BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18212_g1_i1 len=409 path=[1:0-52 54:53-105 107:106-109 111:110-408]

Length=409
                                                                      Score     E

ref|XP_003629332.1|  Defensin                                         50.4    8e-06   
ref|XP_009614667.1|  PREDICTED: defensin-like protein                 47.8    6e-05   
gb|AFK44299.1|  unknown                                               47.8    7e-05   
ref|XP_009768915.1|  PREDICTED: defensin-like protein isoform X2      47.4    9e-05   
ref|XP_009768914.1|  PREDICTED: defensin-like protein isoform X1      47.0    1e-04   
ref|XP_003628979.1|  Defensin                                         46.6    2e-04   
gb|ACN93800.1|  defensin precursor                                    46.2    2e-04   Vigna unguiculata
gb|KHN06998.1|  Defensin-like protein                                 46.2    3e-04   
ref|XP_006585876.1|  PREDICTED: defensin-like protein-like            46.6    3e-04   
ref|XP_007156390.1|  hypothetical protein PHAVU_003G282400g           44.7    8e-04   
ref|XP_004509602.1|  PREDICTED: defensin-1-like                       44.7    9e-04   



>ref|XP_003629332.1| Defensin [Medicago truncatula]
 gb|AET03808.1| Defensin MtDef4.5 [Medicago truncatula]
Length=81

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 40/68 (59%), Gaps = 5/68 (7%)
 Frame = +3

Query  81   DFLKSIVIILFLMLLSSTEMGPTMSAEAKKMCIGK----RGRCWSDGHCKSLCKGQGLCD  248
             FL    I LFL++L +TEMG  M  EA+K C+ +    +G C SD +C ++C  +G  D
Sbjct  4    QFLSIRTIFLFLLVLVATEMGSIMVVEARK-CLSQSHSFKGLCLSDQNCATVCLTEGFTD  62

Query  249  GKCSFLKQ  272
            G+C   +Q
Sbjct  63   GRCRGFRQ  70



>ref|XP_009614667.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 5/61 (8%)
 Frame = +3

Query  102  IILFLMLLSSTEMGPTMSAEAKKMCIGK----RGRCWSDGHCKSLCKGQGLCDGKCSFLK  269
            + L LM++ +TEMGP M AEA+  C  +    +G C S+ +C S+C  +G  DGKC  L+
Sbjct  8    VFLLLMVVFATEMGPVMVAEARN-CESQSERFKGVCVSNRNCASVCNTEGFPDGKCKGLR  66

Query  270  Q  272
            +
Sbjct  67   R  67



>gb|AFK44299.1| unknown [Lotus japonicus]
Length=78

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 5/62 (8%)
 Frame = +3

Query  99   VIILFLMLLSSTEMGPTMSAEAKKMCIGK----RGRCWSDGHCKSLCKGQGLCDGKCSFL  266
             I +FL+LL +TEMGPTM AEA+  C  +    +G C SD +C S+C G+    G C   
Sbjct  10   TIFVFLLLLVATEMGPTMVAEARD-CESQSHRFKGPCVSDTNCASVCHGEKFSGGHCRGF  68

Query  267  KQ  272
            ++
Sbjct  69   RR  70



>ref|XP_009768915.1| PREDICTED: defensin-like protein isoform X2 [Nicotiana sylvestris]
Length=79

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 5/61 (8%)
 Frame = +3

Query  102  IILFLMLLSSTEMGPTMSAEAKKMCIGK----RGRCWSDGHCKSLCKGQGLCDGKCSFLK  269
            + L LM++ +TEMGP M AEA+  C  +    +G C S+ +C S+C  +G  DGKC  L+
Sbjct  12   VFLLLMVVFATEMGPIMVAEARN-CESQSQRFKGVCVSNRNCASVCNTEGFPDGKCKGLR  70

Query  270  Q  272
            +
Sbjct  71   R  71



>ref|XP_009768914.1| PREDICTED: defensin-like protein isoform X1 [Nicotiana sylvestris]
Length=80

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 40/66 (61%), Gaps = 5/66 (8%)
 Frame = +3

Query  87   LKSIVIILFLMLLSSTEMGPTMSAEAKKMCIGK----RGRCWSDGHCKSLCKGQGLCDGK  254
            L S V +L +++ ++ EMGP M AEA+  C  +    +G C S+ +C S+C  +G  DGK
Sbjct  8    LLSTVFLLLMVVFATEEMGPIMVAEARN-CESQSQRFKGVCVSNRNCASVCNTEGFPDGK  66

Query  255  CSFLKQ  272
            C  L++
Sbjct  67   CKGLRR  72



>ref|XP_003628979.1| Defensin [Medicago truncatula]
 ref|XP_003636616.1| Defensin [Medicago truncatula]
 gb|AET03455.1| Defensin MtDef4.4 [Medicago truncatula]
Length=78

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (57%), Gaps = 3/60 (5%)
 Frame = +3

Query  102  IILFLMLLSSTEMGPTMSAEAKKMCIGK---RGRCWSDGHCKSLCKGQGLCDGKCSFLKQ  272
            I +F +LL +TEMGP M AEA+         +G C SD +C S+C+ +G   G C   +Q
Sbjct  11   IFVFFLLLVATEMGPIMVAEARTCETPSNNFKGLCVSDTNCASVCQTEGFPGGHCEGFRQ  70



>gb|ACN93800.1| defensin precursor [Vigna unguiculata]
Length=78

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 5/61 (8%)
 Frame = +3

Query  102  IILFLMLLSSTEMGPTMSAEAKKMCIGK----RGRCWSDGHCKSLCKGQGLCDGKCSFLK  269
            I +FL+LL +TEMGPTM AEA+  C  +    +G C SD +C S+C+ +    G C   +
Sbjct  11   IFVFLLLLVATEMGPTMVAEART-CESQSHRFKGPCVSDTNCASVCRTERFSGGHCRGFR  69

Query  270  Q  272
            +
Sbjct  70   R  70



>gb|KHN06998.1| Defensin-like protein [Glycine soja]
Length=84

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 5/57 (9%)
 Frame = +3

Query  99   VIILFLMLLSSTEMGPTMSAEAKKMCIGK----RGRCWSDGHCKSLCKGQGLCDGKC  257
             I + L+LL +TEMGPTM AEA + C  +    +G C SD +C S+C+ +G   G C
Sbjct  10   TIFVLLLLLIATEMGPTMVAEA-RTCESQSHRFKGPCLSDTNCGSVCRTEGFSGGHC  65



>ref|XP_006585876.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=127

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 5/57 (9%)
 Frame = +3

Query  99   VIILFLMLLSSTEMGPTMSAEAKKMCIGK----RGRCWSDGHCKSLCKGQGLCDGKC  257
             I + L+LL +TEMGPTM AEA + C  +    +G C SD +C S+C+ +G   G C
Sbjct  10   TIFVLLLLLIATEMGPTMVAEA-RTCESQSHRFKGPCLSDTNCGSVCRTEGFSGGHC  65



>ref|XP_007156390.1| hypothetical protein PHAVU_003G282400g [Phaseolus vulgaris]
 gb|ESW28384.1| hypothetical protein PHAVU_003G282400g [Phaseolus vulgaris]
Length=78

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 34/57 (60%), Gaps = 5/57 (9%)
 Frame = +3

Query  99   VIILFLMLLSSTEMGPTMSAEAKKMCIGK----RGRCWSDGHCKSLCKGQGLCDGKC  257
             I +FL+LL +TEMGP M AEA+  C  +    RG+C SD +C S C+ +    G C
Sbjct  10   TIFVFLLLLLATEMGPRMVAEARG-CESRSRHLRGKCESDENCASACRTERFSGGHC  65



>ref|XP_004509602.1| PREDICTED: defensin-1-like [Cicer arietinum]
Length=80

 Score = 44.7 bits (104),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 6/66 (9%)
 Frame = +3

Query  75   MADFLKSI-VIILFLMLLSSTEMGPTMSAEAKKMCIGK----RGRCWSDGHCKSLCKGQG  239
            MA  L S+  I +  +LL  TEMG  M AEA+  CI K    +G C  D +C ++C+ +G
Sbjct  1    MARLLSSVSTIFVMFLLLVVTEMGANMVAEARS-CISKSFTYKGLCVHDRNCANVCRTEG  59

Query  240  LCDGKC  257
              +G C
Sbjct  60   FVEGHC  65



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 521396800190