L+  PR RE+DAGA    L+ RKY
Sbjct  1080  LLRRALRLLACPRGREADAGAQLLLLLLRKY  1110



>ref|XP_008614831.1| hypothetical protein SDRG_10612 [Saprolegnia diclina VS20]
 gb|EQC31824.1| hypothetical protein SDRG_10612 [Saprolegnia diclina VS20]
Length=1851

 Score =   194 bits (493),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 248/1038 (24%), Positives = 409/1038 (39%), Gaps = 250/1038 (24%)
 Frame = +1

Query  508   LTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVE---G  678
             L  ++ AK +L    G L     A  + DV +AA      F++ + D   +T+      G
Sbjct  512   LLPKVTAKGLLASHQGFLASVLVAVANKDVSAAAACL---FVQVVDDLKCTTEDAAMWAG  568

Query  679   GYIKYRAHCLLPILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAEST  858
              ++ Y  H LL       S  A  R  + TY LP+L++ D  S+ P+L  +         
Sbjct  569   LWVPYLVHALL-------SNDAGSRLRVATYVLPILIKSDAASVPPLLAALRA-------  614

Query  859   EIFYPELDSRDIVLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAG  1038
                 P  D+R                  +  ML L++     C   SVA   T L+ D  
Sbjct  615   ---QPASDTR------------------LWSMLELVK-----CARKSVASPPT-LTLDE-  646

Query  1039  VCDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKA  1218
                  VHV               L H D  +R+ A + +  + KT +LPS  +L L++  
Sbjct  647   -----VHV--------------GLVHADGEIRMAAYDMVCASLKTTALPSPSDLQLVQLF  687

Query  1219  VPLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQS  1398
                + +  + + +MK     +    R+R  + +  ++                +      
Sbjct  688   FIASAKSIAPSLRMKSIIGLKAMLLRIRDGMRKSCRR----------------DAATTDD  731

Query  1399  LKHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSS  1578
             + H+      F +W++  +    YP A  +R  M +E++ + L ++   P          
Sbjct  732   VAHQ------FPRWVADLVVACVYPGATPQRVTMGLEILQLYLQIFDGTP----------  775

Query  1579  EISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAII  1758
                        + P  T  L  ++I SWD++R  ++ IL  FP+P+PG      +     
Sbjct  776   ----------FLFPAVTKALFNALISSWDKVRALAYSILETFPSPLPGYDDAVNLQSLYR  825

Query  1759  WAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTP  1938
             WA  L  SPR RE+DAGAL  RL+ ++  L + + +     +V     G S  + L    
Sbjct  826   WALTLASSPRQRETDAGALFLRLLAKQSALLVQFGIVPKSQIV-----GASVQQAL----  876

Query  1939  SSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMD-----WDSIA  2103
                 ++++ S++    A V     D+SE      +HG+LL++R+  ++       W +  
Sbjct  877   ----VDHLVSILASRLAVVR-ANADVSE---PPLIHGLLLSIRFLLDDAQVTLPTWQTTL  928

Query  2104  VAsnissiklllekilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDV  2283
              A+               +     LAL VV           +  +  GA  L+     DV
Sbjct  929   SATFEC------------LWESMQLALSVVG----------DATSGIGAASLDD--TFDV  964

Query  2284  SASTPDDEMKIAKAEQDDGPM-----------DQIVMVGCWLAMKEVSLLLGTIIR-KVP  2427
             +      E   AKA    G +           +Q  +VG WLA +E    + T++R  +P
Sbjct  965   ANEVLTSEQLRAKAVDSRGHVVLDEDDTDPDTEQRAVVGSWLAAREAGAAMDTLVRLALP  1024

Query  2428  LPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTA  2607
             L T         +TD  D L       L  L   G   L  L ++KH GA+      F  
Sbjct  1025  LAT---------VTD--DAL-------LTSLHKAGATLLNALFELKHGGAVATVSVAFEG  1066

Query  2608  LCNRLLCSNDPR--LCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPE  2781
             +C  LL  ++    L      W + L+ R     Q    +LRRSAG  ++F A   SEP 
Sbjct  1067  ICRSLLHHSERHRHLGTWPAKWCDTLLSRLEHAEQAF--ILRRSAGFASSFVALLRSEPR  1124

Query  2782  GAPKRLLPKALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEG  2961
              A   +LPK L  L+ +  ++                               I K+R   
Sbjct  1125  NAAATMLPKVLSVLLRLGGRA-----------------------------NAIDKSR---  1152

Query  2962  VVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRR  3141
                 VHA N+LK    DA LA D +      L ++I  F S+ W VRNS+ + + A  +R
Sbjct  1153  ----VHALNILKLLAQDAVLAEDMAAHVPSMLRLAIDGFESTSWAVRNSSMMLFAAATQR  1208

Query  3142  MIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVV  3321
              IG   V    +A   ++  + F R   + TFL + +         G+  N         
Sbjct  1209  AIGDKQVAD-GAAPNGVSSTDVFSRCTGVDTFLADHV---------GAMTN---------  1249

Query  3322  HPSLCPMLILLSRLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVS  3501
               +L P+L+L+SRL+P    + +  P     F+P +  C+ Q+++  R +A+ AL  +V 
Sbjct  1250  -SALYPLLLLMSRLRPGDGATTSVLPLST--FVPMVTACASQSHIFHRRIAAHALAAIVR  1306

Query  3502  NEKLPTVILNIASELPAI  3555
              + +  V   IAS LP++
Sbjct  1307  TQDIADV---IASLLPSL  1321



>gb|KDO22162.1| hypothetical protein SPRG_12660 [Saprolegnia parasitica CBS 223.65]
Length=1846

 Score =   191 bits (484),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 213/881 (24%), Positives = 359/881 (41%), Gaps = 178/881 (20%)
 Frame = +1

Query  1423  FNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYS  1602
               F +W++  +    YP A  +R  M +E++ + L ++   P                  
Sbjct  737   LQFPQWVADLVVACVYPGATPQRVTMGLEILQLYLQIFDGTP------------------  778

Query  1603  KGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCS  1782
                + P  T  L  ++I SWD++R  ++ IL  FP+P+PG      +     WA  L  S
Sbjct  779   --FLFPAVTKALFNALISSWDKVRALAYSILETFPSPLPGYDDAVNLQSLYRWALTLASS  836

Query  1783  PRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPVIEYI  1962
             PR RE+DAGAL  RL+ ++  L + + +  S  +V     G S  + +       V   +
Sbjct  837   PRQRETDAGALFLRLLAKQSALLVQFGIVPSSKIV-----GASAQQAM-------VDHLV  884

Query  1963  TSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissikllle  2142
              +L   L  AV     D+SE      +HG+LL++R+  ++           + + +  L 
Sbjct  885   GTLASRL--AVVRANADVSE---PPLIHGLLLSIRFLLDD-------ATVTLPTWQTTLA  932

Query  2143  kilalVMRITSLALWVVSADAWYLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAK  2322
                  +     LAL VV           +  +  GA  L+     DV+      E   AK
Sbjct  933   STFECLWESMQLALSVVG----------DATSGIGAASLDD--TFDVANEVLTSEQLRAK  980

Query  2323  AEQDDGPM-----------DQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQIT  2469
             A    G +           +Q  +VG WLA +E    + T++R + LP + V        
Sbjct  981   AVDSRGHVALDEDDTDPDTEQRAVVGSWLAAREAGAAMDTLVR-LALPLATV--------  1031

Query  2470  DGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPR--  2643
                D L       L  L   G   L  L ++KH GA+      F  +C  LL  ++    
Sbjct  1032  -ADDAL-------LTSLHKAGATLLNALFELKHGGAVATVSVAFEGICRSLLHHSERHRH  1083

Query  2644  LCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWL  2823
             L      W + L+ R     Q    +LRRSAG  ++F A   SEP  A   +LPK L  L
Sbjct  1084  LGTWPAKWCDTLLARLEHAEQQF--ILRRSAGFASSFVALLRSEPRNAAATMLPKVLGVL  1141

Query  2824  INVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAA  3003
             + +  +                             +  I K+R       VHA N+LK  
Sbjct  1142  LRLGSR-----------------------------VNAIDKSR-------VHALNILKLL  1165

Query  3004  FNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESAR  3183
               DA LA D +    + L ++I  F S+ W VRNS+ + + A  +R IG   V    +A 
Sbjct  1166  AQDAVLAEDMAAHVPDMLRLAIDGFESTSWAVRNSSMMLFAAATQRAIGDKQVAD-GAAT  1224

Query  3184  RALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRL  3363
               ++  + F R   + +FL   +   T                     +L P+L+L+SRL
Sbjct  1225  NGVSSTDVFSRCAGVDSFLAEHVGAMTP-------------------SALYPLLLLMSRL  1265

Query  3364  KPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASE  3543
             +P   ++ +  P     F+P +  C+ Q+++  R +A+ AL  +V  + +  V++++   
Sbjct  1266  RPGDGSTTSVLPLS--TFVPMVTACASQSHIFHRRIAAYALAAIVRTQDIADVVVSL---  1320

Query  3544  LPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNC----RNLADFSKKEDILSD  3711
             LP+         LS       S N++HG LLQL SL+D       + L   S    +L+ 
Sbjct  1321  LPS---------LSQWMPRRISHNAMHGTLLQLLSLVDRAADDTGKKLLSASAFASLLAP  1371

Query  3712  LIHVLGKHSWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKCISVIWNLLWTLSSEC  3891
             ++H     + + S     C     +FL+++  +L  A    +++    +W+        C
Sbjct  1372  IVHACT--ALLPSALALKCMTTKGTFLQLVSRVLQHASDATLTQS---MWD-------AC  1419

Query  3892  LDLYTSKRPAYFDPTIAELRKQAASSY---FNCAYQTSKDV  4005
             L LY  + P +  P + ++  QA +++   +  A+    DV
Sbjct  1420  LMLYKDEAPRHRSPGL-DIVHQAVAAFVVDYVVAHPVHADV  1459



>gb|KDR11632.1| Thyroid adenoma-associated protein-like protein [Zootermopsis 
nevadensis]
Length=1528

 Score =   188 bits (478),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 140/480 (29%), Positives = 239/480 (50%), Gaps = 54/480 (11%)
 Frame = +1

Query  2350  QIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEII  2529
             Q+V++  W  +KEVSLLLG +  + P+           I   +D+++   +L   Q+  I
Sbjct  586   QMVLLCAWRTVKEVSLLLGELSEQAPI----------LIAKDSDKVTEKGLLTEEQVLTI  635

Query  2530  GNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQ-  2706
             G+H + +L++ KH GA ++   GF  LC RL      RL  L   W+E++M  T+S G+ 
Sbjct  636   GSHLVTLLVETKHRGAFEQAYVGFCKLCGRLWRHPSSRLHHLPRQWLEEVM-YTISWGKG  694

Query  2707  TVDDLLRRSAGIPAAFTAFFLSEPE-GAPKRLLPKALRWLINVAKKSLTDknkensscse  2883
             T     RRSAG+P    A   +EP+ G  +R   +++  L+ +A  S       ++S   
Sbjct  695   TKLCATRRSAGLPFMVQALLTTEPQIGGSRRCFQQSMAALLTLADNSDNRVGTRHTSIVN  754

Query  2884  sssAIDSTMVPDVAAI-------------EMISKTRDEGVVPTVHAFNVLKAAFNDANLA  3024
             + +A +  +  + A++              ++S      V   +HA N+L+A F  + L 
Sbjct  755   NETAAEDYVDDNAASVTSSSATEFNIFNLSVVSSDCVSNVEARIHALNILRALFRHSLLG  814

Query  3025  TDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLE  3204
                + + A+ +IV+I+ F    W  RNSA L ++ALV R+ G    ++  S R  +TG  
Sbjct  815   ESVTPYVAQGVIVAIQGFKGKTWAERNSATLLFSALVTRIFGVHRSREELSMRNRMTGRI  874

Query  3205  FFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITS  3384
             FF RYP+L+ FL  ELK A       S E   ++L     P+L P+L+LLSRL PS +  
Sbjct  875   FFLRYPSLYDFLLKELKEAV-----ASMEACHNSL----QPALFPVLLLLSRLYPSSLEG  925

Query  3385  ETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNH  3564
              T        + PF+ +CSL + L+ R+LA++AL  +V+  +L  ++     +L AI + 
Sbjct  926   -TDSNLQLSAYAPFVHRCSLSSVLKTRMLAAKALVPLVAPHQLVVLL----QKLVAISSQ  980

Query  3565  SMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWI  3744
               T++           N  HG+LLQ+  +L+    +L+  S  +++  ++   +    W+
Sbjct  981   KCTTE-----------NYRHGLLLQIFHILE---ESLSALSVSKEVAGEVEEWIASLKWL  1026



>ref|XP_010903174.1| PREDICTED: thyroid adenoma-associated protein homolog isoform 
X2 [Esox lucius]
Length=1414

 Score =   187 bits (476),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 270/1185 (23%), Positives = 484/1185 (41%), Gaps = 186/1185 (16%)
 Frame = +1

Query  205   ICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVHLIF-DLFL  381
             + L  +++      G + +     SE  G R+L+ V+ + E PL     Q + +F +L L
Sbjct  376   VALDSMQSGQSSAPGLLRDSLRGGSELQG-RLLEHVYTHWEHPLDGVRHQTNTLFKNLLL  434

Query  382   DIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSILDMSP---  552
               Q T   A  +     ++ ++   LL L    +G+Y  LA L + LGA  +L + P   
Sbjct  435   LHQHTHPLALSNPHSDPYVSQLTQTLLGLEWHQRGKYGSLACLVELLGAGYLLALEPQLP  494

Query  553   ----GLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
                 GL+ D T A    D            LE L   + +    EG   ++    + P+L
Sbjct  495   SHLLGLMGDQTLAPYASD-----------LLERLFVSHKAQLAGEGDMERWHGTWVSPLL  543

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFI--GIGCSAESTEIFYPELDSRDI  894
               L        + +  Y LP LL     S+  M+  +     CSA               
Sbjct  544   QVLCRARLDQTTYILDYFLPKLLRCSPSSLAHMVQALQNSPSCSA---------------  588

Query  895   VLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIE  1074
               G    V  L++ L+ +R   +++                  S++ G+   +V      
Sbjct  589   --GSRGSVGALMTCLRAARAQGMVQ------------------SSEEGLWGGLV------  622

Query  1075  VKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAF  1254
                P++ L  AL H    +R+DA   +  + ++  + +S E+ L+   +P  +   S   
Sbjct  623   ---PLSLLRQALVHKHHQVRMDALGLVCESHRSTEVLTSQEIELLCHFLPSCLNSQSPGV  679

Query  1255  QMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFN--  1428
             + +  SL +K   RV+ + + V ++               L  E D   + + +++ +  
Sbjct  680   RQQTISLLKKLLCRVKDSGQLVQRR---------------LAQERDVGQREKDQHVLDTY  724

Query  1429  --FMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYS  1602
               F++WL   LF    P A +   + A+ ++ ++  ++      G  D ++    + P  
Sbjct  725   KEFLRWLCERLFVVLLPGASFSTCLTALRMLALLAQLFTF--TTGPEDMFALGEVVTP--  780

Query  1603  KGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCS  1782
                +  ++ L  +GS   ++  +++ +  +L   P    G+  P+ +   +  A  L  S
Sbjct  781   ---VHAQNVLFCLGS---NFLEVKQLASALLRQLPPSAVGLQEPDRMLCLLQAAMDLSTS  834

Query  1783  PRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLE-FTPSSPVIEY  1959
              +  +S   A  F L+     L    ++      ++  P  L+  +  E  T  +  +  
Sbjct  835   TKPFDSVTAAHLFNLLLHLPDLPQALLLCAQEQGLSFQPPSLTQPQASEALTLETNTLAV  894

Query  1960  ITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMD---------WDSIAVAs  2112
             I  L+  L   V + E  L  A   S ++G    +    ++++         W S+    
Sbjct  895   IQFLLLCLKTEVRKAESSLLLAAATSPLYGRAHCITAALQQLNTRCLTLCGQWRSVVSEL  954

Query  2113  nissiklllekilalVMRITS--LALWVVSADAWYLPDEMEEMT-VDGACFLERPIEMDV  2283
                S ++       +        + +   +  +  L   ++E+   D   F     E+D 
Sbjct  955   ITVSYRMSDVVSPVVQSSSPEGLIPMDTETESSAGLKSILQEIQPRDTNDFFTSARELDT  1014

Query  2284  S-------ASTPDDEMKIAKAEQDDG--PMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPT  2436
                     A+  D+ +  +     +G     Q+V+V CW  MKEVS+LLG + + +PL T
Sbjct  1015  QESGTNEPAAKTDETLHPSTGGGGEGYRVTAQMVLVCCWRTMKEVSMLLGEVCQSLPLQT  1074

Query  2437  SDVPKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCN  2616
             +  P   + IT+              Q+E +G +F + LL+ +H GA +    GF  L N
Sbjct  1075  THTPPDQALITE-------------EQVEGVGRYFRQQLLQSRHRGAFELAYIGFVRL-N  1120

Query  2617  RLLCSNDPR-LCKLTESWMEQLMERTVSKGQTVD-DLLRRSAGIPAAFTAFFLSEPEGAP  2790
              +LC +  R L +L   W+ ++++   S   +      RRSAGIP    A   SEP+ + 
Sbjct  1121  DMLCRSGSRTLQQLPAHWLTEVLQEVKSSDPSSKLCATRRSAGIPFYIQALLSSEPKSSS  1180

Query  2791  KRLLPKALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVP  2970
               LL   +R L  +A                          PD A         DE  VP
Sbjct  1181  CSLLKTTMRELTTLAMPP-----------------------PDRAT--------DETTVP  1209

Query  2971  TVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIG  3150
              VHA N+L+A + D  L  +   F +E +  ++  F+S  W VRNS+ L ++ L+ R+ G
Sbjct  1210  QVHALNILRALYRDTRLGENIVPFVSEGMQAAVLGFTSPVWAVRNSSTLLFSTLITRIFG  1269

Query  3151  FLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVV-HP  3327
                 +   S +  +TG EFF R+P L+ FL ++        LE ++ ++ S+  +V+ HP
Sbjct  1270  VKKGKDEHSKKNRMTGREFFTRFPALYPFLLSQ--------LEEAASSVGSDSGRVILHP  1321

Query  3328  SLCPMLILLSRLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNE  3507
             SL  +L++L RL PSP+   +  P     F+PFI +C      R R +A+RAL   V   
Sbjct  1322  SLFLLLLVLGRLFPSPMDGSS-SPLGLAPFLPFIIRCGHSAVYRTREMAARALVPFVMVT  1380

Query  3508  KLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQL  3642
             ++P+ I  +  +LP ++    T             N IHG LLQ+
Sbjct  1381  QVPSTIQALLDDLP-LEPAPRTQQ-----------NRIHGTLLQV  1413



>ref|XP_006638855.1| PREDICTED: thyroid adenoma-associated protein homolog [Lepisosteus 
oculatus]
Length=1913

 Score =   188 bits (477),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 259/1133 (23%), Positives = 463/1133 (41%), Gaps = 152/1133 (13%)
 Frame = +1

Query  481   KGRYIPLASLTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWS  660
             KG+Y  L+ L   LGA+S+L + P L         D  +   A++ L+      + +  S
Sbjct  456   KGKYGSLSCLVDYLGAESLLALDPQLPAQLLSLMGDQSLAPYASSLLETLFVNHKAQLAS  515

Query  661   TDGVEGGYIK-YRAHCLLPILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGI  837
                    +++ +    + P+L+ L  G     + +  Y LP +L     S+  M+  +  
Sbjct  516   CHERGDSWMEMWHQTWVTPLLAALCEGQLDQTTYILDYCLPKILRCSPGSVEHMVRALQ-  574

Query  838   GCSAESTEIFYPELDSRDIVLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVT  1017
               S++ +    P  D R  +         LV+ L+ +R   ++                 
Sbjct  575   --SSQHSPAGSP--DCRGAL-------GALVTCLRAARAQGVVS----------------  607

Query  1018  DLSTDAGVCDSVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLE  1197
               S+  G+   +V         P+  L  AL H  D +R+DA   +  + ++    S  E
Sbjct  608   --SSQEGLWGGLV---------PLKLLSQALVHKHDQVRLDALGLICESHRSTENLSPEE  656

Query  1198  LSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTA---LERVIKQGTWHPSLIKCLSG  1368
             + L+R  +P ++   S   + +  SL +K   R+R +   L+R ++Q             
Sbjct  657   MDLIRFFLPSSLNSQSPGVRQQTLSLLKKLLCRMRDSAQLLQRRLEQD------------  704

Query  1369  SPLNGEADQSLKHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLP  1548
              P     +   +   +    F+ WL   LF + +P A +     A+ L+ ++ +++    
Sbjct  705   RPEEQGQEHGNRTTLQTYEEFLHWLCEALFQALFPGASFPTCFTALHLLGLIADLFSF--  762

Query  1549  PQGKSDSYSSEISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGIS  1728
                 +DS     SL      ++ P     ++  +  S+  +++ +F++L   P P  G+ 
Sbjct  763   --STADSGPCLFSL----GQMVTPSQAQAVLYCLASSFLEVKQLAFQLLRRLPPPALGLQ  816

Query  1729  SPELVCEAIIWAKKLVCSPRVRES-DAGALTFRLIFRKYVLE-LGWVVRVSCNVVTQSPS  1902
              P  +   +  A  L  S +  +S  A  L   L++ + ++E L    +  C +  Q P+
Sbjct  817   EPGRLSSLLRVALDLSTSTKPFDSVTASHLLNLLVYEEGLVEALSHRAQEQC-ISFQPPT  875

Query  1903  GLSNGENLEFTPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEE  2082
                +  +  F      +  +  L+  L A V + E  L +A     ++G    +    ++
Sbjct  876   PGESPASKAFKLERNTLAVVLFLLACLKAEVAQAETSLLQAAASYPLYGRAHCITVALQQ  935

Query  2083  MDWDSI--------AVAsnissiklllekilalVMRITSLALWVVSADAWY---LPDEME  2229
             +D  S+         VA  I     + + +  +V   +   L  +  D+     L   ++
Sbjct  936   LDSQSLLLVAEWRPVVAELIEMSYRMSDVVSPVVQSSSPEGLIPMDTDSESSACLQQILQ  995

Query  2230  EMT-VDGACFLERPIEMDVS------ASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKE  2388
             E+   D   F   P ++  S       S        A  E+      Q+V+V CW  MKE
Sbjct  996   EIQPRDTNDFFTSPRQLGNSEPEQGGGSLEQAHAAGATGEEQYRVTAQMVLVCCWRTMKE  1055

Query  2389  VSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKH  2568
             VS+LLG + + +PL T   P+              + ++  +Q+E +G +F + LL+ +H
Sbjct  1056  VSMLLGMLCQNLPLQTEAPPR--------------EGLITEQQVEGVGRYFRQQLLQSRH  1101

Query  2569  NGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQTVD-DLLRRSAGIP  2745
              GA +    GF  L + L  S    L +L   W+ +++E   S G T      RRSAGIP
Sbjct  1102  RGAFELAYVGFVKLTDMLARSPGRALQQLPGRWLSEVLEEVRSSGPTSKLCATRRSAGIP  1161

Query  2746  AAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVA  2925
                 A   SEP+ +   LL   ++ L  +                               
Sbjct  1162  FYIQALLSSEPKSSSCSLLRMTMKELTAL-------------------------------  1190

Query  2926  AIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRN  3105
             A+ M     D   VP VH+ N+L+A F D  L+ +   + AE +  +I  F+S  W VRN
Sbjct  1191  ALSMQDNPTDGSSVPQVHSLNILRALFRDTRLSENIVPYVAEGVQAAILGFTSPVWAVRN  1250

Query  3106  SACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGS  3285
             S+ L ++ L+ R+ G    +   S +  +TG EFF R+P L+ FL  +L+         S
Sbjct  1251  SSTLLFSTLITRIFGVKKGKDENSRKNRMTGREFFTRFPALYPFLLRQLEAV------AS  1304

Query  3286  SENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIR  3465
             + +  S + K+   +L  +L+LL +L PSP+   +  P     F+PFI +C      R R
Sbjct  1305  TVDSDSGVLKLHP-NLFLLLLLLGKLYPSPMDGFS-SPLGLAPFVPFIARCGRSPVYRSR  1362

Query  3466  ILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLS  3645
              +A+RAL   V   ++P++I  +  +LP     +               N IHG LLQ+ 
Sbjct  1363  EMAARALVPFVLVTQVPSMIQTLLQDLPECPRSATRQ------------NHIHGTLLQVL  1410

Query  3646  SLLDTNCRNLAD-FSKKEDILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVL  3801
              LL +   +     S +     D+I  +    W+   Q  PC +   +FL VL
Sbjct  1411  HLLRSYQEDRHRPHSLRLPQTHDIIAAVRARLWLARRQN-PCVVTRAAFLDVL  1462



>ref|XP_010903173.1| PREDICTED: thyroid adenoma-associated protein homolog isoform 
X1 [Esox lucius]
Length=1424

 Score =   187 bits (475),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 270/1187 (23%), Positives = 485/1187 (41%), Gaps = 186/1187 (16%)
 Frame = +1

Query  205   ICLQQIKTSMQGTDGYIEEGYDPISEEVGTRVLKIVWNNLEDPLSQTVKQVHLIF-DLFL  381
             + L  +++      G + +     SE  G R+L+ V+ + E PL     Q + +F +L L
Sbjct  376   VALDSMQSGQSSAPGLLRDSLRGGSELQG-RLLEHVYTHWEHPLDGVRHQTNTLFKNLLL  434

Query  382   DIQGTLHWAEGSEKFCSFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSILDMSP---  552
               Q T   A  +     ++ ++   LL L    +G+Y  LA L + LGA  +L + P   
Sbjct  435   LHQHTHPLALSNPHSDPYVSQLTQTLLGLEWHQRGKYGSLACLVELLGAGYLLALEPQLP  494

Query  553   ----GLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYIKYRAHCLLPIL  720
                 GL+ D T A    D            LE L   + +    EG   ++    + P+L
Sbjct  495   SHLLGLMGDQTLAPYASD-----------LLERLFVSHKAQLAGEGDMERWHGTWVSPLL  543

Query  721   SGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFI--GIGCSAESTEIFYPELDSRDI  894
               L        + +  Y LP LL     S+  M+  +     CSA               
Sbjct  544   QVLCRARLDQTTYILDYFLPKLLRCSPSSLAHMVQALQNSPSCSA---------------  588

Query  895   VLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIE  1074
               G    V  L++ L+ +R   +++                  S++ G+   +V      
Sbjct  589   --GSRGSVGALMTCLRAARAQGMVQ------------------SSEEGLWGGLV------  622

Query  1075  VKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAF  1254
                P++ L  AL H    +R+DA   +  + ++  + +S E+ L+   +P  +   S   
Sbjct  623   ---PLSLLRQALVHKHHQVRMDALGLVCESHRSTEVLTSQEIELLCHFLPSCLNSQSPGV  679

Query  1255  QMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFN--  1428
             + +  SL +K   RV+ + + V ++               L  E D   + + +++ +  
Sbjct  680   RQQTISLLKKLLCRVKDSGQLVQRR---------------LAQERDVGQREKDQHVLDTY  724

Query  1429  --FMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYS  1602
               F++WL   LF    P A +   + A+ ++ ++  ++      G  D ++    + P  
Sbjct  725   KEFLRWLCERLFVVLLPGASFSTCLTALRMLALLAQLFTFT--TGPEDMFALGEVVTP--  780

Query  1603  KGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCS  1782
                +  ++ L  +GS   ++  +++ +  +L   P    G+  P+ +   +  A  L  S
Sbjct  781   ---VHAQNVLFCLGS---NFLEVKQLASALLRQLPPSAVGLQEPDRMLCLLQAAMDLSTS  834

Query  1783  PRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLE-FTPSSPVIEY  1959
              +  +S   A  F L+     L    ++      ++  P  L+  +  E  T  +  +  
Sbjct  835   TKPFDSVTAAHLFNLLLHLPDLPQALLLCAQEQGLSFQPPSLTQPQASEALTLETNTLAV  894

Query  1960  ITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMD---------WDSIAVAs  2112
             I  L+  L   V + E  L  A   S ++G    +    ++++         W S+    
Sbjct  895   IQFLLLCLKTEVRKAESSLLLAAATSPLYGRAHCITAALQQLNTRCLTLCGQWRSVVSEL  954

Query  2113  nissiklllekilalVMRITS--LALWVVSADAWYLPDEMEEMT-VDGACFLERPIEMDV  2283
                S ++       +        + +   +  +  L   ++E+   D   F     E+D 
Sbjct  955   ITVSYRMSDVVSPVVQSSSPEGLIPMDTETESSAGLKSILQEIQPRDTNDFFTSARELDT  1014

Query  2284  S-------ASTPDDEMKIAKAEQDDG--PMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPT  2436
                     A+  D+ +  +     +G     Q+V+V CW  MKEVS+LLG + + +PL T
Sbjct  1015  QESGTNEPAAKTDETLHPSTGGGGEGYRVTAQMVLVCCWRTMKEVSMLLGEVCQSLPLQT  1074

Query  2437  SDVPKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCN  2616
             +  P   + IT+              Q+E +G +F + LL+ +H GA +    GF  L N
Sbjct  1075  THTPPDQALITE-------------EQVEGVGRYFRQQLLQSRHRGAFELAYIGFVRL-N  1120

Query  2617  RLLCSNDPR-LCKLTESWMEQLMERTVSKGQTVD-DLLRRSAGIPAAFTAFFLSEPEGAP  2790
              +LC +  R L +L   W+ ++++   S   +      RRSAGIP    A   SEP+ + 
Sbjct  1121  DMLCRSGSRTLQQLPAHWLTEVLQEVKSSDPSSKLCATRRSAGIPFYIQALLSSEPKSSS  1180

Query  2791  KRLLPKALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVP  2970
               LL   +R L  +A                          PD A         DE  VP
Sbjct  1181  CSLLKTTMRELTTLAMPP-----------------------PDRAT--------DETTVP  1209

Query  2971  TVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIG  3150
              VHA N+L+A + D  L  +   F +E +  ++  F+S  W VRNS+ L ++ L+ R+ G
Sbjct  1210  QVHALNILRALYRDTRLGENIVPFVSEGMQAAVLGFTSPVWAVRNSSTLLFSTLITRIFG  1269

Query  3151  FLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVV-HP  3327
                 +   S +  +TG EFF R+P L+ FL ++        LE ++ ++ S+  +V+ HP
Sbjct  1270  VKKGKDEHSKKNRMTGREFFTRFPALYPFLLSQ--------LEEAASSVGSDSGRVILHP  1321

Query  3328  SLCPMLILLSRLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNE  3507
             SL  +L++L RL PSP+   +  P     F+PFI +C      R R +A+RAL   V   
Sbjct  1322  SLFLLLLVLGRLFPSPMDGSS-SPLGLAPFLPFIIRCGHSAVYRTREMAARALVPFVMVT  1380

Query  3508  KLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSS  3648
             ++P+ I  +  +LP ++    T             N IHG LLQ+ +
Sbjct  1381  QVPSTIQALLDDLP-LEPAPRTQQ-----------NRIHGTLLQVKN  1415



>ref|XP_010497607.1| PREDICTED: thyroid adenoma-associated protein homolog, partial 
[Camelina sativa]
Length=114

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 96/117 (82%), Gaps = 4/117 (3%)
 Frame = +1

Query  3142  MIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELF-LEGSSENLTSNLAKV  3318
             MIGFLNVQKR S RRALTGLEFFHRYP LH F+++ELK AT+L    G S+   SNLA +
Sbjct  1     MIGFLNVQKRGSTRRALTGLEFFHRYPLLHPFIYSELKTATDLLDTSGPSD---SNLANL  57

Query  3319  VHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALT  3489
             VHPSL P+LILLSRLKPSPI SETGD  DPF+FMPFI KCS Q+NLR+R+LASRAL 
Sbjct  58    VHPSLWPILILLSRLKPSPIASETGDDLDPFVFMPFIMKCSTQSNLRVRVLASRALV  114



>gb|EJY71466.1| DUF2428 domain containing protein [Oxytricha trifallax]
Length=1649

 Score =   187 bits (475),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 190/789 (24%), Positives = 340/789 (43%), Gaps = 131/789 (17%)
 Frame = +1

Query  1072  EVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTA  1251
             + K P  YLL  +   +    +D  E + +  K  SL S  E  +  + +   +R     
Sbjct  318   DFKFPQEYLLKLVMSENFKTCLDTIEIVAMEVKATSLVSQFEFQMADRFIKHCLRTTFPE  377

Query  1252  FQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNF  1431
             F+ K+    + F  R+RT+ E+ IK+               ++ E  Q +    E + +F
Sbjct  378   FRQKYIKAIKTFIIRLRTSTEKDIKKY--------------VSSEEGQPIPQSVEQVISF  423

Query  1432  MKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYP----Y  1599
             ++    F+  + Y   P E  +   E+M I++ ++      G  +      S+YP     
Sbjct  424   LRDTISFIQENLYLDKPVEGALPLFEIMRIIIELF------GDFEYKLRITSIYPPCHLL  477

Query  1600  SKGLILPESTLL--LVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAII-WAKK  1770
             SK  +L   + +  L+ S+  +W  +R  SF IL  +P   P   + + V E I+  A +
Sbjct  478   SKAGLLDSHSFVVFLLNSLKSTWTMVRIYSFDILCRYPDNYPLFHNNQFVNEVILSTALE  537

Query  1771  LVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSSPV  1950
             L  +P+   ++A A+ F+L+F+K +  L ++  +               E  E       
Sbjct  538   LANNPKAMLAEASAMFFKLLFKKCLKHLNFIQFIE--------------ETSEQEMQLQF  583

Query  1951  IEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDWDSIAVAsnissik  2130
             + Y+  LI     A +     + E  K++ +HG+L   ++ FE+    +    ++     
Sbjct  584   VNYVLGLIKHRVKAFQVTL--IKEGKKEALLHGLLSFFKHLFEDFKLPATLTQADQPQHF  641

Query  2131  ll----lekilalVMRITSLALWVVS-----ADAWYLPDEMEEMTVDGACFLERPIEMDV  2283
                    + +L   ++I+ +   ++S     +DA  +   + E+ VD       PI+MD 
Sbjct  642   NAWRAFFKDLLQTCLQISQVCKGLISNNGLMSDAEGIEGGVGEIKVDCRG---HPIKMDG  698

Query  2284  SASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQ  2463
                  ++E             D +++VG WLA+KE  L L  +++ +  PTS        
Sbjct  699   MGEGVENE-----------DYDNLILVGVWLAVKEDGLTLFNLLKWLDFPTS--------  739

Query  2464  ITDGTDQLSSDIV-LDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDP  2640
                  D  S  IV  D+ QL    ++FL++L   KH GAI+K    F+    +LL S D 
Sbjct  740   ----RDDDSKFIVDSDIHQL---CDNFLDMLFNFKHRGAIEKAAETFSLFSQKLLQSPDA  792

Query  2641  RLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRW  2820
                 L +  ++Q +E+  +  + +  +LRRSAGIP    A   +EP  +   LL K+L +
Sbjct  793   YYKSLPDRMLDQALEKITT--ENLSTILRRSAGIPPTIIAILRAEPISSEPLLLNKSLEF  850

Query  2821  LINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKA  3000
             L+ +A                                     ++ E     +HA N+++ 
Sbjct  851   LLKLA------------------------------------TSQSEKEDSKIHALNIMRF  874

Query  3001  AFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESA  3180
              F DA L  D   +   A+I++  SFSS+ W +RNSA +A+TAL +R++  L+VQ ++ +
Sbjct  875   IFQDAFLRHDVQKYITPAMILATESFSSNSWSIRNSALMAFTALTKRILNNLHVQDQDLS  934

Query  3181  R-RALTGLEFFHRYPTLHTFLFNELKIATELFLEG----SSENLTSNLAKVVHPSLCPML  3345
             R R L+  +F  +Y  L  +  N+L+   E    G      E    +L       +  +L
Sbjct  935   RTRGLSVFDFLSKYEKLSNYFLNKLRDGLEYSHGGIKVKKEEKDKQDLV------IFSIL  988

Query  3346  ILLSRLKPS  3372
             +L+SRL PS
Sbjct  989   LLISRLIPS  997



>ref|XP_008868929.1| hypothetical protein H310_05867 [Aphanomyces invadans]
 gb|ETW02324.1| hypothetical protein H310_05867 [Aphanomyces invadans]
Length=1882

 Score =   185 bits (470),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 216/886 (24%), Positives = 347/886 (39%), Gaps = 223/886 (25%)
 Frame = +1

Query  1102  LALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQMKWASLFR  1281
             L LTH    +R+ A + L  N KT SLPS  ++  ++  +  + +  + + +MK     +
Sbjct  674   LGLTHASGDIRMSAYDMLCTNLKTTSLPSESDIGFIQTFLLSSSKSIAASLRMKLIIGLK  733

Query  1282  KFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKWLSCFLFF  1461
                 R+R    +  ++           S SP+                 F  WL  F+  
Sbjct  734   AILLRIREGGRKTCRRDG------AATSDSPV---------------LRFTSWLEEFVVS  772

Query  1462  SCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPYSKGLILPESTLLLV  1641
                PSA  +R  M +E++ +   +            +    +L+        P  T  L+
Sbjct  773   CITPSATPQRLTMGLEILQLYTQI------------FDKPATLHS-------PAITNALL  813

Query  1642  GSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAII-WAKKLVCSPRVRESDAGALT  1818
              ++I  WDR+R  SF IL  FP+P+PG        +A+  WA  L CSPR RESDAGA  
Sbjct  814   NAMISCWDRVRILSFSILETFPSPLPGYDDG---LDALFDWAVTLCCSPRQRESDAGAYF  870

Query  1819  FRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPS--------SPVIEYITSLI  1974
              RL+++++                         ++L F P+          +I  +++ +
Sbjct  871   MRLLYKQH-------------------------DHLTFLPAPRTQQSCVGHIISLLSTRL  905

Query  1975  DWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEE---MD--WDSIAVAsnissiklll  2139
             D L A    GE  L        +HG+LL  RY  E+   MD  W +  VA          
Sbjct  906   DKLEAGNVPGEPPL--------IHGLLLATRYMLEDTPSMDHTWHATVVALFSV------  951

Query  2140  ekilalVMRITSLALWVVSADAWYLPDEMEEMT--VDGACFLERPIEMDVSASTPDDEMK  2313
                   + R    AL VV      +  +  + T  V G      P+   V        + 
Sbjct  952   ------LWRALDTALVVVGDATSGVGTQALDATYAVVGEVSAIPPLRAKVDCR---GHLI  1002

Query  2314  IAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTS--DVPKSCSQITDGTDQL  2487
             +   +  DG  +Q  +VG WLA +E + +L T+++      S  D P + + +     Q 
Sbjct  1003  LDDPDMADGDAEQRAVVGSWLAARETAAVLATLVKAALTTPSLLDTPTTAASV-----QR  1057

Query  2488  SSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLC--------SNDPR  2643
             + D++L+              L ++KH GA+      +  +C  LL         S+  R
Sbjct  1058  AGDVLLN-------------ALFELKHGGAVATVAVAYEDICKALLTHTASASLSSDSVR  1104

Query  2644  --LCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALR  2817
               L +    W + L+ R     Q    +LRRSAG  ++F A   +EP  A   LLP  L 
Sbjct  1105  RTLAQCPAKWCDVLLHRLEHAEQQF--ILRRSAGFASSFVAILRAEPRNAAATLLPNVLY  1162

Query  2818  WLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLK  2997
              L+ +A+ + T                             + + R       VHA N+LK
Sbjct  1163  TLLRLARNANT-----------------------------VERAR-------VHALNILK  1186

Query  2998  AAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRES  3177
                 DA LA D + F  + L V++  F+S+ W VRNS+ + + A  +R IG   V    +
Sbjct  1187  LLGQDAILAEDMAVFVPQLLTVAVHGFASTSWAVRNSSMMLFAAATQRAIGDKQVADGAA  1246

Query  3178  ARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLS  3357
             A   ++  + F R   L TFL   LK                  A+V      P+L+ LS
Sbjct  1247  A-VGVSAQDVFTRCKGLDTFLLQHLK------------------AQVY-----PLLLFLS  1282

Query  3358  RLKPSPI-----TSETGD--PFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLP  3516
             RL+P  +      S   D  P D   F+P +  C+ +++    I   R     ++    P
Sbjct  1283  RLRPDDVADQHEASTMSDILPLDT--FVPLVMACAEESH----IFHRRMAAHALAAIVAP  1336

Query  3517  TVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLL  3654
               I  +A+ L           +  L N   S N +HG +LQL +L+
Sbjct  1337  ASIPAVAATL-----------VEALQNPRCSNNKLHGSMLQLHALV  1371



>ref|XP_003080090.1| putative death receptor interacting protein (ISS) [Ostreococcus 
tauri]
Length=1357

 Score =   184 bits (468),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 162/600 (27%), Positives = 259/600 (43%), Gaps = 151/600 (25%)
 Frame = +1

Query  2224  MEEMTVDGACFLERPIEMDVSAS----TPDDEMKIAKAEQ---DDGPMDQIVMVGCWLAM  2382
             ME  T     F+ +P  +  +A       DD+  I    +   D  P  QI+   CWL +
Sbjct  366   MERATHMALDFISQPDALGATAEEVILQSDDQSNINDDMEELLDLAPKAQIITTACWLTV  425

Query  2383  KEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKM  2562
             KE+SLL G ++                  D  D  S D+V      + +G   + VL  +
Sbjct  426   KEISLLTGEVM---------------SAPDTADLFSFDVV------KAVGERLISVLFTV  464

Query  2563  KHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGI  2742
             KH G + +TR G TALC  L+ ++   L  L E+W+  L ++     Q + D +RRSAG+
Sbjct  465   KHTGVLARTRIGLTALCACLMRNSSNALKALPETWLNGLFDQLNRPEQGIRDRVRRSAGL  524

Query  2743  PAAFTAFFLSEPEGAPKRLLPKALRWLINVA--KKSLTDknkensscsesssAIDSTMVP  2916
             P AF A  L+EP+G P+  L  AL  L+++A  + S +D                     
Sbjct  525   PYAFMAILLAEPKGQPRVALESALPKLLDIACGETSTSD---------------------  563

Query  2917  DVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWE  3096
                             +P VHAFNV++  F D +L+ DT+  ++  + V I +FSS  WE
Sbjct  564   ----------------IPRVHAFNVVRVIFADKDLSVDTTTHASRGVQVCIDAFSSQTWE  607

Query  3097  V----------------------------------------RNSACLAYTALVRRMIGFL  3156
             V                                        +N+A LAY++L+ ++ G++
Sbjct  608   VTPRWGAWLVPQQHQKRLGDRCSCLPASIRSLGLDTRWRSIKNAATLAYSSLLTKVCGYI  667

Query  3157  NVQKRE-----SARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVV  3321
             N   R+       R  +   +F  RYPTL   L  EL++AT          L    A  V
Sbjct  668   NTVTRQRMFTSDGRHEVKLADFARRYPTLMGHLLRELEVAT--------ATLHLPTAVDV  719

Query  3322  HPSLCPMLILLSRLKPS--PITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGM  3495
             HPSL P+L L SRL+PS       +GD      F+  IR+C     L +R +A+RAL  +
Sbjct  720   HPSLYPILALFSRLRPSLERDLHSSGDK-----FIATIRRCVSGKYLAVRTMAARALVPL  774

Query  3496  VSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNL  3675
             +S+ +L   I +I               L   S +    N++HG LL +  +++     +
Sbjct  775   LSSTRLCEYIEDI---------------LELRSLVAPGLNAVHGALLCVLEIIN----EV  815

Query  3676  ADFSKKEDIL-SDLIHVLGKH--SWIGSPQKCPCPILNCSFLKVLDNMLSIARTCEMSKC  3846
                +  ED+  SD +  + +   S+ G       P+++ ++L+  +  LS+A +C+  KC
Sbjct  816   RSSTYAEDVCWSDFVDGVSRRLISFAGIAVTSRSPLISATWLRCAEATLSVANSCQ--KC  873


 Score =   137 bits (344),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 87/293 (30%), Positives = 155/293 (53%), Gaps = 23/293 (8%)
 Frame = +1

Query  1243  STAFQMKWASLFRKFFSRVRTAL----ERVIKQGTWHPSLIKCLSGSPLNGEADQSLKH-  1407
             + AF+    +   K F+R+   +    +++ ++G   P      +G+   GE D    H 
Sbjct  14    TVAFRNALVTSVSKVFARIWVGVNHVGQKLRRRGEAAPK-----NGAQKVGEVDALKAHV  68

Query  1408  -RAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPP-QGKSDSY--S  1575
              +A+    FM  +   LF + YP APYER+  A+EL+  ++  W       G+++    +
Sbjct  69    QKAQRAHVFMSDIVRVLFSNLYPGAPYERRCTALELLNSVVESWKSYGDISGRNNDLIIA  128

Query  1576  SEISLYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAI  1755
              ++   PYS  +     T LL+G+++DSW+++R ++F++L    +P+ GI +PE + + +
Sbjct  129   KQLLSSPYSVFMQDEAYTSLLMGALVDSWEKMRMTAFKLLRRHASPLAGIETPEKLAKQL  188

Query  1756  IWAKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCNV-VTQSPSGLSNGENLEF  1932
              WA +L+ SPRVRES A AL  RL+  KY+ EL W + +S +V V Q       GEN + 
Sbjct  189   EWALELLHSPRVRESGAAALMIRLLIHKYIFELNWNIELSPHVRVAQG----HQGENRDS  244

Query  1933  TPSSPVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEEMDW  2091
             T     ++ +  L D L   +   E+D+ E C++   HG +L  +YT  ++++
Sbjct  245   TN----LQVLKMLCDLLEQDIYAAEQDIIEGCRRCLAHGAILLAKYTLCDLNF  293



>ref|XP_003758369.1| PREDICTED: thyroid adenoma-associated protein [Sarcophilus harrisii]
Length=1271

 Score =   183 bits (464),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 150/517 (29%), Positives = 235/517 (45%), Gaps = 82/517 (16%)
 Frame = +1

Query  2278  DVSASTP----DDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDV  2445
             D++A  P      EMK  K  Q      Q V+V CW +MKEV+LLLG + + +PL +  V
Sbjct  339   DLAAGVPVITTSAEMK-GKEGQSCDVTAQAVLVCCWRSMKEVALLLGMLCQLMPLQS--V  395

Query  2446  PKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLL  2625
             PK+             D +L + Q++ IGN+F + LL+ +H GA +    GF  L   L 
Sbjct  396   PKA------------PDGLLTVEQVKNIGNYFKQHLLQSRHRGAFELAYTGFVKLTQVLT  443

Query  2626  CSNDPRLCKLTESWMEQLMERTVSKGQTVD-DLLRRSAGIPAAFTAFFLSEPEGAPKRLL  2802
                   L +L E W+  ++E   S   +      RRSAGIP    A   SEP+     LL
Sbjct  444   RCPSECLQRLPEQWLRDVLEEIKSSNPSSKLCATRRSAGIPFYIQALLASEPKKGRMDLL  503

Query  2803  PKALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHA  2982
                ++ LI++A                                  +     +  VP VHA
Sbjct  504   KITMKELISLA----------------------------------VPSDDSQSSVPQVHA  529

Query  2983  FNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNV  3162
              N+L+A F D  L  +   + A+ +  +I  F+S  W VRNS+ L +++L+ R+ G    
Sbjct  530   LNILRALFRDTRLGENIIPYVADGIQAAILGFTSPVWAVRNSSTLLFSSLITRIFGVKRG  589

Query  3163  QKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPM  3342
             +   S +  +TG EFF R+PTLH FL  +L++        +SE        +       +
Sbjct  590   KDEHSKKNRMTGREFFSRFPTLHPFLLKQLEVVANTVDSDNSELNLHPNLFL-------L  642

Query  3343  LILLSRLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTV  3522
             L++L +L PSP+   +        F+PFIR+C      R R +A+RAL   V  +++P  
Sbjct  643   LLILGKLYPSPMDGASS-ALSMAPFVPFIRRCGHSAVYRSREMAARALVPFVMIDQIPDT  701

Query  3523  ILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLL----DTNCRNLADFSK  3690
             I ++ SELP              ++L    N IHG+LLQ+  LL    D+  R  +DF +
Sbjct  702   IQSLLSELP------------NCTDLCIRQNHIHGILLQVFHLLQSYSDSKHRANSDFQQ  749

Query  3691  KEDILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVL  3801
             +   L+D+   +    W+   Q  PC +   + + +L
Sbjct  750   E---LTDITACIRAKLWLAKRQN-PCLVTRAACIDIL  782



>ref|XP_002932440.2| PREDICTED: thyroid adenoma-associated protein homolog [Xenopus 
(Silurana) tropicalis]
Length=1920

 Score =   183 bits (464),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 176/677 (26%), Positives = 298/677 (44%), Gaps = 115/677 (17%)
 Frame = +1

Query  2350  QIVMVGCWLAMKEVSLLLGTIIRKVPLPTS-DVPKSCSQITDGTDQLSSDIVLDLRQLEI  2526
             Q+V+V CW +MKEVSLLLG + + +PL T  D P+                ++ + Q++ 
Sbjct  1040  QMVLVCCWRSMKEVSLLLGMLCQNLPLMTEPDSPRG---------------LITVEQVKE  1084

Query  2527  IGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQ  2706
             +G +F   LL+ +H GA +    GF  L   L+   +  L +L   W+  ++E   S   
Sbjct  1085  MGEYFKHHLLQSRHRGAFELAYVGFAKLTEMLIGCKEESLRRLPGQWLCSVLEEIKSSDP  1144

Query  2707  TVD-DLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscse  2883
             +      RRSAGIP    A   SEP+ +    L   ++ LI++A                
Sbjct  1145  SSKLCATRRSAGIPFYIQALLASEPKNSKAGFLKMTMKQLISLA----------------  1188

Query  2884  sssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIV  3063
                      +P+  A      + D+  +P VHA N+L+A F D  L  +   + AE    
Sbjct  1189  ---------MPESDA------SGDKSTIPQVHALNILRALFRDTRLGENVIPYVAEGTQA  1233

Query  3064  SIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLF  3243
             +I  F+S  W VRNS+ L ++ L+ R+ G    +   S +  +TG EFF R+P L+ FL 
Sbjct  1234  AILGFTSPIWAVRNSSTLLFSTLITRIFGVKRGKDERSKKNRMTGREFFSRFPALYPFLL  1293

Query  3244  NELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMP  3423
              +L++  +     + E+        +HPSL  +L++LS+L PSP+   T        F+P
Sbjct  1294  EQLEVVADTVDSPTGES-------KLHPSLFLLLLILSKLYPSPMDG-TYSALSMAPFIP  1345

Query  3424  FIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLN  3603
             FI +C      R R +A+ AL   V   ++P   LN+ + LP    HS    +       
Sbjct  1346  FIIRCGHSPVYRSREMAAHALVPFVMTNEVPQTALNLLNSLP----HSADPRIRQ-----  1396

Query  3604  ASFNSIHGMLLQLSSLLDT--NCRNLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPIL  3777
                N +HG LLQ+  LL +    ++ A+  + +  + D++  +    W+   Q  PC + 
Sbjct  1397  ---NRVHGTLLQVFYLLQSFFEAKHSANSERIQREMGDIMACMKARLWLAKSQN-PCLVT  1452

Query  3778  NCSFLKVLD---NMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPTIAEL  3948
               SF+ +L+   N   I R  E S   S I  ++     EC DL      A   P + + 
Sbjct  1453  RASFISILEMIINNQEILRNKEFSSFYSDICTII-----EC-DLSEVVPHASAIPGLVQY  1506

Query  3949  RKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQERLIRSLSDA  4128
              +  A    +     +K         L GP  D      + + +  ++  E L+RS    
Sbjct  1507  AQSMARLVLSVLTLNAK---------LGGPDTD------AGSTVCPSQLLETLLRS---D  1548

Query  4129  LYEVRIATLKWLLLFLNS--PESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEKNH  4302
               EVR+  L+ L  + ++   E+R   +S   ++               L ++++VE+N 
Sbjct  1549  FPEVRLLVLESLSKWSDTCAEETRNYLTSKAEKT---------------LFEMISVERNP  1593

Query  4303  KCMNYILKIIYTYNMQQ  4353
             +C+  +L + Y    ++
Sbjct  1594  ECLCQVLTLYYKIGAEE  1610



>ref|XP_008428609.1| PREDICTED: thyroid adenoma-associated protein [Poecilia reticulata]
Length=1905

 Score =   182 bits (463),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 194/705 (28%), Positives = 306/705 (43%), Gaps = 128/705 (18%)
 Frame = +1

Query  2257  LERPIEMDVSASTP----DDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKV  2424
             LE+P   D S  TP    D E     A        Q+V+V CW +MKEV++LLG + + +
Sbjct  998   LEKPEGADQSHRTPPLNADGEGYRVTA--------QMVLVCCWRSMKEVAMLLGQLCQTL  1049

Query  2425  PLPTSDV--PKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAG  2598
             PL  S+   P     IT+             +Q+E +G +F + LL+ +H GA +    G
Sbjct  1050  PLHYSNENEPTHPGLITE-------------QQVEGVGLYFRQQLLQSRHRGAFELAYVG  1096

Query  2599  FTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQTVD-DLLRRSAGIPAAFTAFFLSE  2775
             F  L + L  S    L +L   W+ +++E   S   T      RRSAGIP    A   SE
Sbjct  1097  FVRLTDMLCRSGSRNLQQLPSRWLSEVLEEVKSSDPTSKLCATRRSAGIPFYIQALLSSE  1156

Query  2776  PEGAPKRLLPKALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTRD  2955
             P+ +   LL   +R LI +A  +                                 ++ D
Sbjct  1157  PKASSCSLLKATMRQLIALASPA-------------------------------ADRSTD  1185

Query  2956  EGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALV  3135
                VP VHA N+L+A + D  L  +   F +E +  ++  F+S  W VRNS+ L ++ L+
Sbjct  1186  ASTVPQVHALNILRALYRDTRLGENIIPFVSEGMEAAVLGFTSPVWAVRNSSTLLFSTLI  1245

Query  3136  RRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAK  3315
              R+ G    +   S +  +TG EFF R+P L+ FL ++L+ A    +E  S ++T     
Sbjct  1246  TRIFGVKRGKDEHSKKNRMTGREFFTRFPALYPFLLSQLEEAAA-TVESDSGHVT-----  1299

Query  3316  VVHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGM  3495
              +HPSL  +L++LSRL PSP+   +  P     F P I +CS     R R +A+RAL   
Sbjct  1300  -LHPSLFLLLLVLSRLYPSPMDGSS-SPLGLAPFRPLIMRCSRSAVYRTREMAARALVPF  1357

Query  3496  VSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNL  3675
             V   ++P+ +  +  ELP                 N   N IHG LLQ+  LL +     
Sbjct  1358  VLVTQIPSTVRTLLQELPPEPGP------------NIQQNHIHGTLLQVLFLLRS---FQ  1402

Query  3676  ADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPILNCSFLKVL----DNMLSIARTCEMSK  3843
             AD  +     S +   L +  W+ S +   C +   +FL V+     +  SI    E+  
Sbjct  1403  ADSHRPLPAGSGIGEALRQRMWLAS-RLNSCLVTRGAFLDVMMCLCGSKASILEDSEVRA  1461

Query  3844  CISVIWNLLWTLSSECLDLYTSKRPAYFDPT--IAELRKQAASSYFNCAYQTSKDVNEED  4017
                   ++L  ++SE L   +S  P     T  +  L +   S+  +C            
Sbjct  1462  LRQTTLSIL--MASELLTSDSSSAPLGPGSTQYLLSLAQVGLSASVDC------------  1507

Query  4018  LIYLRGPPPDSELFKESETQMSVTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRT  4197
                     PD  L++  E +      Q+ L   L   LYEVR  TL+ +L  L+  E   
Sbjct  1508  --------PD--LWRGGEQR------QQLLDSLLRSPLYEVRELTLEGILRKLHEEEGDE  1551

Query  4198  AESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEKNHKCMNYILKII  4332
             A+         + LWLS   + A L ++   E++ +C+  +L+++
Sbjct  1552  AKR--------RPLWLSETTV-ADLTKMAVHERHQQCLAKVLQVL  1587



>ref|XP_010705062.1| PREDICTED: thyroid adenoma-associated protein isoform X1 [Meleagris 
gallopavo]
Length=1929

 Score =   182 bits (462),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 186/675 (28%), Positives = 303/675 (45%), Gaps = 105/675 (16%)
 Frame = +1

Query  2350  QIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEII  2529
             Q+V+V CW +MKEVSLLLGT+ + +P   +  P              S+ ++ + Q++ I
Sbjct  1038  QMVLVCCWRSMKEVSLLLGTLCKLLPAQAASEP--------------SNGLITVEQVKNI  1083

Query  2530  GNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVS-KGQ  2706
             G++F   L++ +H GA +   AGF  L   L   N   L K+ E W+  ++E   S    
Sbjct  1084  GDYFKHHLMQSRHRGAFELAYAGFVQLTETLSRCNSESLHKMPEQWLSCVLEEIKSCDPS  1143

Query  2707  TVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscses  2886
             +     RRSAGIP    A   SEP+     LL   ++ L+++A  S              
Sbjct  1144  STLCATRRSAGIPFYIQALLASEPKKGKTDLLKMTIKELMSLAAPS--------------  1189

Query  2887  ssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVS  3066
                                 +    V+P VHA N+L+A F D  L  +   + A+ +  +
Sbjct  1190  --------------------SEPASVIPQVHALNILRALFRDTRLGENVMPYVADGIQAA  1229

Query  3067  IRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFN  3246
             I  F+S  W VRNS+ L ++AL+ R+ G    +   S +  +TG EFF R+P+L+ FL  
Sbjct  1230  ILGFTSPIWAVRNSSTLLFSALITRIFGVKRGKDENSKKNRMTGAEFFSRFPSLYPFLLK  1289

Query  3247  ELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMPF  3426
             +L++     L    E L       +HPSL  +L++L +L PSP+   T        F+PF
Sbjct  1290  QLEVVANT-LNSEDEELK------IHPSLFLLLLILGKLYPSPMDG-TYSALSMAPFVPF  1341

Query  3427  IRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNA  3606
             I +C      R R ++ RAL   V   ++P  +L++  ELP  D+ S          L  
Sbjct  1342  IIRCGHSPVYRSREMSGRALVPFVMINEVPYTVLSLLKELP--DSTS----------LFI  1389

Query  3607  SFNSIHGMLLQ----LSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPI  3774
               NSIHG LLQ    L S LD+     +DF   E  LSD+I  +G   W+   +  PC +
Sbjct  1390  RHNSIHGTLLQVFYLLQSYLDSKQLGNSDF---EQGLSDIITCIGSKLWLAK-RPNPCLV  1445

Query  3775  LNCSFLKVLDNMLSIARTCEMSKCISVI--WNLLWTLSSECLDLYTSKRPAYFDPTIAEL  3948
                +FL VL  MLS        + +  +  W  +  + SE  +L T        P + + 
Sbjct  1446  TRAAFLDVL-VMLSTHLGNSQKQGMQFVEFWEEMNRVISES-ELMTGIPYLTAVPGLVQY  1503

Query  3949  RKQAASSYFNCAYQTS-KDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQERLIRSLSD  4125
              +       +    TS  D+           P   ++ K S + + + R++         
Sbjct  1504  LQSITKLVISVLSVTSTADIQSS------SSPAAMKIVKPSLSIVHLLRYE---------  1548

Query  4126  ALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEKNHK  4305
               +EVR+  L+ +LL+L     +      ++  E  +L L  + L+ +L+ +   EKN +
Sbjct  1549  -FHEVRLLALEAVLLWLKKVNPK------QTAREGGVLCLL-VDLEGILLSMALKEKNLE  1600

Query  4306  CMNYILKIIYTYNMQ  4350
             C   +L+I+Y  +++
Sbjct  1601  CFYKVLEILYNMDLR  1615



>ref|XP_009931189.1| PREDICTED: thyroid adenoma-associated protein [Opisthocomus hoazin]
Length=1930

 Score =   181 bits (460),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 188/689 (27%), Positives = 309/689 (45%), Gaps = 103/689 (15%)
 Frame = +1

Query  2305  EMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQ  2484
             EM+  K  Q      Q+V+V CW +MKEVSLLLGT+ + +P   +  P            
Sbjct  1024  EMR-GKERQTCDVTAQMVLVCCWRSMKEVSLLLGTLCKLLPSQATSEP------------  1070

Query  2485  LSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTES  2664
               S+ ++ + Q++ IG++F   LL+ +H GA +   AGF  L   L   N   L ++ E 
Sbjct  1071  --SNGLITVEQVKNIGDYFKHHLLQSRHRGAFELAYAGFVQLTEMLPRCNSESLRRMPEQ  1128

Query  2665  WMEQLMERTVS-KGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKK  2841
             W+  ++E   S    +     RRSAGIP    A   SEP+ +   LL   ++ LI++A  
Sbjct  1129  WLRCVLEEIKSCDPSSTLCATRRSAGIPFYIQALLASEPKKSKTDLLKMTMKELISLAA-  1187

Query  2842  SLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANL  3021
                                                     VVP VHA N+L+A F D  L
Sbjct  1188  ---------------------------------PLNESPSVVPQVHALNILRALFRDTRL  1214

Query  3022  ATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGL  3201
               +   + A+ +  ++  F S  W VRNS+ L ++AL+ R+ G    +   S +  +TG 
Sbjct  1215  GENIMPYVADGIQAAVLGFMSPVWAVRNSSTLLFSALITRIFGVKRGKDENSKKNRMTGR  1274

Query  3202  EFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPIT  3381
             EFF R+P+L+ FL  +L++AT   L   +E L       +HPSL  +L++L RL PSP+ 
Sbjct  1275  EFFSRFPSLYPFLLKQLEVATRT-LNSEAEELK------IHPSLFLLLLILGRLYPSPMD  1327

Query  3382  SETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDN  3561
               T        F+PFI +C      R R ++ RAL   V   ++P  +L++   LP   +
Sbjct  1328  G-TYSALGMAPFVPFIIRCGHSPVYRSREMSGRALVPFVMVNEVPHTVLSLLEGLPDSTS  1386

Query  3562  HSMTSDLSGLSNLNASFNSIHGMLLQ----LSSLLDTNCRNLADFSKKEDILSDLIHVLG  3729
              S+              N+IHG LLQ    L S LD+     +DF +    L D+I  +G
Sbjct  1387  PSIRQ------------NNIHGTLLQVFHLLQSYLDSKQLMSSDFQQG---LGDIITCIG  1431

Query  3730  KHSWIGSPQKCPCPILNCSFLKVLDNMLS--IARTCEMSKCISVIWNLLWTLSSECLDLY  3903
                W+   +  PC +   ++L VL  MLS  + +  +    +   W  +  + S+  +L 
Sbjct  1432  TKLWLAK-RPNPCLVTRAAYLDVL-VMLSTHLGKFRKQGMQLFQFWEEMNGVISDS-ELV  1488

Query  3904  TSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMS  4083
             +S R +   P + +  +       +    T+            GP   S     S     
Sbjct  1489  SSIRCSSAVPGLIQYLQSVTKLVISVLSVTA------------GPDIQS---SSSPVAKK  1533

Query  4084  VTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQ  4263
             + +    ++  L    +EVR+  L+ +LL+L    S+  + + +  S + LL    IGL+
Sbjct  1534  IAKPSLSIVCLLHCEFHEVRLLALEAVLLWLKQTNSK--QIAEERGSALCLL----IGLE  1587

Query  4264  AMLMQLLAVEKNHKCMNYILKIIYTYNMQ  4350
               L+ +   EKN +C + +L+I+Y  +++
Sbjct  1588  GTLLTMALEEKNLQCFSKVLEILYNMDLR  1616



>ref|NP_001103529.1| thyroid adenoma-associated protein homolog [Gallus gallus]
 sp|A8C754.1|THADA_CHICK RecName: Full=Thyroid adenoma-associated protein homolog [Gallus 
gallus]
 gb|ABQ10600.1| thyroid adenoma-associated protein [Gallus gallus]
Length=1930

 Score =   181 bits (460),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 187/676 (28%), Positives = 304/676 (45%), Gaps = 107/676 (16%)
 Frame = +1

Query  2350  QIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEII  2529
             Q+V+V CW +MKEVSLLLGT+ + +P   S  P              S  ++ + Q++ I
Sbjct  1039  QMVLVCCWRSMKEVSLLLGTLCKLLPTQASSEP--------------SHGLITVEQVKNI  1084

Query  2530  GNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVS-KGQ  2706
             G++F   L++ +H GA +   AGF  L   L   N   L K+ E W+  ++E   S    
Sbjct  1085  GDYFKHHLMQSRHRGAFELAYAGFVQLTETLSRCNSESLRKMPEQWLRCVLEEIKSCDPS  1144

Query  2707  TVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscses  2886
             +     RRSAGIP    A   SEP+     LL   ++ L+++A  S              
Sbjct  1145  STLCATRRSAGIPFYIQALLASEPKKGKMDLLKMTIKELMSLASPS--------------  1190

Query  2887  ssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVS  3066
                                 +     +P VHA N+L+A F D  L  +   + A+ +  +
Sbjct  1191  --------------------SEPPSAIPQVHALNILRALFRDTRLGENIMPYVADGIQAA  1230

Query  3067  IRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFN  3246
             I  F+S  W VRNS+ L ++AL+ R+ G    +   S +  +TG EFF R+P+L+ FL  
Sbjct  1231  ILGFTSPIWAVRNSSTLLFSALITRIFGVKRGKDENSKKNRMTGAEFFSRFPSLYPFLLK  1290

Query  3247  ELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMPF  3426
             +L++     L    E L       +HPSL  +L++L +L PSP+   T        F PF
Sbjct  1291  QLEVVANT-LNSEDEELK------IHPSLFLLLLILGKLYPSPMDG-TYSALSMAPFXPF  1342

Query  3427  IRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDLSGL---SN  3597
             I +C      R R ++ RAL        +P V++N   E+P    H++ S L GL   ++
Sbjct  1343  IIRCGHSPVYRSREMSGRAL--------VPFVMIN---EVP----HTVLSLLKGLPDSAS  1387

Query  3598  LNASFNSIHGMLLQLSSLLDT--NCRNLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCP  3771
             L    N+IHG LLQ+S LL +  + + L + S  E  LSD++  +G   W+   +  PC 
Sbjct  1388  LCIRQNNIHGTLLQVSHLLQSYLDSKQLGN-SDFEQGLSDIVTCIGSKLWLAK-RPNPCL  1445

Query  3772  ILNCSFLKVLDNMLSIARTCEMSKCISVI--WNLLWTLSSECLDLYTSKRPAYFDPTIAE  3945
             +   +FL VL  MLS        + +  +  W  +  + SEC +L T        P + +
Sbjct  1446  VTRAAFLDVL-VMLSTHLGNSQKQGMQFVEFWEEMNRVISEC-ELMTGIPYLTAVPGLVQ  1503

Query  3946  LRKQAASSYFNCAYQTS-KDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQERLIRSLS  4122
               +       +    TS  D+                    S T M + +    ++  L 
Sbjct  1504  YLQSITKLVISVLSVTSAADIQSSS----------------SPTAMKIAKPPLSIVHLLH  1547

Query  4123  DALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEKNH  4302
                +EVR+  L+ +LL+L   +   A+   K    + LL    + L+ +L+ +   EKN 
Sbjct  1548  SEFHEVRLLALEAVLLWL---KKVNAKQIAKEGGVLCLL----VDLEGVLLSMTLKEKNL  1600

Query  4303  KCMNYILKIIYTYNMQ  4350
             +C   +L+I+Y  +++
Sbjct  1601  ECFYKVLEILYNMDLR  1616



>gb|KFR09124.1| Thyroid adenoma-associated protein, partial [Opisthocomus hoazin]
Length=1918

 Score =   181 bits (459),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 188/689 (27%), Positives = 309/689 (45%), Gaps = 103/689 (15%)
 Frame = +1

Query  2305  EMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQ  2484
             EM+  K  Q      Q+V+V CW +MKEVSLLLGT+ + +P   +  P            
Sbjct  1024  EMR-GKERQTCDVTAQMVLVCCWRSMKEVSLLLGTLCKLLPSQATSEP------------  1070

Query  2485  LSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTES  2664
               S+ ++ + Q++ IG++F   LL+ +H GA +   AGF  L   L   N   L ++ E 
Sbjct  1071  --SNGLITVEQVKNIGDYFKHHLLQSRHRGAFELAYAGFVQLTEMLPRCNSESLRRMPEQ  1128

Query  2665  WMEQLMERTVS-KGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKK  2841
             W+  ++E   S    +     RRSAGIP    A   SEP+ +   LL   ++ LI++A  
Sbjct  1129  WLRCVLEEIKSCDPSSTLCATRRSAGIPFYIQALLASEPKKSKTDLLKMTMKELISLAA-  1187

Query  2842  SLTDknkensscsesssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANL  3021
                                                     VVP VHA N+L+A F D  L
Sbjct  1188  ---------------------------------PLNESPSVVPQVHALNILRALFRDTRL  1214

Query  3022  ATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGL  3201
               +   + A+ +  ++  F S  W VRNS+ L ++AL+ R+ G    +   S +  +TG 
Sbjct  1215  GENIMPYVADGIQAAVLGFMSPVWAVRNSSTLLFSALITRIFGVKRGKDENSKKNRMTGR  1274

Query  3202  EFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPIT  3381
             EFF R+P+L+ FL  +L++AT   L   +E L       +HPSL  +L++L RL PSP+ 
Sbjct  1275  EFFSRFPSLYPFLLKQLEVATRT-LNSEAEELK------IHPSLFLLLLILGRLYPSPMD  1327

Query  3382  SETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDN  3561
               T        F+PFI +C      R R ++ RAL   V   ++P  +L++   LP   +
Sbjct  1328  G-TYSALGMAPFVPFIIRCGHSPVYRSREMSGRALVPFVMVNEVPHTVLSLLEGLPDSTS  1386

Query  3562  HSMTSDLSGLSNLNASFNSIHGMLLQ----LSSLLDTNCRNLADFSKKEDILSDLIHVLG  3729
              S+              N+IHG LLQ    L S LD+     +DF +    L D+I  +G
Sbjct  1387  PSIRQ------------NNIHGTLLQVFHLLQSYLDSKQLMSSDFQQG---LGDIITCIG  1431

Query  3730  KHSWIGSPQKCPCPILNCSFLKVLDNMLS--IARTCEMSKCISVIWNLLWTLSSECLDLY  3903
                W+   +  PC +   ++L VL  MLS  + +  +    +   W  +  + S+  +L 
Sbjct  1432  TKLWLAK-RPNPCLVTRAAYLDVL-VMLSTHLGKFRKQGMQLFQFWEEMNGVISDS-ELV  1488

Query  3904  TSKRPAYFDPTIAELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMS  4083
             +S R +   P + +  +       +    T+            GP   S     S     
Sbjct  1489  SSIRCSSAVPGLIQYLQSVTKLVISVLSVTA------------GPDIQS---SSSPVAKK  1533

Query  4084  VTRFQERLIRSLSDALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQ  4263
             + +    ++  L    +EVR+  L+ +LL+L    S+  + + +  S + LL    IGL+
Sbjct  1534  IAKPSLSIVCLLHCEFHEVRLLALEAVLLWLKQTNSK--QIAEERGSALCLL----IGLE  1587

Query  4264  AMLMQLLAVEKNHKCMNYILKIIYTYNMQ  4350
               L+ +   EKN +C + +L+I+Y  +++
Sbjct  1588  GTLLTMALEEKNLQCFSKVLEILYNMDLR  1616



>ref|XP_010705063.1| PREDICTED: thyroid adenoma-associated protein isoform X2 [Meleagris 
gallopavo]
Length=1516

 Score =   181 bits (458),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 149/489 (30%), Positives = 228/489 (47%), Gaps = 77/489 (16%)
 Frame = +1

Query  2350  QIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEII  2529
             Q+V+V CW +MKEVSLLLGT+ + +P   +  P              S+ ++ + Q++ I
Sbjct  1038  QMVLVCCWRSMKEVSLLLGTLCKLLPAQAASEP--------------SNGLITVEQVKNI  1083

Query  2530  GNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVS-KGQ  2706
             G++F   L++ +H GA +   AGF  L   L   N   L K+ E W+  ++E   S    
Sbjct  1084  GDYFKHHLMQSRHRGAFELAYAGFVQLTETLSRCNSESLHKMPEQWLSCVLEEIKSCDPS  1143

Query  2707  TVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscses  2886
             +     RRSAGIP    A   SEP+     LL   ++ L+++A  S              
Sbjct  1144  STLCATRRSAGIPFYIQALLASEPKKGKTDLLKMTIKELMSLAAPS--------------  1189

Query  2887  ssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVS  3066
                                 +    V+P VHA N+L+A F D  L  +   + A+ +  +
Sbjct  1190  --------------------SEPASVIPQVHALNILRALFRDTRLGENVMPYVADGIQAA  1229

Query  3067  IRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFN  3246
             I  F+S  W VRNS+ L ++AL+ R+ G    +   S +  +TG EFF R+P+L+ FL  
Sbjct  1230  ILGFTSPIWAVRNSSTLLFSALITRIFGVKRGKDENSKKNRMTGAEFFSRFPSLYPFLLK  1289

Query  3247  ELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMPF  3426
             +L++     L    E L       +HPSL  +L++L +L PSP+   T        F+PF
Sbjct  1290  QLEVVANT-LNSEDEELK------IHPSLFLLLLILGKLYPSPMDG-TYSALSMAPFVPF  1341

Query  3427  IRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNA  3606
             I +C      R R ++ RAL   V   ++P  +L++  ELP              ++L  
Sbjct  1342  IIRCGHSPVYRSREMSGRALVPFVMINEVPYTVLSLLKELP------------DSTSLFI  1389

Query  3607  SFNSIHGMLLQ----LSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPI  3774
               NSIHG LLQ    L S LD+     +DF   E  LSD+I  +G   W+   +  PC +
Sbjct  1390  RHNSIHGTLLQVFYLLQSYLDSKQLGNSDF---EQGLSDIITCIGSKLWLAK-RPNPCLV  1445

Query  3775  LNCSFLKVL  3801
                +FL VL
Sbjct  1446  TRAAFLDVL  1454



>ref|XP_010003267.1| PREDICTED: thyroid adenoma-associated protein [Chaetura pelagica]
Length=2099

 Score =   180 bits (456),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 149/489 (30%), Positives = 228/489 (47%), Gaps = 77/489 (16%)
 Frame = +1

Query  2350  QIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEII  2529
             Q+V+V CW +MKEVSLLLGT+ + +P   +  P              SD ++ + Q++ I
Sbjct  1038  QMVLVCCWRSMKEVSLLLGTLCKLLPSQAASEP--------------SDGLITVEQVKNI  1083

Query  2530  GNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVS-KGQ  2706
             G++F   LL+ +H GA +   AGF  L   L   N   L K+ E W+  ++E   S    
Sbjct  1084  GDYFKHHLLQSRHRGAFELAYAGFVQLTEMLSRCNSESLRKMPEQWLSCVLEEIKSCDPS  1143

Query  2707  TVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscses  2886
             +     RRSAGIP    A   SEP+ +   LL  A++ LI++A                 
Sbjct  1144  STLCATRRSAGIPFYIQALLASEPKKSKTDLLKMAMKELISLAA----------------  1187

Query  2887  ssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVS  3066
                                      V+P VHA N+L+A F D  L  +   + A+ +  +
Sbjct  1188  ------------------PLNESSSVIPQVHALNILRALFRDTRLGENIMPYVADGIQAA  1229

Query  3067  IRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFN  3246
             I  F S  W VRNS+ L ++AL+ R+ G    +   S +  +TG EFF R+P+L+ FL N
Sbjct  1230  ILGFVSPVWAVRNSSTLLFSALITRIFGVKRGKDENSKKNRMTGREFFSRFPSLYPFLLN  1289

Query  3247  ELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMPF  3426
             +L++ T   L   +E L       +HPSL  +L++L RL PSP+        +   F+PF
Sbjct  1290  QLEVVTNT-LNSEAEELK------IHPSLFLLLLILGRLYPSPMDGAYS-ALNMAPFVPF  1341

Query  3427  IRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNA  3606
             I +C      R R ++ RAL   V   ++P ++L++   LP   +  +            
Sbjct  1342  IIRCGHSPVYRSREMSGRALVPFVMVNEVPQIVLSLMEGLPDSTSPCIRQ----------  1391

Query  3607  SFNSIHGMLLQ----LSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPI  3774
               N+IHG LLQ    L S  ++N    +DF      LSD+I  +G   W+   Q  PC +
Sbjct  1392  --NNIHGTLLQVLHLLQSYFESNHLVSSDFQHD---LSDIITSIGTKLWLAKRQN-PCLV  1445

Query  3775  LNCSFLKVL  3801
                ++L VL
Sbjct  1446  TRAAYLDVL  1454



>gb|KFU95163.1| Thyroid adenoma-associated protein, partial [Chaetura pelagica]
Length=1921

 Score =   180 bits (456),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 149/489 (30%), Positives = 228/489 (47%), Gaps = 77/489 (16%)
 Frame = +1

Query  2350  QIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEII  2529
             Q+V+V CW +MKEVSLLLGT+ + +P   +  P              SD ++ + Q++ I
Sbjct  1038  QMVLVCCWRSMKEVSLLLGTLCKLLPSQAASEP--------------SDGLITVEQVKNI  1083

Query  2530  GNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVS-KGQ  2706
             G++F   LL+ +H GA +   AGF  L   L   N   L K+ E W+  ++E   S    
Sbjct  1084  GDYFKHHLLQSRHRGAFELAYAGFVQLTEMLSRCNSESLRKMPEQWLSCVLEEIKSCDPS  1143

Query  2707  TVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscses  2886
             +     RRSAGIP    A   SEP+ +   LL  A++ LI++A                 
Sbjct  1144  STLCATRRSAGIPFYIQALLASEPKKSKTDLLKMAMKELISLAA----------------  1187

Query  2887  ssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVS  3066
                                      V+P VHA N+L+A F D  L  +   + A+ +  +
Sbjct  1188  ------------------PLNESSSVIPQVHALNILRALFRDTRLGENIMPYVADGIQAA  1229

Query  3067  IRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFN  3246
             I  F S  W VRNS+ L ++AL+ R+ G    +   S +  +TG EFF R+P+L+ FL N
Sbjct  1230  ILGFVSPVWAVRNSSTLLFSALITRIFGVKRGKDENSKKNRMTGREFFSRFPSLYPFLLN  1289

Query  3247  ELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMPF  3426
             +L++ T   L   +E L       +HPSL  +L++L RL PSP+        +   F+PF
Sbjct  1290  QLEVVTNT-LNSEAEELK------IHPSLFLLLLILGRLYPSPMDGAYS-ALNMAPFVPF  1341

Query  3427  IRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNA  3606
             I +C      R R ++ RAL   V   ++P ++L++   LP   +  +            
Sbjct  1342  IIRCGHSPVYRSREMSGRALVPFVMVNEVPQIVLSLMEGLPDSTSPCIRQ----------  1391

Query  3607  SFNSIHGMLLQ----LSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPI  3774
               N+IHG LLQ    L S  ++N    +DF      LSD+I  +G   W+   Q  PC +
Sbjct  1392  --NNIHGTLLQVLHLLQSYFESNHLVSSDFQHD---LSDIITSIGTKLWLAKRQN-PCLV  1445

Query  3775  LNCSFLKVL  3801
                ++L VL
Sbjct  1446  TRAAYLDVL  1454



>ref|XP_009827032.1| hypothetical protein H257_04299 [Aphanomyces astaci]
 gb|ETV83602.1| hypothetical protein H257_04299 [Aphanomyces astaci]
Length=1886

 Score =   179 bits (454),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 253/1084 (23%), Positives = 422/1084 (39%), Gaps = 276/1084 (25%)
 Frame = +1

Query  508   LTKRLGAKSILDMSPGLLFDTTKAYVDDDVCSAATTFLKCFLECLRDEYWSTDGVEGGYI  687
             L  +L A S+LD  P LL     A  + +V ++A +     LE LR    ST  +     
Sbjct  528   LLPKLDAVSLLDQHPTLLHGVLSAVGNQEVAASAASLFVQLLEALRRAT-STTTLTPDLT  586

Query  688   KYRAHCLLPILSGLSSGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIF  867
              +    +  ++  L +    LR  + TY LP+L++ +  S+  +L         E+  + 
Sbjct  587   AWSKWWVDAVVDALLNSDTHLRLRIATYVLPILVKSEPASVAILL---------EAARL-  636

Query  868   YPELDSRDIVLGVEQRVAVLVSLLKVSRMLALIEGDIDWCEYSSVALEVTDLSTDAGVCD  1047
              P+ D+R         +  L+ L+K +R                + LE   L+TD     
Sbjct  637   RPDSDAR---------LWTLLELVKCAR---------------KIMLEPPTLTTDE----  668

Query  1048  SVVHVKGIEVKIPVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPL  1227
                          +N+    LTH    +R+ A + L  + KT SLPS  +++ ++  +  
Sbjct  669   -------------INF---GLTHASGDIRMAAYDMLCTSLKTTSLPSESDIAFVQTFLLS  712

Query  1228  NMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKH  1407
             + +  +T+ +MK     +    R+R    +  ++                      + +H
Sbjct  713   SAKSIATSLRMKLIIGLKATLLRIREGARKTCRRDV-------------------TASEH  753

Query  1408  RAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEIS  1587
              A     F  WL  F+     PSA  +R  M +E+  +   ++   P             
Sbjct  754   LA---LQFPAWLEGFVVSCITPSATPQRLTMGLEVFQLYTQIFDNPP-------------  797

Query  1588  LYPYSKGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAII-WA  1764
                    L  P  T  L+ ++I  WDR+R  S+ IL  FP+P+PG    EL  + +  WA
Sbjct  798   ------SLHTPAITNALLNAMISCWDRVRTLSYSILETFPSPLPGY---ELGLDTLFDWA  848

Query  1765  KKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFTPSS  1944
               L CSPR RESDAGA   RL+++++V                         +L F PS 
Sbjct  849   MTLCCSPRQRESDAGAHFMRLLYKQHV-------------------------HLTFLPSP  883

Query  1945  PVIEYITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRYTFEE---MDWDSIAVAsn  2115
                +   + I  L  A  +  + ++   +   +HG+LL  RY  E+   +D    A  + 
Sbjct  884   RTPQACVAHIVALLGARLDELETVNAPGEPPLIHGLLLATRYMLEDTPSLDHTWHAPVTA  943

Query  2116  issiklllekilalVMRITSLALWVVSADAWY--------LPDEMEEMTVDGACFLERPI  2271
             I S+         +V+   +  +   + DA Y        +P    +M   G   L+ P 
Sbjct  944   IFSVLWRALNTALVVVGDATSGVGTQALDAAYAVVGEVSAIPPLRAKMDCRGHLVLDDP-  1002

Query  2272  EMDVSASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTS--DV  2445
               DV+                DG   Q  +VG WLA +E + +L T+++   +  S  + 
Sbjct  1003  --DVA----------------DGDSAQRAVVGSWLAAREAAAVLATLVKAALITPSLLET  1044

Query  2446  PKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLL  2625
             P + S +     Q + D++L+              L ++KH GA+      +  +C  LL
Sbjct  1045  PTTASSV-----QRAGDVLLN-------------ALFELKHGGAVATVSVAYEDICKALL  1086

Query  2626  CSNDP----------RLCKLTES-WMEQLMERTVSKGQTVDDLLRRSAGIPAAFTAFFLS  2772
              S+            R   L+ + W + L+ R     Q    +LRRSAG  ++F A   +
Sbjct  1087  SSSPSFSTSSTDSIRRSLALSPAKWCDVLLHRLEHAEQQF--ILRRSAGFASSFVAILRA  1144

Query  2773  EPEGAPKRLLPKALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAAIEMISKTR  2952
             EP  A   LLP  L  L+ +A+                          DV  +E +    
Sbjct  1145  EPRNAAATLLPHVLATLLRLAR--------------------------DVDTVERVR---  1175

Query  2953  DEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTAL  3132
                    VHA N+LK    DA LA D + F  + L V++  F S  W VRNS+ + + A 
Sbjct  1176  -------VHALNILKLLGQDAILAEDVAVFVPDLLTVAVHGFESKSWAVRNSSMMLFAAA  1228

Query  3133  VRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFNELKIATELFLEGSSENLTSNLA  3312
              +R IG   V    +A   ++  + F R   L TFL   L+                   
Sbjct  1229  TQRAIGDKQVADGAAA-VGVSAQDVFTRCKGLDTFLLTHLQ-------------------  1268

Query  3313  KVVHPSLCPMLILLSRLKPSPITSETGD-------PFDPFLFMPFIRKCSLQNNLRIRIL  3471
                   + P+L+ LSRL+P  +  +          P D   F+P +  C+ + ++  R +
Sbjct  1269  ----SQVYPLLLFLSRLRPDDVADQHSAATISDVLPLD--TFVPLVVACAGETHIFHRRM  1322

Query  3472  ASRALTGMVSNEKLPTVILNIASEL--PAIDNHSMTSDLSGLSNLNASFNSIHGMLLQLS  3645
             A+ AL  +V+   +P V+  +   L  P   N                 N +HG +LQL 
Sbjct  1323  AAHALAAIVAPTSIPAVVATLVQALQGPRYKN-----------------NKLHGSMLQLQ  1365

Query  3646  SLLD  3657
             +L+D
Sbjct  1366  ALVD  1369



>ref|XP_007577228.1| PREDICTED: thyroid adenoma-associated protein [Poecilia formosa]
Length=1908

 Score =   179 bits (453),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 218/860 (25%), Positives = 365/860 (42%), Gaps = 180/860 (21%)
 Frame = +1

Query  2350  QIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDV--PKSCSQITDGTDQLSSDIVLDLRQLE  2523
             Q+++V CW +MKEV++LLG + + +PL  S+   P     IT+             +Q+E
Sbjct  1028  QMLLVCCWRSMKEVAMLLGQLCQTLPLHYSNEIEPTHPGLITE-------------QQVE  1074

Query  2524  IIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKG  2703
              +G +F + LL+ +H GA +    GF  L + L  S    L +L   W+ +++E   S  
Sbjct  1075  GVGLYFRQQLLQSRHRGAFELAYVGFVRLTDMLCRSGSRNLQQLPTRWLSEVLEEVKSSD  1134

Query  2704  QTVD-DLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscs  2880
              T      RRSAGIP    A   SEP+ +   LL   ++ LI +A  +            
Sbjct  1135  PTSKLCATRRSAGIPFYIQALLSSEPKASSCSLLKATMKQLIALASPA------------  1182

Query  2881  esssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALI  3060
                                  ++ D   VP VHA N+L+A + D  L  +   F +E + 
Sbjct  1183  -------------------ADRSTDASTVPQVHALNILRALYRDTRLGENIIPFVSEGMQ  1223

Query  3061  VSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFL  3240
              ++  F+S  W VRNS+ L ++ L+ R+ G    +   S +  +TG EFF R+P L+ FL
Sbjct  1224  AAVLGFTSPVWAVRNSSTLLFSTLITRIFGVKRGKDEHSKKNRMTGREFFTRFPALYPFL  1283

Query  3241  FNELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFLFM  3420
              ++L+ A    +E  S ++T      +HPSL  +L++LSRL PSP+   +  P     F 
Sbjct  1284  LSQLEEAAS-TVESDSGHVT------LHPSLFLLLLVLSRLYPSPMDGSS-SPLGLAPFR  1335

Query  3421  PFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNL  3600
             P I +CS     R R +A+RAL   V   ++P+ +  +  +LPA                
Sbjct  1336  PLIMRCSRSAVYRTREMAARALVPFVLVTQIPSTVRTLLQDLPAEPGP------------  1383

Query  3601  NASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPILN  3780
             N   N IHG LLQ+  LL +     AD  +     S +   L +  W+ S +   C +  
Sbjct  1384  NIQQNHIHGALLQVLFLLRS---FQADSHRPLPAGSGIGEALRQRMWLAS-RLNSCLVTR  1439

Query  3781  CSFLKVL----DNMLSIARTCEMSKCISVIWNLLWTLSSECLDLYTSKRPAYFDPT--IA  3942
              +FL V+     +  SI    E+S       ++L  ++SE L   +S  P     T  + 
Sbjct  1440  GAFLDVMVCLCGSKASILEDSEVSALRQTALSIL--MASELLTSDSSSAPLGPGSTQYLL  1497

Query  3943  ELRKQAASSYFNCAYQTSKDVNEEDLIYLRGPPPDSELFKESETQMSVTRFQERLIRSLS  4122
              L +   S+  +C                    PD  L++ +E +      Q+ L   L 
Sbjct  1498  SLAQVGLSASVDC--------------------PD--LWRGAEQR------QQLLDSLLR  1529

Query  4123  DALYEVRIATLKWLLLFLNSPESRTAESSNKSQSEIKLLWLSNIGLQAMLMQLLAVEKNH  4302
               LYEVR   L+ +L  L+  E   A+         + LWLS   + A L  +   E++ 
Sbjct  1530  SPLYEVRELALESVLRKLHEEEGDEAKR--------RPLWLSETTV-ADLTNMAVHERHQ  1580

Query  4303  KCMNYILKIIYTYNMQQYNKNCGQHEKPTFVGNMDSDSVLQFWDKVVSLYKVTRHAKTRE  4482
             +C+  +L+++                       + S S L + D   +L +        E
Sbjct  1581  QCLAKVLQVLCV---------------------LGSSSELLWKDGAKTLSQ-------EE  1612

Query  4483  MLVCCMAVCIKRLADLFTSSI------CSLGNEKVVVVNPS---DPSKLSVFSECIDYFV  4635
             +L+  +      LA+ FT S+       +L ++ VV +  S   DP  +  F++    + 
Sbjct  1613  VLIHLLT-----LAENFTHSVELLCAAVTLASQLVVALVSSDHQDPGAVVCFAQ----WG  1663

Query  4636  EVIQEHSDASEPINMRKAAAQSIVASGLLDQAQALSPSVSNHQVPDGNKQKDALHLYAHK  4815
              +++  S   +P+ ++   A+ +V           S  ++N Q+P G             
Sbjct  1664  ALVRSCSAEDQPVEVKLMVAKVLVTCS--------STLMTNPQLPLG----------LAA  1705

Query  4816  ILDLWFTCMKLLEDEDDGLR  4875
              + LW +   LL+DED  +R
Sbjct  1706  TVSLWSSLFTLLQDEDQEVR  1725



>ref|XP_010737964.1| PREDICTED: thyroid adenoma-associated protein [Larimichthys crocea]
Length=1883

 Score =   179 bits (453),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 141/486 (29%), Positives = 224/486 (46%), Gaps = 69/486 (14%)
 Frame = +1

Query  2350  QIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEII  2529
             Q+V+V CW +MKEV++LLG + + +PL            T+        ++ +  Q+E +
Sbjct  1051  QMVLVCCWRSMKEVAMLLGQLCQSLPL----------HYTNDNSHTHPGLITE-AQVEGV  1099

Query  2530  GNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQT  2709
             G +F + LL+ +H GA +    GF  L + L  S    L +L   W+ +++E   S   +
Sbjct  1100  GLYFRQQLLQSRHRGAFELAYVGFVRLTDMLCRSGSQALQQLPARWLSEVLEEVKSSDPS  1159

Query  2710  VD-DLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscses  2886
                   RRSAGIP    A   SEP+ +   LL   +R LI +A  S              
Sbjct  1160  SKLCATRRSAGIPFYIQALLSSEPKSSSCGLLKMTMRELIALAMPS--------------  1205

Query  2887  ssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVS  3066
                              I +  D   VP VHA N+L+A + D  L  +   F ++ +  +
Sbjct  1206  -----------------IDRNTDSSTVPQVHALNILRALYRDTRLGENIIPFVSDGMQAA  1248

Query  3067  IRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFN  3246
             +  F+S  W VRNS+ L ++ L+ R+ G    +   S +  +TG EFF R+P L+ FL N
Sbjct  1249  VLGFTSPVWAVRNSSTLLFSTLITRIFGVKKGKDEHSKKNRMTGREFFTRFPALYPFLLN  1308

Query  3247  ELKIATELFLEGSSENLTSNLAKV-VHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMP  3423
             +        LE ++  + S+  +V +HPSL  +L++LSRL PSP+   +  P     FMP
Sbjct  1309  Q--------LEEAAATVESDSGQVKLHPSLFLLLLVLSRLYPSPMDG-SSSPLGLAPFMP  1359

Query  3424  FIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLN  3603
             FI +C      R R +A+RAL   V   ++P+++  +  ELP+     +           
Sbjct  1360  FIIRCGRSAVYRTREMAARALVPFVLVTQVPSIVHTLLQELPSEPGPKI-----------  1408

Query  3604  ASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPILNC  3783
                N IHG LLQ+  LL +      D  +     + +   L +  W+ S Q   C +   
Sbjct  1409  -QHNHIHGTLLQVLFLLRS---YQTDSHRPLTAGNGISKALRQRMWLASRQN-SCVVTRG  1463

Query  3784  SFLKVL  3801
             +FL VL
Sbjct  1464  AFLDVL  1469



>emb|CDW77950.1| heat repeat domain containing protein [Stylonychia lemnae]
Length=1565

 Score =   178 bits (451),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 173/749 (23%), Positives = 332/749 (44%), Gaps = 131/749 (17%)
 Frame = +1

Query  1186  SSLELSLMRKAVPLNMRCCSTAFQMKWASLFRKFFSRVRTALERVIKQGTWHPSLIKCLS  1365
             +  E  +  + +   +R     F+ K+    + F  R+RT+ ++ I++            
Sbjct  282   TKFEYEMANRFIKNCLRTTFPEFRQKYIKAIKSFIIRLRTSTDKDIRKYV----------  331

Query  1366  GSPLNGEADQSLKHRAENLFNFMKWLSCFLFFSCYPSAPYERKIMAMELMLIMLNVWHML  1545
                     +  +    + + +FM+ +  F+  + Y   P E  +   E+  I + ++   
Sbjct  332   -----ASEEGQMTENVQQVVDFMRDIITFIQDNLYLDKPVEGALPLFEIFKIFIELF---  383

Query  1546  PPQGKSDSYSSEISLYP----YSKGLILPEST--LLLVGSIIDSWDRLRESSFRILLHFP  1707
                G  +       +YP     SK  +L + +  + L+ S+  +W ++R  S+ IL+ +P
Sbjct  384   ---GDYEYKLRITQIYPPCHLISKAKLLEQQSFFVFLLNSLKSTWTQVRMYSYDILIRYP  440

Query  1708  TPIPGISSPELVCEAIIW-AKKLVCSPRVRESDAGALTFRLIFRKYVLELGWVVRVSCNV  1884
                P       +   I+  A +L  +P+   ++A AL F LI +K + +L ++       
Sbjct  441   DNYPLYQDKNFINTVILQTALELANNPKAMLAEASALFFNLILKKCLRQLDFL-------  493

Query  1885  VTQSPSGLSNGENLEFTPSSPVIEYITSLID-----WLCAAVEEGEKDLSEACKKSFVHG  2049
                   G  + ++L+       ++YI SLI      +  + ++EG+K+       + +HG
Sbjct  494   --DIQDGTQDDQDLQL----QYLKYILSLIQKRVTTFQVSLIKEGKKE-------ALLHG  540

Query  2050  VLLTLRYTFEE--MDWDSIAVAsnissiklllekilalVMRITSLALWVVS-----ADAW  2208
             +L   ++ FE+  ++ +           +   + +L   + I+ +   ++S     +DA 
Sbjct  541   LLSFFKHLFEDFKINVNPETNPEAFQKWRTFFKDLLDTCLSISQVCKGLISNNGLMSDAE  600

Query  2209  YLPDEMEEMTVDGACFLERPIEMDVSASTPDDEMKIAKAEQDDGPMDQIVMVGCWLAMKE  2388
              +   + E+ VD       PI+MD      ++E             + +++VG WLA+KE
Sbjct  601   GVEGGIGEIKVDCRG---HPIKMDGLGEGVENE-----------DYENLILVGVWLAVKE  646

Query  2389  VSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEIIGNHFLEVLLKMKH  2568
               L L   ++ +  PTS          D T       ++D + + ++ + FL++L   KH
Sbjct  647   DGLTLFNFLKWLDFPTSR--------DDNTK-----FIVD-QDIHLLCDSFLDMLFNFKH  692

Query  2569  NGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVSKGQTVDDLLRRSAGIPA  2748
              GAI+K    F+  C +LL S D     L E  ++Q +E+  +  + +  +LRRSAGIP 
Sbjct  693   RGAIEKAAETFSLFCQKLLSSPDAYYKSLPERMLDQALEKITT--ENLSTILRRSAGIPP  750

Query  2749  AFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscsesssAIDSTMVPDVAA  2928
                A   +EP  A   LL K L +L+ +A++S+++                         
Sbjct  751   TIIAILRAEPISAEPILLNKTLEFLLKLAQESVSE-------------------------  785

Query  2929  IEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVSIRSFSSSYWEVRNS  3108
                    RD+     +HA N+++  F DA L  D   F   A+I++  SFSS+ W +RNS
Sbjct  786   -------RDDS---KIHALNIMRFIFQDAFLRHDVQKFITPAMILATESFSSNSWSIRNS  835

Query  3109  ACLAYTALVRRMIGFLNVQKRESAR-RALTGLEFFHRYPTLHTFLFNELKIATELFLEGS  3285
             A +A+TAL +R++  L+VQ ++ +R + L+  EF  +Y  L  +   ++K+   L L G 
Sbjct  836   ALMAFTALTKRILNNLHVQDQDLSRTKGLSVFEFLTKYEKLSNYF--QIKLKEGLKLTGK  893

Query  3286  SENLTSNLAKVVHPSLCPMLILLSRLKPS  3372
              +        +V   +  +L+L+SRL PS
Sbjct  894   IQKEEKEKQDLV---IFSILLLISRLIPS  919



>gb|EFA85521.1| hypothetical protein PPL_01478 [Polysphondylium pallidum PN500]
Length=2170

 Score =   178 bits (452),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 137/492 (28%), Positives = 231/492 (47%), Gaps = 59/492 (12%)
 Frame = +1

Query  2317  AKAEQDDGPMDQIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSD  2496
             A  +Q  G   QI+ V  W +MK +SL LG I+ +V  PT++           T+Q   D
Sbjct  1183  ASGDQIKGSAGQIITVCSWQSMKHLSLCLGAILDRVTFPTANT----------TEQTIKD  1232

Query  2497  IVLDLRQLEIIGNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQ  2676
              ++ + Q+  IG  F+ +LL  +H GAI+K   GF  LC+RL+ S  P L  L  SW++ 
Sbjct  1233  TLISVEQINEIGRSFVHILLNTRHKGAIEKAYLGFQVLCSRLMGSTLPALYTLPSSWIDS  1292

Query  2677  LMERTVSKGQTVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLI-NVAKKSLTD  2853
             L +R   +  ++    RRSAG+P  FT     E      ++    L+ +I N+ K +   
Sbjct  1293  LFKRVQEQSLSIT---RRSAGLPFVFTGLLTGESTHQKNKMAGPLLQLVITNLLKMA---  1346

Query  2854  knkensscsesssAIDSTMVPDVAAIEMISKTRDEGVV--PTVHAFNVLKAAFNDANLAT  3027
                             S     + A E+I     E  +  P VH+ N+L++ F +  +  
Sbjct  1347  ----------------SGNNSGLQASEVIDHDLAEQRIYLPQVHSINILRSIFRNKTMTN  1390

Query  3028  DTSGFSAEALIVSIRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEF  3207
             +   + A+ +I  + ++SS  W VRN+A +A++ +V +++G   V++  S     T   F
Sbjct  1391  ELGQYFADTMIAIVGAYSSPSWSVRNAATMAFSTMVDKVVGVKKVREESSQLNTTTFHYF  1450

Query  3208  FHRYPTLHTFLFNEL-KIATELFLE-GSSENLTSNLAKVVHPSLCPMLILLSRLKPSPIT  3381
             F   P+L+ FL     K  T +  E G S++       V+  S+  +L+L +RL+PS +T
Sbjct  1451  FGHMPSLYPFLLEHFSKSLTAIQQEQGQSDH-------VLQSSVYAILVLFARLQPSNMT  1503

Query  3382  SETGDPFDPFLFMPFIRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDN  3561
              +  D   P  F+ +I +C   +N  +R +A+RAL   + + ++   I  + + +    N
Sbjct  1504  -DPADSLSPTPFIQYISECCTFSNFMVRQIAARALVPFIPSREVIGFINTLINNV----N  1558

Query  3562  HSMTSDLSGLSNLNASFNSIHGMLLQLSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSW  3741
              S   D          FN IHG+L Q+  LL  +   +     KE ++ D I  + +  W
Sbjct  1559  QSDKRD----------FNRIHGVLFQIYHLLKLHIPTILSPKDKETMVIDAIGAMERLLW  1608

Query  3742  IGSPQKCPCPIL  3777
             I S +  P   L
Sbjct  1609  ILSKRVVPLAYL  1620


 Score =   161 bits (408),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 163/697 (23%), Positives = 303/697 (43%), Gaps = 96/697 (14%)
 Frame = +1

Query  97    SSVKTILYDGILSELCNFCEHPTDSHFNFHALTVMQICLQQIKTSMQGTD--GYIEEGYD  270
             S+ ++I  + I  E+ N C    D      ++  + +    ++  ++ TD    +   Y 
Sbjct  413   SNRQSIFLNYIYLEIVNACVTAVDVFGRVASIEYLHLWYDILRQQLETTDIESLLHVDYQ  472

Query  271   PISEEVGTRVLKIVWNNLEDPLSQTVKQVHLIFDLFLDI------QGTLHWAEGSEKFC-  429
                      VL+I++ N E  +S    Q++ IF+  L I      Q + +    +   C 
Sbjct  473   HFFGNYFNMVLEIIFTNWESTISSIPTQLNEIFNCLLSIHYLCMKQQSNNKNNNNTNDCK  532

Query  430   --------SFLRKIASDLLHLGPRCKGRYIPLASLTKRLGAKSILDMSPGLLFDTTKAYV  585
                     +F+  I + L+      KG+Y  L S+  R GA  +  +    + D   A  
Sbjct  533   QQLSGTASNFIPDITTRLIEEPWTQKGKYALLKSIIDREGALFMFSLKGNFMKDILLAMS  592

Query  586   DDDVCSAATTFLKCFLECLRDEY---------WSTDGVEGGYIKYRA--HCLLPILSGLS  732
             D  +C++A  FL+  +E L++E          +S + +E   I+ +   + L+P+L+ L+
Sbjct  593   DHTICNSAKGFLELLMESLKNEVSKRIKAENTFSDEKLESEAIQEQCELYWLIPLLNVLT  652

Query  733   SGFAKLRSNLNTYALPVLLELDVDSIFPMLGFIGIGCSAESTEIFYPELD--SRDIVLGV  906
                    S +  Y  P  L++   S+  +L  +    +  +        +   + IV+  
Sbjct  653   ECDDNTCSKIILYGTPCFLKVFPRSLISILDVLNKDNNNNNKSSNNNNNNKCKQQIVMDN  712

Query  907   EQRVAVLVSLLKVSRMLALIEG-DIDWCEYSSVALEVTDLSTDAGVCDSVVHVKGIEVKI  1083
             +  + + +S+L  +R LA++EG +I    YS++                           
Sbjct  713   KISLRISLSVLNTARQLAILEGIEILNNNYSTINQ-------------------------  747

Query  1084  PVNYLLLALTHIDDSLRIDAAESLFINPKTASLPSSLELSLMRKAVPLNMRCCSTAFQMK  1263
                    +L + DDSLR+   E +  +PK    P+ +E+ L+++ + L ++  S   +  
Sbjct  748   -------SLYNQDDSLRMLGLELVCCSPKNTERPTRVEIGLLKEFLSLALKSSSPYIRNH  800

Query  1264  WASLFRKFFSRVRTALERVIKQGTWHPSLIKCLSGSPLNGEADQSLKHRAENLFNFMKWL  1443
               S+  KF+ R+R +  +V +            S +         L    + +  F+ W 
Sbjct  801   TNSILDKFWVRLRESYAKVFRTK----------SVATAATTTTNELYLSNDEIVEFINWC  850

Query  1444  SCFLFFSC-YPSAPYERKIMAMELMLIMLNVWHMLPPQGKSDSYSSEISLYPY------S  1602
             S  LF SC YP APY RK++ ++ +  M++ +        ++ +  + ++ P+       
Sbjct  851   SS-LFVSCLYPGAPYPRKMLPIDAISSMVDAF-------SAERFKDKPAVVPFLSFVNER  902

Query  1603  KGLILPESTLLLVGSIIDSWDRLRESSFRILLHFPTPIPGISSPELVCEAIIWAKKLVCS  1782
               L    +TL+L+ ++ D +DR RE +  IL  FP+P+PG S  + +   I+W  KL CS
Sbjct  903   STLFSSSNTLVLINNLWDQYDRCREVASSILNRFPSPLPGFSEQQPIASLILWGLKLACS  962

Query  1783  PRVRESDAGALTFRLIFRKYVLELGWVVRVSCNVVTQSPSGLSNGENLEFT-PSSPVIEY  1959
             P+ RESD GA+  RL   KYV     V   + N    +P  LS     EF    + V+ Y
Sbjct  963   PKARESDTGAMVLRLYLNKYVALGRSVPTFTAN--QDAPIALS-----EFADKDNAVLHY  1015

Query  1960  ITSLIDWLCAAVEEGEKDLSEACKKSFVHGVLLTLRY  2070
             I  ++  L + V     +L EA K + +HG++L++RY
Sbjct  1016  IRQIMRVLRSQVALASSNLLEAAKYAPMHGLILSIRY  1052



>ref|XP_010391975.1| PREDICTED: thyroid adenoma-associated protein isoform X2 [Corvus 
cornix cornix]
Length=1838

 Score =   177 bits (449),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 147/489 (30%), Positives = 228/489 (47%), Gaps = 77/489 (16%)
 Frame = +1

Query  2350  QIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEII  2529
             Q+V+V CW +MKEVSLLLGT+ + +P  T+  P              SD ++ + Q++ I
Sbjct  946   QMVLVCCWRSMKEVSLLLGTLCKLLPSQTTSEP--------------SDALITVEQVKNI  991

Query  2530  GNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVS-KGQ  2706
             G++F   LL+ +H GA +   AGF  L   L   N   L K+ E W+  ++E   S    
Sbjct  992   GDYFKHHLLQSRHRGAFELAYAGFVQLTEMLSRCNSESLHKMPEQWLSYVLEEIKSCDPS  1051

Query  2707  TVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscses  2886
             +     RRSAGIP    A   SEP+ +   LL   ++ LI++A                 
Sbjct  1052  STLCATRRSAGIPFYIQALLASEPKKSKTDLLKMTMKELISLA-----------------  1094

Query  2887  ssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVS  3066
              + ++ ++                 V+P VHA N+L+A + D  L  +   + A+ +  S
Sbjct  1095  -APLNESL----------------SVIPQVHALNILRALYRDTRLGENIVPYVADGIKAS  1137

Query  3067  IRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFN  3246
             I  F S  W VRNS+ L ++AL+ R+ G    +   S +  +TG EFF R+P+L+ FL  
Sbjct  1138  ILGFMSPVWAVRNSSTLLFSALITRIFGVKRGKDENSKKNRMTGREFFSRFPSLYPFLLK  1197

Query  3247  ELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPITSETGDPFDPFLFMPF  3426
             +L++ T   L   +E L       +HPSL  +L++L RL PSP+   +        F+PF
Sbjct  1198  QLEVVTN-SLNSEAEELK------IHPSLFLLLLILGRLYPSPMDG-SHSALSTAPFVPF  1249

Query  3427  IRKCSLQNNLRIRILASRALTGMVSNEKLPTVILNIASELPAIDNHSMTSDLSGLSNLNA  3606
             I +C      R R ++ RAL   V   ++P  +L +   LP    H M            
Sbjct  1250  IIRCGHSPVYRCREMSGRALVPFVMANEVPHTVLALLQGLPDPATHCMRQ----------  1299

Query  3607  SFNSIHGMLLQ----LSSLLDTNCRNLADFSKKEDILSDLIHVLGKHSWIGSPQKCPCPI  3774
               N++HG LLQ    L S L++N     DF +    L D+I  +G   W+      PC +
Sbjct  1300  --NTVHGTLLQVFHLLQSYLESNQFASLDFQQG---LGDIITCMGTKLWLAKRLN-PCLV  1353

Query  3775  LNCSFLKVL  3801
                + L +L
Sbjct  1354  TRAACLDIL  1362



>ref|XP_010391973.1| PREDICTED: thyroid adenoma-associated protein isoform X1 [Corvus 
cornix cornix]
 ref|XP_010391974.1| PREDICTED: thyroid adenoma-associated protein isoform X1 [Corvus 
cornix cornix]
Length=1929

 Score =   177 bits (448),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 149/490 (30%), Positives = 230/490 (47%), Gaps = 79/490 (16%)
 Frame = +1

Query  2350  QIVMVGCWLAMKEVSLLLGTIIRKVPLPTSDVPKSCSQITDGTDQLSSDIVLDLRQLEII  2529
             Q+V+V CW +MKEVSLLLGT+ + +P  T+  P              SD ++ + Q++ I
Sbjct  1037  QMVLVCCWRSMKEVSLLLGTLCKLLPSQTTSEP--------------SDALITVEQVKNI  1082

Query  2530  GNHFLEVLLKMKHNGAIDKTRAGFTALCNRLLCSNDPRLCKLTESWMEQLMERTVS-KGQ  2706
             G++F   LL+ +H GA +   AGF  L   L   N   L K+ E W+  ++E   S    
Sbjct  1083  GDYFKHHLLQSRHRGAFELAYAGFVQLTEMLSRCNSESLHKMPEQWLSYVLEEIKSCDPS  1142

Query  2707  TVDDLLRRSAGIPAAFTAFFLSEPEGAPKRLLPKALRWLINVAKKSLTDknkensscses  2886
             +     RRSAGIP    A   SEP+ +   LL   ++ LI++A                 
Sbjct  1143  STLCATRRSAGIPFYIQALLASEPKKSKTDLLKMTMKELISLA-----------------  1185

Query  2887  ssAIDSTMVPDVAAIEMISKTRDEGVVPTVHAFNVLKAAFNDANLATDTSGFSAEALIVS  3066
              + ++ ++                 V+P VHA N+L+A + D  L  +   + A+ +  S
Sbjct  1186  -APLNESL----------------SVIPQVHALNILRALYRDTRLGENIVPYVADGIKAS  1228

Query  3067  IRSFSSSYWEVRNSACLAYTALVRRMIGFLNVQKRESARRALTGLEFFHRYPTLHTFLFN  3246
             I  F S  W VRNS+ L ++AL+ R+ G    +   S +  +TG EFF R+P+L+ FL  
Sbjct  1229  ILGFMSPVWAVRNSSTLLFSALITRIFGVKRGKDENSKKNRMTGREFFSRFPSLYPFLLK  1288

Query  3247  ELKIATELFLEGSSENLTSNLAKVVHPSLCPMLILLSRLKPSPI-TSETGDPFDPFLFMP  3423
             +L++ T   L   +E L       +HPSL  +L++L RL PSP+  S +     P