BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18226_g1_i2 len=167 path=[21:0-52 74:53-80 102:81-166]

Length=167
                                                                      Score     E

gb|AAB07724.1|  Pn47p                                                 96.7    3e-22   Ipomoea nil [qian niu]
ref|XP_003569462.2|  PREDICTED: LOW QUALITY PROTEIN: putative pen...  53.5    2e-06   
ref|XP_004505133.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  52.4    3e-06   
gb|EMS63185.1|  Phospholipase A1-II 1                                 52.8    4e-06   
ref|XP_002456057.1|  hypothetical protein SORBIDRAFT_03g029630        52.0    4e-06   Sorghum bicolor [broomcorn]
emb|CDM83551.1|  unnamed protein product                              52.0    5e-06   
ref|XP_004505132.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  52.0    5e-06   
gb|EMT15519.1|  Lipase                                                51.6    5e-06   
ref|XP_002522552.1|  triacylglycerol lipase, putative                 51.6    6e-06   Ricinus communis
sp|A2WT95.2|PLA1_ORYSI  RecName: Full=Phospholipase A1-II 1           51.6    6e-06   Oryza sativa Indica Group [Indian rice]
dbj|BAJ96485.1|  predicted protein                                    51.6    6e-06   
gb|EAY75191.1|  hypothetical protein OsI_03083                        51.2    8e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_002522553.1|  triacylglycerol lipase, putative                 51.2    8e-06   Ricinus communis
ref|XP_011027708.1|  PREDICTED: phospholipase A1-IIgamma-like         51.2    9e-06   
ref|XP_008225210.1|  PREDICTED: phospholipase A1-IIgamma              50.8    1e-05   
gb|ABK96341.1|  unknown                                               50.4    1e-05   Populus trichocarpa x Populus deltoides
ref|XP_002305084.2|  hypothetical protein POPTR_0004s05380g           50.4    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_008675277.1|  PREDICTED: phospholipase A1-II 1                 50.1    2e-05   
ref|XP_004969327.1|  PREDICTED: phospholipase A1-II 1-like            49.3    3e-05   
ref|XP_003608142.1|  Lipase                                           49.3    3e-05   
ref|XP_007213350.1|  hypothetical protein PRUPE_ppa1027164mg          49.3    3e-05   
ref|XP_011101305.1|  PREDICTED: phospholipase A1-II 1-like            49.3    4e-05   
ref|XP_006644443.1|  PREDICTED: phospholipase A1-II 1-like isofor...  48.9    4e-05   
ref|XP_006644442.1|  PREDICTED: phospholipase A1-II 1-like isofor...  48.9    4e-05   
emb|CDO96758.1|  unnamed protein product                              48.9    5e-05   
ref|XP_011074749.1|  PREDICTED: phospholipase A1-IIgamma              48.9    5e-05   
gb|AFK47098.1|  unknown                                               48.5    6e-05   
ref|XP_004293927.1|  PREDICTED: phospholipase A1-IIgamma-like         48.9    6e-05   
ref|XP_003528480.1|  PREDICTED: phospholipase A1-IIgamma-like         48.5    8e-05   
ref|XP_007153707.1|  hypothetical protein PHAVU_003G058100g           47.8    1e-04   
ref|XP_009352805.1|  PREDICTED: phospholipase A1-IIgamma-like         47.4    2e-04   
ref|XP_008449390.1|  PREDICTED: phospholipase A1-IIgamma              47.4    2e-04   
ref|XP_008383647.1|  PREDICTED: phospholipase A1-IIgamma              47.4    2e-04   
ref|XP_004232957.2|  PREDICTED: phospholipase A1-II 1-like            47.4    2e-04   
ref|XP_003608120.1|  Lipase                                           47.0    2e-04   
ref|XP_004140112.1|  PREDICTED: phospholipase A1-IIgamma-like         47.0    2e-04   
ref|XP_007148062.1|  hypothetical protein PHAVU_006G177300g           47.0    2e-04   
ref|XP_002305750.2|  lipase class 3 family protein                    47.0    3e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006362440.1|  PREDICTED: phospholipase A1-II 1-like            47.0    3e-04   
ref|XP_007153706.1|  hypothetical protein PHAVU_003G058000g           47.0    3e-04   
ref|XP_009765842.1|  PREDICTED: phospholipase A1-II 1-like            46.6    3e-04   
ref|XP_010655496.1|  PREDICTED: phospholipase A1-IIgamma isoform X2   46.2    4e-04   
ref|XP_009393076.1|  PREDICTED: phospholipase A1-II 1                 46.2    5e-04   
ref|XP_003608122.1|  Lipase                                           45.8    6e-04   
gb|EYU36835.1|  hypothetical protein MIMGU_mgv1a020546mg              45.8    7e-04   
emb|CDO96757.1|  unnamed protein product                              45.4    8e-04   
emb|CBI30665.3|  unnamed protein product                              45.4    8e-04   
ref|XP_003541709.1|  PREDICTED: phospholipase A1-IIgamma-like         45.4    9e-04   
gb|KHN08451.1|  Phospholipase A1-IIgamma                              45.4    0.001   



>gb|AAB07724.1| Pn47p [Ipomoea nil]
Length=402

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = -1

Query  167  SKKSHYLK-DLEGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLKA  3
            SKKSHYLK D   LS HDLMLYMH IDGYQGSQGGFER  DFDLAKVN+YGDYLKA
Sbjct  312  SKKSHYLKPDFPNLSTHDLMLYMHAIDGYQGSQGGFERQEDFDLAKVNKYGDYLKA  367



>ref|XP_003569462.2| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At5g52630 [Brachypodium distachyon]
Length=990

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  131  LSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            L++HD+  YMHGI G QGS GGFE   D D+A VN++ D LK
Sbjct  915  LTWHDMECYMHGIAGTQGSNGGFELEVDRDIALVNKHEDALK  956



>ref|XP_004505133.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Cicer arietinum]
Length=364

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -1

Query  167  SKKSHYLKDLEGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            +KKS YLK   G+S H+L +Y+HG+ G QGS+GGF    + D+A VN+  D LK
Sbjct  270  TKKSKYLK--SGVSSHNLEVYLHGVAGTQGSKGGFNLEVNRDIALVNKSNDGLK  321



>gb|EMS63185.1| Phospholipase A1-II 1 [Triticum urartu]
Length=797

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  131  LSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            L++HD+  YMHG+ G QGS GGFE   D D+A VN++ D LK
Sbjct  721  LTWHDMECYMHGVAGTQGSNGGFELEVDRDIALVNKHEDALK  762



>ref|XP_002456057.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
 gb|EES01177.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
Length=393

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = -1

Query  161  KSHYLKDL-EGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            +S YLK     L++HD+  YMHG+ G QGS GGFE   D D+A VN++ D LK
Sbjct  307  ESPYLKSPGNPLTWHDMECYMHGVAGAQGSSGGFELAVDRDIALVNKHEDALK  359



>emb|CDM83551.1| unnamed protein product [Triticum aestivum]
Length=394

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  131  LSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            L++HD+  YMHG+ G QGS GGFE   D D+A VN++ D LK
Sbjct  318  LTWHDMECYMHGVAGTQGSNGGFELEVDRDIALVNKHEDALK  359



>ref|XP_004505132.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Cicer arietinum]
Length=401

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -1

Query  167  SKKSHYLKDLEGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            +KKS YLK   G+S H+L +Y+HG+ G QGS+GGF    + D+A VN+  D LK
Sbjct  307  TKKSKYLK--SGVSSHNLEVYLHGVAGTQGSKGGFNLEVNRDIALVNKSNDGLK  358



>gb|EMT15519.1| Lipase [Aegilops tauschii]
Length=394

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  131  LSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            L++HD+  YMHG+ G QGS GGFE   D D+A VN++ D LK
Sbjct  318  LTWHDMECYMHGVAGTQGSNGGFELEVDRDIALVNKHEDALK  359



>ref|XP_002522552.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39852.1| triacylglycerol lipase, putative [Ricinus communis]
Length=403

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -1

Query  158  SHYLKDLEGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYL  9
            S Y+K    +  HDL LY HGI GYQG    F+   DFDLA VN+Y D L
Sbjct  307  SPYIKKATFMEPHDLNLYCHGISGYQGKDRKFKLAVDFDLALVNKYNDLL  356



>sp|A2WT95.2|PLA1_ORYSI RecName: Full=Phospholipase A1-II 1 [Oryza sativa Indica Group]
 sp|A2ZW16.2|PLA1_ORYSJ RecName: Full=Phospholipase A1-II 1 [Oryza sativa Japonica Group]
Length=393

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = -1

Query  161  KSHYLKDL-EGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            KS YLK     L++HD+  YMHG+ G QGS GGF+   D D+A VN++ D LK
Sbjct  307  KSPYLKAPGNPLTWHDMECYMHGVAGTQGSNGGFKLEIDRDIALVNKHEDALK  359



>dbj|BAJ96485.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  131  LSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            L++HD+  YMHG+ G QGS GGFE   D D+A VN++ D LK
Sbjct  318  LTWHDMECYMHGVAGTQGSNGGFELEVDRDIALVNKHEDALK  359



>gb|EAY75191.1| hypothetical protein OsI_03083 [Oryza sativa Indica Group]
 gb|EAZ12913.1| hypothetical protein OsJ_02836 [Oryza sativa Japonica Group]
Length=358

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = -1

Query  161  KSHYLKDL-EGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            KS YLK     L++HD+  YMHG+ G QGS GGF+   D D+A VN++ D LK
Sbjct  272  KSPYLKAPGNPLTWHDMECYMHGVAGTQGSNGGFKLEIDRDIALVNKHEDALK  324



>ref|XP_002522553.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39853.1| triacylglycerol lipase, putative [Ricinus communis]
Length=442

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -1

Query  158  SHYLKDLEGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYL  9
            S Y+K    +  HDL LY HGI GYQG    F+   DFDLA VN+Y D L
Sbjct  346  SPYIKKATFMEPHDLNLYCHGISGYQGKDRKFKLAVDFDLALVNKYNDLL  395



>ref|XP_011027708.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
 ref|XP_011015585.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=396

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDLEGL-SYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            ++KS Y+K ++ L  +H+L LY+HG+ G QGS+GGF    D D+A VN+  D LK
Sbjct  310  TRKSPYVKSMDDLGDFHNLELYIHGVAGTQGSEGGFNLEVDRDIALVNKDLDGLK  364



>ref|XP_008225210.1| PREDICTED: phospholipase A1-IIgamma [Prunus mume]
Length=431

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDLEGL-SYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            ++KS YLK   GL S+H+L  Y+HG+ G QGS+GGF+     D+A VN+  D LK
Sbjct  339  TRKSKYLKSPGGLASWHNLEGYLHGVAGTQGSKGGFKLEVKRDIALVNKSADDLK  393



>gb|ABK96341.1| unknown [Populus trichocarpa x Populus deltoides]
Length=396

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDLEGL-SYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            ++KS Y+K ++ L  +H+L LY+HG+ G QGS+GGF    D D+A VN+  D LK
Sbjct  310  TRKSPYVKSMDDLGDFHNLELYIHGVAGTQGSEGGFNLEVDRDIALVNKDLDGLK  364



>ref|XP_002305084.2| hypothetical protein POPTR_0004s05380g [Populus trichocarpa]
 gb|EEE85595.2| hypothetical protein POPTR_0004s05380g [Populus trichocarpa]
Length=396

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDLEGL-SYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            ++KS Y+K ++ L  +H+L LY+HG+ G QGS+GGF    D D+A VN+  D LK
Sbjct  310  TRKSPYVKSMDDLGDFHNLELYIHGVAGTQGSEGGFNLEVDRDIALVNKDLDGLK  364



>ref|XP_008675277.1| PREDICTED: phospholipase A1-II 1 [Zea mays]
 tpg|DAA58340.1| TPA: hypothetical protein ZEAMMB73_464828 [Zea mays]
Length=395

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  131  LSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            L++HD+  YMHG+ G QGS GGFE   D D+A VN++ D L+
Sbjct  319  LTWHDMECYMHGVAGAQGSSGGFELLVDRDVALVNKHEDALR  360



>ref|XP_004969327.1| PREDICTED: phospholipase A1-II 1-like [Setaria italica]
Length=394

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  131  LSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            L++HD+  YMHG+ G QGS GGF+   D D+A VN++ D LK
Sbjct  318  LTWHDMECYMHGVAGTQGSSGGFKLLVDRDIALVNKHEDALK  359



>ref|XP_003608142.1| Lipase [Medicago truncatula]
Length=349

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -1

Query  167  SKKSHYLKDLEGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            ++KS YLK   G+S H++ +Y+HGI G QGS+GGF    + D+A +N+  D LK
Sbjct  257  TEKSKYLK--SGVSAHNMEVYLHGIAGTQGSKGGFNLEVNRDIALLNKSNDGLK  308



>ref|XP_007213350.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
 gb|EMJ14549.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
Length=402

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDLEGL-SYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            ++KS YLK   GL S+H+L  Y+HG+ G QGS+GGF+     D+A VN+  D L+
Sbjct  310  TRKSKYLKSPGGLASWHNLEGYLHGVAGTQGSKGGFKLEVKRDIALVNKSADDLE  364



>ref|XP_011101305.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
 ref|XP_011101310.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
Length=411

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  167  SKKSHYLKDLEGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            + KS YLK+    S+H+L  Y+HG+ G +GS+GGF+   + D+A VN++ D LK
Sbjct  323  TDKSSYLKEGNLSSWHNLEAYLHGVAGTRGSEGGFKLEVNRDIALVNKHMDALK  376



>ref|XP_006644443.1| PREDICTED: phospholipase A1-II 1-like isoform X2 [Oryza brachyantha]
Length=396

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  131  LSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            L++HD+  YMHG+ G QGS GGF+   D D++ VN++ D LK
Sbjct  321  LTWHDMECYMHGVAGTQGSNGGFKLEIDRDISLVNKHEDALK  362



>ref|XP_006644442.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Oryza brachyantha]
Length=397

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  131  LSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            L++HD+  YMHG+ G QGS GGF+   D D++ VN++ D LK
Sbjct  322  LTWHDMECYMHGVAGTQGSNGGFKLEIDRDISLVNKHEDALK  363



>emb|CDO96758.1| unnamed protein product [Coffea canephora]
Length=396

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDLEGLS-YHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            + KS YLK    LS +H L  YMHGI G QG QGGF+   + D+A VN++ D LK
Sbjct  307  TTKSKYLKSPGNLSSWHSLECYMHGIAGTQGLQGGFKLVANRDVALVNKHMDALK  361



>ref|XP_011074749.1| PREDICTED: phospholipase A1-IIgamma [Sesamum indicum]
Length=419

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDLEGL-SYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            + KS+YLK    L S+H+L  Y+HG+ G QGS+GGF+   + D+A VN++ D LK
Sbjct  330  TDKSNYLKSPGNLNSWHNLEAYLHGVAGTQGSRGGFKLEVNRDIALVNKHLDGLK  384



>gb|AFK47098.1| unknown [Medicago truncatula]
 gb|AES90319.2| phospholipase A1 [Medicago truncatula]
Length=400

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -1

Query  167  SKKSHYLKDLEGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            ++KS YLK   G+S H++ +Y+HGI G QGS+GGF    + D+A +N+  D LK
Sbjct  307  TEKSKYLK--SGVSEHNMEVYLHGIAGTQGSKGGFNLEVNRDIALLNKSNDGLK  358



>ref|XP_004293927.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=438

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDLEG-LSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            S+KS YLK     LS+H+L  Y+HG+ G QGS+GGF+     D+A VN+  D LK
Sbjct  347  SRKSSYLKSPGSVLSWHNLEGYLHGVAGTQGSKGGFKLEVKRDIALVNKSHDALK  401



>ref|XP_003528480.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31002.1| Phospholipase A1-IIgamma [Glycine soja]
Length=402

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -1

Query  167  SKKSHYLKDLEGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            ++KS YLK   G+S H+L  Y+HG+ G QG +GGF    + D+A VN+  D LK
Sbjct  309  TRKSKYLK--SGVSAHNLEAYLHGVAGTQGEKGGFNLEVNRDIALVNKSMDALK  360



>ref|XP_007153707.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
 gb|ESW25701.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
Length=399

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -1

Query  167  SKKSHYLKDLEGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            ++KS YLK  EG+S H+L  Y+HG+ G QG +GGF    + D+A +N+  D LK
Sbjct  306  TRKSKYLK--EGVSAHNLEAYLHGVAGTQGKKGGFNLEVNRDIALLNKGMDALK  357



>ref|XP_009352805.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=430

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDLEGL-SYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            ++KS YLK   G+ S+H++  Y+HG+ G QGS+GGF+     D+A VN+  D LK
Sbjct  339  TQKSKYLKSPGGVASWHNMEGYLHGVAGTQGSKGGFKLEVKRDIALVNKSVDALK  393



>ref|XP_008449390.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=479

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDLEGL-SYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            ++KS YLK   G  S+H L  Y+HG+ G QG++GGF      D+A+VN+  + LK
Sbjct  388  TRKSEYLKSPGGFKSWHSLEAYLHGVAGTQGNEGGFMLEVKRDIARVNKALNALK  442



>ref|XP_008383647.1| PREDICTED: phospholipase A1-IIgamma [Malus domestica]
Length=430

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDLEGL-SYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            ++KS YLK   G+ S+H++  Y+HG+ G QGS+GGF+     D+A VN+  D LK
Sbjct  339  TQKSKYLKSPGGVVSWHNMEGYLHGVAGTQGSKGGFKLEVKRDIALVNKSVDALK  393



>ref|XP_004232957.2| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=429

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDL-EGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            ++KS YLK   +  S+H+   Y+HGI G QGS+GGF+   + D++ +N+Y D LK
Sbjct  340  TRKSGYLKSPGDQSSFHNTDCYLHGIAGTQGSKGGFKLEVERDISLINKYLDALK  394



>ref|XP_003608120.1| Lipase [Medicago truncatula]
 gb|AES90317.1| phospholipase A1 [Medicago truncatula]
Length=408

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -1

Query  167  SKKSHYLKDLEGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            +++S YLK   G+S H++ +Y+HGI G QGS+GGF    + D+A +N+  D LK
Sbjct  316  TEESKYLKS--GVSAHNMEVYLHGIAGTQGSKGGFNLEVNRDIALLNKSNDGLK  367



>ref|XP_004140112.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004165194.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 gb|KGN47948.1| hypothetical protein Csa_6G419450 [Cucumis sativus]
Length=398

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDLEGL-SYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            ++KS YLK   G  S+H L  Y+HG+ G QG++GGF      D+A+VN+  + LK
Sbjct  307  TRKSEYLKSPGGFKSWHSLEAYLHGVAGTQGNEGGFTLEVKRDIARVNKALNALK  361



>ref|XP_007148062.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
 gb|ESW20056.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
Length=424

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDL-EGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            ++KS YLK     LS+H+L  Y+HG+ G QGS+GGF+   + D+A +N+  D LK
Sbjct  335  TRKSMYLKSPGNPLSWHNLEGYLHGVAGTQGSKGGFKLEVNRDIALLNKTLDALK  389



>ref|XP_002305750.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE86261.2| lipase class 3 family protein [Populus trichocarpa]
Length=395

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDLEGLS-YHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            + KS YLK    +S +H+L  Y+HG+ G QGS+GGFE   + D+A +N+  D LK
Sbjct  305  TTKSKYLKSPGNVSSWHNLEAYLHGVAGTQGSKGGFELVANRDIALINKTTDGLK  359



>ref|XP_006362440.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=431

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDL-EGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            ++KS YLK   +  S+H+   Y+HGI G QGS+GGF+   + D++ +N+Y D LK
Sbjct  342  TRKSGYLKSPGDQSSFHNTDCYLHGIAGTQGSKGGFKLEVERDISLINKYLDALK  396



>ref|XP_007153706.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
 gb|ESW25700.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
Length=399

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -1

Query  167  SKKSHYLKDLEGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            ++KS +LK  EG+S H+L  Y+HG+ G QG +GGF    + D+A +N+  D LK
Sbjct  306  TRKSKFLK--EGVSAHNLEAYLHGVAGTQGKKGGFNLEVNRDIALLNKGMDALK  357



>ref|XP_009765842.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=414

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDL-EGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            + KS YLK   +  S+H++  Y+HG+ G QGS+GGF+     D++ VN+Y D LK
Sbjct  325  TTKSTYLKSPGDESSWHNMDCYLHGVAGTQGSKGGFKLEVQHDISVVNKYLDALK  379



>ref|XP_010655496.1| PREDICTED: phospholipase A1-IIgamma isoform X2 [Vitis vinifera]
Length=321

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = -1

Query  167  SKKSHYLKDLEGLS-YHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYL  9
            ++KS YLK    LS +H+L  ++HG+ G QGS+GGF    + D+A VN+  D L
Sbjct  230  TRKSKYLKSPGNLSTWHNLEAHLHGVAGTQGSRGGFRLEVNRDIALVNKSIDAL  283



>ref|XP_009393076.1| PREDICTED: phospholipase A1-II 1 [Musa acuminata subsp. malaccensis]
Length=396

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDLEGLS-YHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            ++KS YLK    L+ +H+L  Y+HG  G QG +GGF+   D D+A VN+  D LK
Sbjct  306  TRKSEYLKAPGDLTTWHNLECYLHGTAGAQGRRGGFKLAIDRDVALVNKSTDALK  360



>ref|XP_003608122.1| Lipase [Medicago truncatula]
Length=387

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = -1

Query  158  SHYLKDLEGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            S YLK   G+S H++ +Y+HGI G QGS+GGF    + D+A +N+  D LK
Sbjct  297  SKYLK--SGVSEHNMEVYLHGIAGTQGSKGGFNLEVNRDIALLNKSNDGLK  345



>gb|EYU36835.1| hypothetical protein MIMGU_mgv1a020546mg [Erythranthe guttata]
Length=426

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDLEGLS-YHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            + KS YLK    LS +H L  Y+HG+ G QGS+GGF+   +  LA VN++ D LK
Sbjct  336  TDKSSYLKSPGNLSSWHSLEGYLHGVAGTQGSRGGFKLEVNRSLALVNKHMDGLK  390



>emb|CDO96757.1| unnamed protein product [Coffea canephora]
Length=372

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDLEGLS-YHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            + KS YLK+   LS +H L  YMHG+ G QG Q GF+   + D+A +N+Y D LK
Sbjct  283  TTKSKYLKNPGNLSSWHSLECYMHGVAGKQGLQEGFKLVVNRDVALLNKYMDVLK  337



>emb|CBI30665.3| unnamed protein product [Vitis vinifera]
Length=368

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = -1

Query  167  SKKSHYLKDLEGLS-YHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYL  9
            ++KS YLK    LS +H+L  ++HG+ G QGS+GGF    + D+A VN+  D L
Sbjct  277  TRKSKYLKSPGNLSTWHNLEAHLHGVAGTQGSRGGFRLEVNRDIALVNKSIDAL  330



>ref|XP_003541709.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=421

 Score = 45.4 bits (106),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDL-EGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            ++KS YLK      S+H+L  Y+HG+ G QGS+GGF      D+A VN+  D LK
Sbjct  332  TRKSMYLKSPGNPSSWHNLEAYLHGVAGTQGSKGGFNLEVHRDIALVNKTLDALK  386



>gb|KHN08451.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score = 45.4 bits (106),  Expect = 0.001, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -1

Query  167  SKKSHYLKDL-EGLSYHDLMLYMHGIDGYQGSQGGFERHGDFDLAKVNRYGDYLK  6
            ++KS YLK      S+H+L  Y+HG+ G QGS+GGF      D+A VN+  D LK
Sbjct  307  TRKSMYLKSPGNPSSWHNLEAYLHGVAGTQGSKGGFNLEVHRDIALVNKTLDALK  361



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 516244808268