BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18196_g1_i3 len=1959 path=[1:0-685 687:686-1425 1427:1426-1958]

Length=1959
                                                                      Score     E

gb|AHZ08762.1|  flavonoid biosynthesis oxidoreductase protein           572   0.0      
ref|XP_009608170.1|  PREDICTED: flavanone 3-dioxygenase                 572   0.0      
ref|XP_006347521.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    570   0.0      
ref|NP_001233840.1|  flavonoid biosynthesis oxidoreductase protein      567   0.0      
ref|XP_009797505.1|  PREDICTED: flavanone 3-dioxygenase                 565   0.0      
ref|XP_006347314.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    564   0.0      
ref|XP_011090789.1|  PREDICTED: flavanone 3-dioxygenase-like            563   0.0      
ref|XP_004241427.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    558   0.0      
emb|CDP04983.1|  unnamed protein product                                553   0.0      
gb|EYU31999.1|  hypothetical protein MIMGU_mgv1a009622mg                551   0.0      
ref|XP_011003288.1|  PREDICTED: flavanone 3-dioxygenase                 549   0.0      
gb|KHG13755.1|  Flavanone 3-dioxygenase                                 546   0.0      
ref|XP_011043760.1|  PREDICTED: flavanone 3-dioxygenase-like            546   0.0      
ref|XP_007039214.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    545   0.0      
ref|XP_010048418.1|  PREDICTED: flavanone 3-dioxygenase                 543   0.0      
ref|XP_006578869.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    541   0.0      
ref|XP_004307914.1|  PREDICTED: flavanone 3-dioxygenase-like            541   0.0      
gb|AIC75909.1|  flavonoid 3-hydroxylase                                 540   0.0      
gb|KDP30058.1|  hypothetical protein JCGZ_18383                         540   0.0      
gb|KHN23297.1|  Flavanone 3-dioxygenase                                 538   0.0      
ref|XP_006478091.1|  PREDICTED: flavanone 3-dioxygenase-like            538   0.0      
ref|XP_003526765.1|  PREDICTED: flavanone 3-dioxygenase-like            535   0.0      
ref|XP_002273640.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    535   0.0      Vitis vinifera
emb|CAN63747.1|  hypothetical protein VITISV_009059                     533   0.0      Vitis vinifera
ref|XP_010035324.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    533   0.0      
ref|XP_011093200.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    533   0.0      
ref|XP_010034909.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    532   0.0      
ref|XP_010038390.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    531   0.0      
ref|XP_002524434.1|  1-aminocyclopropane-1-carboxylate oxidase, p...    529   0.0      Ricinus communis
ref|XP_010089920.1|  Naringenin,2-oxoglutarate 3-dioxygenase            527   4e-180   
ref|XP_010671334.1|  PREDICTED: flavanone 3-dioxygenase                 526   8e-180   
ref|XP_007218269.1|  hypothetical protein PRUPE_ppa008269mg             526   1e-179   
ref|XP_007136430.1|  hypothetical protein PHAVU_009G044600g             523   9e-179   
ref|XP_004502767.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          517   3e-176   
ref|XP_003602395.1|  1-aminocyclopropane-1-carboxylate oxidase          516   1e-175   
ref|XP_008362804.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    516   1e-175   
ref|XP_010525537.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    513   1e-174   
ref|XP_008234635.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    511   5e-174   
ref|XP_010241045.1|  PREDICTED: hyoscyamine 6-dioxygenase-like is...    511   6e-174   
ref|XP_009351913.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    509   3e-173   
ref|XP_002872117.1|  oxidoreductase                                     509   3e-173   
ref|NP_001267994.1|  uncharacterized protein LOC100854106               509   4e-173   
ref|NP_197841.1|  putative 2OG-Fe(II) oxygenase                         509   6e-173   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010251364.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    508   8e-173   
ref|XP_010421278.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    508   1e-172   
ref|XP_009361273.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    508   1e-172   
ref|XP_010454772.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    507   2e-172   
ref|XP_008376823.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    507   3e-172   
ref|XP_010493615.1|  PREDICTED: 2'-deoxymugineic-acid 2'-dioxygen...    506   8e-172   
ref|XP_008462909.1|  PREDICTED: LOW QUALITY PROTEIN: flavanone 3-...    505   1e-171   
ref|XP_011075887.1|  PREDICTED: hyoscyamine 6-dioxygenase               504   6e-171   
ref|XP_006394708.1|  hypothetical protein EUTSA_v10004527mg             501   9e-170   
ref|XP_004137205.1|  PREDICTED: flavanone 3-dioxygenase-like            499   2e-169   
gb|AAM62620.1|  flavanone 3-hydroxylase-like protein                    499   3e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288115.1|  hypothetical protein CARUB_v10001347mg             498   2e-168   
ref|XP_010541508.1|  PREDICTED: 2'-deoxymugineic-acid 2'-dioxygenase    496   3e-168   
ref|XP_010038475.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    493   9e-167   
gb|KFK27729.1|  hypothetical protein AALP_AA8G421900                    492   2e-166   
ref|XP_009150979.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    492   2e-166   
emb|CDX88109.1|  BnaA06g27000D                                          492   3e-166   
ref|XP_009130058.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    491   3e-166   
emb|CDY05412.1|  BnaC02g41200D                                          491   3e-166   
emb|CDX80450.1|  BnaC07g29940D                                          486   4e-164   
gb|EEC74418.1|  hypothetical protein OsI_09784                          485   9e-164   Oryza sativa Indica Group [Indian rice]
ref|NP_001048799.1|  Os03g0122300                                       484   3e-163   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003558942.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    481   5e-162   
ref|XP_008650338.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    478   5e-161   
ref|XP_004985921.1|  PREDICTED: flavanone 3-dioxygenase-like            478   6e-161   
gb|AAL58118.1|AC092697_6  putative flavanone 3-hydroxylase              477   1e-160   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649297.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    478   1e-160   
ref|XP_006662003.1|  PREDICTED: flavanone 3-dioxygenase-like            476   5e-160   
dbj|BAJ98133.1|  predicted protein                                      475   7e-160   
ref|XP_008354296.1|  PREDICTED: 2'-deoxymugineic-acid 2'-dioxygen...    474   1e-159   
ref|XP_002467587.1|  hypothetical protein SORBIDRAFT_01g030560          473   6e-159   Sorghum bicolor [broomcorn]
ref|XP_009411417.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    470   6e-158   
ref|XP_010934017.1|  PREDICTED: flavanone 3-dioxygenase                 469   1e-157   
ref|XP_009389864.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    468   5e-157   
ref|XP_009382233.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    466   4e-156   
ref|XP_009397555.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    466   1e-155   
ref|XP_009400200.1|  PREDICTED: flavanone 3-dioxygenase-like            463   4e-155   
ref|XP_002465962.1|  hypothetical protein SORBIDRAFT_01g049030          461   2e-154   Sorghum bicolor [broomcorn]
ref|XP_008797642.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    461   3e-154   
ref|XP_008650332.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    462   3e-154   
ref|XP_009400481.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    456   2e-152   
ref|XP_003580379.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    454   1e-151   
ref|XP_008783535.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    452   4e-151   
gb|EMT01663.1|  Naringenin,2-oxoglutarate 3-dioxygenase                 454   7e-151   
ref|NP_001151167.1|  gibberellin 20 oxidase 2                           452   8e-151   Zea mays [maize]
ref|XP_004983813.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    451   1e-150   
ref|XP_004976588.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    449   1e-149   
ref|XP_009389277.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    448   2e-149   
gb|EMS52381.1|  Naringenin,2-oxoglutarate 3-dioxygenase                 447   4e-148   
gb|EEE61552.1|  hypothetical protein OsJ_15896                          444   8e-148   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053651.1|  Os04g0581000                                       443   2e-147   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652690.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    441   2e-146   
ref|XP_009392937.1|  PREDICTED: flavanone 3-dioxygenase-like            435   3e-144   
gb|EMS57783.1|  Naringenin,2-oxoglutarate 3-dioxygenase                 428   1e-141   
gb|AGV54879.1|  flavanone 3-dioxygenase-like protein                    427   5e-141   
gb|EYU45321.1|  hypothetical protein MIMGU_mgv1a018206mg                422   5e-140   
gb|ABF93708.1|  oxidoreductase, 2OG-Fe oxygenase family protein, ...    422   6e-140   Oryza sativa Japonica Group [Japonica rice]
gb|EEE51319.1|  hypothetical protein OsJ_32283                          422   1e-139   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010241046.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    406   3e-134   
gb|ABB20895.1|  flavanone 3-hydroxylase                                 404   3e-132   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006421688.1|  hypothetical protein CICLE_v10005149mg             406   4e-132   
ref|XP_006490103.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          403   1e-131   
gb|KDO65452.1|  hypothetical protein CISIN_1g019027mg                   403   1e-131   
ref|XP_002317046.2|  hypothetical protein POPTR_0011s15310g             402   5e-131   Populus trichocarpa [western balsam poplar]
gb|AGX27514.1|  PRXQ2                                                   401   1e-130   
ref|XP_010941174.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    400   1e-130   
ref|XP_010040087.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    400   1e-130   
gb|ABG66223.1|  oxidoreductase, 2OG-Fe oxygenase family protein, ...    397   2e-130   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010251334.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    400   3e-130   
ref|XP_010040086.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    399   4e-130   
ref|XP_002300519.1|  hypothetical protein POPTR_0001s45610g             397   3e-129   Populus trichocarpa [western balsam poplar]
gb|KDP27711.1|  hypothetical protein JCGZ_19834                         397   3e-129   
ref|XP_011038018.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          395   9e-129   
ref|XP_007211193.1|  hypothetical protein PRUPE_ppa008100mg             395   1e-128   
ref|XP_006397057.1|  hypothetical protein EUTSA_v10028770mg             395   2e-128   
ref|XP_002278004.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    395   2e-128   Vitis vinifera
ref|XP_007209285.1|  hypothetical protein PRUPE_ppa008091mg             394   3e-128   
ref|XP_004985922.1|  PREDICTED: uncharacterized protein LOC101778942    420   3e-128   
ref|XP_010104902.1|  Hyoscyamine 6-dioxygenase                          394   6e-128   
ref|XP_004309513.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          393   1e-127   
ref|XP_009388156.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    392   2e-127   
ref|XP_008797635.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    392   2e-127   
ref|XP_006465312.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          392   2e-127   
gb|KEH18558.1|  1-aminocyclopropane-1-carboxylate oxidase               392   3e-127   
ref|XP_006427307.1|  hypothetical protein CICLE_v10025958mg             391   5e-127   
ref|XP_010040085.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    391   6e-127   
ref|XP_008392657.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          390   8e-127   
ref|XP_007039318.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    390   1e-126   
ref|XP_003548081.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    390   2e-126   
ref|XP_010054742.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    392   3e-126   
ref|XP_008375465.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    390   3e-126   
ref|XP_010039652.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    389   3e-126   
ref|XP_010039651.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    389   4e-126   
ref|XP_008775841.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    389   4e-126   
ref|XP_011042696.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    389   4e-126   
ref|XP_008392659.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          388   7e-126   
ref|XP_009348691.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          388   8e-126   
ref|XP_002518945.1|  1-aminocyclopropane-1-carboxylate oxidase, p...    388   9e-126   Ricinus communis
ref|XP_003528757.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    387   1e-125   
ref|XP_008245738.1|  PREDICTED: hyoscyamine 6-dioxygenase-like is...    386   4e-125   
ref|XP_010941175.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    385   9e-125   
ref|XP_010455445.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          385   1e-124   
gb|KFK31848.1|  hypothetical protein AALP_AA6G166400                    385   1e-124   
gb|KDP28403.1|  hypothetical protein JCGZ_14174                         385   2e-124   
ref|XP_009348690.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          384   2e-124   
ref|XP_004510617.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    384   3e-124   
ref|XP_009360216.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    383   6e-124   
ref|XP_002872518.1|  predicted protein                                  384   6e-124   
ref|XP_010042284.1|  PREDICTED: 2'-deoxymugineic-acid 2'-dioxygen...    384   6e-124   
ref|XP_004308273.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    383   1e-123   
ref|XP_010437070.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          383   1e-123   
ref|XP_009335249.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    382   2e-123   
ref|XP_003581564.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    382   2e-123   
ref|NP_192787.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    382   3e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002278024.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    381   3e-123   Vitis vinifera
ref|XP_002267625.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    381   5e-123   Vitis vinifera
ref|XP_002320903.2|  hypothetical protein POPTR_0014s10230g             381   5e-123   Populus trichocarpa [western balsam poplar]
ref|XP_009113617.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    382   6e-123   
tpg|DAA36335.1|  TPA: hypothetical protein ZEAMMB73_926701              381   6e-123   
ref|XP_010919037.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    380   1e-122   
ref|XP_002448382.1|  hypothetical protein SORBIDRAFT_06g026350          380   1e-122   Sorghum bicolor [broomcorn]
ref|XP_002515091.1|  1-aminocyclopropane-1-carboxylate oxidase, p...    379   2e-122   Ricinus communis
ref|XP_010934019.1|  PREDICTED: LOW QUALITY PROTEIN: naringenin,2...    380   2e-122   
ref|XP_007135331.1|  hypothetical protein PHAVU_010G120300g             379   2e-122   
ref|XP_010538868.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    378   7e-122   
ref|XP_008244203.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    377   1e-121   
ref|XP_009134194.1|  PREDICTED: hyoscyamine 6-dioxygenase               378   1e-121   
ref|XP_007219345.1|  hypothetical protein PRUPE_ppa019415mg             377   2e-121   
ref|XP_008245737.1|  PREDICTED: hyoscyamine 6-dioxygenase-like is...    377   3e-121   
emb|CDY05103.1|  BnaC03g29010D                                          376   3e-121   
ref|XP_007219505.1|  hypothetical protein PRUPE_ppa022381mg             376   4e-121   
ref|XP_006421681.1|  hypothetical protein CICLE_v10007009mg             373   2e-120   
ref|XP_006288068.1|  hypothetical protein CARUB_v10001301mg             373   7e-120   
ref|XP_002872519.1|  oxidoreductase                                     372   2e-119   
emb|CAH67943.1|  H0303A11-B0406H05.3                                    372   2e-119   Oryza sativa [red rice]
ref|XP_007051408.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    371   4e-119   
ref|XP_008783539.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    370   6e-119   
ref|XP_006583203.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    370   6e-119   
dbj|BAJ94485.1|  predicted protein                                      370   8e-119   
gb|KFK31850.1|  hypothetical protein AALP_AA6G166600                    370   8e-119   
ref|NP_001053652.1|  Os04g0581100                                       370   1e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006397055.1|  hypothetical protein EUTSA_v10028774mg             369   3e-118   
ref|XP_006653701.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    369   3e-118   
ref|NP_192788.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    368   7e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134195.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    367   1e-117   
emb|CDX90761.1|  BnaA03g24410D                                          367   1e-117   
ref|XP_008360739.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          366   1e-117   
gb|KHN16398.1|  Flavonol synthase/flavanone 3-hydroxylase               365   3e-117   
ref|XP_010437037.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    366   3e-117   
gb|KCW77284.1|  hypothetical protein EUGRSUZ_D01643                     365   4e-117   
emb|CDX86858.1|  BnaA09g22480D                                          365   5e-117   
ref|XP_006288121.1|  hypothetical protein CARUB_v10001353mg             365   7e-117   
ref|XP_010054743.1|  PREDICTED: 2'-deoxymugineic-acid 2'-dioxygen...    366   7e-117   
ref|XP_003521829.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    365   7e-117   
ref|XP_004145878.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    363   3e-116   
ref|XP_004165509.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    363   4e-116   
ref|XP_008437463.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    363   5e-116   
gb|AAP54811.2|  oxidoreductase, 2OG-Fe oxygenase family protein, ...    359   8e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002300518.1|  hypothetical protein POPTR_0001s45600g             362   1e-115   Populus trichocarpa [western balsam poplar]
emb|CDX99548.1|  BnaC09g24440D                                          359   8e-115   
ref|XP_010421965.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    358   5e-114   
ref|XP_010455446.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    357   1e-113   
gb|KDO39552.1|  hypothetical protein CISIN_1g020127mg                   354   8e-113   
emb|CDX99550.1|  BnaC09g24420D                                          345   2e-109   
emb|CBI34622.3|  unnamed protein product                                343   7e-109   
dbj|BAJ95938.1|  predicted protein                                      338   1e-107   
gb|KCW45490.1|  hypothetical protein EUGRSUZ_L00788                     340   3e-107   
ref|XP_006421685.1|  hypothetical protein CICLE_v10006618mg             340   3e-107   
gb|KCW45838.1|  hypothetical protein EUGRSUZ_L00351                     338   1e-105   
gb|ADE77790.1|  unknown                                                 328   2e-102   
gb|ABK26685.1|  unknown                                                 323   2e-100   Picea sitchensis
ref|XP_002321354.2|  hypothetical protein POPTR_0015s00510g             315   1e-99    Populus trichocarpa [western balsam poplar]
ref|XP_002318498.2|  hypothetical protein POPTR_0012s00660g             313   6e-99    Populus trichocarpa [western balsam poplar]
ref|XP_011038017.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    318   9e-99    
gb|KCW46636.1|  hypothetical protein EUGRSUZ_K004471                    309   1e-97    
ref|XP_002300517.2|  hypothetical protein POPTR_0001s45580g             315   2e-97    Populus trichocarpa [western balsam poplar]
gb|KHG05802.1|  Gibberellin 20 oxidase 2                                307   2e-96    
ref|XP_008797638.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    308   7e-96    
ref|XP_008797637.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    309   3e-95    
gb|EMS45572.1|  Naringenin,2-oxoglutarate 3-dioxygenase                 307   2e-94    
gb|KCW45836.1|  hypothetical protein EUGRSUZ_L00350                     304   5e-93    
ref|XP_008356982.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    299   9e-93    
ref|XP_009109951.1|  PREDICTED: gibberellin 20 oxidase 2-like           296   2e-92    
ref|XP_008245821.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          298   3e-92    
gb|ACU23251.1|  unknown                                                 298   3e-92    Glycine max [soybeans]
ref|XP_007039320.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    297   2e-91    
ref|XP_002888500.1|  predicted protein                                  293   3e-90    
ref|XP_008382909.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    290   6e-90    
ref|XP_008376267.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          300   6e-90    
gb|AAN74829.1|  Putative flavanone 3-hydroxylase                        290   3e-89    Oryza sativa Japonica Group [Japonica rice]
gb|ABK21816.1|  unknown                                                 291   1e-88    Picea sitchensis
gb|ABK22911.1|  unknown                                                 290   3e-88    Picea sitchensis
ref|XP_006421684.1|  hypothetical protein CICLE_v10007024mg             283   2e-86    
ref|XP_011038015.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    285   3e-86    
ref|XP_011038122.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    285   5e-86    
ref|XP_011028793.1|  PREDICTED: 2'-deoxymugineic-acid 2'-dioxygen...    283   3e-85    
ref|XP_009354968.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          281   8e-85    
gb|AHW42451.1|  GA2ox1                                                  281   1e-84    
ref|XP_007199354.1|  hypothetical protein PRUPE_ppa025199mg             280   2e-84    
ref|XP_011040623.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    281   2e-84    
ref|XP_010111901.1|  Hyoscyamine 6-dioxygenase                          280   4e-84    
gb|ABK22784.1|  unknown                                                 280   4e-84    Picea sitchensis
ref|XP_011010090.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    279   9e-84    
gb|ABK23053.1|  unknown                                                 279   1e-83    Picea sitchensis
ref|XP_002302052.2|  hypothetical protein POPTR_0002s04070g             278   1e-83    Populus trichocarpa [western balsam poplar]
ref|XP_002317047.2|  hypothetical protein POPTR_0011s15320g             280   2e-83    Populus trichocarpa [western balsam poplar]
ref|XP_002317048.2|  hypothetical protein POPTR_0011s15340g             278   3e-83    Populus trichocarpa [western balsam poplar]
ref|XP_002317049.2|  hypothetical protein POPTR_0011s16710g             278   4e-83    Populus trichocarpa [western balsam poplar]
ref|XP_002989580.1|  2-oxoglutarate-iron(II)-dependent oxygenase        278   4e-83    
ref|XP_009389870.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    272   9e-83    
ref|XP_011040620.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    275   2e-82    
ref|XP_006421682.1|  hypothetical protein CICLE_v10006486mg             273   2e-82    
ref|XP_010679241.1|  PREDICTED: 2'-deoxymugineic-acid 2'-dioxygen...    275   2e-82    
gb|AHW42461.1|  GA2ox11                                                 276   2e-82    
ref|XP_006443857.1|  hypothetical protein CICLE_v10024242mg             274   3e-82    
ref|XP_011010089.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    275   5e-82    
ref|XP_011083312.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          274   6e-82    
gb|KDO39553.1|  hypothetical protein CISIN_1g044795mg                   271   1e-81    
ref|XP_002302051.1|  hypothetical protein POPTR_0002s04060g             273   1e-81    Populus trichocarpa [western balsam poplar]
ref|XP_006377883.1|  hypothetical protein POPTR_0011s15350g             273   1e-81    
gb|ABK22814.1|  unknown                                                 273   2e-81    Picea sitchensis
ref|XP_011040618.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    273   3e-81    
ref|XP_004292201.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          272   3e-81    
ref|XP_006288120.1|  hypothetical protein CARUB_v10001353mg             269   3e-81    
ref|XP_010679238.1|  PREDICTED: 2'-deoxymugineic-acid 2'-dioxygen...    271   4e-81    
ref|XP_011010088.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    272   4e-81    
gb|KHG09975.1|  Hyoscyamine 6-dioxygenase                               271   5e-81    
ref|XP_009354934.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          271   6e-81    
ref|XP_002975246.1|  2-oxoacid-dependent dioxygenase                    271   8e-81    
ref|XP_002964234.1|  oxidoreductase                                     271   1e-80    
ref|XP_011040619.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    271   1e-80    
gb|ABK26232.1|  unknown                                                 271   2e-80    Picea sitchensis
ref|XP_007222215.1|  hypothetical protein PRUPE_ppa007852mg             270   3e-80    
ref|XP_004292202.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          268   9e-80    
ref|XP_003536937.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          268   1e-79    
ref|XP_007044805.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    267   2e-79    
ref|XP_006441262.1|  hypothetical protein CICLE_v10022725mg             260   2e-79    
ref|XP_010679236.1|  PREDICTED: 2'-deoxymugineic-acid 2'-dioxygen...    267   3e-79    
ref|XP_008221139.1|  PREDICTED: 2'-deoxymugineic-acid 2'-dioxygen...    266   7e-79    
ref|XP_011100328.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    267   1e-78    
gb|KEH42556.1|  hyoscyamine 6-dioxygenase-like protein                  265   1e-78    
emb|CDX90759.1|  BnaA03g24390D                                          263   2e-78    
gb|ABK23247.1|  unknown                                                 261   3e-78    
ref|XP_002532366.1|  1-aminocyclopropane-1-carboxylate oxidase, p...    263   4e-78    
ref|XP_007144913.1|  hypothetical protein PHAVU_007G194000g             263   6e-78    
ref|XP_002306841.1|  hypothetical protein POPTR_0005s24440g             263   9e-78    
ref|XP_006427305.1|  hypothetical protein CICLE_v10027096mg             261   1e-77    
ref|XP_011025997.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          262   2e-77    
ref|XP_011026002.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          262   3e-77    
gb|KHF99637.1|  Hyoscyamine 6-dioxygenase                               261   3e-77    
ref|XP_001780809.1|  predicted protein                                  261   6e-77    
ref|XP_004310153.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    260   8e-77    
gb|KHF98282.1|  Hyoscyamine 6-dioxygenase                               260   9e-77    
ref|XP_004146985.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          259   2e-76    
ref|XP_010241650.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    259   4e-76    
ref|XP_002993848.1|  2-oxoacid-dependent dioxygenase                    258   6e-76    
ref|XP_004495106.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          258   6e-76    
ref|XP_002965939.1|  2-oxoacid-dependent dioxygenase                    258   6e-76    
gb|KCW84720.1|  hypothetical protein EUGRSUZ_B01535                     258   6e-76    
ref|XP_010039153.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          259   7e-76    
emb|CDP15311.1|  unnamed protein product                                259   7e-76    
ref|XP_002968370.1|  2-oxoacid dioxygenase                              258   8e-76    
ref|XP_002965940.1|  2-oxoacid-dependent dioxygenase                    257   2e-75    
ref|XP_006421686.1|  hypothetical protein CICLE_v10006688mg             254   2e-75    
gb|KEH42554.1|  aminocyclopropanecarboxylate oxidase                    257   2e-75    
ref|XP_004289929.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          257   2e-75    
ref|XP_006352743.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          256   2e-75    
gb|AAM48133.1|AF509338_1  putative flavanone 3-hydroxylase              256   3e-75    
ref|XP_002965941.1|  2-oxoacid-dependent dioxygenase                    256   5e-75    
ref|XP_008387868.1|  PREDICTED: 2'-deoxymugineic-acid 2'-dioxygen...    256   6e-75    
ref|XP_002264085.1|  PREDICTED: hyoscyamine 6-dioxygenase               255   8e-75    
ref|XP_009334203.1|  PREDICTED: 2'-deoxymugineic-acid 2'-dioxygen...    255   1e-74    
ref|XP_010654004.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    256   1e-74    
ref|XP_002968368.1|  2-oxoacid-dependent dioxygenase                    254   2e-74    
gb|KHG05803.1|  Naringenin,2-oxoglutarate 3-dioxygenase                 246   3e-74    
ref|XP_006389039.1|  hypothetical protein POPTR_0056s00260g             253   4e-74    
gb|KDO65454.1|  hypothetical protein CISIN_1g042145mg                   249   5e-74    
ref|XP_006382387.1|  hypothetical protein POPTR_0005s01660g             253   5e-74    
ref|XP_002317662.2|  hypothetical protein POPTR_0011s15420g             253   5e-74    
ref|XP_002300515.2|  hypothetical protein POPTR_0001s45550g             252   8e-74    
ref|XP_002963905.1|  oxidoreductase 2-oxoglutarate-Iron(II)-depen...    253   9e-74    
ref|XP_006490220.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    249   9e-74    
ref|XP_004242358.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          252   1e-73    
ref|XP_002446985.1|  hypothetical protein SORBIDRAFT_06g026340          247   1e-73    
ref|XP_011040611.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    251   1e-73    
gb|KHF99636.1|  Hyoscyamine 6-dioxygenase                               251   2e-73    
ref|XP_009354977.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          251   2e-73    
ref|XP_007201497.1|  hypothetical protein PRUPE_ppa014841mg             251   3e-73    
ref|XP_011038934.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          251   3e-73    
ref|XP_007050320.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    251   4e-73    
ref|XP_010940496.1|  PREDICTED: 2'-deoxymugineic-acid 2'-dioxygen...    252   4e-73    
ref|XP_011040622.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    248   4e-73    
ref|XP_008235696.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          251   4e-73    
ref|XP_006374077.1|  hypothetical protein POPTR_0015s00500g             243   7e-73    
ref|XP_009785264.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    251   7e-73    
gb|KEH23177.1|  leucoanthocyanidin dioxygenase-like protein             250   9e-73    
emb|CDO99823.1|  unnamed protein product                                251   1e-72    
ref|XP_004137996.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     251   1e-72    
gb|KHG16697.1|  Hyoscyamine 6-dioxygenase                               249   1e-72    
ref|XP_004491897.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          249   2e-72    
gb|EMT29200.1|  Naringenin,2-oxoglutarate 3-dioxygenase                 244   3e-72    
ref|XP_007204370.1|  hypothetical protein PRUPE_ppa007337mg             249   4e-72    
ref|XP_011086643.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    248   4e-72    
ref|XP_010935837.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    249   6e-72    
ref|XP_009141604.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2        248   6e-72    
ref|XP_004292203.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          247   6e-72    
ref|XP_008241350.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    248   6e-72    
ref|XP_007027527.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    251   6e-72    
ref|XP_007158397.1|  hypothetical protein PHAVU_002G149600g             247   7e-72    
ref|XP_002526463.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    248   8e-72    
ref|XP_008664561.1|  PREDICTED: 2'-deoxymugineic-acid 2'-dioxygen...    250   1e-71    
ref|XP_004516960.1|  PREDICTED: thebaine 6-O-demethylase-like           248   1e-71    
ref|XP_004233151.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          247   1e-71    
ref|XP_009386210.1|  PREDICTED: thebaine 6-O-demethylase-like           248   1e-71    
ref|XP_008451261.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          246   2e-71    
ref|XP_006353081.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          246   2e-71    
ref|XP_011083313.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          249   2e-71    
gb|KEH21762.1|  1-aminocyclopropane-1-carboxylate oxidase               246   2e-71    
ref|XP_002965938.1|  2-oxoacid-dependent dioxygenase                    248   2e-71    
gb|KEH21761.1|  1-aminocyclopropane-1-carboxylate oxidase               246   2e-71    
ref|XP_010032128.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    247   3e-71    
ref|XP_007026685.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    246   3e-71    
ref|XP_011019103.1|  PREDICTED: thebaine 6-O-demethylase-like           246   3e-71    
dbj|BAK02804.1|  predicted protein                                      239   4e-71    
ref|XP_002968365.1|  2-oxoacid-dependent dioxygenase                    246   4e-71    
ref|XP_004507291.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          245   5e-71    
emb|CDY30486.1|  BnaA04g25870D                                          245   5e-71    
ref|XP_010528915.1|  PREDICTED: protein SRG1                            246   5e-71    
emb|CAN77294.1|  hypothetical protein VITISV_033210                     247   6e-71    
ref|XP_008347271.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    238   6e-71    
ref|XP_008442413.1|  PREDICTED: protein SRG1-like                       245   7e-71    
ref|XP_002279001.1|  PREDICTED: hyoscyamine 6-dioxygenase               245   8e-71    
ref|XP_002519428.1|  Leucoanthocyanidin dioxygenase, putative           246   9e-71    
ref|XP_004246595.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1        245   1e-70    
ref|XP_009143068.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    245   1e-70    
ref|XP_002308223.2|  hypothetical protein POPTR_0006s10210g             244   1e-70    
ref|XP_004500496.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    244   2e-70    
ref|XP_007162817.1|  hypothetical protein PHAVU_001G183300g             244   2e-70    
ref|NP_181207.2|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    244   3e-70    
ref|XP_004971189.1|  PREDICTED: protein SRG1-like                       244   3e-70    
ref|XP_006397660.1|  hypothetical protein EUTSA_v10001518mg             243   3e-70    
ref|XP_003535233.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    244   3e-70    
ref|XP_009142283.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    243   3e-70    
gb|AFK38431.1|  unknown                                                 243   3e-70    
ref|XP_010545149.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    243   3e-70    
ref|XP_009798077.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    244   4e-70    
ref|XP_006376597.1|  hypothetical protein POPTR_0012s00650g             238   4e-70    
gb|KHN18704.1|  Codeine O-demethylase                                   243   4e-70    
ref|XP_002985262.1|  2-oxoglutarate-iron(II)-dependent oxygenase        243   5e-70    
emb|CDX74687.1|  BnaA05g04330D                                          243   5e-70    
ref|XP_004308617.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    243   6e-70    
ref|XP_004250131.2|  PREDICTED: hyoscyamine 6-dioxygenase-like          242   7e-70    
ref|NP_001241598.1|  uncharacterized protein LOC100778488               243   8e-70    
gb|AAM14878.1|  putative flavonol synthase                              242   8e-70    
ref|NP_001149522.1|  gibberellin 20 oxidase 2                           244   9e-70    
emb|CDX75020.1|  BnaA05g07660D                                          243   9e-70    
ref|NP_182007.2|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    242   1e-69    
ref|XP_004304329.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    243   1e-69    
ref|XP_009369176.1|  PREDICTED: leucoanthocyanidin dioxygenase          242   1e-69    
ref|XP_006402598.1|  hypothetical protein EUTSA_v10006360mg             242   1e-69    
ref|XP_009125612.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    243   1e-69    
ref|XP_006441260.1|  hypothetical protein CICLE_v10022512mg             234   1e-69    
ref|XP_006577713.1|  PREDICTED: codeine O-demethylase-like              244   1e-69    
emb|CDY14105.1|  BnaC02g02220D                                          243   1e-69    
ref|XP_010253753.1|  PREDICTED: protein SRG1-like                       241   1e-69    
gb|KDP24441.1|  hypothetical protein JCGZ_25005                         242   2e-69    
ref|XP_002970071.1|  2-oxoglutarate-iron(II)-dependent oxygenase        241   2e-69    
ref|XP_004148957.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          241   2e-69    
ref|XP_006441261.1|  hypothetical protein CICLE_v10022512mg             235   2e-69    
ref|XP_003600918.1|  Leucoanthocyanidin dioxygenase                     241   2e-69    
emb|CDP03734.1|  unnamed protein product                                241   2e-69    
ref|XP_007141760.1|  hypothetical protein PHAVU_008G223500g             241   2e-69    
ref|XP_011024308.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    242   2e-69    
ref|XP_010508250.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    241   2e-69    
ref|XP_007199437.1|  hypothetical protein PRUPE_ppa026666mg             241   2e-69    
ref|XP_009419671.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    241   2e-69    
ref|XP_003613110.1|  1-aminocyclopropane-1-carboxylate oxidase          241   3e-69    
ref|XP_003590434.1|  Naringenin,2-oxoglutarate 3-dioxygenase            241   3e-69    
ref|XP_006354398.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    242   3e-69    
ref|XP_003613111.1|  Flavonol synthase/flavanone 3-hydroxylase          243   3e-69    
gb|AES60686.2|  leucoanthocyanidin dioxygenase-like protein             241   3e-69    
emb|CDY04960.1|  BnaAnng01420D                                          241   3e-69    
gb|KHN14530.1|  Flavonol synthase/flavanone 3-hydroxylase               240   4e-69    
ref|XP_004170094.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     240   5e-69    
ref|XP_004491898.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          239   5e-69    
ref|XP_006573023.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    240   5e-69    
ref|XP_002299412.1|  oxidoreductase family protein                      240   5e-69    
gb|KEH42547.1|  2OG-Fe(II) oxygenase family oxidoreductase              239   5e-69    
ref|XP_002316410.2|  oxidoreductase family protein                      241   5e-69    
ref|XP_011026744.1|  PREDICTED: protein SRG1                            240   6e-69    
gb|KFK36717.1|  hypothetical protein AALP_AA4G160400                    240   6e-69    
ref|XP_010518085.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    240   6e-69    
ref|XP_009130890.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    240   7e-69    
ref|XP_009598235.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 1-...    240   7e-69    
ref|XP_010111906.1|  Hyoscyamine 6-dioxygenase                          239   7e-69    
gb|KGN44744.1|  hypothetical protein Csa_7G375860                       239   7e-69    
ref|XP_004148958.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          239   8e-69    
ref|XP_009138848.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    239   8e-69    
emb|CDP03735.1|  unnamed protein product                                239   8e-69    
emb|CCX35480.1|  Downy Mildew Resistant 6-like protein                  239   9e-69    
ref|NP_001280919.1|  hyoscyamine 6-dioxygenase-like                     239   9e-69    
ref|XP_009344998.1|  PREDICTED: protein SRG1                            239   9e-69    
ref|XP_004137903.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     239   1e-68    
ref|XP_008232058.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    240   1e-68    
ref|XP_009361472.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    240   1e-68    
ref|XP_002880137.1|  oxidoreductase                                     239   1e-68    
ref|XP_010920852.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    239   1e-68    
ref|XP_011084903.1|  PREDICTED: protein SRG1-like                       239   1e-68    
ref|XP_006294468.1|  hypothetical protein CARUB_v10023480mg             239   1e-68    
gb|KHN48225.1|  Putative 2-oxoglutarate/Fe(II)-dependent dioxygenase    240   1e-68    
ref|XP_008778930.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    239   1e-68    
gb|KDP28868.1|  hypothetical protein JCGZ_14639                         238   2e-68    
ref|XP_002876545.1|  oxidoreductase                                     239   2e-68    
ref|XP_011083021.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          238   2e-68    
ref|XP_010529961.1|  PREDICTED: leucoanthocyanidin dioxygenase          238   2e-68    
emb|CDY23457.1|  BnaC04g49850D                                          239   2e-68    
ref|XP_006659703.1|  PREDICTED: 2'-deoxymugineic-acid 2'-dioxygen...    239   2e-68    
ref|XP_010101426.1|  Leucoanthocyanidin dioxygenase                     239   2e-68    
ref|XP_010516892.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    239   2e-68    
ref|XP_004243295.2|  PREDICTED: flavonol synthase/flavanone 3-hyd...    239   2e-68    
ref|XP_004514213.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     238   3e-68    
ref|XP_010667714.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    239   3e-68    
emb|CDY56988.1|  BnaA04g27300D                                          238   3e-68    
gb|EYU46466.1|  hypothetical protein MIMGU_mgv1a019872mg                238   3e-68    
ref|XP_002975060.1|  2-oxoacid-dependent dioxygenase                    238   3e-68    
ref|XP_010689599.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    238   3e-68    
ref|XP_009416290.1|  PREDICTED: codeine O-demethylase-like              238   4e-68    
ref|XP_008451257.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          237   4e-68    
ref|XP_010090425.1|  Thebaine 6-O-demethylase                           239   4e-68    
ref|XP_009409556.1|  PREDICTED: protein SRG1-like                       238   4e-68    
ref|XP_002445675.1|  hypothetical protein SORBIDRAFT_07g024030          239   4e-68    
ref|XP_003541434.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    238   4e-68    
ref|XP_003604674.1|  Leucoanthocyanidin dioxygenase                     238   4e-68    
gb|AES86871.2|  leucoanthocyanidin dioxygenase-like protein             238   5e-68    
ref|XP_009399997.1|  PREDICTED: protein SRG1-like                       238   5e-68    
gb|KDO39405.1|  hypothetical protein CISIN_1g035868mg                   238   5e-68    
ref|XP_004243300.1|  PREDICTED: protein SRG1-like                       239   6e-68    
ref|XP_009406925.1|  PREDICTED: protein SRG1-like                       237   6e-68    
ref|XP_009369495.1|  PREDICTED: hyoscyamine 6-dioxygenase-like          237   6e-68    
ref|XP_004250129.1|  PREDICTED: hyoscyamine 6-dioxygenase               236   6e-68    
ref|XP_008347068.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    238   6e-68    
ref|XP_002964787.1|  2-oxoglutarate-iron(II)-dependent oxygenase        237   6e-68    
ref|XP_010509447.1|  PREDICTED: feruloyl CoA ortho-hydroxylase 2-...    238   7e-68    
ref|XP_007050321.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    237   7e-68    
ref|XP_009384795.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    237   8e-68    
ref|XP_010506415.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    237   9e-68    
ref|XP_002272995.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    237   9e-68    
gb|KHN20840.1|  Codeine O-demethylase                                   237   9e-68    
gb|AAC97525.1|  flavanone 3-hydroxylase                                 237   9e-68    
ref|XP_008442759.1|  PREDICTED: 2'-deoxymugineic-acid 2'-dioxygenase    237   9e-68    
ref|XP_006399020.1|  hypothetical protein EUTSA_v10013861mg             237   1e-67    
gb|EMT24263.1|  Protein SRG1                                            237   1e-67    
ref|XP_006421511.1|  hypothetical protein CICLE_v10006702mg             236   1e-67    
ref|XP_010543724.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    238   1e-67    
ref|XP_003544081.1|  PREDICTED: leucoanthocyanidin dioxygenase-like     237   1e-67    
gb|AFK35107.1|  unknown                                                 236   1e-67    
ref|XP_004243794.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    238   1e-67    



>gb|AHZ08762.1| flavonoid biosynthesis oxidoreductase protein [Nicotiana tabacum]
Length=337

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/337 (77%), Positives = 304/337 (90%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T++L SG  +ST+PQ YIRP+S+RP+LSEV  C++VPVID+GCGDR+ I+RQIG+AC 
Sbjct  1     METKVLSSGIRHSTIPQSYIRPQSDRPRLSEVVDCENVPVIDMGCGDRNHIIRQIGEACH  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGVP  ++E+ML++A EFFNL VEEK+KLYSDDPSKTMRLSTSFNVKKETV
Sbjct  61    LYGFFQVINHGVPTNLVEEMLEIAREFFNLPVEEKLKLYSDDPSKTMRLSTSFNVKKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL+KYAPEWPSNP + R++V  Y TEVRQ+GF+++EAI+ESLGL+  C
Sbjct  121   HNWRDYLRLHCYPLEKYAPEWPSNPASFREIVSRYCTEVRQLGFRLQEAIAESLGLEKVC  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K+VLGEQGQHMA+NFYPPCP+PELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA
Sbjct  181   IKDVLGEQGQHMAINFYPPCPQPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             VKP+PDAFVIN+GDQLQA+SNG+YKSVWHRAIVN+DK R+SVASFLCP + A ISAPK L
Sbjct  241   VKPQPDAFVINLGDQLQAVSNGRYKSVWHRAIVNSDKARLSVASFLCPCDSAKISAPKLL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +D SP +Y+DFTY EYY KFWSRNL+QEHCLE FKN
Sbjct  301   TEDGSPVIYQDFTYAEYYKKFWSRNLDQEHCLEFFKN  337



>ref|XP_009608170.1| PREDICTED: flavanone 3-dioxygenase [Nicotiana tomentosiformis]
Length=337

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/337 (77%), Positives = 304/337 (90%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T++L SG  +ST+PQ YIRP+S+RP+LSEV  C++VPVID+GCGDR+ I+RQIG+AC 
Sbjct  1     METKVLSSGIRHSTIPQSYIRPQSDRPRLSEVVDCENVPVIDMGCGDRNHIIRQIGEACH  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGVP  ++E+ML++A EFFNL VEEK+KLYSDDPSKTMRLSTSFNVKKETV
Sbjct  61    LYGFFQVINHGVPTNLVEEMLEIAREFFNLPVEEKLKLYSDDPSKTMRLSTSFNVKKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL+KYAPEWPSNP + R++V  Y TEVRQ+GF+++EAI+ESLGL+  C
Sbjct  121   HNWRDYLRLHCYPLEKYAPEWPSNPASFREIVSRYCTEVRQLGFRLQEAIAESLGLEKVC  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K+VLGEQGQHMA+NFYPPCP+PELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA
Sbjct  181   IKDVLGEQGQHMAINFYPPCPQPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             VKP+PDAFVIN+GDQLQA+SNG+YKSVWHRAIVN+DK R+SVASFLCP + A ISAPK L
Sbjct  241   VKPQPDAFVINLGDQLQAVSNGRYKSVWHRAIVNSDKARLSVASFLCPCDSAKISAPKLL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +D SP +Y+DFTY EYY KFWSRNL+QEHCLE FKN
Sbjct  301   TEDGSPVIYQDFTYAEYYKKFWSRNLDQEHCLELFKN  337



>ref|XP_006347521.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Solanum 
tuberosum]
Length=337

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/337 (78%), Positives = 305/337 (91%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T+++ SG  +STLPQ YIRPES+RP+LS+V  C++VP+IDLGCGD++ I+R IG+AC+
Sbjct  1     METKVISSGIHHSTLPQSYIRPESDRPRLSDVVDCENVPIIDLGCGDQAQIIRLIGEACQ  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGVPK+V+E ML VA EFFNL VEEK+KLYSDDPSKTMRLSTSFNVKKETV
Sbjct  61    TYGFFQVINHGVPKEVVEKMLGVAGEFFNLPVEEKLKLYSDDPSKTMRLSTSFNVKKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHC+PL+KYAPEWPSNP + RD+V  Y TEVRQ+GF++EEAI+ESLGL+ +C
Sbjct  121   HNWRDYLRLHCHPLEKYAPEWPSNPSSFRDIVSRYCTEVRQLGFRLEEAIAESLGLEKEC  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K+VLGEQGQHMA+NFYPPCP+PELTYGLPAHTDPN+LTILLQDLQV+GLQVLKDGKWLA
Sbjct  181   IKDVLGEQGQHMAINFYPPCPQPELTYGLPAHTDPNSLTILLQDLQVSGLQVLKDGKWLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             VKP+PDAFVIN+GDQLQA+SNGKYKSVWHRAIVN+D+ RMSVASFLCP + A ISAPK L
Sbjct  241   VKPQPDAFVINLGDQLQAVSNGKYKSVWHRAIVNSDQARMSVASFLCPCDSAKISAPKLL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +D SP +Y+DFTY EYY KFWSRNL+QEHCLE FKN
Sbjct  301   TEDGSPVIYQDFTYAEYYKKFWSRNLDQEHCLELFKN  337



>ref|NP_001233840.1| flavonoid biosynthesis oxidoreductase protein [Solanum lycopersicum]
 gb|ADN39436.1| flavonoid biosynthesis oxidoreductase protein [Solanum lycopersicum]
Length=337

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/337 (77%), Positives = 304/337 (90%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T+++ SG  +STLPQ YIRPES+RP+LSEV  C++VP+IDL CGD++ I+RQIG+AC+
Sbjct  1     METKVISSGINHSTLPQSYIRPESDRPRLSEVVDCENVPIIDLSCGDQAQIIRQIGEACQ  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGVPK+V+E ML VA EFFNL VEEK+KLYSDDPSKTMRLSTSFNVKKETV
Sbjct  61    TYGFFQVINHGVPKEVVEKMLGVAGEFFNLPVEEKLKLYSDDPSKTMRLSTSFNVKKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL+KYAPEWPSNP + R++V  Y  E+RQ+GF++EEAI+ESLGLD +C
Sbjct  121   HNWRDYLRLHCYPLEKYAPEWPSNPSSFREIVSRYCREIRQLGFRLEEAIAESLGLDKEC  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K+VLGEQGQHMA+N+Y PCP+PELTYGLPAHTDPN+LTILLQDLQVAGLQVLKDGKWLA
Sbjct  181   IKDVLGEQGQHMAINYYLPCPQPELTYGLPAHTDPNSLTILLQDLQVAGLQVLKDGKWLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             VKP+PDAFVIN+GDQLQA+SNGKY+SVWHRAIVN+D+ RMSVASFLCP + A ISAPK L
Sbjct  241   VKPQPDAFVINLGDQLQAVSNGKYRSVWHRAIVNSDQARMSVASFLCPCDSAKISAPKLL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +D SP +Y+DFTY EYY+KFWSRNL+Q+HCLE FKN
Sbjct  301   TEDGSPVIYQDFTYAEYYNKFWSRNLDQQHCLELFKN  337



>ref|XP_009797505.1| PREDICTED: flavanone 3-dioxygenase [Nicotiana sylvestris]
Length=337

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/337 (76%), Positives = 302/337 (90%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  ++L SG  +ST+PQ YIRP+S+RP+L EV  C++VPVID+GCGDR+ IV QIG+ACR
Sbjct  1     MEAKVLSSGIRHSTIPQSYIRPQSDRPRLFEVADCENVPVIDMGCGDRNLIVHQIGEACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGVPK ++E+ML++  EFF L VEEK+KLYSDDPSKTMRLSTSFNVKKETV
Sbjct  61    LYGFFQVINHGVPKNLVEEMLEIGREFFRLPVEEKLKLYSDDPSKTMRLSTSFNVKKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL+KYAPEWPSNP + R++V  Y TEVRQ+GF+++EAI+ESLGL+ +C
Sbjct  121   HNWRDYLRLHCYPLEKYAPEWPSNPASFREIVSRYCTEVRQLGFRLQEAIAESLGLEKEC  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K+VLGEQGQHMA+NFYPPCP+PELTYGLPAHTDPNALTILLQDL+VAGLQVLKDG+WLA
Sbjct  181   IKDVLGEQGQHMAINFYPPCPQPELTYGLPAHTDPNALTILLQDLEVAGLQVLKDGEWLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             VKP+PDAFVIN+GDQLQA+SNG+YKSVWHRAIVN+DK R+SVASFLCP + A ISAPK L
Sbjct  241   VKPQPDAFVINLGDQLQAVSNGRYKSVWHRAIVNSDKARLSVASFLCPCDSAKISAPKLL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +D SP +Y+DFTY EYY KFWSRNL+QEHCLE FKN
Sbjct  301   TEDGSPVIYQDFTYAEYYKKFWSRNLDQEHCLELFKN  337



>ref|XP_006347314.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Solanum 
tuberosum]
Length=342

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/337 (77%), Positives = 300/337 (89%), Gaps = 1/337 (0%)
 Frame = -3

Query  1870  TTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDD-VPVIDLGCGDRSFIVRQIGDACR  1694
             TT +L  G  +STLP+ Y+RPES+RP++SEV   DD VPVID+ C DR+ IV QIG+ACR
Sbjct  3     TTSVLSGGFNHSTLPESYVRPESQRPRMSEVVDRDDLVPVIDMSCTDRNVIVHQIGEACR  62

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGV KKV+++ML VAHEFF L VEEKMKLYSDDPSKTMRLSTSFNVKKETV
Sbjct  63    LYGFFQVINHGVSKKVMDEMLGVAHEFFKLPVEEKMKLYSDDPSKTMRLSTSFNVKKETV  122

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL KYAPEWPSNPP+ R++V  Y  EVRQVG+++EEAISESLGL+  C
Sbjct  123   HNWRDYLRLHCYPLDKYAPEWPSNPPSFREIVSKYCMEVRQVGYRLEEAISESLGLEKDC  182

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              KNVLGEQGQHMA+NFYPPCP+PELTYGLPAHTDPNA+TILLQDLQVAGLQVLKDG+WL+
Sbjct  183   IKNVLGEQGQHMAINFYPPCPQPELTYGLPAHTDPNAITILLQDLQVAGLQVLKDGEWLS  242

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             +KP+PDAFVIN+GDQL+ALSNGKYKS+WHRAIVN+DK RMSVASFLCP + ++ISAPK L
Sbjct  243   IKPQPDAFVINLGDQLEALSNGKYKSIWHRAIVNSDKARMSVASFLCPNDCSIISAPKTL  302

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             ++D S A+YRDFTY EYY KFWSRNL+QE+CLE FKN
Sbjct  303   IEDGSSAIYRDFTYTEYYDKFWSRNLDQEYCLELFKN  339



>ref|XP_011090789.1| PREDICTED: flavanone 3-dioxygenase-like [Sesamum indicum]
 ref|XP_011090797.1| PREDICTED: flavanone 3-dioxygenase-like [Sesamum indicum]
Length=336

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/332 (78%), Positives = 290/332 (87%), Gaps = 0/332 (0%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACRHYGFF  1679
             + SG  +S+LP  YIRPES+RPKLSEV  CD+VP++DLGCGDRS I++QIGDACR YGFF
Sbjct  5     VISGIQFSSLPSSYIRPESQRPKLSEVVECDNVPIVDLGCGDRSLIIKQIGDACREYGFF  64

Query  1678  QVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRD  1499
             QV NHGV K+V++ +L VAHEFF L VEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRD
Sbjct  65    QVTNHGVSKEVVDKILGVAHEFFRLPVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRD  124

Query  1498  YLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVL  1319
             YLRLHCYPL KY PEWP+NP + +D+V  Y  EVRQ+GF+++EAISESLGLD    KNVL
Sbjct  125   YLRLHCYPLDKYVPEWPTNPSSFKDIVSSYCMEVRQLGFRLQEAISESLGLDKDSLKNVL  184

Query  1318  GEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRP  1139
             GEQGQHMA+N+YP CPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKW+A+KP+P
Sbjct  185   GEQGQHMAMNYYPACPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWMAIKPQP  244

Query  1138  DAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDES  959
             DAFVINIGDQLQALSNGKYKSVWHRA+VN D  R+SVASFLCP + A ISAPK L   E 
Sbjct  245   DAFVINIGDQLQALSNGKYKSVWHRAVVNADNARLSVASFLCPCDSANISAPKGLTSGED  304

Query  958   PAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              AVYRDFTY EYY+KFWSRNL+QEHCLE FKN
Sbjct  305   GAVYRDFTYAEYYNKFWSRNLDQEHCLELFKN  336



>ref|XP_004241427.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Solanum 
lycopersicum]
Length=343

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/337 (77%), Positives = 297/337 (88%), Gaps = 1/337 (0%)
 Frame = -3

Query  1870  TTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDD-VPVIDLGCGDRSFIVRQIGDACR  1694
             TT +L SG  +STLPQ Y+RPES+RP +SEV   DD VPVID+ C DR+ IV QIG+ACR
Sbjct  4     TTSVLSSGFNHSTLPQSYVRPESQRPCMSEVVDSDDLVPVIDMSCTDRNVIVHQIGEACR  63

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGV KK +++ML V+HEFF L VEEKMKLYSDDPSKTMRLSTSFNVKKETV
Sbjct  64    LYGFFQVINHGVSKKAMDEMLGVSHEFFKLPVEEKMKLYSDDPSKTMRLSTSFNVKKETV  123

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL KYAPEWPSNPP+ R++V  Y  EVR++G+++EEAISESLGL+  C
Sbjct  124   HNWRDYLRLHCYPLDKYAPEWPSNPPSFREIVSKYCMEVRELGYRLEEAISESLGLEKDC  183

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              KNVLGEQGQHMA+NFYP CP+PELTYGLPAHTDPNA+TILLQDLQVAGLQVLKDGKWL+
Sbjct  184   IKNVLGEQGQHMAINFYPQCPQPELTYGLPAHTDPNAITILLQDLQVAGLQVLKDGKWLS  243

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             +KP+P+AFVIN+GDQL+ALSNGKYKS+WHRAIVN+DK RMSVASFLCP + ++ISAPK L
Sbjct  244   IKPQPNAFVINLGDQLEALSNGKYKSIWHRAIVNSDKARMSVASFLCPNDCSIISAPKTL  303

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +D S A+YRDFTY EYY KFWSRNL+QE+CLE FKN
Sbjct  304   TEDGSSAIYRDFTYAEYYEKFWSRNLDQEYCLELFKN  340



>emb|CDP04983.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/337 (74%), Positives = 295/337 (88%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T+++ SG  Y++LP+ Y+RPESERP+LSEV+ C +VPV+DLG GDR+ +VRQIGDACR
Sbjct  1     METKVISSGIKYTSLPESYVRPESERPRLSEVSDCQNVPVVDLGFGDRNLMVRQIGDACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGV K  ++ ML+ A EFF+L VEEK+KLYSDDPSKT RLSTSFNVKKETV
Sbjct  61    DYGFFQVINHGVSKDAVDKMLETATEFFSLPVEEKLKLYSDDPSKTTRLSTSFNVKKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL+KY PEWPSNPP+ +++V  Y  ++R++G ++EEAI+ESLGLD +C
Sbjct  121   HNWRDYLRLHCYPLEKYVPEWPSNPPSFKEMVSNYCVQIRELGLRLEEAIAESLGLDKEC  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K VLG+QGQHMAVN+YPPCP+P+LTYGLP HTDPNALTILLQDL VAGLQVL+DG+WLA
Sbjct  181   IKKVLGDQGQHMAVNYYPPCPQPDLTYGLPGHTDPNALTILLQDLNVAGLQVLRDGRWLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             VKP PDAFV+NIGDQLQALSNG YKSVWHRA+VN D+PR+SVASFLCP + AVISAPKPL
Sbjct  241   VKPHPDAFVVNIGDQLQALSNGIYKSVWHRAVVNADQPRLSVASFLCPCDHAVISAPKPL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
               D SP VYRDFTY +YY KFWSRNL+QEHCLE FKN
Sbjct  301   TADGSPVVYRDFTYAQYYKKFWSRNLDQEHCLELFKN  337



>gb|EYU31999.1| hypothetical protein MIMGU_mgv1a009622mg [Erythranthe guttata]
Length=336

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/337 (77%), Positives = 293/337 (87%), Gaps = 1/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T+++ SG  +S+LP  YIRPES+RPKLSE+   D+VPVIDLGC D + IV+QIGDACR
Sbjct  1     METKVI-SGVHFSSLPASYIRPESDRPKLSEIEEFDNVPVIDLGCEDHNLIVKQIGDACR  59

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGV K +++++L VAHEFF+LSVEEKMKLYSDDP+KTMRLSTSFNVKKETV
Sbjct  60    EYGFFQVINHGVSKALVDNILCVAHEFFDLSVEEKMKLYSDDPTKTMRLSTSFNVKKETV  119

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL+KY PEWPSNP + +DVV  Y  E+RQ+G +++E ISESLGLD   
Sbjct  120   HNWRDYLRLHCYPLEKYVPEWPSNPSSFKDVVSTYCAEIRQLGLRLQEDISESLGLDKDN  179

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              KNVLG+QGQHMAVN+YP CPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA
Sbjct  180   LKNVLGDQGQHMAVNYYPACPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  239

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             +KP+P AFVINIGDQLQALSNGKYKSVWHRA+VN DK R+SVASFLCP + A ISAPK L
Sbjct  240   IKPQPGAFVINIGDQLQALSNGKYKSVWHRAVVNADKARLSVASFLCPCDSANISAPKGL  299

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
                E PAVYRD+TY EYY KFWSRNL+QEHCLE FKN
Sbjct  300   TGGEDPAVYRDYTYNEYYKKFWSRNLDQEHCLELFKN  336



>ref|XP_011003288.1| PREDICTED: flavanone 3-dioxygenase [Populus euphratica]
Length=338

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/338 (76%), Positives = 292/338 (86%), Gaps = 1/338 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T+++ SG  Y+ LP  Y+RPESERP+LSEV+TC+DVPVIDLGC DR+ IV+Q+GDAC 
Sbjct  1     MDTKVISSGVHYTNLPASYVRPESERPRLSEVSTCEDVPVIDLGCQDRNQIVQQVGDACE  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
             HYGFFQVINHGV  + +E ML VAH+FF+L VEEK+KLYSDDPSKTMRLSTSFNV KE V
Sbjct  61    HYGFFQVINHGVSLEAVEKMLGVAHDFFSLPVEEKLKLYSDDPSKTMRLSTSFNVNKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL KY PEWPSNPP  +++V+ Y  +VR++GF+I+E ISESLGL+   
Sbjct  121   HNWRDYLRLHCYPLDKYVPEWPSNPPPFKEIVRSYCIQVRELGFRIQELISESLGLEKDH  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQV-LKDGKWL  1157
              KNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQ+L  AGLQV LKDGKW+
Sbjct  181   IKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQELSAAGLQVLLKDGKWV  240

Query  1156  AVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKP  977
             AV P PDAFVINIGDQLQALSNG+YKSVWHRAI NTDK RMSVASFLCP ++A+I+ PK 
Sbjct  241   AVNPHPDAFVINIGDQLQALSNGRYKSVWHRAITNTDKARMSVASFLCPCDNALITPPKA  300

Query  976   LLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             L DD + A+YRDFTY EYY KFWSRNL+QEHCLE FKN
Sbjct  301   LTDDGTGAIYRDFTYAEYYKKFWSRNLDQEHCLELFKN  338



>gb|KHG13755.1| Flavanone 3-dioxygenase [Gossypium arboreum]
Length=337

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/337 (76%), Positives = 290/337 (86%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T++L SG  YS LP+ Y+RPESERP+LSEV+ C+DVPVIDLGC DR+ I++QI  AC 
Sbjct  1     MDTKVLSSGIRYSNLPESYVRPESERPRLSEVSECEDVPVIDLGCEDRTHIIQQICRACM  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGV K+ +E ML+VAH+FF L +EEK+KLYSDDPSKTMRLSTSFNV KE V
Sbjct  61    QYGFFQVINHGVSKETVEKMLQVAHDFFELPLEEKLKLYSDDPSKTMRLSTSFNVNKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL KY PEWPSNPP  +++V  Y  EVR++G++++E ISESLGL+   
Sbjct  121   HNWRDYLRLHCYPLHKYVPEWPSNPPPFKNIVSNYCVEVRELGYRLQELISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              KNVLGEQGQHMAVN+YPPCPEPELTYGLP HTDPNALTILLQDLQVAGLQVLKDGKWLA
Sbjct  181   IKNVLGEQGQHMAVNYYPPCPEPELTYGLPGHTDPNALTILLQDLQVAGLQVLKDGKWLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P+PDAFVINIGDQLQALSNG+YKSVWHRA+VN +K RMSVASFLCP + A+IS  KPL
Sbjct  241   VNPQPDAFVINIGDQLQALSNGRYKSVWHRAVVNANKERMSVASFLCPFDRALISPAKPL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +D   AVYRDFTY EYYSKFWSRNL+QEHCLE FKN
Sbjct  301   TEDGCGAVYRDFTYAEYYSKFWSRNLDQEHCLELFKN  337



>ref|XP_011043760.1| PREDICTED: flavanone 3-dioxygenase-like [Populus euphratica]
 ref|XP_011043761.1| PREDICTED: flavanone 3-dioxygenase-like [Populus euphratica]
 ref|XP_011043762.1| PREDICTED: flavanone 3-dioxygenase-like [Populus euphratica]
Length=338

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/337 (75%), Positives = 289/337 (86%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T++L SG  Y+ LP  Y+RPESERP+L EV+TC++VPVIDLGC +R  IV+Q+GDAC+
Sbjct  1     MDTKVLSSGIQYTNLPASYVRPESERPRLWEVSTCENVPVIDLGCQERDQIVQQVGDACK  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
             +YGFFQVINHGV  + +E ML VAHEFF+L VEEK+KLYSDDPSKTMRLSTSFNV KE V
Sbjct  61    NYGFFQVINHGVSLEAVEKMLGVAHEFFSLPVEEKLKLYSDDPSKTMRLSTSFNVNKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL KYAPEWPS PP  +D+V  Y  +VR++GF+I+E ISESLGL+   
Sbjct  121   HNWRDYLRLHCYPLDKYAPEWPSKPPPFKDIVSSYCIQVRELGFRIQELISESLGLEKDH  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              KNVLGEQGQHMAVNFYPPCPEPELT+GLP HTDPNALTILLQD  VAGLQVLKDGKW+A
Sbjct  181   VKNVLGEQGQHMAVNFYPPCPEPELTFGLPGHTDPNALTILLQDQSVAGLQVLKDGKWVA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P PDAFVINIGDQLQALSNG+YKSVWHRAI NTDK RMSVASFLCP ++A+I+ PK L
Sbjct  241   VNPHPDAFVINIGDQLQALSNGRYKSVWHRAITNTDKARMSVASFLCPYDNALITPPKAL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              DD + A+YRDFTY EYY KFWSRNL+QEHCLE FKN
Sbjct  301   TDDGTGAIYRDFTYAEYYKKFWSRNLDQEHCLELFKN  337



>ref|XP_007039214.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Theobroma cacao]
 gb|EOY23715.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Theobroma cacao]
Length=337

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/337 (76%), Positives = 287/337 (85%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T++L +G  Y+ LP+ Y+RPESERP+LSEV  C++VPVIDLGC DRS I +QI  AC 
Sbjct  1     METKVLSTGIRYTNLPESYVRPESERPRLSEVLECENVPVIDLGCKDRSQITQQIALACT  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGV K+  E M +VAH+FF L VEEK+KLYSDDPSKTMRLSTSFNV KE V
Sbjct  61    FYGFFQVINHGVSKEATEGMFQVAHDFFGLPVEEKLKLYSDDPSKTMRLSTSFNVNKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL KY PEWPSNP + +++V  Y  EVR++G++++E ISESLGLD   
Sbjct  121   HNWRDYLRLHCYPLHKYVPEWPSNPSSFKEIVSHYCVEVRELGYRLQELISESLGLDKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              KNVLGEQGQHMAVN+YPPCP+PELTYGLP HTDPNALTILLQDLQVAGLQVLKDGKW+A
Sbjct  181   IKNVLGEQGQHMAVNYYPPCPQPELTYGLPGHTDPNALTILLQDLQVAGLQVLKDGKWVA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P P+AFVINIGDQLQALSNGKYKSVWHRAIVN DKPRMSVASFLCP + A+IS  KPL
Sbjct  241   VNPHPNAFVINIGDQLQALSNGKYKSVWHRAIVNADKPRMSVASFLCPYDHALISPAKPL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +D S AVYRDFTY EYYSKFWSRNL+QEHCLE FKN
Sbjct  301   TEDGSGAVYRDFTYAEYYSKFWSRNLDQEHCLELFKN  337



>ref|XP_010048418.1| PREDICTED: flavanone 3-dioxygenase [Eucalyptus grandis]
Length=355

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/337 (75%), Positives = 288/337 (85%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T+++ SG  YS LP  Y+RPESERPKLSEV+TC++VPVIDL C DR+ IV+ I  AC 
Sbjct  1     MDTKVISSGKHYSALPASYVRPESERPKLSEVSTCENVPVIDLSCTDRARIVKAIAYACS  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQV+NHGV K+ + DML+VA EFF+L VEEK+KLYSDDPSKTMRLSTSFNV KE V
Sbjct  61    VFGFFQVVNHGVSKEAVADMLRVATEFFSLPVEEKLKLYSDDPSKTMRLSTSFNVNKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL+KY PEWPSNP + +DVV  Y  EVR +G++IEE ISESLGL+   
Sbjct  121   HNWRDYLRLHCYPLEKYVPEWPSNPSSFKDVVSNYSKEVRALGYRIEELISESLGLESPR  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
                VLG+QGQHMAVNFYPPCPEPELTYGLP HTDPNALTILLQDLQV GLQVLKDGKWLA
Sbjct  181   VPRVLGDQGQHMAVNFYPPCPEPELTYGLPGHTDPNALTILLQDLQVTGLQVLKDGKWLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             ++P PDAFVINIGDQLQALSNGKY+SVWHRA+VN DKPRMS+ASFLCP +DA+IS P+ L
Sbjct  241   IQPIPDAFVINIGDQLQALSNGKYRSVWHRAVVNADKPRMSIASFLCPSDDALISPPESL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             +++ S AVYRDFTY EYY KFWSRNL+QEHCLE FKN
Sbjct  301   VEEGSVAVYRDFTYAEYYKKFWSRNLDQEHCLELFKN  337



>ref|XP_006578869.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Glycine 
max]
 gb|KHN19568.1| Flavanone 3-dioxygenase [Glycine soja]
Length=338

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/337 (75%), Positives = 290/337 (86%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T++L SG  YS LP+ YIRPESERP+LSEV+ C+DVP+IDLGC +R+ IV QIG+ACR
Sbjct  1     MDTKVLSSGVQYSNLPESYIRPESERPRLSEVSECEDVPIIDLGCQNRAQIVHQIGEACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
             +YGFFQVINHGV  +  ++M +VAH FF L VEEK+KLYS+DPSKTMRLSTSFNVKKETV
Sbjct  61    NYGFFQVINHGVALEAAKEMAEVAHGFFKLPVEEKLKLYSEDPSKTMRLSTSFNVKKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL KYAPEWPSNPP+ ++ V  Y T VR++G +I+E ISESLGL+   
Sbjct  121   HNWRDYLRLHCYPLDKYAPEWPSNPPSFKETVTEYCTLVRELGLRIQEYISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              KNVLGEQGQHMAVN+YPPCPEPELTYGLP HTDPNALTILLQDLQV GLQVLK+GKWLA
Sbjct  181   IKNVLGEQGQHMAVNYYPPCPEPELTYGLPGHTDPNALTILLQDLQVCGLQVLKNGKWLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P+P+AFVINIGDQLQALSNG YKSVWHRA+VN +KPR+SVASFLCP ++A+IS  KPL
Sbjct  241   VNPQPNAFVINIGDQLQALSNGLYKSVWHRAVVNVEKPRLSVASFLCPNDEALISPAKPL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +  S A+YR FTY EYY KFWSRNL+QEHCLE FKN
Sbjct  301   TEGGSEAIYRGFTYAEYYKKFWSRNLDQEHCLEFFKN  337



>ref|XP_004307914.1| PREDICTED: flavanone 3-dioxygenase-like [Fragaria vesca subsp. 
vesca]
Length=338

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/337 (75%), Positives = 287/337 (85%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T++L SG  Y+ LP  YIRPESERP+LSEV+ C+++PVIDL   DRS  V+QIG+AC+
Sbjct  1     MDTKVLSSGIRYTNLPVSYIRPESERPRLSEVSVCENIPVIDLDSQDRSQTVQQIGEACK  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
             +YGFFQVINHGV  + +  ML+VA+EFF LSVEEKMKLYSDDPSKTMRLSTSFNVKKETV
Sbjct  61    YYGFFQVINHGVSIEAVAKMLRVANEFFELSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHC+PL KY PEWPSNPPT +D+V  Y  EVR++G++IEE ISESLGL+   
Sbjct  121   HNWRDYLRLHCHPLDKYVPEWPSNPPTFKDIVSSYCKEVRELGYRIEELISESLGLEKHY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              KN LGEQGQHMAVNFYPPCPEPELTYGLP HTDPNALTILLQDL V GLQVLKDGKW+A
Sbjct  181   IKNTLGEQGQHMAVNFYPPCPEPELTYGLPGHTDPNALTILLQDLGVCGLQVLKDGKWVA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P P+AFVINIGDQLQALSNG YKSVWHRA+ NTDK R+SVASFLCP +DA+IS  K L
Sbjct  241   VNPHPNAFVINIGDQLQALSNGIYKSVWHRAVTNTDKARLSVASFLCPQDDALISPAKSL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +D SPA+YR +TY EYY KFW+RNL+QEHCLE FKN
Sbjct  301   TEDGSPAIYRGYTYTEYYKKFWTRNLDQEHCLELFKN  337



>gb|AIC75909.1| flavonoid 3-hydroxylase [Hibiscus cannabinus]
Length=337

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/337 (75%), Positives = 290/337 (86%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T++L SG  YS LP+ Y+RPESERP+LS+V+ C++VPVIDLGC DR+ IV+QI  AC 
Sbjct  1     MDTKVLSSGIRYSGLPESYVRPESERPRLSQVSECENVPVIDLGCEDRTHIVQQISLACI  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
             +YGFFQVINHGV K+ ++ ML+VAH+FF L VEEK+KLYSDDPSKTMRLSTSFNVKKE V
Sbjct  61    NYGFFQVINHGVSKEAVDGMLQVAHDFFGLPVEEKLKLYSDDPSKTMRLSTSFNVKKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHC+PL KY PEWPSNPP+ +++V  Y  +VR++G++I+E ISESLGL+   
Sbjct  121   HNWRDYLRLHCHPLHKYVPEWPSNPPSFKEIVSHYCVQVRELGYRIQELISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              KNVLG+QGQHMAVN+YP CPEPELTYGLP HTDPNALTILLQDL VAGLQVLKDGKWLA
Sbjct  181   IKNVLGDQGQHMAVNYYPACPEPELTYGLPGHTDPNALTILLQDLHVAGLQVLKDGKWLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             + P PDAFVINIGDQLQALSNG+YKSVWHRAIVN DK RMSVASFLCP + A+IS  KPL
Sbjct  241   INPYPDAFVINIGDQLQALSNGRYKSVWHRAIVNADKARMSVASFLCPYDHALISPAKPL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +D   AVYRDFTY EYYSKFWSRNL+QEHCLE FKN
Sbjct  301   TEDGCGAVYRDFTYAEYYSKFWSRNLDQEHCLEIFKN  337



>gb|KDP30058.1| hypothetical protein JCGZ_18383 [Jatropha curcas]
Length=337

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/337 (76%), Positives = 286/337 (85%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T++L SG  YS LP+ YIRPESERP+LSEV  C+DVPVIDLGC DR+ IV++IGDAC 
Sbjct  1     METKVLSSGIHYSNLPESYIRPESERPRLSEVLICEDVPVIDLGCPDRAQIVKKIGDACT  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQVINHGV  + +E M+ VA EFF L VEEK+KLYSDDPSKT+RLSTSFNV KE V
Sbjct  61    EFGFFQVINHGVSLEEMEKMIGVASEFFRLPVEEKLKLYSDDPSKTIRLSTSFNVNKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL KY PEWPSNPP  +++V  Y  EVR++GF+++E ISESLGL+   
Sbjct  121   HNWRDYLRLHCYPLDKYVPEWPSNPPPFKEIVSNYCKEVRELGFRLQELISESLGLEKDH  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              KNVLGEQGQHMAVNFYPPCPEPELTYGLP HTDPNALTILLQDLQVAGLQV KDGKWLA
Sbjct  181   IKNVLGEQGQHMAVNFYPPCPEPELTYGLPGHTDPNALTILLQDLQVAGLQVFKDGKWLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P P+AFVINIGDQLQALSNG+YKSVWHRAIVN +K RMSVASFLCP +DA+IS  KPL
Sbjct  241   VNPHPNAFVINIGDQLQALSNGRYKSVWHRAIVNAEKARMSVASFLCPQDDALISPAKPL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +  S AVY+DFTY EYY KFWSRNL+QEHCLE FKN
Sbjct  301   TEHGSGAVYKDFTYAEYYKKFWSRNLDQEHCLELFKN  337



>gb|KHN23297.1| Flavanone 3-dioxygenase [Glycine soja]
Length=338

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/337 (74%), Positives = 289/337 (86%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  ++L SG  YS LP+ YIRPESERP+LSEV+ C+DVP+IDLG  +R+ IV QIG+ACR
Sbjct  1     MDIKVLSSGVQYSNLPESYIRPESERPRLSEVSECEDVPIIDLGSQNRAQIVHQIGEACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
             +YGFFQVINHGV  +  ++M +VAH FF L VEEK+KLYS+D SKTMRLSTSFNVKKETV
Sbjct  61    NYGFFQVINHGVALEAAKEMEEVAHGFFKLPVEEKLKLYSEDTSKTMRLSTSFNVKKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL+KYAPEWPSNPP+ ++ V  Y T +R++G +I+E ISESLGL+   
Sbjct  121   HNWRDYLRLHCYPLEKYAPEWPSNPPSFKETVTEYCTIIRELGLRIQEYISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              KNVLGEQGQHMAVN+YPPCPEPELTYGLP HTDPNALTILLQDLQVAGLQVLKDGKWLA
Sbjct  181   IKNVLGEQGQHMAVNYYPPCPEPELTYGLPGHTDPNALTILLQDLQVAGLQVLKDGKWLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P+P+AFVINIGDQLQALSNG YKSVWHRA+VN +KPR+SVASFLCP ++A+IS  KPL
Sbjct  241   VSPQPNAFVINIGDQLQALSNGLYKSVWHRAVVNVEKPRLSVASFLCPNDEALISPAKPL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +  S AVYR FTY EYY KFWSRNL+QEHCLE FKN
Sbjct  301   TEHGSEAVYRGFTYAEYYKKFWSRNLDQEHCLELFKN  337



>ref|XP_006478091.1| PREDICTED: flavanone 3-dioxygenase-like [Citrus sinensis]
 gb|KDO46360.1| hypothetical protein CISIN_1g019665mg [Citrus sinensis]
Length=337

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/337 (75%), Positives = 284/337 (84%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T++L SG  Y+ LP+ Y+RPESERP LSEV+ C +VPVIDL C DRS IV+Q+ DAC+
Sbjct  1     MDTKVLSSGIRYTNLPEGYVRPESERPNLSEVSECKNVPVIDLACDDRSLIVQQVADACK  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
             +YGFFQ INH VP + +E +L+VA EFFNL VEEK+KLYSDDPSKTMRLSTSFNV KE V
Sbjct  61    NYGFFQAINHEVPLETVERVLEVAKEFFNLPVEEKLKLYSDDPSKTMRLSTSFNVNKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL KY PEWPSNP T ++ V  Y +EVR +G+++ E ISESLGL+   
Sbjct  121   HNWRDYLRLHCYPLDKYVPEWPSNPSTFKEFVSTYCSEVRGLGYRVLELISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K VLGEQGQHMAVNFYPPCPEPELTYGLP HTDPNALTILLQDL+VAGLQVLKD KW+A
Sbjct  181   IKKVLGEQGQHMAVNFYPPCPEPELTYGLPGHTDPNALTILLQDLEVAGLQVLKDDKWVA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P P+AFVINIGDQLQALSNG+YKSVWHRAIVN +K RMSVASFLCP  DA+IS PK L
Sbjct  241   VNPLPNAFVINIGDQLQALSNGRYKSVWHRAIVNAEKARMSVASFLCPNNDAMISPPKAL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +D S AVYRDFTY EYYSKFWSRNL+QEHCLE FKN
Sbjct  301   TEDGSGAVYRDFTYAEYYSKFWSRNLDQEHCLELFKN  337



>ref|XP_003526765.1| PREDICTED: flavanone 3-dioxygenase-like [Glycine max]
Length=338

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/337 (74%), Positives = 288/337 (85%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  ++L SG  YS LP+ YIRPESERP+LSEV+ C+DVP+IDLG  +R+ IV QIG+ACR
Sbjct  1     MDIKVLSSGVQYSNLPESYIRPESERPRLSEVSECEDVPIIDLGSQNRAQIVHQIGEACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
             +YGFFQVINHGV  +  ++M +VAH FF L VEEK+KLYS+D SKTMRLSTSFNVKKETV
Sbjct  61    NYGFFQVINHGVALEAAKEMEEVAHGFFKLPVEEKLKLYSEDTSKTMRLSTSFNVKKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
              NWRDYLRLHCYPL+KYAPEWPSNPP+ ++ V  Y T +R++G +I+E ISESLGL+   
Sbjct  121   RNWRDYLRLHCYPLEKYAPEWPSNPPSFKETVTEYCTIIRELGLRIQEYISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              KNVLGEQGQHMAVN+YPPCPEPELTYGLP HTDPNALTILLQDLQVAGLQVLKDGKWLA
Sbjct  181   IKNVLGEQGQHMAVNYYPPCPEPELTYGLPGHTDPNALTILLQDLQVAGLQVLKDGKWLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P+P+AFVINIGDQLQALSNG YKSVWHRA+VN +KPR+SVASFLCP ++A+IS  KPL
Sbjct  241   VSPQPNAFVINIGDQLQALSNGLYKSVWHRAVVNVEKPRLSVASFLCPNDEALISPAKPL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +  S AVYR FTY EYY KFWSRNL+QEHCLE FKN
Sbjct  301   TEHGSEAVYRGFTYAEYYKKFWSRNLDQEHCLELFKN  337



>ref|XP_002273640.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 5 [Vitis 
vinifera]
 emb|CBI29158.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/337 (73%), Positives = 282/337 (84%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M +++L +G P++TLP+ YIRPESERP+LSE+  C++VP+IDL C DR+ I+ Q+ DAC 
Sbjct  1     MDSKVLSTGIPFTTLPENYIRPESERPRLSEIADCENVPIIDLSCDDRAQIIEQLADACS  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGV  + IE ML VA+EFF L VEEKMKLYSDDPSKTMRLSTSFNVKKE V
Sbjct  61    RYGFFQVINHGVSAEAIEKMLHVANEFFQLPVEEKMKLYSDDPSKTMRLSTSFNVKKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHC+PL++Y PEWPSNPP  +D V  Y  EVRQ+G ++EEAI ESLGL+   
Sbjct  121   HNWRDYLRLHCHPLEQYMPEWPSNPPEFKDTVSNYCVEVRQLGHRLEEAIGESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              +N LGEQGQHMAVN+YPPCPEPELTYGLPAHTDPNALTILLQD  VAGLQVLKDGKW+A
Sbjct  181   IRNTLGEQGQHMAVNYYPPCPEPELTYGLPAHTDPNALTILLQDSHVAGLQVLKDGKWVA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             VKP P AFV+NIGDQLQALSNGKY+SVWHRA VN  K RMS+ASFLCP +DA+IS  + L
Sbjct  241   VKPHPGAFVVNIGDQLQALSNGKYRSVWHRATVNVGKARMSIASFLCPSDDALISPARAL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              D+ S A+YR FTY EYY KFWSRNL+QEHCLE FKN
Sbjct  301   TDEGSAAIYRSFTYAEYYKKFWSRNLDQEHCLEVFKN  337



>emb|CAN63747.1| hypothetical protein VITISV_009059 [Vitis vinifera]
Length=337

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/337 (73%), Positives = 281/337 (83%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M +++L +G P++TLP+ YIRPESERP+LSE   C++VP+IDL C DR+ I+ Q+ DAC 
Sbjct  1     MDSKVLSTGIPFTTLPENYIRPESERPRLSEXADCENVPIIDLSCDDRAQIIEQLADACS  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGV  + IE ML VA+EFF L VEEKMKLYSDDPSKTMRLSTSFNVKKE V
Sbjct  61    RYGFFQVINHGVSAEAIEKMLHVANEFFQLPVEEKMKLYSDDPSKTMRLSTSFNVKKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHC+PL++Y PEWPSNPP  +D V  Y  EVRQ+G ++EEAI ESLGL+   
Sbjct  121   HNWRDYLRLHCHPLEQYMPEWPSNPPEFKDTVSNYCVEVRQLGHRLEEAIGESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              +N LGEQGQHMAVN+YPPCPEPELTYGLPAHTDPNALTILLQD  VAGLQVLKDGKW+A
Sbjct  181   IRNTLGEQGQHMAVNYYPPCPEPELTYGLPAHTDPNALTILLQDSHVAGLQVLKDGKWVA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             VKP P AFV+NIGDQLQALSNGKY+SVWHRA VN  K RMS+ASFLCP +DA+IS  + L
Sbjct  241   VKPHPGAFVVNIGDQLQALSNGKYRSVWHRATVNVGKARMSIASFLCPSDDALISPARAL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              D+ S A+YR FTY EYY KFWSRNL+QEHCLE FKN
Sbjct  301   TDEGSAAIYRSFTYAEYYKKFWSRNLDQEHCLEVFKN  337



>ref|XP_010035324.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 5-like [Eucalyptus 
grandis]
Length=339

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/337 (72%), Positives = 285/337 (85%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +++  GT ++ LP+ Y+RPESERP+LSEV+  + VP+IDLGC DRS +V Q+GDACR
Sbjct  1     MEAKVISGGTRFTRLPRSYVRPESERPRLSEVSAFEHVPIIDLGCNDRSRVVHQVGDACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGV  + +E M +VA EFF L VEEKMKLYS+DP+KTMRLSTSFNVKKE V
Sbjct  61    VYGFFQVINHGVSTEAVERMQEVAAEFFRLPVEEKMKLYSEDPTKTMRLSTSFNVKKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHC+PL+KY  EWP+NPPT ++ V  Y  EVR++G+++EE ISESLGL+   
Sbjct  121   HNWRDYLRLHCHPLEKYMEEWPANPPTFKEFVSNYCREVRRLGYRLEELISESLGLEKDA  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              +N+LGEQGQHMAVNFYPPCPEPELTYGLP HTDPNALTILLQDL VAGLQVLKDGKW+A
Sbjct  181   VRNILGEQGQHMAVNFYPPCPEPELTYGLPGHTDPNALTILLQDLHVAGLQVLKDGKWVA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             + P P+AFVINIGDQLQALSNG+YKSVWHRAIVN DKPRMS+ASFLCP +DA+IS+P  L
Sbjct  241   IDPHPNAFVINIGDQLQALSNGRYKSVWHRAIVNADKPRMSIASFLCPSDDALISSPVSL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             LD+     YRDFTY EYY KFWSRNL+QEHCLE FKN
Sbjct  301   LDNGCGPTYRDFTYAEYYKKFWSRNLDQEHCLELFKN  337



>ref|XP_011093200.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Sesamum 
indicum]
Length=336

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/337 (72%), Positives = 285/337 (85%), Gaps = 1/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +++ +G  +S++P  YIRPES+RPKL EV  C+++PVIDLGC DRS IVRQIGDACR
Sbjct  1     MAVKVISAGQ-FSSIPVSYIRPESDRPKLFEVADCNNIPVIDLGCKDRSLIVRQIGDACR  59

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGV K   + +L VAHEFF L VEEKMKLYSDDPS+T RLSTSFNV+KETV
Sbjct  60    EYGFFQVINHGVSKAATDKILGVAHEFFGLPVEEKMKLYSDDPSRTTRLSTSFNVRKETV  119

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             +NWRDYLRLHCYPL KY PEWPS P + +D+V  Y  +VRQ+GF+++E ISESLGL+  C
Sbjct  120   NNWRDYLRLHCYPLDKYVPEWPSTPSSFKDIVSNYCMKVRQLGFRLQEDISESLGLEKDC  179

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              KN+LGEQGQHMA+N+YP CP+PELTYGLPAHTDPN+LTILLQDLQVAGLQVLKDG+WLA
Sbjct  180   LKNILGEQGQHMAMNYYPACPQPELTYGLPAHTDPNSLTILLQDLQVAGLQVLKDGRWLA  239

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             +KP P+AFVINIGDQ+QALSNGKYKSVWHRA+VN DKPR+SVASFLCP + A ISAPK L
Sbjct  240   IKPHPNAFVINIGDQIQALSNGKYKSVWHRAVVNADKPRLSVASFLCPSDAASISAPKAL  299

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              D    ++YRDFTY EYY KFWS NL++ HCLE FKN
Sbjct  300   TDRGERSIYRDFTYAEYYKKFWSGNLDEGHCLELFKN  336



>ref|XP_010034909.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 5-like [Eucalyptus 
grandis]
 gb|KCW46116.1| hypothetical protein EUGRSUZ_K00039 [Eucalyptus grandis]
Length=339

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/337 (72%), Positives = 285/337 (85%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +++  GT +++LP+ Y+RPESERP+LSEV+  + VP+IDLGC DRS +VRQ+GDACR
Sbjct  1     MEAKVISGGTRFTSLPRSYVRPESERPRLSEVSAFEHVPIIDLGCNDRSQVVRQVGDACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGV  + +E M +VA EFF L VEEKMKLYS+DP+KTMRLSTSFNVKKE V
Sbjct  61    VYGFFQVINHGVSTEAVERMQEVAAEFFRLPVEEKMKLYSEDPTKTMRLSTSFNVKKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHC+PL+KY  EWP+NPPT ++ V  Y  EVR++G+++EE ISESLGL+   
Sbjct  121   HNWRDYLRLHCHPLEKYMEEWPANPPTFKEFVSNYCREVRRLGYRLEELISESLGLEKDA  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              +N+LGEQGQHMAVNFYPPCPEPELTYGLP HTDPNALTILLQD  VAGLQVLKDGKW+A
Sbjct  181   VRNILGEQGQHMAVNFYPPCPEPELTYGLPGHTDPNALTILLQDPHVAGLQVLKDGKWVA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             + P P+AFVINIGDQLQALSNG+YKSVWHRAIVN DKPRMS+ASFLCP  DA+IS+P  L
Sbjct  241   IDPHPNAFVINIGDQLQALSNGRYKSVWHRAIVNADKPRMSIASFLCPSNDALISSPVSL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             LD+     YRDFTY EYY KFWSRNL+QEHCLE FKN
Sbjct  301   LDNGCGPTYRDFTYAEYYKKFWSRNLDQEHCLELFKN  337



>ref|XP_010038390.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 5-like [Eucalyptus 
grandis]
 gb|KCW46117.1| hypothetical protein EUGRSUZ_K00040 [Eucalyptus grandis]
Length=339

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/337 (72%), Positives = 285/337 (85%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +++  GT +++LP+ Y+RPESERP+L EV+  + VP+IDLGC DRS +VRQ+GDACR
Sbjct  1     MEAKVISGGTRFTSLPRSYVRPESERPRLFEVSAFEHVPIIDLGCNDRSRVVRQVGDACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGV  + +E M +VA EFF L  EEKMKLYS+DP+KTMRLSTSFNVKKE V
Sbjct  61    VYGFFQVINHGVSTEAVERMQEVAAEFFRLPEEEKMKLYSEDPTKTMRLSTSFNVKKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHC+PL+KY  EWP+NPPT ++ V  Y  EVR++G+++EE ISESLGL+   
Sbjct  121   HNWRDYLRLHCHPLEKYMEEWPANPPTFKEFVSNYCREVRRLGYRLEELISESLGLEKDA  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              +N+LGEQGQHMAVNFYPPCPEPELTYGLP HTDPNALTILLQDL VAGLQVLKDGKW+A
Sbjct  181   VRNILGEQGQHMAVNFYPPCPEPELTYGLPGHTDPNALTILLQDLHVAGLQVLKDGKWVA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             + P P+AFVINIGDQLQALSNG+YKSVWHRAIVN DKPRMS+ASFLCP +DA+IS+P  L
Sbjct  241   IDPHPNAFVINIGDQLQALSNGRYKSVWHRAIVNADKPRMSIASFLCPSDDALISSPVSL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             LD+     YRDFTY EYY KFWSRNL+QEHCLE FKN
Sbjct  301   LDNGCGPTYRDFTYAEYYKKFWSRNLDQEHCLELFKN  337



>ref|XP_002524434.1| 1-aminocyclopropane-1-carboxylate oxidase, putative [Ricinus 
communis]
 gb|EEF37969.1| 1-aminocyclopropane-1-carboxylate oxidase, putative [Ricinus 
communis]
Length=337

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/337 (73%), Positives = 286/337 (85%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T++L SG  YS LP+ +IRPESERP+LSEV  CD+VP++DLGC D + +V+QIG AC 
Sbjct  1     MDTKVLSSGIRYSNLPESFIRPESERPRLSEVLACDNVPIVDLGCEDGAQVVQQIGYACS  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
             +YGFFQVINH VP +V+ DML VA EFF L +EEK+K+YSDDP+KTMRLSTSFN+KKE V
Sbjct  61    NYGFFQVINHKVPDEVVADMLLVASEFFKLPLEEKLKIYSDDPTKTMRLSTSFNMKKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL KY  EWPS+PP  +++V  Y  EVR++GF+++E ISESLGL    
Sbjct  121   HNWRDYLRLHCYPLDKYISEWPSDPPLFKEIVSRYCIEVRKLGFRLQELISESLGLPKDH  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              +NVLGEQGQHMAVN+YPPCP+P+LTYGLP HTDPNALTILLQDLQVAGLQV KDGKWLA
Sbjct  181   IRNVLGEQGQHMAVNYYPPCPQPDLTYGLPGHTDPNALTILLQDLQVAGLQVFKDGKWLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P P+AFVIN+GDQLQALSNG+YKSVWHRAIVN D+ RMS+ASFLCP +DA+IS  KPL
Sbjct  241   VNPHPNAFVINLGDQLQALSNGRYKSVWHRAIVNADRERMSIASFLCPCDDALISPAKPL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              + ES AVYRDFTY EYY KFWSRNL+QEHCLE FKN
Sbjct  301   TEGESGAVYRDFTYAEYYKKFWSRNLDQEHCLELFKN  337



>ref|XP_010089920.1| Naringenin,2-oxoglutarate 3-dioxygenase [Morus notabilis]
 gb|EXB38596.1| Naringenin,2-oxoglutarate 3-dioxygenase [Morus notabilis]
 gb|AHY35312.1| flavanone 3-hydroxylase 2 [Morus notabilis]
Length=339

 Score =   527 bits (1357),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 248/338 (73%), Positives = 287/338 (85%), Gaps = 1/338 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T++L SG  +S LP+ YIRPESERP+LSEV+ C++VPVIDLG  DR+ IV+Q+GDAC+
Sbjct  1     METKVLSSGVRFSNLPESYIRPESERPRLSEVSDCENVPVIDLGSDDRAQIVKQVGDACK  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGV  +  E ML VA EFFNL +EEK+K YSDDPSKTMRLSTSFNVKKETV
Sbjct  61    FYGFFQVINHGVSNEAAEKMLGVASEFFNLPLEEKLKFYSDDPSKTMRLSTSFNVKKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL KY  EWPS PP+ +++VK Y T+VR++GF+++E I+ESLGL+   
Sbjct  121   HNWRDYLRLHCYPLDKYVLEWPSIPPSFKEIVKSYCTDVRELGFRLQELIAESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
               +VLGEQGQHMAVN+YPPCPEPELTYGLP HTDPNALTILLQDLQV+GLQV KDGKW+A
Sbjct  181   ITSVLGEQGQHMAVNYYPPCPEPELTYGLPGHTDPNALTILLQDLQVSGLQVRKDGKWVA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             VKP P+AFVINIGDQLQALSNG YKSVWHRAIVN DKPR+SVASFLCP +DA+IS PK L
Sbjct  241   VKPHPNAFVINIGDQLQALSNGIYKSVWHRAIVNADKPRLSVASFLCPFDDALISPPKAL  300

Query  973   L-DDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
               +D S AVYR +TY EYY KFWS NL++EHCLE FK 
Sbjct  301   TGEDGSGAVYRGYTYAEYYKKFWSMNLDEEHCLEFFKT  338



>ref|XP_010671334.1| PREDICTED: flavanone 3-dioxygenase [Beta vulgaris subsp. vulgaris]
Length=339

 Score =   526 bits (1355),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 241/337 (72%), Positives = 283/337 (84%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +LL +G P+ TLP  Y RPES+RP LS+V+ C+DVPVI+L   D S I++Q+  AC 
Sbjct  1     MDHKLLSTGIPHKTLPDNYTRPESQRPNLSQVSDCEDVPVINLAAEDHSQILQQVSHACT  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
             HYGFFQV NHGV KK+ E+M KVA EFF L VEEKMKLYSDDP+KT+RLSTSFNVKKE V
Sbjct  61    HYGFFQVKNHGVSKKLTEEMQKVAQEFFKLPVEEKMKLYSDDPTKTLRLSTSFNVKKEEV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHC+PL+KY PEWPSNPP+ +++V +Y+ EVR++GF+I+E ISESLGL+   
Sbjct  121   HNWRDYLRLHCWPLEKYVPEWPSNPPSFKEIVSMYIKEVRELGFRIQELISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              KN L +Q QHMAVN+YP CPEPE+TYGLP HTDPNALTILLQDL V+GLQ+LKDG WLA
Sbjct  181   LKNALRDQAQHMAVNYYPECPEPEMTYGLPGHTDPNALTILLQDLHVSGLQILKDGIWLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             VKP+PDAFVINIGDQLQALSNG YKSVWHRA+VN DKPR+S+ASFLCP + A+ISAP+ L
Sbjct  241   VKPQPDAFVINIGDQLQALSNGLYKSVWHRAVVNADKPRLSIASFLCPADSALISAPRRL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
               + S AVYRDFTYPEYY  FWSRNL+QEHCLE FKN
Sbjct  301   TAEGSSAVYRDFTYPEYYKTFWSRNLDQEHCLELFKN  337



>ref|XP_007218269.1| hypothetical protein PRUPE_ppa008269mg [Prunus persica]
 gb|EMJ19468.1| hypothetical protein PRUPE_ppa008269mg [Prunus persica]
Length=339

 Score =   526 bits (1354),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 240/336 (71%), Positives = 282/336 (84%), Gaps = 0/336 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T++L SG  Y  LP+ Y+RPESERP+LSEV+ C ++PVI+L   +R+  V+Q+GDAC+
Sbjct  1     METKVLSSGFKYENLPEGYVRPESERPRLSEVSECKNIPVINLASENRAETVQQVGDACK  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGV  + +E ML  A EFF+L VEEKMKLYSDDPSKTMRLSTSFNVKKE V
Sbjct  61    SYGFFQVINHGVSTEAVEKMLGTATEFFSLPVEEKMKLYSDDPSKTMRLSTSFNVKKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL+KY PEWPSNP + +D+V  Y  EVR++GF+++E ISESLGL+   
Sbjct  121   HNWRDYLRLHCYPLEKYVPEWPSNPSSFKDIVSKYSEEVRELGFRLQELISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K+ LGEQGQHMAVNFYPPCP+PELTYGLP HTDPNALTILLQDL+VAGLQVLKDGKW+A
Sbjct  181   IKSTLGEQGQHMAVNFYPPCPQPELTYGLPGHTDPNALTILLQDLEVAGLQVLKDGKWIA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P P+AFVIN+GDQLQALSNG Y+SVWHRAI NTD+ R+SVASFLCP +DA+IS  K L
Sbjct  241   VNPHPNAFVINLGDQLQALSNGIYRSVWHRAITNTDRARLSVASFLCPQDDALISPAKAL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
              DD S A+YR +TY EYY KFW+R+LNQEHCLE FK
Sbjct  301   TDDGSAAIYRGYTYTEYYKKFWTRDLNQEHCLELFK  336



>ref|XP_007136430.1| hypothetical protein PHAVU_009G044600g [Phaseolus vulgaris]
 gb|ESW08424.1| hypothetical protein PHAVU_009G044600g [Phaseolus vulgaris]
Length=338

 Score =   523 bits (1348),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 243/337 (72%), Positives = 282/337 (84%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  ++L SG  YS LP+ YIRPESERP+LSEV  C+DVP++DLGC +R+ IV QIG+ACR
Sbjct  1     MDRKVLSSGIRYSNLPESYIRPESERPRLSEVLECEDVPIVDLGCENRAQIVHQIGEACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQV+NHGV  + + +M +VAH FF L +EEK+KLYS+DPSKT RLSTSFNV KETV
Sbjct  61    LYGFFQVMNHGVDVEAVREMTEVAHGFFKLPLEEKLKLYSEDPSKTTRLSTSFNVNKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL KY PEWPSNPP+ ++ VK Y  EVR++G +IEE I ESLGL+   
Sbjct  121   HNWRDYLRLHCYPLDKYVPEWPSNPPSFKERVKKYCEEVRELGLRIEEYIGESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              KNVLGEQGQHMAVN+YPPCP+P+LTYGLP HTDPNALTILLQDL V+GLQVLKDG WLA
Sbjct  181   IKNVLGEQGQHMAVNYYPPCPQPQLTYGLPGHTDPNALTILLQDLNVSGLQVLKDGNWLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             VKP+P+AFVINIGDQLQALSNG YKSVWHRA+VN DKPR+SVASFLCP + A+IS    L
Sbjct  241   VKPQPNAFVINIGDQLQALSNGLYKSVWHRAVVNVDKPRLSVASFLCPNDQALISPATRL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +D S A+YR +TY EYY KFWSRNL+QEHCLE FKN
Sbjct  301   TEDGSEAMYRGYTYAEYYKKFWSRNLDQEHCLELFKN  337



>ref|XP_004502767.1| PREDICTED: hyoscyamine 6-dioxygenase-like [Cicer arietinum]
Length=340

 Score =   517 bits (1331),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 241/337 (72%), Positives = 281/337 (83%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T++L SG  YS LP+ YIRPES+RP+LSEV+  + VP+IDLG  +R+ IV+ IG+AC 
Sbjct  1     MDTKVLSSGIRYSKLPESYIRPESDRPRLSEVSKFEGVPIIDLGSHNRTQIVQLIGEACS  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGVP + +++  +VA+EFFNL VEEK+KLYSDDPSKTMRLSTSFNV KE V
Sbjct  61    SYGFFQVINHGVPLEALKETAEVAYEFFNLPVEEKLKLYSDDPSKTMRLSTSFNVNKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL+ Y PEWPSNPP+ ++ V  Y   VR++G +IEE +SESLGL+   
Sbjct  121   HNWRDYLRLHCYPLENYVPEWPSNPPSFKEAVANYCKVVRELGLRIEEYVSESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              +N LGEQGQHMAVN+YPPCP+PELTYGLP HTDPNALTILLQDL VAGLQVLKDG WLA
Sbjct  181   IRNALGEQGQHMAVNYYPPCPQPELTYGLPGHTDPNALTILLQDLHVAGLQVLKDGNWLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P PDAFVINIGDQ+QALSNG YKSVWHRA+VN DKPR+SVASFLCP  +A+I   KPL
Sbjct  241   VHPHPDAFVINIGDQIQALSNGLYKSVWHRAVVNVDKPRLSVASFLCPDNEALICPAKPL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +D S AVYR +TY EYYSKFWSRNL+Q+HCLE FKN
Sbjct  301   TEDGSGAVYRGYTYAEYYSKFWSRNLDQDHCLELFKN  337



>ref|XP_003602395.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
 gb|AES72646.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=338

 Score =   516 bits (1328),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 242/337 (72%), Positives = 281/337 (83%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T++L SG  YS LP+ YIRPES+RP LS+V+  ++VP+IDLG  +R+ IV+QIG+AC 
Sbjct  1     MDTKVLSSGIHYSKLPESYIRPESDRPCLSQVSEFENVPIIDLGSHNRTQIVQQIGEACS  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQV+NHGVP + ++   +VA++FF L VEEKMKLYSDDP+KTMRLSTSFNV KE V
Sbjct  61    SYGFFQVVNHGVPLEELKKTAEVAYDFFKLPVEEKMKLYSDDPTKTMRLSTSFNVNKEEV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL  Y PEWPSNPP+ ++ V  Y  EVR++G +IEE ISESLGL+   
Sbjct  121   HNWRDYLRLHCYPLDNYVPEWPSNPPSFKETVANYCKEVRELGLRIEEYISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              +N LGEQGQHMAVN+YPPCP+PELTYGLP HTDPNALTILLQDL VAGLQVLKDGKWLA
Sbjct  181   LRNALGEQGQHMAVNYYPPCPQPELTYGLPGHTDPNALTILLQDLHVAGLQVLKDGKWLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             + P PDAFVINIGDQLQALSNG YKSVWHRAIVN +KPR+SVASFLCP  +A+I   KPL
Sbjct  241   INPIPDAFVINIGDQLQALSNGLYKSVWHRAIVNAEKPRLSVASFLCPDNEALICPAKPL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +D S AVYR FTYPEYYSKFWSR+L +EHCLE FKN
Sbjct  301   TEDGSGAVYRGFTYPEYYSKFWSRDLEKEHCLEFFKN  337



>ref|XP_008362804.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 5-like [Malus 
domestica]
Length=341

 Score =   516 bits (1328),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 235/336 (70%), Positives = 285/336 (85%), Gaps = 0/336 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T++L SG  Y+ LP+ Y+RPES+RP+LSEV+ C+++PVIDL   +R+  V+Q+GDAC+
Sbjct  1     MDTKVLSSGVIYTNLPESYVRPESDRPRLSEVSECENIPVIDLASPNRAQTVQQVGDACK  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
             +YGFFQVINHGV  + +E M+ VA+EFFNL VEEK+KLYSDDPSKTMRLSTSFNVKKE V
Sbjct  61    YYGFFQVINHGVSTEGVEKMVGVANEFFNLPVEEKLKLYSDDPSKTMRLSTSFNVKKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL KY PEWPSNP + RD V  Y  EVR++G+++EE  SESLGL+   
Sbjct  121   HNWRDYLRLHCYPLDKYVPEWPSNPSSFRDTVGNYCREVRELGYRLEELXSESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              ++ LGEQGQHMAVNFYPPCP+PELTYGLPAHTDPNALTILLQDL VAGLQVLKDGKW+A
Sbjct  181   IRSTLGEQGQHMAVNFYPPCPQPELTYGLPAHTDPNALTILLQDLGVAGLQVLKDGKWVA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P+P+AFVINIGDQLQALSNG YKSVWHRAI NT++PR+SVASF CP +DA+IS  K L
Sbjct  241   VNPQPNAFVINIGDQLQALSNGIYKSVWHRAITNTERPRLSVASFFCPQDDALISPAKAL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             ++D S A+YR +TY EYY KFW+R+L ++HCL+ F+
Sbjct  301   IEDGSAAIYRGYTYTEYYKKFWTRDLEKDHCLDLFR  336



>ref|XP_010525537.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Tarenaya 
hassleriana]
Length=338

 Score =   513 bits (1320),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 239/337 (71%), Positives = 280/337 (83%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +LL +G   STLP+KY+RP S+RP LSEV+   D P+IDL C DRS IV +I  AC 
Sbjct  1     MAARLLSTGLRLSTLPEKYVRPASDRPHLSEVSDLQDFPLIDLSCSDRSRIVHKIHRACI  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQVINHGV K+ +E ML+VA+EFF+L VEEKMKLYS+DP++T RLSTSFNVKKE V
Sbjct  61    RFGFFQVINHGVSKEAVEKMLEVANEFFSLPVEEKMKLYSEDPTRTTRLSTSFNVKKEEV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL  YA +WPS PP+ +++V  Y TEVR++GF+IEE ISESLGL+ + 
Sbjct  121   HNWRDYLRLHCYPLHSYAHQWPSTPPSFKEIVSKYCTEVRELGFRIEEMISESLGLEKEY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              KNVLGEQGQHMAVN+YPPCPEP+LTYGLPAHTDPNALT+LLQD  V GLQ+L + KW A
Sbjct  181   VKNVLGEQGQHMAVNYYPPCPEPDLTYGLPAHTDPNALTVLLQDAAVPGLQILIEDKWFA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             VKP PDAFVINIGDQLQALSNG YKSVWHRA+ N++KPR+SVASFLCP + AVIS  +PL
Sbjct  241   VKPCPDAFVINIGDQLQALSNGIYKSVWHRAVTNSEKPRISVASFLCPSDSAVISPAEPL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +DE+ AVYRDFTY EYY KFWSRNL+QEHCL  FKN
Sbjct  301   REDETGAVYRDFTYAEYYKKFWSRNLDQEHCLNLFKN  337



>ref|XP_008234635.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase [Prunus mume]
Length=339

 Score =   511 bits (1317),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 236/336 (70%), Positives = 277/336 (82%), Gaps = 0/336 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T++L SG  Y  LP+ Y+RPESERP+LSEV  C+++PVI+L   +R+  V+Q+ DAC+
Sbjct  1     METKVLSSGFKYENLPEGYVRPESERPRLSEVFECENIPVINLASENRAETVQQVCDACK  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQVINHGV  + +E ML  A EFF+L VEEKMKLYSDDPSKTMRLSTSFNV KE V
Sbjct  61    SFGFFQVINHGVSTEAVEKMLGTATEFFSLPVEEKMKLYSDDPSKTMRLSTSFNVNKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL+KY PEWPSNP + +D+V  Y  EVR++GF+++E ISESLGL+   
Sbjct  121   HNWRDYLRLHCYPLEKYVPEWPSNPSSFKDIVSKYSEEVRELGFRLQELISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K+ LG QGQHMAVNFYPPCP+PELTYGLP HTDPNALTILLQDL VAGLQVLKDGKW+A
Sbjct  181   IKSTLGVQGQHMAVNFYPPCPQPELTYGLPGHTDPNALTILLQDLGVAGLQVLKDGKWVA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P P+AFVIN+GDQLQALSNG YKSVWHRAI NTD+ R+SVASFLCP +DA+IS  K L
Sbjct  241   VNPHPNAFVINLGDQLQALSNGIYKSVWHRAITNTDRARLSVASFLCPQDDALISPAKAL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
              DD S A+YR +TY EYY KFW+R+L QEHCLE FK
Sbjct  301   TDDGSAAIYRGYTYTEYYKKFWTRDLTQEHCLELFK  336



>ref|XP_010241045.1| PREDICTED: hyoscyamine 6-dioxygenase-like isoform X1 [Nelumbo 
nucifera]
Length=338

 Score =   511 bits (1316),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 239/338 (71%), Positives = 280/338 (83%), Gaps = 3/338 (1%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M ++ L +G+ YSTLP+ Y+RP +ERP+LSEVTTC+DVPVIDL C DR+ I +Q+GDACR
Sbjct  1     MESKFLSAGS-YSTLPESYVRPVTERPRLSEVTTCEDVPVIDLSCSDRNLISQQVGDACR  59

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQVINHG+  +    M ++A  FF L VEEKMK YSDDPSKT+RLSTSFNVKKETV
Sbjct  60    RFGFFQVINHGISVESTSRMFEMARGFFQLPVEEKMKYYSDDPSKTLRLSTSFNVKKETV  119

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL +Y  EWPS+P + +++V  Y  EVRQ+G ++ E +SESLGL+   
Sbjct  120   HNWRDYLRLHCYPLDQYVREWPSSPSSFKEIVSSYCKEVRQLGLRLLEYVSESLGLEGDY  179

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              + VLGEQGQHMAVN+YPPCPEPELTYGLPAHTDPNA+TILLQD QV GLQVLKDGKWLA
Sbjct  180   MEKVLGEQGQHMAVNYYPPCPEPELTYGLPAHTDPNAITILLQDQQVTGLQVLKDGKWLA  239

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P P+AFVINIGDQLQALSNG+YKSVWHRA+VN DKPR+SVASFLCP  DAVI+  K L
Sbjct  240   VNPHPNAFVINIGDQLQALSNGRYKSVWHRAVVNCDKPRISVASFLCPANDAVIAPAKGL  299

Query  973   LDDESPA--VYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
              DD +PA  +YR FTY EYY KFWSRNL+Q+HCLE FK
Sbjct  300   TDDGTPAPPLYRSFTYDEYYKKFWSRNLDQQHCLELFK  337



>ref|XP_009351913.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 5-like [Pyrus 
x bretschneideri]
Length=341

 Score =   509 bits (1312),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 233/336 (69%), Positives = 282/336 (84%), Gaps = 0/336 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T++L SG  Y+ LP+ Y+RPES+RP LSEV+ C+++PVIDL   +R+  V+Q+GDAC+
Sbjct  1     METKVLSSGIIYTNLPESYVRPESDRPHLSEVSECENIPVIDLASPNRAQTVQQVGDACK  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
             +YGFFQVINHGV  + +E M+ VA+EFFNL +EEK+KLYS+DPSKTMRLSTSFNV KE V
Sbjct  61    YYGFFQVINHGVSTEGVEKMVGVANEFFNLPLEEKLKLYSEDPSKTMRLSTSFNVNKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL KY PEWPSNP + RD V  Y  EVR++G+++EE ISESLGL+   
Sbjct  121   HNWRDYLRLHCYPLDKYVPEWPSNPSSFRDTVSNYCREVRELGYRLEELISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              ++ LGEQGQHMAVNFYPPCP+PELTYGLP HTDPNALTILLQDL VAGLQVLKDGKW+A
Sbjct  181   IRSTLGEQGQHMAVNFYPPCPQPELTYGLPGHTDPNALTILLQDLGVAGLQVLKDGKWVA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P+P+AFVINIGDQLQALSNG YKSVWHRAI NT++ R+SVASFLCP +DA+IS  K L
Sbjct  241   VSPQPNAFVINIGDQLQALSNGIYKSVWHRAITNTERARLSVASFLCPQDDALISPAKAL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
              +D S A+YR +TY EYY KFW+R+L ++HCL+ FK
Sbjct  301   TEDGSAAMYRGYTYTEYYKKFWTRDLEKDHCLDLFK  336



>ref|XP_002872117.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48376.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=341

 Score =   509 bits (1312),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 236/340 (69%), Positives = 281/340 (83%), Gaps = 3/340 (1%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M   L+ +G  ++TLP+ Y+RP S+RP+LSEV+  +D P+ID+   DRS +V+QI  AC 
Sbjct  1     MAATLISTGLRHTTLPENYVRPISDRPRLSEVSQLEDFPLIDISSTDRSVLVQQIHQACA  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQVINHGV K++I++M+ VAHEFF++S+EEKMKLYSDDP+KT RLSTSFNVKKE V
Sbjct  61    RFGFFQVINHGVSKQLIDEMVSVAHEFFSMSMEEKMKLYSDDPTKTTRLSTSFNVKKEEV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             +NWRDYLRLHCYP+ KY  EWPSNPP+ +++V  Y  EVR+VGFKIEE ISESLGL+   
Sbjct  121   NNWRDYLRLHCYPIHKYVHEWPSNPPSFKEIVSKYSREVREVGFKIEELISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K VLGEQGQHMAVN+YPPCPEPELTYGLPAHTDPNALTILLQD  V GLQ+L DG+W A
Sbjct  181   MKKVLGEQGQHMAVNYYPPCPEPELTYGLPAHTDPNALTILLQDTTVCGLQILIDGQWFA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P PDAFVINIGDQLQALSNG YKSVWHRA+ NT+ PR+SVASFLCP + AV+S  KPL
Sbjct  241   VNPHPDAFVINIGDQLQALSNGVYKSVWHRAVTNTENPRLSVASFLCPADCAVMSPAKPL  300

Query  973   L---DDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
                 D+E+  VYRDFTY EYY KFWSRNL+QEHCLE+F+N
Sbjct  301   WEAEDNETKPVYRDFTYAEYYKKFWSRNLDQEHCLEYFRN  340



>ref|NP_001267994.1| uncharacterized protein LOC100854106 [Vitis vinifera]
 emb|CAN76696.1| hypothetical protein VITISV_035675 [Vitis vinifera]
 emb|CBI23094.3| unnamed protein product [Vitis vinifera]
 gb|AGQ42622.1| 2ODDlike2 [Vitis vinifera]
Length=338

 Score =   509 bits (1310),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 235/338 (70%), Positives = 280/338 (83%), Gaps = 1/338 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCG-DRSFIVRQIGDAC  1697
             M +++L +G  Y TLPQ YIRPE ERP+LS+V+ C  VP+IDLG   +R+ +++ I DAC
Sbjct  1     MESKVLSTGIRYLTLPQSYIRPEPERPRLSQVSECKHVPIIDLGKDVNRAQLIQHIADAC  60

Query  1696  RHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKET  1517
             R YGFFQVINHGV  +++E ML+VA EF+ L VEEKMKLYSDDP+KTMRLSTSFNV KE 
Sbjct  61    RLYGFFQVINHGVAAEMMEKMLEVADEFYRLPVEEKMKLYSDDPTKTMRLSTSFNVNKEK  120

Query  1516  VHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQ  1337
             VHNWRDYLRLHCYPL +Y PEWPSNPP+ +++V  Y  EVR++GF+++E ISESLGL+  
Sbjct  121   VHNWRDYLRLHCYPLDQYTPEWPSNPPSFKEIVSSYCKEVRELGFRLQEMISESLGLEKD  180

Query  1336  CFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWL  1157
               KNV GEQGQHMAVN+YPPCP+PELTYGLP HTDPNALTILLQDL+VAGLQVLKDG WL
Sbjct  181   HIKNVFGEQGQHMAVNYYPPCPQPELTYGLPGHTDPNALTILLQDLRVAGLQVLKDGTWL  240

Query  1156  AVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKP  977
             A+KP P AFV+NIGDQLQA+SNGKYKSVWHRA+VN +  R+SVASFLCP  DAVI   KP
Sbjct  241   AIKPHPGAFVVNIGDQLQAVSNGKYKSVWHRAVVNAESERLSVASFLCPCNDAVIGPAKP  300

Query  976   LLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             L +D S  +Y++FTY EYY KFW R+L+QEHCLE FKN
Sbjct  301   LTEDGSAPIYKNFTYAEYYKKFWGRDLDQEHCLELFKN  338



>ref|NP_197841.1| putative 2OG-Fe(II) oxygenase [Arabidopsis thaliana]
 gb|AAK62420.1|AF386975_1 flavanone 3-hydroxylase-like protein [Arabidopsis thaliana]
 dbj|BAB11205.1| flavanone 3-hydroxylase-like protein [Arabidopsis thaliana]
 gb|AAM10017.1| flavanone 3-hydroxylase-like protein [Arabidopsis thaliana]
 gb|AED93322.1| downy mildew resistance 6 protein / oxidoreductase [Arabidopsis 
thaliana]
Length=341

 Score =   509 bits (1310),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 236/340 (69%), Positives = 281/340 (83%), Gaps = 3/340 (1%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +L+ +G  ++TLP+ Y+RP S+RP+LSEV+  +D P+IDL   DRSF+++QI  AC 
Sbjct  1     MAAKLISTGFRHTTLPENYVRPISDRPRLSEVSQLEDFPLIDLSSTDRSFLIQQIHQACA  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQVINHGV K++I++M+ VA EFF++S+EEKMKLYSDDP+KT RLSTSFNVKKE V
Sbjct  61    RFGFFQVINHGVNKQIIDEMVSVAREFFSMSMEEKMKLYSDDPTKTTRLSTSFNVKKEEV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             +NWRDYLRLHCYP+ KY  EWPSNPP+ +++V  Y  EVR+VGFKIEE ISESLGL+   
Sbjct  121   NNWRDYLRLHCYPIHKYVNEWPSNPPSFKEIVSKYSREVREVGFKIEELISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K VLGEQGQHMAVN+YPPCPEPELTYGLPAHTDPNALTILLQD  V GLQ+L DG+W A
Sbjct  181   MKKVLGEQGQHMAVNYYPPCPEPELTYGLPAHTDPNALTILLQDTTVCGLQILIDGQWFA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P PDAFVINIGDQLQALSNG YKSVWHRA+ NT+ PR+SVASFLCP + AV+S  KPL
Sbjct  241   VNPHPDAFVINIGDQLQALSNGVYKSVWHRAVTNTENPRLSVASFLCPADCAVMSPAKPL  300

Query  973   L---DDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
                 DDE+  VY+DFTY EYY KFWSRNL+QEHCLE+F N
Sbjct  301   WEAEDDETKPVYKDFTYAEYYKKFWSRNLDQEHCLENFLN  340



>ref|XP_010251364.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase [Nelumbo nucifera]
Length=338

 Score =   508 bits (1309),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 233/337 (69%), Positives = 279/337 (83%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  + L +G  YSTLP+ Y+RPESERP+LS+VT C D+PV+DL C DR  I +QIG+ACR
Sbjct  1     MEPKFLSTGFQYSTLPENYVRPESERPRLSQVTNCPDIPVVDLACVDRCRISQQIGNACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQVINHG+P +    ML++A EFF++SVEEKMK YSDDPSKT+RLSTSFNVKKETV
Sbjct  61    CFGFFQVINHGIPVESTMRMLEMAKEFFHMSVEEKMKYYSDDPSKTLRLSTSFNVKKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
              NWRDYLRLHCYPL KY  EWPS+P + +DVV  Y  EVRQ+GF++ E ISESLGL+ + 
Sbjct  121   RNWRDYLRLHCYPLDKYVHEWPSHPSSFKDVVSRYSKEVRQLGFRLLEYISESLGLEEEY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              + VLGEQGQHMA+N+Y PCP+PELTYGLPAHTDPNA+TILLQD QVAGLQV KDG W A
Sbjct  181   MEKVLGEQGQHMAINYYQPCPQPELTYGLPAHTDPNAITILLQDEQVAGLQVFKDGNWFA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P+PD F+INIGDQLQALSNG+Y+SVWHR +VNT+KPR+SVASFLCP   AVI+  + L
Sbjct  241   VNPQPDTFIINIGDQLQALSNGQYRSVWHRTVVNTEKPRISVASFLCPANHAVITPAEGL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +D +PA+Y+ FTY EYY KFWSRNL+Q+HCLE FKN
Sbjct  301   TEDGTPAMYKSFTYEEYYQKFWSRNLDQQHCLELFKN  337



>ref|XP_010421278.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 5-like [Camelina 
sativa]
Length=342

 Score =   508 bits (1308),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 232/340 (68%), Positives = 282/340 (83%), Gaps = 3/340 (1%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +L+ +G  ++TLP+ Y+RP S+RP+LSEV+  +D P+IDL   DRS +++Q+  AC 
Sbjct  1     MAAKLISTGLRHTTLPENYVRPLSDRPRLSEVSQLEDFPLIDLSSSDRSLLIQQLHQACA  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQ+INHG+ K++I+ M+ VAHEFF++++EEKMKLYSDDP++T RLSTSFNVKKE V
Sbjct  61    RFGFFQIINHGINKQLIDAMVSVAHEFFSMTMEEKMKLYSDDPTRTTRLSTSFNVKKEEV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             +NWRDYLRLHCYP+ KY  EWPSNPP+ +++V  Y  EVR+VGFKIEE ISESLGL+   
Sbjct  121   NNWRDYLRLHCYPIHKYVNEWPSNPPSFKEIVSQYSREVREVGFKIEELISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              KNVLGEQGQHMAVN+YPPCPEPELTYGLPAHTDPNALTILLQD  V GLQ+L DG+W A
Sbjct  181   MKNVLGEQGQHMAVNYYPPCPEPELTYGLPAHTDPNALTILLQDTTVCGLQILIDGQWFA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P PDAFVINIGDQLQALSNG YKSVWHRA+ NT+ PR+SVASFLCP + AV+S  KPL
Sbjct  241   VNPHPDAFVINIGDQLQALSNGVYKSVWHRAVTNTENPRLSVASFLCPADCAVMSPAKPL  300

Query  973   LD---DESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +   DE+  VYRDFTY EYY KFWSRNL+QEHCLE+F+N
Sbjct  301   WEDENDEAKPVYRDFTYAEYYKKFWSRNLDQEHCLENFRN  340



>ref|XP_009361273.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 5 [Pyrus 
x bretschneideri]
Length=341

 Score =   508 bits (1308),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 233/336 (69%), Positives = 281/336 (84%), Gaps = 0/336 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  ++L SG  +S +P+ Y+RPES+RP LSEV+ C ++PVIDL   +R   V+QIGDAC+
Sbjct  1     MDAKVLSSGVRHSNVPESYVRPESDRPGLSEVSECQNIPVIDLASPNRDQTVQQIGDACK  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
             +YGFFQVINHGV  + +E M+ VA+EFF+L VEEK+KLYSDDPSKTMRLSTSFN+ KE V
Sbjct  61    NYGFFQVINHGVSTEGVEKMVGVANEFFSLPVEEKLKLYSDDPSKTMRLSTSFNLNKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL KY PEWPSNP + +D V  Y TEVR++G+K+EE ISESLGL+   
Sbjct  121   HNWRDYLRLHCYPLDKYVPEWPSNPSSFKDTVSSYCTEVRELGYKLEELISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K+ LGEQGQHMAVNFYPPCP+PELTYGLP+HTDPNALTILLQDL VAGLQVLKDGKW+A
Sbjct  181   IKSALGEQGQHMAVNFYPPCPQPELTYGLPSHTDPNALTILLQDLGVAGLQVLKDGKWVA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P+P+AFVINIGDQLQALSNG YKSVWHRA+ NT++ R+SVASFLCP +DA+IS  K L
Sbjct  241   VNPQPNAFVINIGDQLQALSNGIYKSVWHRAVTNTERARLSVASFLCPQDDALISPAKAL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
              +D S A+YR +TY EYY KFW+R+L ++HCL+ FK
Sbjct  301   TEDGSAAIYRGYTYTEYYKKFWTRDLEKDHCLDLFK  336



>ref|XP_010454772.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 5-like [Camelina 
sativa]
Length=342

 Score =   507 bits (1306),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 233/340 (69%), Positives = 280/340 (82%), Gaps = 3/340 (1%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +L+ +G   +TLP+ Y+RP  +RP+LSEV+  +D P+IDL   DRS +++Q+  AC 
Sbjct  1     MAAKLISTGLRLTTLPENYVRPLPDRPRLSEVSQLEDFPLIDLSSSDRSLLIQQLHQACA  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQVINHG+ K++I+DM+ VAHEFF++S+EEKMKLYSDDP+++ RLSTSFNVKKE V
Sbjct  61    RFGFFQVINHGINKQLIDDMVSVAHEFFSMSMEEKMKLYSDDPTRSTRLSTSFNVKKEEV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             +NWRDYLRLHCYP+ KY  EWPSNPP+ +++V  Y  EVR+VGFKIEE ISESLGL+   
Sbjct  121   NNWRDYLRLHCYPIHKYVNEWPSNPPSFKEIVSKYSREVREVGFKIEELISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              KNVLGEQGQHMAVN+YPPCPEPELTYGLPAHTDPNALTILLQD  V GLQ+L DG+W  
Sbjct  181   MKNVLGEQGQHMAVNYYPPCPEPELTYGLPAHTDPNALTILLQDTTVCGLQILIDGQWFV  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P PDAFVINIGDQLQALSNG YKSVWHRA+ NT+ PR+SVASFLCP E AV+S  KPL
Sbjct  241   VNPHPDAFVINIGDQLQALSNGVYKSVWHRAVTNTENPRLSVASFLCPAECAVMSPAKPL  300

Query  973   LD---DESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +   DE+  VYRDFTY EYY KFWSRNL+QEHCLE+F+N
Sbjct  301   WEDENDEAKPVYRDFTYAEYYKKFWSRNLDQEHCLENFRN  340



>ref|XP_008376823.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 5 [Malus 
domestica]
Length=341

 Score =   507 bits (1305),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 231/336 (69%), Positives = 280/336 (83%), Gaps = 0/336 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  ++L SG  +S +P+ Y+RPES+RP LSEV+ C ++PVIDL   +R+  V+QIGDAC+
Sbjct  1     MDAKVLSSGVRHSNVPESYVRPESDRPGLSEVSECQNIPVIDLASPNRAQTVQQIGDACK  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
             +YGFFQVINHGV  + +E M+ VA+EFF+L VEEK+KLYSDDPSKTMRLSTSFNV KE V
Sbjct  61    NYGFFQVINHGVSTEGVEKMVGVANEFFSLPVEEKLKLYSDDPSKTMRLSTSFNVNKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL KY PEWPSNP + +D V  Y TEVR++G++++E ISESLGL+   
Sbjct  121   HNWRDYLRLHCYPLDKYVPEWPSNPSSFKDTVSSYCTEVRELGYRLQELISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K+ LGEQGQHMAVNFYPPCP+PELTYGLP HTDPNALTILLQDL VAGLQVLKDGKW+A
Sbjct  181   IKSALGEQGQHMAVNFYPPCPQPELTYGLPGHTDPNALTILLQDLGVAGLQVLKDGKWVA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P P+AFVIN+GDQLQALSNG YKSVWHRA+ NT++ R+SVASFLCP +DA+IS  K L
Sbjct  241   VNPHPNAFVINVGDQLQALSNGIYKSVWHRAVTNTERARLSVASFLCPQDDALISPAKAL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
              +D S A+YR +TY EYY KFW+R+L ++HCL+ FK
Sbjct  301   TEDGSAAIYRGYTYTEYYKKFWTRDLEKDHCLDLFK  336



>ref|XP_010493615.1| PREDICTED: 2'-deoxymugineic-acid 2'-dioxygenase-like [Camelina 
sativa]
Length=340

 Score =   506 bits (1302),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 234/340 (69%), Positives = 281/340 (83%), Gaps = 4/340 (1%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +L+ +G  ++TLP+ Y+RP S+RP+LSEV+  +D P+IDL   DRS +++Q+  AC 
Sbjct  1     MAAKLISTGR-HTTLPENYVRPLSDRPRLSEVSQLEDFPLIDLSSSDRSLLIQQLHQACA  59

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQVINHG+ KK+I+DM+ VAHEFF++S+EEKMKLYSDDP++T RLSTSFNVKKE V
Sbjct  60    RFGFFQVINHGINKKLIDDMVSVAHEFFSMSMEEKMKLYSDDPTRTTRLSTSFNVKKEEV  119

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             +NWRDYLRLHCYP+ KY  EWPSNP + +++V  Y  EVR+VGFKIEE ISESLGL+   
Sbjct  120   NNWRDYLRLHCYPIHKYVNEWPSNPSSFKEIVSKYSREVREVGFKIEELISESLGLEKDY  179

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              KNVLGEQGQHMAVN+YPPCPEPELTYGLPAHTDPNALTILLQD  V GLQ+L DG+W  
Sbjct  180   MKNVLGEQGQHMAVNYYPPCPEPELTYGLPAHTDPNALTILLQDTTVCGLQILIDGQWFV  239

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P PDAFVINIGDQLQALSNG YKSVWHRA+ NT+ PR+SVASFLCP + AV+S  KPL
Sbjct  240   VNPHPDAFVINIGDQLQALSNGVYKSVWHRAVTNTENPRLSVASFLCPADCAVMSPAKPL  299

Query  973   LD---DESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +   DE+  VYRDFTY EYY KFWSRNL+QEHCLE+F+N
Sbjct  300   WEDENDEAKPVYRDFTYAEYYKKFWSRNLDQEHCLENFRN  339



>ref|XP_008462909.1| PREDICTED: LOW QUALITY PROTEIN: flavanone 3-dioxygenase-like 
[Cucumis melo]
Length=338

 Score =   505 bits (1301),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 236/337 (70%), Positives = 279/337 (83%), Gaps = 2/337 (1%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  QLL SG  +  LP+KY RPES+RP+LSEV  CD VP+IDLGC +R  IV+Q+ +AC+
Sbjct  1     MEIQLLCSGERHEKLPEKYERPESDRPRLSEVCGCDKVPIIDLGCEEREMIVKQVEEACK  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGV K+++E M++V   FF L VEEK+K YSDDPSKT+RLSTSFNV+KE  
Sbjct  61    SYGFFQVINHGVRKELVEKMIEVGKLFFGLPVEEKLKFYSDDPSKTVRLSTSFNVRKEQF  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL  Y P WPSNPP+ R++V  Y  EVR+VG++IEE ISESLGL+ + 
Sbjct  121   HNWRDYLRLHCYPLSNYTPHWPSNPPSFREIVSNYCNEVREVGYRIEELISESLGLEKEY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              + VLGEQGQHMA+N+YPPCP+PELTYGLP HTDPNALTILLQD+ VAGLQVLKDGKWLA
Sbjct  181   IRKVLGEQGQHMAINYYPPCPQPELTYGLPGHTDPNALTILLQDIHVAGLQVLKDGKWLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P P+AFVINIGDQLQALSNG YKSVWHRA+VN +KPR+SVASFLCP +DA+I+ P P 
Sbjct  241   VNPXPNAFVINIGDQLQALSNGMYKSVWHRAVVNVEKPRLSVASFLCPCDDALIT-PAPP  299

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             L   SP +YR FTY +YY+ FWSRNL+Q+HCLE FKN
Sbjct  300   LSQPSP-IYRPFTYAQYYNTFWSRNLDQQHCLELFKN  335



>ref|XP_011075887.1| PREDICTED: hyoscyamine 6-dioxygenase [Sesamum indicum]
Length=345

 Score =   504 bits (1297),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 234/337 (69%), Positives = 275/337 (82%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M TQLL +G  +STLP  Y+RPE +RPKL +V    + P+IDLGC DR+FIV+QI  AC+
Sbjct  1     METQLLSAGVRFSTLPPSYVRPEPDRPKLFQVADYHNAPIIDLGCADRTFIVQQIAQACQ  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
             +YGFFQV NHGV  +V E ML+VA EFF+L VEEKMKLYS+DPSKT RLSTS N  KET+
Sbjct  61    NYGFFQVTNHGVLNEVAEKMLEVADEFFHLPVEEKMKLYSNDPSKTTRLSTSSNPPKETI  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLR+HC+PL KYA EWP+NPP+ R++V  Y  E+RQ+G +++E ISESLGL    
Sbjct  121   HNWRDYLRIHCHPLDKYAEEWPTNPPSFREIVGNYCVEIRQLGLRLQELISESLGLHKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
                 LGEQGQHMA+N+YPPCPEPELTYGLPAHTDPN LTILLQD +VAGLQ+LKD KWLA
Sbjct  181   INKTLGEQGQHMAINYYPPCPEPELTYGLPAHTDPNTLTILLQDTKVAGLQLLKDDKWLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             VKP P+AFV+N+GDQLQALSN KYKS WHRA+VNT  PR+SVASFLCP + AVI APK L
Sbjct  241   VKPIPNAFVVNLGDQLQALSNTKYKSSWHRAVVNTHHPRVSVASFLCPSDTAVIKAPKEL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             + DES A+YRD+TY EYY KFWSRNL+Q HCLE FKN
Sbjct  301   IGDESQAIYRDYTYAEYYDKFWSRNLDQGHCLELFKN  337



>ref|XP_006394708.1| hypothetical protein EUTSA_v10004527mg [Eutrema salsugineum]
 gb|ESQ31994.1| hypothetical protein EUTSA_v10004527mg [Eutrema salsugineum]
Length=341

 Score =   501 bits (1289),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 232/340 (68%), Positives = 278/340 (82%), Gaps = 3/340 (1%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +L+ +G  +++LP+ Y+RP  +RP+L+EV+  +D P+IDL   DRS +V+QI  AC 
Sbjct  1     MAAKLISTGFRHTSLPENYVRPLIDRPRLTEVSQLEDFPLIDLSSTDRSRLVQQIHQACA  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQVINHGV K+ ++ M+ VA EFF++S+EEKMKLYSDDP+KT RLSTSFNVKKE V
Sbjct  61    RFGFFQVINHGVSKETVDAMVSVAKEFFSMSMEEKMKLYSDDPTKTTRLSTSFNVKKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             +NWRDYLRLHCYP+ KY  EWPSNPP+ +++V  Y  EVR+VGF++EE ISESLGL+   
Sbjct  121   NNWRDYLRLHCYPIHKYVHEWPSNPPSFKEIVSKYSREVREVGFRVEELISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K VLGEQGQHMAVN+YPPCPEPELTYGLPAHTDPNALTILLQD  V GLQ+L DG W A
Sbjct  181   MKKVLGEQGQHMAVNYYPPCPEPELTYGLPAHTDPNALTILLQDTTVCGLQILIDGHWFA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V PRPDAFVINIGDQLQALSNG YKSVWHRA+ NT+KPR+SVASFLCP + AV+S  KPL
Sbjct  241   VNPRPDAFVINIGDQLQALSNGVYKSVWHRAVTNTEKPRLSVASFLCPADCAVMSPAKPL  300

Query  973   L---DDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
                 DDE+  +YRDFTY EYY KFWSRNL+QEHCLE+F N
Sbjct  301   WEAEDDETKPIYRDFTYAEYYKKFWSRNLDQEHCLENFLN  340



>ref|XP_004137205.1| PREDICTED: flavanone 3-dioxygenase-like [Cucumis sativus]
 ref|XP_004166681.1| PREDICTED: flavanone 3-dioxygenase-like [Cucumis sativus]
 gb|KGN53620.1| 1-aminocyclopropane-1-carboxylate oxidase [Cucumis sativus]
Length=342

 Score =   499 bits (1286),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 234/337 (69%), Positives = 278/337 (82%), Gaps = 2/337 (1%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  QLL SG  +  LP+KY RPES+RP+LSEV   D VP+IDLGC +R  IV+Q+ +AC+
Sbjct  5     MEIQLLCSGGRHEKLPEKYERPESDRPRLSEVCCWDKVPIIDLGCEEREMIVKQVEEACK  64

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGV K+++E +++V  +FF L +EEK+K YSDDPSKT+RLSTSFNV+KE  
Sbjct  65    SYGFFQVINHGVRKELVEKVIEVGKQFFELPMEEKLKFYSDDPSKTVRLSTSFNVRKEQF  124

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
              NWRDYLRLHCYPL  Y P WPSNPP+ R++V  Y  EVR+VG++IEE ISESLGL+ + 
Sbjct  125   RNWRDYLRLHCYPLSNYTPHWPSNPPSFREIVSSYCNEVRKVGYRIEELISESLGLEKEY  184

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              +  LGEQGQHMA+N+YPPCP+PELTYGLP HTDPNALTILLQDL VAGLQVLKDGKWLA
Sbjct  185   IRKKLGEQGQHMAINYYPPCPQPELTYGLPGHTDPNALTILLQDLHVAGLQVLKDGKWLA  244

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P P+AFVINIGDQLQALSNG YKSVWHRA+VN DKPR+SVASFLCP +DA+I+ P PL
Sbjct  245   VNPHPNAFVINIGDQLQALSNGVYKSVWHRAVVNVDKPRLSVASFLCPCDDALIT-PAPL  303

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             L   SP +YR FTY +YY+ FWSRNL+Q+HCLE FKN
Sbjct  304   LSQPSP-IYRPFTYAQYYNTFWSRNLDQQHCLELFKN  339



>gb|AAM62620.1| flavanone 3-hydroxylase-like protein [Arabidopsis thaliana]
Length=341

 Score =   499 bits (1285),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 233/340 (69%), Positives = 278/340 (82%), Gaps = 3/340 (1%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +L+ +G  ++TLP+ Y+RP S+RP+LSEV+  +D P+IDL   DRSF+++QI  AC 
Sbjct  1     MAAKLISTGFRHTTLPENYVRPISDRPRLSEVSQLEDFPLIDLSSTDRSFLIQQIHQACA  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQV NHGV K++I++M+ VA EFF++S+EEKMKLYSDDP+KT RLSTSFNVKKE V
Sbjct  61    RFGFFQVKNHGVNKQIIDEMVSVAREFFSMSMEEKMKLYSDDPTKTTRLSTSFNVKKEEV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             +NWRDYLRLHCYP+ KY  EWPSNPP+ +++V  Y  EVR+VGFKIEE ISESLGL+   
Sbjct  121   NNWRDYLRLHCYPIHKYVNEWPSNPPSFKEIVSKYSREVREVGFKIEELISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K VLGEQGQHMAVN+YPPCPEPELTYGLPAHTDPNALTILLQD  V GLQ+L DG+W A
Sbjct  181   MKKVLGEQGQHMAVNYYPPCPEPELTYGLPAHTDPNALTILLQDTTVCGLQILIDGQWFA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P PDAFVINIGDQLQALSNG YKSVW RA+ NT+ PR+SVASFLCP + AV+S  KPL
Sbjct  241   VNPHPDAFVINIGDQLQALSNGVYKSVWRRAVTNTENPRLSVASFLCPADCAVMSPAKPL  300

Query  973   L---DDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
                 DDE+  VY+DFTY EYY KFWSRNL+QEH LE+F N
Sbjct  301   WEAEDDETKPVYKDFTYAEYYKKFWSRNLDQEHFLENFLN  340



>ref|XP_006288115.1| hypothetical protein CARUB_v10001347mg [Capsella rubella]
 gb|EOA21013.1| hypothetical protein CARUB_v10001347mg [Capsella rubella]
Length=342

 Score =   498 bits (1281),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 231/339 (68%), Positives = 274/339 (81%), Gaps = 3/339 (1%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +L+ +G  ++TLP  Y+RP S+RP+LSEV+  +D P+IDL   DRS +V+Q   AC 
Sbjct  1     MAAKLISTGLRHTTLPGNYVRPISDRPRLSEVSQLEDFPLIDLSSSDRSLLVQQTHQACA  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQV NHGV K+VI+DM+ VAHEFF++S+EEKMKLYSDDP++T RLSTSFNVKKE V
Sbjct  61    RFGFFQVTNHGVSKQVIDDMVSVAHEFFSMSMEEKMKLYSDDPTRTTRLSTSFNVKKEEV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             +NWRDYLRLHCYP+ KY  EWPS PP+ ++VV  Y  EVR+VGF IEE ISESLGL+   
Sbjct  121   NNWRDYLRLHCYPIHKYVHEWPSKPPSFKEVVSKYSREVREVGFNIEELISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K VLGEQGQHMAVN+YPPCPEPELTYGLPAHTDPNALTILLQD  V GLQ+L DG+W A
Sbjct  181   LKKVLGEQGQHMAVNYYPPCPEPELTYGLPAHTDPNALTILLQDSTVCGLQILIDGQWFA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P P+AFVINIGDQLQALSNG YKSVWHRA+ NT+ PR+SVASFLCP + AV+S  K L
Sbjct  241   VNPHPNAFVINIGDQLQALSNGVYKSVWHRAVTNTENPRLSVASFLCPADCAVMSPAKSL  300

Query  973   L---DDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
                 D E+  +YRDFTY EYY KFWSRNL+QEHCLE+F+
Sbjct  301   WEAEDSETKPIYRDFTYAEYYKKFWSRNLDQEHCLENFR  339



>ref|XP_010541508.1| PREDICTED: 2'-deoxymugineic-acid 2'-dioxygenase [Tarenaya hassleriana]
Length=338

 Score =   496 bits (1278),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 230/337 (68%), Positives = 272/337 (81%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +LL +G   STLP+KYIRP S+RP+LSEV    D+P+IDL C DRS IVRQI  AC 
Sbjct  1     MAARLLSTGDRQSTLPEKYIRPASDRPRLSEVGELQDLPLIDLSCPDRSEIVRQIHHACS  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQVINHG+ K+  E M+ V  EFF L  EEKMKLYSDDP+KT RL+TSFNVKKE +
Sbjct  61    RFGFFQVINHGIGKEEREKMVGVGREFFRLPAEEKMKLYSDDPAKTTRLATSFNVKKEEI  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHC+PL KY+PEWPS PP+ ++VV  Y TEVR++G +IEE ISESLGL+ + 
Sbjct  121   HNWRDYLRLHCFPLHKYSPEWPSLPPSFKEVVSKYCTEVRELGLRIEELISESLGLEKEY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K VLGEQGQHMA+N+YPPCP+PELTYGLPAHTDPNALTILLQD  V+GLQ+L DGKW +
Sbjct  181   VKKVLGEQGQHMALNYYPPCPDPELTYGLPAHTDPNALTILLQDTTVSGLQILIDGKWFS  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P PDAFVINIGDQLQALSNG YKSVWHRA+ N++  R+SVASFLCP + A+I   +PL
Sbjct  241   VNPHPDAFVINIGDQLQALSNGIYKSVWHRAVTNSEIARLSVASFLCPADTAIIRPAEPL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
                 + A+YRDFTYPEYY  FWSRNL+QEHCL+ FK+
Sbjct  301   TGGSAGAIYRDFTYPEYYKTFWSRNLDQEHCLQLFKS  337



>ref|XP_010038475.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 5-like [Eucalyptus 
grandis]
 gb|KCW46637.1| hypothetical protein EUGRSUZ_K00448 [Eucalyptus grandis]
Length=348

 Score =   493 bits (1270),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 229/337 (68%), Positives = 271/337 (80%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +++  GT ++ LP+ Y+RPESERP+LSEV+  + VP+IDLGC DRS +V Q+GDACR
Sbjct  1     MEAKVISGGTRFTRLPRSYVRPESERPRLSEVSAFEHVPIIDLGCNDRSRVVHQVGDACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHGV  +V+E M +VA EFF L  EEKMKLYS+DP+KTMRLSTSFN KKE V
Sbjct  61    VYGFFQVINHGVSTEVVERMQEVAAEFFRLPGEEKMKLYSEDPTKTMRLSTSFNEKKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             H WRD   LHC+PL+KY  EWP+NPPT ++  + Y  EVR +G+++EE ISESLGL+   
Sbjct  121   HEWRDSHSLHCHPLEKYMEEWPANPPTFKEFARNYCREVRGLGYRLEELISESLGLEKDA  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
               N+LGEQGQH AVNF PPCPEPELTYGLP HTDPNALTILLQD+ V  LQVLKDGKW+A
Sbjct  181   IVNILGEQGQHTAVNFCPPCPEPELTYGLPGHTDPNALTILLQDIHVTSLQVLKDGKWVA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             + P P+AFVINIGDQLQALSNG+YKSVWHRAIVN DKPRMS+ASFL P   A+IS+P  L
Sbjct  241   INPHPNAFVINIGDQLQALSNGRYKSVWHRAIVNADKPRMSIASFLSPSSHALISSPVSL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             LD+    +YR+FTY EYY KF SRNL+QEHCLE FKN
Sbjct  301   LDNGRGPIYREFTYAEYYKKFCSRNLDQEHCLELFKN  337



>gb|KFK27729.1| hypothetical protein AALP_AA8G421900 [Arabis alpina]
Length=341

 Score =   492 bits (1267),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 231/340 (68%), Positives = 276/340 (81%), Gaps = 3/340 (1%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +L+ +G   +TLP  Y+RP S+RP+LSEV+  +D P+IDL   DRS +V+QI  AC 
Sbjct  1     MAGKLISTGLRLTTLPGNYVRPFSDRPRLSEVSQLEDFPLIDLSSTDRSRLVQQIHQACT  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQVINHGV K+ I++M+ VA+EFF++S+EEKMKLYSDDP++T RLSTSFNVKKE +
Sbjct  61    RFGFFQVINHGVDKETIDEMVSVANEFFSMSMEEKMKLYSDDPTRTTRLSTSFNVKKEEI  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             +NWRDYLRLHCYP+ KY  EWPSNP   ++VV  Y  EVR+VGF+IEE ISESLGL+   
Sbjct  121   NNWRDYLRLHCYPIDKYIHEWPSNPIPFKNVVSKYSREVREVGFRIEELISESLGLETDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              + VLGEQGQHMAVN+YPPCPEPELTYGLPAHTDPNALTILLQD  V GLQ+L DG+W A
Sbjct  181   LRKVLGEQGQHMAVNYYPPCPEPELTYGLPAHTDPNALTILLQDSTVCGLQILIDGQWFA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             + P PDAFVINIGDQLQALSNG YKSVWHRA+ NT+ PR+SVASFLCP + A++S  KPL
Sbjct  241   INPHPDAFVINIGDQLQALSNGVYKSVWHRAVTNTEMPRLSVASFLCPADCAIMSPAKPL  300

Query  973   L---DDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
                 +DES  VYRDFTY EYY KFWSRNL+QEHCLE+F N
Sbjct  301   WEAEEDESKPVYRDFTYAEYYKKFWSRNLDQEHCLENFLN  340



>ref|XP_009150979.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Brassica 
rapa]
Length=341

 Score =   492 bits (1266),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 231/340 (68%), Positives = 275/340 (81%), Gaps = 3/340 (1%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +L+ +G  ++TLP+ Y+RP S RP LS+V+  +D P+IDL   +RS +V+QI  AC 
Sbjct  1     MAAKLISTGFRHTTLPENYVRPLSNRPCLSDVSPLEDFPIIDLSSTERSRLVQQIHQACS  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQVINH V K+ I+ M+ VA+EFF++S+EEKMKLYSDDP+KT RLSTSFNVKKE V
Sbjct  61    RFGFFQVINHRVSKETIDGMVSVANEFFSMSMEEKMKLYSDDPTKTTRLSTSFNVKKEEV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             +NWRDYLRLHCYP+ KY  EWPS PP+ ++VV  Y TEVR++GF IEE ISESLGL+   
Sbjct  121   NNWRDYLRLHCYPISKYVHEWPSKPPSFKEVVSRYSTEVRELGFTIEELISESLGLEKDH  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              + VLGEQGQHMAVN+YPPCPEPELTYGLPAHTDPNALTILLQD  V GLQ+L DG+W A
Sbjct  181   MRKVLGEQGQHMAVNYYPPCPEPELTYGLPAHTDPNALTILLQDATVCGLQILIDGQWFA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P PDAFVINIGDQ QALSNG YKSVWHRA+ NT+KPR+SVASFLCP + AVIS  KPL
Sbjct  241   VNPHPDAFVINIGDQFQALSNGVYKSVWHRAVTNTEKPRLSVASFLCPADCAVISPAKPL  300

Query  973   L---DDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
                 DDE+  +YRD+TY EYY KFWSRNL+QEHCLE+F N
Sbjct  301   WEAEDDEAKPIYRDYTYAEYYKKFWSRNLDQEHCLENFLN  340



>emb|CDX88109.1| BnaA06g27000D [Brassica napus]
Length=341

 Score =   492 bits (1266),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 231/340 (68%), Positives = 274/340 (81%), Gaps = 3/340 (1%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +L+ +G  ++TLP+ Y+RP S RP LS+V+   D P+IDL   DRS +V+QI  AC 
Sbjct  1     MAAKLISTGIRHTTLPENYVRPLSNRPCLSDVSPLKDFPIIDLSSTDRSRLVQQIHQACS  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQVINH V K  I+ M+ VA+EFF++S+EEKMKLYSDDP+KT RLSTSFNVKKE V
Sbjct  61    RFGFFQVINHRVSKDTIDGMVSVANEFFSMSMEEKMKLYSDDPTKTTRLSTSFNVKKEEV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             +NWRDYLRLHCYP+ KY  EWPSNPP+ ++VV  Y T+VR++GF IEE ISESLGL+   
Sbjct  121   NNWRDYLRLHCYPISKYVHEWPSNPPSFKEVVSRYSTDVRELGFTIEELISESLGLEKDH  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              + VLGEQGQHMAVN+YPPCPEPELTYGLPAHTDPNALTILLQD  V GLQ+L DG+W A
Sbjct  181   MRKVLGEQGQHMAVNYYPPCPEPELTYGLPAHTDPNALTILLQDATVCGLQILIDGQWFA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P PDAFVINIGDQ QALSNG YKSVWHRA+ NT+KPR+SVASFLCP + AVIS  KPL
Sbjct  241   VNPHPDAFVINIGDQFQALSNGIYKSVWHRAVTNTEKPRLSVASFLCPADCAVISPAKPL  300

Query  973   L---DDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
                 +DE+  +YRD+TY EYY KFWSRNL+QEHCLE+F N
Sbjct  301   WEAEEDEAKPIYRDYTYAEYYKKFWSRNLDQEHCLENFLN  340



>ref|XP_009130058.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 5 [Brassica 
rapa]
 emb|CDY05445.1| BnaA02g32460D [Brassica napus]
Length=341

 Score =   491 bits (1265),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 229/340 (67%), Positives = 274/340 (81%), Gaps = 3/340 (1%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +L+ +G   +TLP+ Y+RP S+RP+LSEV+  +D P+ID+   DR  +V+QI  AC 
Sbjct  1     MAAKLISTGFRLTTLPENYVRPLSDRPRLSEVSQLEDFPLIDISATDRPRLVQQIHQACA  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQVINHGV K  I++M+ VAHEFF + ++EKMKLYSDDP+KT RLSTSFNVK+E V
Sbjct  61    RFGFFQVINHGVSKATIDEMVTVAHEFFGMPMDEKMKLYSDDPTKTPRLSTSFNVKEEEV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             +NWRDYLRLHCYP+ KY  EWPSNPP+ ++VV  Y  E+R++GFKIEE ISESLGL+   
Sbjct  121   NNWRDYLRLHCYPIDKYVHEWPSNPPSFKEVVSKYSREIRELGFKIEELISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K VLGEQGQHMAVN+YPPCPEPELTYGLPAHTDPNALTILLQD  V GLQ+L DG W A
Sbjct  181   MKKVLGEQGQHMAVNYYPPCPEPELTYGLPAHTDPNALTILLQDATVCGLQILIDGHWFA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V PRPDAFVINIGDQLQALSNG YKSVWHRA+ NT+ PR+S+ASF+CP   AVIS  KPL
Sbjct  241   VNPRPDAFVINIGDQLQALSNGVYKSVWHRAVTNTENPRLSIASFMCPDNGAVISPAKPL  300

Query  973   L---DDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
                 ++E+  VYRD+TY EYY KFWSRNL+QEHCLE+F N
Sbjct  301   WEAKEEEAKPVYRDYTYAEYYKKFWSRNLDQEHCLENFLN  340



>emb|CDY05412.1| BnaC02g41200D [Brassica napus]
Length=341

 Score =   491 bits (1265),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 228/340 (67%), Positives = 275/340 (81%), Gaps = 3/340 (1%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +LL +G  +STLP+ Y+RP S+RP+LS+V+  +D P+ID+   DRS +V++I  AC 
Sbjct  1     MAAKLLSTGFRHSTLPENYVRPLSDRPRLSQVSQLEDFPLIDISSTDRSRLVQKIHQACA  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQVINHGV K  I++M+ VAHEFF + ++EKMKLYSDDP+KT RLSTSFNVK+E V
Sbjct  61    RFGFFQVINHGVSKATIDEMVSVAHEFFGMPMDEKMKLYSDDPTKTPRLSTSFNVKEEEV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             +NWRDYLRLHCYP+ KY  EWPSNPP+ ++VV  Y  E+R++G KIEE ISESLGL+   
Sbjct  121   NNWRDYLRLHCYPIDKYVHEWPSNPPSFKEVVSKYSREIRELGLKIEELISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K VLGEQGQHMAVN+YPPCPEPELTYGLPAHTDPNALTILLQD  V GLQ+L DG W A
Sbjct  181   MKKVLGEQGQHMAVNYYPPCPEPELTYGLPAHTDPNALTILLQDATVCGLQILIDGHWFA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V PRPDAFVINIGDQLQALSNG YKSVWHRA+ NT+ PR+S+ASF+CP   AVIS  KPL
Sbjct  241   VNPRPDAFVINIGDQLQALSNGVYKSVWHRAVTNTENPRLSIASFMCPDNGAVISPAKPL  300

Query  973   L---DDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
                 ++E+  +YRD+TY EYY KFWSRNL+QEHCLE+F N
Sbjct  301   WEAKEEEAKPIYRDYTYAEYYKKFWSRNLDQEHCLENFLN  340



>emb|CDX80450.1| BnaC07g29940D [Brassica napus]
Length=341

 Score =   486 bits (1252),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 229/340 (67%), Positives = 272/340 (80%), Gaps = 3/340 (1%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +L+ +G  ++TLP+ Y+RP S RP LS+V+   D P+IDL   DRS +V+QI  AC 
Sbjct  1     MAAKLISTGIRHTTLPENYVRPLSNRPCLSDVSPLKDFPIIDLSSTDRSRLVQQIHQACS  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQVINH V K  I+ M+ VA+EFF++ +EEKMKLYSDDP+KT RLSTSFNVKKE V
Sbjct  61    RFGFFQVINHRVSKDTIDGMVSVANEFFSMPMEEKMKLYSDDPTKTTRLSTSFNVKKEEV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             +NWRDYLRLHCYP+ KY  EWPSNPP+ ++VV  Y T+VR++GF IEE ISESLGL    
Sbjct  121   NNWRDYLRLHCYPISKYVHEWPSNPPSFKEVVSRYSTDVRELGFTIEELISESLGLKKGH  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              + VLGEQGQHMAVN+YPPCPEPELTYGLPAHTDPNALTILLQD  V GLQ+L DG+W A
Sbjct  181   MRKVLGEQGQHMAVNYYPPCPEPELTYGLPAHTDPNALTILLQDATVCGLQILIDGQWFA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P PDAFVINIGDQ +ALSNG YKSVWHRA+ NT+KPR+SVASFLCP + AVIS  KPL
Sbjct  241   VNPHPDAFVINIGDQFEALSNGIYKSVWHRAVTNTEKPRLSVASFLCPADCAVISPAKPL  300

Query  973   L---DDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
                 +DE+  +YRD+TY EYY KFWSRNL+QEHCLE+F N
Sbjct  301   WEAEEDEAKPIYRDYTYAEYYKKFWSRNLDQEHCLENFLN  340



>gb|EEC74418.1| hypothetical protein OsI_09784 [Oryza sativa Indica Group]
Length=342

 Score =   485 bits (1249),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 222/332 (67%), Positives = 271/332 (82%), Gaps = 0/332 (0%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACRHYGFF  1679
             L S   + TLP  Y+RPE++RP+L++V +   +PV+DL   DR+ +V Q+G ACR +GFF
Sbjct  5     LISTADHDTLPGNYVRPEAQRPRLADVLSDASIPVVDLANPDRAKLVSQVGAACRSHGFF  64

Query  1678  QVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRD  1499
             QV+NHGVP ++   +L VAH+FF L VEEK KLYSDDP+K +RLSTSFNV+KETVHNWRD
Sbjct  65    QVLNHGVPVELTLSVLAVAHDFFRLPVEEKAKLYSDDPAKKIRLSTSFNVRKETVHNWRD  124

Query  1498  YLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVL  1319
             YLRLHCYPL +Y P+WPSNPP+ R+++  Y  EVR++GF++  AISESLGL+    K VL
Sbjct  125   YLRLHCYPLHRYLPDWPSNPPSFREIISTYCKEVRELGFRLYGAISESLGLEQDYIKKVL  184

Query  1318  GEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRP  1139
             GEQ QHMAVNFYP CPEPELT+GLPAHTDPNALTILL D QVAGLQVLK+G+W+AV P+P
Sbjct  185   GEQEQHMAVNFYPKCPEPELTFGLPAHTDPNALTILLMDQQVAGLQVLKEGRWIAVNPQP  244

Query  1138  DAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDES  959
             +A VINIGDQLQALSNG+YKSVWHRA+VN+DK RMSVASFLCP  D +I   + L+ D S
Sbjct  245   NALVINIGDQLQALSNGRYKSVWHRAVVNSDKARMSVASFLCPCNDVLIGPAQKLITDGS  304

Query  958   PAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             PAVYR++TY EYY KFWSRNL+QEHCLE F+ 
Sbjct  305   PAVYRNYTYDEYYKKFWSRNLDQEHCLELFRT  336



>ref|NP_001048799.1| Os03g0122300 [Oryza sativa Japonica Group]
 gb|ABF93706.1| oxidoreductase, 2OG-Fe oxygenase family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10713.1| Os03g0122300 [Oryza sativa Japonica Group]
 dbj|BAG96661.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58240.1| hypothetical protein OsJ_09221 [Oryza sativa Japonica Group]
Length=342

 Score =   484 bits (1245),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 221/332 (67%), Positives = 270/332 (81%), Gaps = 0/332 (0%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACRHYGFF  1679
             L S   + TLP  Y+RPE++RP+L++V +   +PV+DL   DR+ +V Q+G ACR +GFF
Sbjct  5     LISTADHDTLPGNYVRPEAQRPRLADVLSDASIPVVDLANPDRAKLVSQVGAACRSHGFF  64

Query  1678  QVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRD  1499
             QV+NHGVP ++   +L VAH+FF L  EEK KLYSDDP+K +RLSTSFNV+KETVHNWRD
Sbjct  65    QVLNHGVPVELTLSVLAVAHDFFRLPAEEKAKLYSDDPAKKIRLSTSFNVRKETVHNWRD  124

Query  1498  YLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVL  1319
             YLRLHCYPL +Y P+WPSNPP+ R+++  Y  EVR++GF++  AISESLGL+    K VL
Sbjct  125   YLRLHCYPLHRYLPDWPSNPPSFREIISTYCKEVRELGFRLYGAISESLGLEQDYIKKVL  184

Query  1318  GEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRP  1139
             GEQ QHMAVNFYP CPEPELT+GLPAHTDPNALTILL D QVAGLQVLK+G+W+AV P+P
Sbjct  185   GEQEQHMAVNFYPKCPEPELTFGLPAHTDPNALTILLMDQQVAGLQVLKEGRWIAVNPQP  244

Query  1138  DAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDES  959
             +A VINIGDQLQALSNG+YKSVWHRA+VN+DK RMSVASFLCP  D +I   + L+ D S
Sbjct  245   NALVINIGDQLQALSNGRYKSVWHRAVVNSDKARMSVASFLCPCNDVLIGPAQKLITDGS  304

Query  958   PAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             PAVYR++TY EYY KFWSRNL+QEHCLE F+ 
Sbjct  305   PAVYRNYTYDEYYKKFWSRNLDQEHCLELFRT  336



>ref|XP_003558942.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Brachypodium 
distachyon]
Length=336

 Score =   481 bits (1237),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 220/337 (65%), Positives = 270/337 (80%), Gaps = 1/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  QL+ S   + TLP+ Y+R  +ERP+L EV     +PV+DL   DR+ IV QIG ACR
Sbjct  1     MAEQLI-STCAHETLPESYVRDAAERPRLDEVVPDAHIPVVDLAHPDRAAIVSQIGAACR  59

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQV+NHG+P +++E  + VAHEFF LS EEK KLYSDDP+K +RLSTSFNV+KETV
Sbjct  60    SHGFFQVLNHGLPAELMEAAMAVAHEFFRLSPEEKAKLYSDDPAKKIRLSTSFNVRKETV  119

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHC+PL+++ P+WPSNP   R+V+  Y  E+R++GF++  AISESLGL+   
Sbjct  120   HNWRDYLRLHCHPLEQFVPDWPSNPSAFREVMSTYCKEIRELGFRLYAAISESLGLEEDY  179

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K VLGEQ QHMAVNFYP CP PELTYGLPAHTDPNALTILL D QVAGLQVLKDG+W+A
Sbjct  180   MKKVLGEQEQHMAVNFYPKCPSPELTYGLPAHTDPNALTILLMDEQVAGLQVLKDGQWIA  239

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V PRP+A V+N+GDQLQALSNG+YKSVWHRA+VN+D+PRMS+ASF+CP    V+   + L
Sbjct  240   VNPRPNALVVNLGDQLQALSNGRYKSVWHRAVVNSDRPRMSIASFMCPCNSVVLGPAEKL  299

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             + D SPAVYR++TY EYY KFWSRNL+QEHCLE F+ 
Sbjct  300   VGDASPAVYRNYTYDEYYKKFWSRNLDQEHCLELFRT  336



>ref|XP_008650338.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like isoform 
X2 [Zea mays]
Length=339

 Score =   478 bits (1231),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 218/332 (66%), Positives = 262/332 (79%), Gaps = 0/332 (0%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACRHYGFF  1679
             L S   +  LP  Y+RPE++RP+L EV    ++PV+DL   DR  +V ++ +ACR +GFF
Sbjct  5     LISTADHDRLPDSYVRPETQRPRLREVVPDAEIPVVDLADPDREAVVARVAEACRTHGFF  64

Query  1678  QVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRD  1499
             Q++NHGVP+++   M+ VA+EFF L  EEK KLYSDDP+K MRLSTSFNV+KETVHNWRD
Sbjct  65    QLLNHGVPEQLTAAMMSVAYEFFRLPAEEKAKLYSDDPAKKMRLSTSFNVRKETVHNWRD  124

Query  1498  YLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVL  1319
             YLRLHC+PL++Y P+WP NPP+ R  V  Y + VR++GF++  AISE LGLD    K  L
Sbjct  125   YLRLHCHPLEQYVPDWPDNPPSFRRTVSAYCSAVRELGFRLYVAISEGLGLDGAYIKEAL  184

Query  1318  GEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRP  1139
             GEQ QHMAVNFYP CP PELTYGLPAHTDPNALTILL D QVAGLQVLKDG+W+AV PRP
Sbjct  185   GEQEQHMAVNFYPRCPAPELTYGLPAHTDPNALTILLMDQQVAGLQVLKDGRWIAVNPRP  244

Query  1138  DAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDES  959
              A V+NIGDQLQALSNG+Y+SVWHRA+VN D+PRMSVASFLCP  DA I     LL D +
Sbjct  245   GALVVNIGDQLQALSNGRYRSVWHRAVVNADRPRMSVASFLCPCNDARIGPAARLLTDGT  304

Query  958   PAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             PAVYRD+TY EYY+KFWSRNL+QEHCLE F+ 
Sbjct  305   PAVYRDYTYAEYYAKFWSRNLDQEHCLELFRT  336



>ref|XP_004985921.1| PREDICTED: flavanone 3-dioxygenase-like [Setaria italica]
Length=336

 Score =   478 bits (1229),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 222/337 (66%), Positives = 266/337 (79%), Gaps = 1/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  QL+ S   +  LP+ Y+RPE++RP+L EV +   +PV+DL   D + +V  IG+AC 
Sbjct  1     MADQLI-STAVHEELPENYVRPEAQRPRLHEVVSDAQIPVVDLADPDPAAVVASIGEACT  59

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQV+NHGVP +++  ML VA+EFF L  EEK KLYSDDP K MRLSTSFNV+KETV
Sbjct  60    THGFFQVLNHGVPVELMVAMLAVAYEFFRLPAEEKAKLYSDDPGKKMRLSTSFNVRKETV  119

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL++Y P+WP+NPP+ R++V  Y  EVR +GF++ EAIS SLGL+   
Sbjct  120   HNWRDYLRLHCYPLEQYVPDWPANPPSFREIVSAYCREVRALGFRLYEAISASLGLEDDY  179

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K  LGEQ QHMAVNFYP CP PELTYGLPAHTDPNALTILL D QVAGLQVL DG+W+A
Sbjct  180   VKRTLGEQEQHMAVNFYPRCPAPELTYGLPAHTDPNALTILLMDQQVAGLQVLNDGRWIA  239

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V PRP+A VINIGDQLQALSNG+YKSVWHRA+VN+D+PRMSVASFLCP  D  I     L
Sbjct  240   VNPRPNALVINIGDQLQALSNGRYKSVWHRAVVNSDRPRMSVASFLCPCNDVRIGPAAKL  299

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             + + +PAVYRD+TY EYY KFWSRNL+QEHCLE F+ 
Sbjct  300   VGEGAPAVYRDYTYAEYYGKFWSRNLDQEHCLELFRT  336



>gb|AAL58118.1|AC092697_6 putative flavanone 3-hydroxylase [Oryza sativa Japonica Group]
 gb|AAM76343.1|AC074196_1 unknown protein [Oryza sativa Japonica Group]
 gb|ABB47934.2| oxidoreductase, 2OG-Fe oxygenase family protein, expressed [Oryza 
sativa Japonica Group]
 gb|EEC67367.1| hypothetical protein OsI_34472 [Oryza sativa Indica Group]
Length=342

 Score =   477 bits (1228),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 216/332 (65%), Positives = 265/332 (80%), Gaps = 0/332 (0%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACRHYGFF  1679
             L S   + T+P KY+RPES+RP+L  V +   +PV+DL   DR+ +V  +GDACR +GFF
Sbjct  11    LLSTAVHDTMPGKYVRPESQRPRLDLVVSDARIPVVDLASPDRAAVVSAVGDACRTHGFF  70

Query  1678  QVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRD  1499
             QV+NHG+   +I  +++V  EFF L  EEK KLYSDDP+K +RLSTSFNV+KETVHNWRD
Sbjct  71    QVVNHGIDAALIASVMEVGREFFRLPAEEKAKLYSDDPAKKIRLSTSFNVRKETVHNWRD  130

Query  1498  YLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVL  1319
             YLRLHCYPL ++ P+WPSNPP+ ++++  Y TEVR++GF++ EAISESLGL+    +  L
Sbjct  131   YLRLHCYPLHQFVPDWPSNPPSFKEIIGTYCTEVRELGFRLYEAISESLGLEGGYMRETL  190

Query  1318  GEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRP  1139
             GEQ QHMAVN+YP CPEPELTYGLPAHTDPNALTILL D QVAGLQVL DGKW+AV P+P
Sbjct  191   GEQEQHMAVNYYPQCPEPELTYGLPAHTDPNALTILLMDDQVAGLQVLNDGKWIAVNPQP  250

Query  1138  DAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDES  959
              A VINIGDQLQALSNGKY+SVWHRA+VN+D+ RMSVASFLCP     +   K L+ D+S
Sbjct  251   GALVINIGDQLQALSNGKYRSVWHRAVVNSDRERMSVASFLCPCNSVELGPAKKLITDDS  310

Query  958   PAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             PAVYR++TY EYY KFWSRNL+QEHCLE F+ 
Sbjct  311   PAVYRNYTYDEYYKKFWSRNLDQEHCLELFRT  342



>ref|XP_006649297.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Oryza 
brachyantha]
Length=349

 Score =   478 bits (1229),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 223/336 (66%), Positives = 268/336 (80%), Gaps = 1/336 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  QL+ S   + TLP  Y+RPE++RP+L+EV     +PV+DL   DR+ +V Q+G ACR
Sbjct  1     MAEQLI-STADHDTLPGSYVRPEAQRPRLAEVVADASIPVVDLADPDRAHLVSQVGAACR  59

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQV+NHGVP ++I     VAHEFF L  EE  KLYSDDP+K +RLSTSFNV+KETV
Sbjct  60    SHGFFQVLNHGVPVELILSGGAVAHEFFRLPAEEMAKLYSDDPAKKIRLSTSFNVRKETV  119

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL +Y P+WPSNP + R++V  Y  EVR++GF++  AISESL L+   
Sbjct  120   HNWRDYLRLHCYPLDRYLPDWPSNPTSFREIVSTYCKEVRELGFRLYGAISESLDLEHDY  179

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              +NVLGEQ QHMAVNFYP CPEPELT+GLPAHTDPNALTILL D QVAGLQVL +GKW+A
Sbjct  180   IRNVLGEQEQHMAVNFYPKCPEPELTFGLPAHTDPNALTILLMDQQVAGLQVLNEGKWIA  239

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P+P+A VINIGDQLQALSNG+YKSVWHRA+VN+DK RMSVASFLCP  D +I   + L
Sbjct  240   VNPQPNALVINIGDQLQALSNGRYKSVWHRAVVNSDKARMSVASFLCPCNDVLIGPAQKL  299

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             + D SPAVYR++TY EYY KFWSRNL+QEHCLE F+
Sbjct  300   ITDGSPAVYRNYTYDEYYKKFWSRNLDQEHCLELFR  335



>ref|XP_006662003.1| PREDICTED: flavanone 3-dioxygenase-like [Oryza brachyantha]
Length=340

 Score =   476 bits (1224),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 216/332 (65%), Positives = 264/332 (80%), Gaps = 0/332 (0%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACRHYGFF  1679
             L S   + T+P KY+RPES+RP+L  V +   +PV+DL   DR+ +V  IGDAC  +GFF
Sbjct  9     LLSTAVHETMPGKYVRPESQRPRLDLVVSGARIPVVDLASPDRAAVVSAIGDACHTHGFF  68

Query  1678  QVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRD  1499
             QV+NHG+   +I  +++VA EFF L  EEK KLYSDDP+K +RLSTSFNV+KETVHNWRD
Sbjct  69    QVVNHGIDPALILSVMEVAREFFRLPAEEKAKLYSDDPAKKIRLSTSFNVRKETVHNWRD  128

Query  1498  YLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVL  1319
             YLRLHCYPL+ + P+WPSNPP+ ++++  Y TEVR++GF++ EAISESLGL+    K  +
Sbjct  129   YLRLHCYPLEHFVPDWPSNPPSFKEIISTYCTEVRELGFRLYEAISESLGLEGSYIKKTM  188

Query  1318  GEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRP  1139
             GEQ QHMAVN+YP CPEPELTYGLPAHTDPNALTILL D QVAGLQVL DGKW+AV P+P
Sbjct  189   GEQEQHMAVNYYPQCPEPELTYGLPAHTDPNALTILLMDDQVAGLQVLNDGKWIAVNPQP  248

Query  1138  DAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDES  959
              A VINIGDQLQALSNG+Y+SVWHRA+VN+D+ RMSVASFLCP     +   K L+ D+S
Sbjct  249   GALVINIGDQLQALSNGRYRSVWHRAVVNSDRERMSVASFLCPCNSVELGPAKKLVTDDS  308

Query  958   PAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             PAVYR +TY EYY KFWSRNL+QEHCLE F+ 
Sbjct  309   PAVYRSYTYDEYYKKFWSRNLDQEHCLELFRT  340



>dbj|BAJ98133.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00634.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score =   475 bits (1223),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 217/337 (64%), Positives = 266/337 (79%), Gaps = 1/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  QL+ +   + TLP  Y+R E+ERP+L EV    D+PV+DL   DR+ +V QIG AC 
Sbjct  1     MAEQLISTAV-HHTLPHSYVRSEAERPRLHEVVPDADIPVVDLANPDRAAVVSQIGAACS  59

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQV+NHG+P + +   + VAH+FF L  EEK KLYSDDP+K MRLSTSFNV+KETV
Sbjct  60    SHGFFQVLNHGLPVEAMRAAMAVAHDFFRLPPEEKAKLYSDDPAKKMRLSTSFNVRKETV  119

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHC+PL ++ PEWP+NPP  RDV+  Y  EVR +GF++  AISESLGL+   
Sbjct  120   HNWRDYLRLHCHPLDQFVPEWPANPPPFRDVMSTYCKEVRDLGFRLYAAISESLGLEQDY  179

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K VLGEQ QHMAVNFYP CP PELTYGLPAHTDPNALTIL+ D QVAGLQVLK+G+W+A
Sbjct  180   IKKVLGEQEQHMAVNFYPKCPSPELTYGLPAHTDPNALTILMMDEQVAGLQVLKEGRWIA  239

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V PRP+A VIN+GDQLQALSNG+Y+SVWHRA+VN+D+PRMS+ASFLCP    ++   + L
Sbjct  240   VNPRPNALVINLGDQLQALSNGRYRSVWHRAVVNSDRPRMSIASFLCPCNSVMLGPAEKL  299

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             +  E+PAVYR++TY EYY KFWSRNL+QEHCLE F+ 
Sbjct  300   IGAETPAVYRNYTYDEYYKKFWSRNLDQEHCLELFRT  336



>ref|XP_008354296.1| PREDICTED: 2'-deoxymugineic-acid 2'-dioxygenase-like [Malus domestica]
Length=332

 Score =   474 bits (1220),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 221/336 (66%), Positives = 270/336 (80%), Gaps = 9/336 (3%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M T++L SG  Y+ LP+ Y+RPES+RP+LSEV+ C+++PVIDL   +R+  V+Q+GDAC+
Sbjct  1     MDTKVLSSGVIYTNLPESYVRPESDRPRLSEVSECENIPVIDLASPNRAQTVQQVGDACK  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
             +YGFFQVINHGV  + +E M+ VA+EFFNL VEEK+KLYSDDPSKTMRLSTSFNVKKE V
Sbjct  61    YYGFFQVINHGVSTEGVEKMVGVANEFFNLPVEEKLKLYSDDPSKTMRLSTSFNVKKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL KY PEWPSNP + RD V  Y  EVR++G+++EE ISESLGL+   
Sbjct  121   HNWRDYLRLHCYPLDKYVPEWPSNPSSFRDTVGNYCREVRELGYRLEELISESLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              ++ LGEQGQHMAVNFYPPCP+PELTYGLPAHTDPNALTILLQDL VAGL+  K    LA
Sbjct  181   IRSTLGEQGQHMAVNFYPPCPQPELTYGLPAHTDPNALTILLQDLGVAGLKFSKMANGLA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P+P+AF         ALSNG YKSVWHRA+ NT++ R+SVASFLCP +DA+IS  K L
Sbjct  241   VNPQPNAF---------ALSNGIYKSVWHRAVTNTERARLSVASFLCPQDDALISPAKAL  291

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
              +D S A+YR +TY EYY KFW+R+L ++HCL+ FK
Sbjct  292   TEDGSAAIYRGYTYTEYYKKFWTRDLEKDHCLDLFK  327



>ref|XP_002467587.1| hypothetical protein SORBIDRAFT_01g030560 [Sorghum bicolor]
 gb|EER94585.1| hypothetical protein SORBIDRAFT_01g030560 [Sorghum bicolor]
Length=336

 Score =   473 bits (1216),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 218/337 (65%), Positives = 264/337 (78%), Gaps = 1/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  QLL S   + TLP  Y+RPES+RP+L+EV T   +PV+DLG  DR+ +V  IGDACR
Sbjct  1     MAEQLL-STAVHDTLPGSYVRPESQRPRLAEVVTGARIPVVDLGSPDRAAVVAAIGDACR  59

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQV+NHGV   ++  ++ V   FF LS EEK KLYSDDP++ +RLSTSFNV+KETV
Sbjct  60    SHGFFQVLNHGVHADLVAAVMAVGRAFFRLSPEEKAKLYSDDPARKIRLSTSFNVRKETV  119

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHC+PL ++ P+WPSNPP  +D +  Y  EVR++GF++  AISESLGL+   
Sbjct  120   HNWRDYLRLHCHPLDEFVPDWPSNPPDFKDTMSTYCKEVRELGFRLYAAISESLGLEASY  179

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K  LGEQ QHMAVNFYPPCPEPELTYGLPAHTDPNALTILL D  VAGLQVL  GKW+A
Sbjct  180   MKETLGEQEQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLMDQDVAGLQVLHGGKWVA  239

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P+P A +INIGDQLQALSNG+Y+SVWHRA+VN+D+ RMSVASFLCP    V+   K L
Sbjct  240   VNPQPGALIINIGDQLQALSNGQYRSVWHRAVVNSDRERMSVASFLCPCNHVVLGPAKKL  299

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             + +++PAVYR +TY EYY KFWSRNL+QEHCLE F+ 
Sbjct  300   VTEDTPAVYRSYTYDEYYKKFWSRNLDQEHCLELFRT  336



>ref|XP_009411417.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Musa 
acuminata subsp. malaccensis]
Length=341

 Score =   470 bits (1210),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 215/336 (64%), Positives = 265/336 (79%), Gaps = 0/336 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  QLL + T + TLP+ Y+RPES+RP+L++V T   +P+IDLG  D++ I+ +IG AC+
Sbjct  1     MADQLLSTATHHHTLPENYVRPESQRPRLTQVITDASIPIIDLGSPDKAQIISRIGQACQ  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQV+NHG+  +++  M+    EFF L  EEK KLYSDDPSK +RLSTSFNVKKE V
Sbjct  61    SYGFFQVVNHGIDTELMVKMMTTGLEFFRLPSEEKAKLYSDDPSKKIRLSTSFNVKKELV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL++Y P WPSNP + ++VV  Y  +VR +GF++  AIS SLGL+   
Sbjct  121   HNWRDYLRLHCYPLEEYVPGWPSNPSSFKEVVSTYCQQVRGLGFRLLGAISLSLGLEEDF  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              +  LGEQ QHMA+N+YP CPEPELTYGLPAHTDPNALT+LLQD  VAGLQVL+DGKW+A
Sbjct  181   IERALGEQEQHMAINYYPKCPEPELTYGLPAHTDPNALTVLLQDSDVAGLQVLRDGKWMA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P+P A VINIGDQLQALSNG+Y SVWHRA+VN++K RMSVASFLCP  + +IS P+ L
Sbjct  241   VDPKPSALVINIGDQLQALSNGRYNSVWHRAVVNSNKERMSVASFLCPCNNVIISPPEEL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             + + SPA YR +TY EYY KFWSRNL+ EHCLE FK
Sbjct  301   VSEGSPATYRRYTYDEYYKKFWSRNLDGEHCLELFK  336



>ref|XP_010934017.1| PREDICTED: flavanone 3-dioxygenase [Elaeis guineensis]
Length=337

 Score =   469 bits (1208),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 224/337 (66%), Positives = 270/337 (80%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +LL +   +  LP+ Y+RPES+RP+L+EV +  ++PV+DLG  D+S I+ QI DACR
Sbjct  1     MADRLLSTVPHHRNLPESYVRPESQRPRLAEVESDANIPVVDLGADDQSQIISQINDACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQ++NHG+  +++  M+ +A EFF L  EEK KLYSDDP+K +RLSTSFNV+KETV
Sbjct  61    SYGFFQIVNHGISVELMLKMMAIAFEFFYLPPEEKAKLYSDDPAKKIRLSTSFNVRKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL+++ P WPSNPP+ R+VV  Y  EVRQ+GF++   IS SLGL+   
Sbjct  121   HNWRDYLRLHCYPLEEFVPGWPSNPPSFREVVSTYCREVRQLGFRLLGLISLSLGLEEDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              + VLGEQ QHMA+N+YP CPEPELTYGLPAHTDPNALTILLQD +VAGLQV KDGKW+ 
Sbjct  181   IEKVLGEQEQHMAINYYPQCPEPELTYGLPAHTDPNALTILLQDQKVAGLQVFKDGKWIR  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P P+AFVINIGDQLQALSNG+YKSVWHRA+VN+D+ RMSVASFLCP   AVIS  K L
Sbjct  241   VDPHPNAFVINIGDQLQALSNGRYKSVWHRAVVNSDEERMSVASFLCPCNSAVISPAKTL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
               D S AVYR FTY EYY KFWSRNL+QEHCLE FK+
Sbjct  301   TGDGSAAVYRSFTYAEYYKKFWSRNLDQEHCLELFKS  337



>ref|XP_009389864.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=337

 Score =   468 bits (1204),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 215/337 (64%), Positives = 269/337 (80%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  +LL +   + +LP+ YIRPES+RP+L+EV +   VP +DL   D+S ++ QI DACR
Sbjct  1     MADRLLSTVPHHHSLPENYIRPESQRPRLAEVISDAHVPAVDLSSPDKSHVIAQIADACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQV+NHGVP +++  M+ +A EFF L  EEK K YSDDP++ MRLSTSFN++KETV
Sbjct  61    SYGFFQVLNHGVPVELMVKMMVIALEFFRLPPEEKAKHYSDDPARKMRLSTSFNIRKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL+ Y PEWPSNP + ++V   Y  EVRQ+GF++  AIS SLGL+ + 
Sbjct  121   HNWRDYLRLHCYPLEDYVPEWPSNPSSFKEVASAYCKEVRQLGFRLLGAISLSLGLEEKY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              + VLGEQ QHMAVN+YP CP+P+LTYGLP HTDPNALTILLQD  V+GLQVLK G+W+A
Sbjct  181   MEEVLGEQEQHMAVNYYPKCPQPQLTYGLPPHTDPNALTILLQDPDVSGLQVLKHGQWIA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P+P AFVINIGDQLQALSNG+YKSVWHRA+VN++K RMS+ASFLCP   A+IS P+ L
Sbjct  241   VHPQPHAFVINIGDQLQALSNGRYKSVWHRAVVNSEKERMSIASFLCPCNCAIISPPEKL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             + + SPA+YR +TY EYY KFWSRNL+ EHCLE F++
Sbjct  301   ISEASPAMYRSYTYEEYYKKFWSRNLDDEHCLEVFRS  337



>ref|XP_009382233.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Musa 
acuminata subsp. malaccensis]
Length=353

 Score =   466 bits (1200),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 220/336 (65%), Positives = 274/336 (82%), Gaps = 0/336 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  QLL + T + TLP+ Y+RPES+RP+L++V +  ++P+IDLG  D+S I+ QIG AC+
Sbjct  1     MADQLLSTVTYHETLPENYVRPESQRPRLTQVISDANIPIIDLGSPDKSRIISQIGKACQ  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQV+NHG+  +++  M+ ++ EFF L  EEK KLYSDDP+K MRLSTSFNV+KE V
Sbjct  61    SYGFFQVVNHGIDTELMVKMMAISLEFFRLPPEEKAKLYSDDPAKKMRLSTSFNVRKEAV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL++Y P WPSNP + ++VV  Y  EVR++GF++  A+S SLGL+ + 
Sbjct  121   HNWRDYLRLHCYPLEEYVPGWPSNPSSFKEVVSTYCKEVRRLGFRLLGALSLSLGLEEEY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              + VLG+Q QHMA+N+YP CPEPELTYGLPAHTDPNALTILLQ   VAGLQVLKDGKW+A
Sbjct  181   IERVLGQQEQHMAINYYPRCPEPELTYGLPAHTDPNALTILLQQPNVAGLQVLKDGKWIA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V+PRP+AFVINIGDQLQALSN ++KSVWHRA+VN+D  RMSVASFLCP   A+IS P+ L
Sbjct  241   VEPRPNAFVINIGDQLQALSNARFKSVWHRAVVNSDTERMSVASFLCPCNTAIISPPEKL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             L + SPAVYR +TY EYY+KFWSRNL+ EHCLE FK
Sbjct  301   LAEGSPAVYRSYTYDEYYNKFWSRNLDDEHCLELFK  336



>ref|XP_009397555.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Musa 
acuminata subsp. malaccensis]
Length=369

 Score =   466 bits (1198),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 219/344 (64%), Positives = 265/344 (77%), Gaps = 0/344 (0%)
 Frame = -3

Query  1894  SFR*PDSMTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVR  1715
             + R   SM  QLL + T + +LP+ Y+RPES+RP L+EV    DVP IDLG  D S  V 
Sbjct  26    ALRRASSMADQLLSTVTHHGSLPETYVRPESQRPHLNEVLRDADVPTIDLGSTDLSQTVA  85

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             Q+ DAC  YGFFQV+NHGVP +++  M+ VA EFF L  EEK KLYSDDP+K MRLSTSF
Sbjct  86    QVADACSTYGFFQVVNHGVPIELMLKMMAVALEFFRLPSEEKAKLYSDDPAKKMRLSTSF  145

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             NV+KE   NWRDYLRLHCYPL+++ P WPSNP + ++VV  Y  EVRQ+GF++   IS  
Sbjct  146   NVRKEKFRNWRDYLRLHCYPLEEFVPGWPSNPSSFKEVVSSYCREVRQLGFRLLGLISIG  205

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL+      VLGEQ QHMAVN+YP CP PELTYGL AHTDPNALT+LLQD  VAGLQV 
Sbjct  206   LGLEEDYMATVLGEQEQHMAVNYYPKCPAPELTYGLQAHTDPNALTLLLQDPDVAGLQVR  265

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             KDGKW+AV P+P+AFV+NIGDQLQALSNG+Y+SVWHRA+VN DK R+SVASFLCP  +A+
Sbjct  266   KDGKWIAVNPQPNAFVVNIGDQLQALSNGRYRSVWHRAVVNADKERISVASFLCPCNNAI  325

Query  994   ISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             IS P+ L+ D SPA+YR +TY EYY KFWSRNL+ EHCL+ F++
Sbjct  326   ISPPEKLVADGSPAMYRSYTYDEYYKKFWSRNLDDEHCLQLFRS  369



>ref|XP_009400200.1| PREDICTED: flavanone 3-dioxygenase-like [Musa acuminata subsp. 
malaccensis]
Length=337

 Score =   463 bits (1191),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 214/336 (64%), Positives = 263/336 (78%), Gaps = 0/336 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  QLL + + Y ++P+ Y+RPES+RP+L+EV    ++P IDLG  D   I+ Q+ DACR
Sbjct  1     MADQLLSAVSDYVSIPESYVRPESQRPRLNEVIRGANIPTIDLGSEDELQIIAQVADACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQV+NHGVP + ++ M+ VA EFF L  EEK K YSDDP+K MRLSTSFN+KKETV
Sbjct  61    SFGFFQVVNHGVPLESMQKMMAVASEFFRLPPEEKAKHYSDDPAKKMRLSTSFNIKKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
              NWRDYLRLHCYPL+++ P WPSNP + RDVV  Y  EVR++GF++  AIS SL L+   
Sbjct  121   RNWRDYLRLHCYPLEEFVPGWPSNPASFRDVVSTYCREVRRLGFRLLRAISLSLELEEGY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
                VLGEQ QHMAVN+YP CPEPELTYGL AHTDPNALT+LLQD  VAGLQVLKDGKW+A
Sbjct  181   MAKVLGEQEQHMAVNYYPKCPEPELTYGLQAHTDPNALTVLLQDPNVAGLQVLKDGKWIA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P+PDA VINIGDQLQALSNG+Y+SVWHRA+VN+++ R+SVASFLCP    VIS P+ L
Sbjct  241   VNPQPDALVINIGDQLQALSNGRYRSVWHRAVVNSERERISVASFLCPSSSVVISPPEKL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             + D +  VYR +TY EYY KFWSRNL+ +HCL+ F+
Sbjct  301   VGDRARPVYRTYTYDEYYKKFWSRNLDDDHCLKLFE  336



>ref|XP_002465962.1| hypothetical protein SORBIDRAFT_01g049030 [Sorghum bicolor]
 gb|EER92960.1| hypothetical protein SORBIDRAFT_01g049030 [Sorghum bicolor]
Length=336

 Score =   461 bits (1187),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 217/332 (65%), Positives = 261/332 (79%), Gaps = 0/332 (0%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACRHYGFF  1679
             L S   + TLP  Y+RPE++RP+L EV    ++PV+DL   DR+ +V ++ +ACR +GFF
Sbjct  5     LISTAEHDTLPDSYVRPETQRPRLREVVPDAEIPVVDLAVPDRAAVVARVAEACRTHGFF  64

Query  1678  QVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRD  1499
             QV+NHGV +++   ML VA+EFF L  EEK KLYSDDP K MRLSTSFNV+KETVHNWRD
Sbjct  65    QVVNHGVAEELTAAMLAVAYEFFRLPAEEKAKLYSDDPGKKMRLSTSFNVRKETVHNWRD  124

Query  1498  YLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVL  1319
             YLRLHC+PL++Y P+WP NPP+ R+ V  Y  EVR +GF++  AISE L LD    K  L
Sbjct  125   YLRLHCHPLEQYVPDWPDNPPSFRETVSAYCREVRALGFRLYGAISEGLDLDGVYIKETL  184

Query  1318  GEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRP  1139
             GEQ QHMAVNFYP CP PELTYGLPAHTDPNALTILL D QVAGLQVLKDG+W+AV PRP
Sbjct  185   GEQEQHMAVNFYPRCPAPELTYGLPAHTDPNALTILLMDQQVAGLQVLKDGRWIAVNPRP  244

Query  1138  DAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDES  959
              A V+N+GDQLQALSNG+YKSVWHRA+VN+D+PRMSVASFLCP  D  I     L+  ++
Sbjct  245   GALVVNLGDQLQALSNGRYKSVWHRAVVNSDRPRMSVASFLCPCNDVRIGPAAKLVTGDT  304

Query  958   PAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             PAVYRD+TY EYY+KFWSRNL+QEHCLE F+ 
Sbjct  305   PAVYRDYTYAEYYAKFWSRNLDQEHCLELFRT  336



>ref|XP_008797642.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Phoenix 
dactylifera]
Length=337

 Score =   461 bits (1185),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 219/336 (65%), Positives = 267/336 (79%), Gaps = 0/336 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  QLL +G P  TLP+ Y+RPESERP+L+EV +  ++PVIDLG  + S I+ QIG AC+
Sbjct  1     MADQLLSTGPPRRTLPESYVRPESERPRLAEVESDTNIPVIDLGADNESHIISQIGAACQ  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQ++NHG+   +++DM+++  EFF+L  EEK KLYSDDP+K +RLSTSFN++KE V
Sbjct  61    SYGFFQIVNHGMAIGLMDDMVEITREFFSLPPEEKAKLYSDDPAKKIRLSTSFNIRKEKV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL+ + P WPS PP+ R+VV  Y  EVR +GFKI   IS SLGL+   
Sbjct  121   HNWRDYLRLHCYPLEDFVPGWPSKPPSFREVVSSYCREVRHLGFKILGLISLSLGLEKDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              + VLGEQ QHMA+N+YP CPEPELTYGLPAHTDPNA+TILLQD +VAGLQV +DGKW+ 
Sbjct  181   IEKVLGEQEQHMAINYYPQCPEPELTYGLPAHTDPNAVTILLQDQKVAGLQVQRDGKWIR  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P P+AFVIN+GDQ+QALSNG+YKSVWHRAIVN+DK R+SVASFLCP   A IS  K L
Sbjct  241   VDPHPNAFVINLGDQIQALSNGRYKSVWHRAIVNSDKERISVASFLCPCNSAAISPAKKL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
               + SPAVYR +TY EYY KFWS NL+Q+HCLE FK
Sbjct  301   TGEGSPAVYRSYTYDEYYKKFWSSNLDQDHCLELFK  336



>ref|XP_008650332.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like isoform 
X1 [Zea mays]
 tpg|DAA43014.1| TPA: hypothetical protein ZEAMMB73_562821 [Zea mays]
Length=369

 Score =   462 bits (1188),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 218/362 (60%), Positives = 262/362 (72%), Gaps = 30/362 (8%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACRHYGFF  1679
             L S   +  LP  Y+RPE++RP+L EV    ++PV+DL   DR  +V ++ +ACR +GFF
Sbjct  5     LISTADHDRLPDSYVRPETQRPRLREVVPDAEIPVVDLADPDREAVVARVAEACRTHGFF  64

Query  1678  QVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRD  1499
             Q++NHGVP+++   M+ VA+EFF L  EEK KLYSDDP+K MRLSTSFNV+KETVHNWRD
Sbjct  65    QLLNHGVPEQLTAAMMSVAYEFFRLPAEEKAKLYSDDPAKKMRLSTSFNVRKETVHNWRD  124

Query  1498  YLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVL  1319
             YLRLHC+PL++Y P+WP NPP+ R  V  Y + VR++GF++  AISE LGLD    K  L
Sbjct  125   YLRLHCHPLEQYVPDWPDNPPSFRRTVSAYCSAVRELGFRLYVAISEGLGLDGAYIKEAL  184

Query  1318  GEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRP  1139
             GEQ QHMAVNFYP CP PELTYGLPAHTDPNALTILL D QVAGLQVLKDG+W+AV PRP
Sbjct  185   GEQEQHMAVNFYPRCPAPELTYGLPAHTDPNALTILLMDQQVAGLQVLKDGRWIAVNPRP  244

Query  1138  DAFVINIGDQL------------------------------QALSNGKYKSVWHRAIVNT  1049
              A V+NIGDQL                              QALSNG+Y+SVWHRA+VN 
Sbjct  245   GALVVNIGDQLQVTCSCLALPLFPPSHLLSAPGLHYCTAPAQALSNGRYRSVWHRAVVNA  304

Query  1048  DKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHF  869
             D+PRMSVASFLCP  DA I     LL D +PAVYRD+TY EYY+KFWSRNL+QEHCLE F
Sbjct  305   DRPRMSVASFLCPCNDARIGPAARLLTDGTPAVYRDYTYAEYYAKFWSRNLDQEHCLELF  364

Query  868   KN  863
             + 
Sbjct  365   RT  366



>ref|XP_009400481.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Musa 
acuminata subsp. malaccensis]
Length=337

 Score =   456 bits (1173),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 213/337 (63%), Positives = 264/337 (78%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  QLL +   Y +LP+ YIRPE +RP L+EV +   +P ID+G  DRS +V QIG ACR
Sbjct  1     MADQLLSTAPDYHSLPENYIRPEDQRPVLTEVVSDAHIPAIDMGAPDRSHVVSQIGHACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQV+NHGVP +++  +L VA EFF+L   EK KLYSDDP+K +RLSTS N++KET+
Sbjct  61    SYGFFQVVNHGVPVELMLRLLVVAREFFHLPPTEKAKLYSDDPTKKVRLSTSSNIRKETI  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
              NWRDYLR+HCYPL++Y PEWP +P + ++VV  Y  EVRQ+G ++ EAIS SLGL+  C
Sbjct  121   RNWRDYLRIHCYPLEEYVPEWPCDPSSFKEVVSAYCKEVRQLGLRLLEAISLSLGLEEDC  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
                 LGEQGQHMA+N+YP CP+P+LTYGLPAHTDPNALTILL D  VAGLQVLKDG+W+A
Sbjct  181   LVKALGEQGQHMAINYYPRCPQPQLTYGLPAHTDPNALTILLPDPDVAGLQVLKDGRWIA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P   AFVINIGDQLQAL+NGKYKSV HRA+VN +K R+SVASFLCP   A+IS P+ L
Sbjct  241   VDPLAHAFVINIGDQLQALTNGKYKSVLHRAVVNPEKERISVASFLCPCNYAIISPPERL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             + + SPA+YR +TY EYY KFWSRNL++E CLE F++
Sbjct  301   ISEGSPAMYRSYTYEEYYKKFWSRNLDEEPCLELFQS  337



>ref|XP_003580379.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Brachypodium 
distachyon]
Length=339

 Score =   454 bits (1168),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 210/336 (63%), Positives = 262/336 (78%), Gaps = 0/336 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  QLL + + + TLP+ Y RPES+RP+L+EV T  ++P+IDL   D+  ++ +I  ACR
Sbjct  1     MANQLLSTVSCHDTLPEGYARPESDRPRLAEVATDSNIPLIDLASPDKLRVIAEIDRACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHG+ ++++E ++ V  EFF L  EEK KLYSD+PSK +RLSTSFNV+KETV
Sbjct  61    TYGFFQVINHGISEELLEKVMAVGLEFFRLPPEEKAKLYSDEPSKKIRLSTSFNVRKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHC+PL+++ P+WPSNP   ++++  Y  EVR +G ++  AIS SLGLD   
Sbjct  121   HNWRDYLRLHCHPLEEFVPDWPSNPEAFKEIISTYCREVRLLGLRLMGAISLSLGLDENY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              +NVLGEQ QHMAVN+YP CPEP+LTYGLP HTDPNALT+LLQD  V+GLQVLKDG+W+A
Sbjct  181   VENVLGEQEQHMAVNYYPRCPEPDLTYGLPKHTDPNALTVLLQDPNVSGLQVLKDGQWIA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V PRP+A VIN+GDQLQALSNG YKSVWHRA+VN  + RMSVASFLCP   AVI     L
Sbjct  241   VDPRPNALVINLGDQLQALSNGAYKSVWHRAVVNAAQERMSVASFLCPCNSAVIGPAAKL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             + D    VYR +TY EYY+KFWSRNL+QEHCLE F+
Sbjct  301   VGDGDEPVYRSYTYDEYYNKFWSRNLDQEHCLELFR  336



>ref|XP_008783535.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Phoenix 
dactylifera]
Length=337

 Score =   452 bits (1164),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 217/337 (64%), Positives = 266/337 (79%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  QLL +     TLP+ Y+RPES+RP+L+EV +  ++ V+DLG  D S I+ QIGDAC+
Sbjct  1     MADQLLSTAPHRRTLPESYVRPESQRPRLAEVESDANISVVDLGADDESQIISQIGDACQ  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YG FQV+NHG+P +++  ML VA EFF L  EEK KLYSDDP+K +RLSTSFNV+KETV
Sbjct  61    SYGLFQVVNHGMPVELMLKMLAVAFEFFCLPPEEKAKLYSDDPAKKIRLSTSFNVRKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL+++ PEWPS P + R+VV  Y  EVR++GF++   IS SLGL+   
Sbjct  121   HNWRDYLRLHCYPLEEFVPEWPSKPASFREVVSSYCREVRRLGFRLLGLISLSLGLEEDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              + VLGEQ QHMA+N+YP CPEPELT+GLPAHTDPNALTILLQD +VAGLQ+LKD KW+ 
Sbjct  181   IEKVLGEQEQHMAINYYPRCPEPELTFGLPAHTDPNALTILLQDPKVAGLQILKDDKWIR  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P P+AFV+N+GDQLQALSNG+YKSV HRA+VN+D  RMSVASF+CP   AVIS  + L
Sbjct  241   VDPHPNAFVVNVGDQLQALSNGRYKSVRHRAVVNSDMDRMSVASFVCPCNSAVISPARKL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
               + SPA+YR FTY EYY KFWSRNL+QEHCLE F+ 
Sbjct  301   TGEGSPAIYRSFTYEEYYKKFWSRNLDQEHCLELFRG  337



>gb|EMT01663.1| Naringenin,2-oxoglutarate 3-dioxygenase [Aegilops tauschii]
Length=382

 Score =   454 bits (1167),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 219/383 (57%), Positives = 269/383 (70%), Gaps = 47/383 (12%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  QL+ +   + TLP  Y+R E++RP+L EV    D+PV+DL   DR+ +V QIG AC 
Sbjct  1     MAEQLISTAV-HHTLPDSYVRSEADRPRLDEVVPDADIPVVDLANPDRAAVVAQIGAACS  59

Query  1693  HYGFFQV----------------------------------------------INHGVPK  1652
              +GFFQV                                              +NHG+P 
Sbjct  60    SHGFFQVSPKLPIPIPSDLQARPALCFSFREERMEALCFGSPWSRMSLIDRQVLNHGLPL  119

Query  1651  KVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLHCYPL  1472
             +V+   + VAH+FF LS EEK KLYSDDP+K MRLSTSFNV+KETVHNWRDYLRLHC+PL
Sbjct  120   EVMLAAMAVAHDFFRLSPEEKAKLYSDDPAKKMRLSTSFNVRKETVHNWRDYLRLHCHPL  179

Query  1471  QKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQHMAV  1292
             +++ PEWP+NPP  RDV+  Y  EVRQ+GF++   ISESLGL+    K VLGEQ QHMAV
Sbjct  180   EQFVPEWPANPPPFRDVMSTYCKEVRQLGFRLYAMISESLGLEQDYIKKVLGEQEQHMAV  239

Query  1291  NFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVINIGD  1112
             NFYP CP PELTYGLPAHTDPNALTIL+ D QVAGLQVLK+G+W+AV PRP+A VIN+GD
Sbjct  240   NFYPKCPSPELTYGLPAHTDPNALTILMMDEQVAGLQVLKEGRWIAVNPRPNALVINLGD  299

Query  1111  QLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYRDFTY  932
             QLQALSNG+YKSVWHRA+VN+D+PRMS+ASFLCP     +   + L+ ++SPAVYR++TY
Sbjct  300   QLQALSNGRYKSVWHRAVVNSDRPRMSIASFLCPCNSVKLGPAEKLIGEKSPAVYRNYTY  359

Query  931   PEYYSKFWSRNLNQEHCLEHFKN  863
              EYY KFWSRNL+QEHCLE F+ 
Sbjct  360   DEYYKKFWSRNLDQEHCLELFRT  382



>ref|NP_001151167.1| gibberellin 20 oxidase 2 [Zea mays]
 gb|ACF87367.1| unknown [Zea mays]
 gb|ACG41840.1| gibberellin 20 oxidase 2 [Zea mays]
 tpg|DAA46074.1| TPA: gibberellin 20 oxidase 2 [Zea mays]
Length=336

 Score =   452 bits (1162),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 207/332 (62%), Positives = 259/332 (78%), Gaps = 0/332 (0%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACRHYGFF  1679
             L S   + TLP  Y+RPE ERP+L+EV T   +PV+DLG  DR  +V  +GDACR +GFF
Sbjct  5     LLSTAVHDTLPGSYVRPEPERPRLAEVVTGARIPVVDLGSPDRGAVVAAVGDACRSHGFF  64

Query  1678  QVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRD  1499
             QV+NHG+   ++  ++     FF L  EEK KLYSDDP++ +RLSTSFNV+KETVHNWRD
Sbjct  65    QVVNHGIHAALVAAVMAAGRGFFRLPPEEKAKLYSDDPARKIRLSTSFNVRKETVHNWRD  124

Query  1498  YLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVL  1319
             YLRLHC+PL ++ P+WPSNPP  ++ +  Y  EVR++GF++  AISESLGL+    K  L
Sbjct  125   YLRLHCHPLDEFLPDWPSNPPDFKETMGTYCKEVRELGFRLYAAISESLGLEASYMKEAL  184

Query  1318  GEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRP  1139
             GEQ QHMAVNFYPPCPEPELTYGLPAHTDPNALTILL D  VAGLQVL  G+W+AV P+P
Sbjct  185   GEQEQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLMDPDVAGLQVLHAGQWVAVNPQP  244

Query  1138  DAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDES  959
              A +INIGDQLQALSNG+Y+SVWHRA+VN+D+ RMSVASFLCP    V+   + L+ +++
Sbjct  245   GALIINIGDQLQALSNGQYRSVWHRAVVNSDRERMSVASFLCPCNHVVLGPARKLVTEDT  304

Query  958   PAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             PAVYR++TY +YY+KFWSRNL+QEHCLE F+ 
Sbjct  305   PAVYRNYTYDKYYAKFWSRNLDQEHCLELFRT  336



>ref|XP_004983813.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Setaria 
italica]
Length=337

 Score =   451 bits (1161),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 209/332 (63%), Positives = 261/332 (79%), Gaps = 0/332 (0%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACRHYGFF  1679
             L S   + T+P  Y+RPE++RP+L+EV +   +PV+DL   DR+ +V  IG ACR +GFF
Sbjct  5     LLSTAVHRTMPGNYVRPEAQRPRLAEVVSGARIPVVDLTSPDRAAVVAAIGGACRTHGFF  64

Query  1678  QVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRD  1499
             QV+NHG+   +I +++ VA EFF L  EEK KLYSDDP++ +RLSTSFNV+KETVHNWRD
Sbjct  65    QVLNHGIDAGLIAEVMAVAREFFRLPAEEKAKLYSDDPARKIRLSTSFNVRKETVHNWRD  124

Query  1498  YLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVL  1319
             YLRLHC+PL ++ P+WPSNPP  ++ +  Y  EVR++GF++   ISESLGL+P   K  L
Sbjct  125   YLRLHCHPLDQFVPDWPSNPPDFKETMSSYCKEVRELGFRLYAVISESLGLEPGYMKETL  184

Query  1318  GEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRP  1139
             GEQ QHMAVNFYPPCP PELTYGLPAHTDPNALTILL D  VAGLQVL DGKW+AV P+P
Sbjct  185   GEQEQHMAVNFYPPCPSPELTYGLPAHTDPNALTILLMDQDVAGLQVLHDGKWVAVNPQP  244

Query  1138  DAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDES  959
              A +INIGDQLQALSNG+Y+SVWHRA+VN+D+ R+SVASFLCP  D  +   + L+  E+
Sbjct  245   GALIINIGDQLQALSNGQYRSVWHRAVVNSDRERLSVASFLCPCNDVELGPARKLVTAET  304

Query  958   PAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             PAVYR++TY EYY KFWSRNL+QEHCLE F+ 
Sbjct  305   PAVYRNYTYDEYYKKFWSRNLDQEHCLELFRT  336



>ref|XP_004976588.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like isoform 
X1 [Setaria italica]
 ref|XP_004976589.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like isoform 
X2 [Setaria italica]
 ref|XP_004976590.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like isoform 
X3 [Setaria italica]
Length=342

 Score =   449 bits (1155),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 212/338 (63%), Positives = 261/338 (77%), Gaps = 1/338 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M +QLL        LP+ YIRPES+RP+L+EV T  +VP++DL   D+  ++ +IG ACR
Sbjct  1     MGSQLLSIVERREVLPESYIRPESDRPRLAEVMTDSNVPLVDLSSPDKQRVIAEIGLACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQVINHG+ K++++ M+ V  +FF L  EEK KLYSD+PSK +RLSTSFNV+KETV
Sbjct  61    TYGFFQVINHGIEKELLDKMMAVGLQFFRLPPEEKEKLYSDEPSKKIRLSTSFNVRKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHC+PL+++ PEWPSNP + +++V  Y  EVR++G ++   IS SLGL+   
Sbjct  121   HNWRDYLRLHCHPLEEFLPEWPSNPESFKEIVSEYCREVRRLGLRLLGMISLSLGLEEDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDG-KWL  1157
              +  LGEQ QHMAVN+YP CPEP+LTYGLP HTDPNALTILLQD  VAGLQVLKDG  W+
Sbjct  181   IEKALGEQEQHMAVNYYPQCPEPDLTYGLPKHTDPNALTILLQDPNVAGLQVLKDGDHWI  240

Query  1156  AVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKP  977
             AV PRP+A VIN+GDQLQALSNG YKSVWHRA+VN  + RMSVASFLCP   AVIS    
Sbjct  241   AVNPRPNALVINLGDQLQALSNGAYKSVWHRAVVNAARERMSVASFLCPCNSAVISPAAG  300

Query  976   LLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             L+ D  P VYR +TY EYY +FWSRNL+QEHCLE F++
Sbjct  301   LVGDGDPPVYRSYTYDEYYKRFWSRNLDQEHCLELFRS  338



>ref|XP_009389277.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Musa 
acuminata subsp. malaccensis]
Length=339

 Score =   448 bits (1153),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/337 (65%), Positives = 268/337 (80%), Gaps = 0/337 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  QLL + + +S+LP  Y+RPES+RP+L EV    ++P IDLG  D S ++ Q+GDACR
Sbjct  1     MADQLLSTVSHHSSLPDTYVRPESQRPRLHEVVRDANIPTIDLGSPDVSRVIAQVGDACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQV+NHGVP +++  M+ VA EFF L  EEK K YSDDP+K MRLSTSFN++KETV
Sbjct  61    SFGFFQVVNHGVPVELMLAMMAVASEFFRLPPEEKAKHYSDDPTKKMRLSTSFNIRKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
              NWRDYLRLHCYPL+++ P WPSNP + ++VV  Y  EVRQ+G ++   IS SLGL+   
Sbjct  121   RNWRDYLRLHCYPLEEFVPGWPSNPASFKEVVSGYCREVRQLGLRLLGLISLSLGLEEAY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
                VLGEQ QHMAVN+YP CPEPELTYGL AHTDPNALTILLQD +VAGLQVLK+GKW+A
Sbjct  181   MVKVLGEQEQHMAVNYYPKCPEPELTYGLQAHTDPNALTILLQDPKVAGLQVLKNGKWIA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P+PDA+VINIGDQLQALSNG+Y+SV HRA+VN++  RMSVASFLCP   AVIS P+ L
Sbjct  241   VNPQPDAYVINIGDQLQALSNGRYRSVCHRAVVNSETDRMSVASFLCPCNSAVISTPEKL  300

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             + D SPA+YR +TY EYY+KFWSRNL+ EHCLE FK+
Sbjct  301   VVDGSPAIYRSYTYEEYYNKFWSRNLDDEHCLELFKS  337



>gb|EMS52381.1| Naringenin,2-oxoglutarate 3-dioxygenase [Triticum urartu]
Length=384

 Score =   447 bits (1149),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 217/385 (56%), Positives = 267/385 (69%), Gaps = 49/385 (13%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  QL+ +   + TLP+ Y+R E+ERP+L EV    D+PV+DL   DR+ +V QIG AC 
Sbjct  1     MAEQLISTAV-HHTLPESYVRSEAERPRLDEVVPDADIPVVDLANPDRAAVVAQIGAACS  59

Query  1693  HYGFFQV------------------------------------------------INHGV  1658
              +GFFQV                                                +NHG+
Sbjct  60    SHGFFQVSPSQFPFPPAYKPGRRSVFPFGKREWGRSAFAHRARVCRVWSLTDRQVLNHGL  119

Query  1657  PKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLHCY  1478
             P +V+   +  AHEFF LS EEK KLY+DDP+K MRLSTSFNV+KETVHNWRDYLRLHC+
Sbjct  120   PLEVMLAAMAGAHEFFRLSPEEKAKLYADDPAKKMRLSTSFNVRKETVHNWRDYLRLHCH  179

Query  1477  PLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQHM  1298
             PL+++ PEWP+NPP  RDV+  Y  EVRQ+GF++   IS SLGL+    K VLGEQ QHM
Sbjct  180   PLEQFVPEWPTNPPPFRDVMSTYCKEVRQLGFRLYAMISASLGLEQDYIKKVLGEQEQHM  239

Query  1297  AVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVINI  1118
             AVNFYP CP PELTYGLPAHTDPNALTIL+ D QVAGLQVLK+G+W+AV P P+A VIN+
Sbjct  240   AVNFYPKCPSPELTYGLPAHTDPNALTILMMDEQVAGLQVLKEGRWIAVNPWPNALVINL  299

Query  1117  GDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYRDF  938
             GDQLQALSNG+YKSVWHRA+VN+D+PRMS+ASFLCP     +   + L+ ++SPAVYR++
Sbjct  300   GDQLQALSNGRYKSVWHRAVVNSDRPRMSIASFLCPCNSVKLGPAEKLIGEKSPAVYRNY  359

Query  937   TYPEYYSKFWSRNLNQEHCLEHFKN  863
             TY EYY KFWSRNL+QEHCLE F+ 
Sbjct  360   TYDEYYKKFWSRNLDQEHCLELFRT  384



>gb|EEE61552.1| hypothetical protein OsJ_15896 [Oryza sativa Japonica Group]
Length=340

 Score =   444 bits (1143),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 209/337 (62%), Positives = 259/337 (77%), Gaps = 1/337 (0%)
 Frame = -3

Query  1870  TTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACRH  1691
             TTQLL +     TLP+ Y RPES+RP+L+EV T  ++P+IDL   D+  ++ +I  ACR 
Sbjct  3     TTQLLSTVEHRETLPEGYARPESDRPRLAEVATDSNIPLIDLASPDKPRVIAEIAQACRT  62

Query  1690  YGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVH  1511
             YGFFQV NHG+ ++++E ++ VA EFF L  EEK KLYSD+PSK +RLSTSFNV+KETVH
Sbjct  63    YGFFQVTNHGIAEELLEKVMAVALEFFRLPPEEKEKLYSDEPSKKIRLSTSFNVRKETVH  122

Query  1510  NWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCF  1331
             NWRDYLRLHC+PL+++ PEWPSNP   ++++  Y  EVRQ+G ++  AIS SLGL+    
Sbjct  123   NWRDYLRLHCHPLEEFVPEWPSNPAQFKEIMSTYCREVRQLGLRLLGAISVSLGLEEDYI  182

Query  1330  KNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDG-KWLA  1154
             + VLGEQ QHMAVN+YP CPEP+LTYGLP HTDPNALTILL D  VAGLQVL+DG +W+ 
Sbjct  183   EKVLGEQEQHMAVNYYPRCPEPDLTYGLPKHTDPNALTILLPDPHVAGLQVLRDGDQWIV  242

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V PRP+A V+N+GDQ+QALSN  YKSVWHRA+VN  + RMSVASF+CP   AVIS  + L
Sbjct  243   VNPRPNALVVNLGDQIQALSNDAYKSVWHRAVVNAVQERMSVASFMCPCNSAVISPARKL  302

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             + D    VYR FTY EYY KFWSRNL+QEHCLE FK 
Sbjct  303   VADGDAPVYRSFTYDEYYKKFWSRNLDQEHCLELFKG  339



>ref|NP_001053651.1| Os04g0581000 [Oryza sativa Japonica Group]
 emb|CAD41169.2| OSJNBa0064M23.14 [Oryza sativa Japonica Group]
 dbj|BAF15565.1| Os04g0581000 [Oryza sativa Japonica Group]
Length=340

 Score =   443 bits (1140),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 209/337 (62%), Positives = 259/337 (77%), Gaps = 1/337 (0%)
 Frame = -3

Query  1870  TTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACRH  1691
             TTQLL +     TLP+ Y RPES+RP+L+EV T  ++P+IDL   D+  ++ +I  ACR 
Sbjct  3     TTQLLSTVEHRETLPEGYARPESDRPRLAEVATDSNIPLIDLASPDKPRVIAEIAQACRT  62

Query  1690  YGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVH  1511
             YGFFQV NHG+ ++++E ++ VA EFF L  EEK KLYSD+PSK +RLSTSFNV+KETVH
Sbjct  63    YGFFQVTNHGIAEELLEKVMAVALEFFRLPPEEKEKLYSDEPSKKIRLSTSFNVRKETVH  122

Query  1510  NWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCF  1331
             NWRDYLRLHC+PL+++ PEWPSNP   ++++  Y  EVRQ+G ++  AIS SLGL+    
Sbjct  123   NWRDYLRLHCHPLEEFVPEWPSNPAQFKEIMSTYCREVRQLGLRLLGAISVSLGLEEDYI  182

Query  1330  KNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDG-KWLA  1154
             + VLGEQ QHMAVN+YP CPEP+LTYGLP HTDPNALTILL D  VAGLQVL+DG +W+ 
Sbjct  183   EKVLGEQEQHMAVNYYPRCPEPDLTYGLPKHTDPNALTILLPDPHVAGLQVLRDGDQWIV  242

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V PRP+A V+N+GDQ+QALSN  YKSVWHRA+VN  + RMSVASF+CP   AVIS  + L
Sbjct  243   VNPRPNALVVNLGDQIQALSNDAYKSVWHRAVVNPVQERMSVASFMCPCNSAVISPARKL  302

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             + D    VYR FTY EYY KFWSRNL+QEHCLE FK 
Sbjct  303   VADGDAPVYRSFTYDEYYKKFWSRNLDQEHCLELFKG  339



>ref|XP_006652690.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Oryza 
brachyantha]
Length=340

 Score =   441 bits (1134),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 208/337 (62%), Positives = 259/337 (77%), Gaps = 1/337 (0%)
 Frame = -3

Query  1870  TTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACRH  1691
             TTQLL +      LP+ Y RPES+RP+L+EV T  ++PVIDL   D+  +V +I  ACR 
Sbjct  3     TTQLLSTVEHREKLPEGYERPESDRPRLAEVVTDSNIPVIDLASPDKPRVVAEIARACRT  62

Query  1690  YGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVH  1511
             YGFFQV NHG+ ++++E ++ VA EFF L  EEK KLYSD+PSK +RLSTSFNV+KETVH
Sbjct  63    YGFFQVTNHGISEELLEKVMAVALEFFRLPPEEKEKLYSDEPSKKIRLSTSFNVRKETVH  122

Query  1510  NWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCF  1331
             NWRDYLRLHC+PL+++ PEWPSNP   ++++  Y  +VRQ+GF++  AIS SLGL+    
Sbjct  123   NWRDYLRLHCHPLEEFVPEWPSNPAQFKEIMSTYCRQVRQLGFRLLGAISLSLGLEEDYI  182

Query  1330  KNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKD-GKWLA  1154
             + VLGEQ QHMAVN+YP CPEP+LTYGLP HTDPNALTILL D  VAGLQVL+D G+W+A
Sbjct  183   EKVLGEQEQHMAVNYYPRCPEPDLTYGLPKHTDPNALTILLPDPNVAGLQVLRDGGQWIA  242

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V PRP+A  +N+GDQ+QALSNG YKSVWHRA+VN  + RMSVASFLCP   AVIS  + L
Sbjct  243   VDPRPNALTVNLGDQIQALSNGAYKSVWHRAVVNASQERMSVASFLCPCNSAVISPAREL  302

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             + D    VY+ +TY  YY KFWSRNL+QEHCLE F+ 
Sbjct  303   VADGDEPVYQSYTYDAYYKKFWSRNLDQEHCLELFRG  339



>ref|XP_009392937.1| PREDICTED: flavanone 3-dioxygenase-like [Musa acuminata subsp. 
malaccensis]
Length=337

 Score =   435 bits (1119),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 205/337 (61%), Positives = 260/337 (77%), Gaps = 2/337 (1%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M +QLL +   + +LP+ Y+RPES+RP+L +V    ++P+IDLG  D+  IV Q+ DACR
Sbjct  1     MASQLLSAVGNHISLPESYVRPESQRPRLHDVINDTNIPIIDLGSPDKQQIVAQVADACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQV+NHGV    ++ M+ VA EFF+L  EEK K YSDD +K MRLSTSFN++KE+V
Sbjct  61    SFGFFQVVNHGVTVDSMQKMMGVASEFFHLPPEEKEKYYSDDTTKKMRLSTSFNIRKESV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
              NWRDYLRLHCYPL++  P WPSNP + ++VV  Y  EVRQ+GF++  AIS SL L+   
Sbjct  121   RNWRDYLRLHCYPLEELVPGWPSNPASFKEVVSAYCREVRQLGFRLLGAISLSLELEEDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              + +LGEQ QHMAVN+YP CP+PELTYGLPAHTDPN LTILLQD  VAGLQVLKDG+W+A
Sbjct  181   LEKMLGEQEQHMAVNYYPKCPDPELTYGLPAHTDPNVLTILLQDPNVAGLQVLKDGRWMA  240

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V+P P+A V+N+ DQLQALSNG+Y+SV HRA+VN+DK R+SVASFLCPG   VIS P+ L
Sbjct  241   VRPLPNALVVNVADQLQALSNGRYRSVRHRAVVNSDKERISVASFLCPGNSVVISPPEKL  300

Query  973   L-DDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             +  D   A+YR +TY +YY KFWSR L+ EHCL+ FK
Sbjct  301   VGGDGCRAMYRSYTYEQYYDKFWSRALD-EHCLDFFK  336



>gb|EMS57783.1| Naringenin,2-oxoglutarate 3-dioxygenase [Triticum urartu]
Length=340

 Score =   428 bits (1101),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 202/336 (60%), Positives = 257/336 (76%), Gaps = 1/336 (0%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  QLL +     TLP+ Y RPE++RP+L++V T  ++P+IDL   D+  ++ +I  ACR
Sbjct  1     MANQLLSTVAHRDTLPEGYTRPENDRPQLADVVTDSNIPLIDLASPDKHRVIAEIDQACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQ+INHG+ ++++E ++ V  EFF L  EEK KLYSD+PSK +RLSTSFNV+KETV
Sbjct  61    TYGFFQIINHGISEELLEKVMAVGLEFFRLPPEEKAKLYSDEPSKKIRLSTSFNVRKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHC+PL+++ P+WPSNP T ++++  Y  EVR +G ++  AIS  LGL+   
Sbjct  121   HNWRDYLRLHCHPLEEFVPDWPSNPETFKEIISTYCREVRLLGLRLLGAISLGLGLEEDY  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDG-KWL  1157
              +NVLGEQ QHMAVN+YP CPEP+LTYGLP HTDPNALTILL D  V+GLQVLKDG +W+
Sbjct  181   IENVLGEQEQHMAVNYYPRCPEPDLTYGLPKHTDPNALTILLMDPHVSGLQVLKDGAQWI  240

Query  1156  AVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKP  977
             AV PRP+A V+N+GDQLQA+SNG YKSVWHRA+VN  + R+SVASFLCP   AVI     
Sbjct  241   AVDPRPNALVVNLGDQLQAVSNGAYKSVWHRAVVNAARERLSVASFLCPCNSAVIGPADK  300

Query  976   LLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHF  869
             L+ D    VYR +TY EYY KFWSRNL+Q+HCLE F
Sbjct  301   LIGDGDEPVYRSYTYDEYYKKFWSRNLDQDHCLELF  336



>gb|AGV54879.1| flavanone 3-dioxygenase-like protein [Phaseolus vulgaris]
Length=355

 Score =   427 bits (1099),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 207/337 (61%), Positives = 250/337 (74%), Gaps = 4/337 (1%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACR  1694
             M  ++L SG  YS LP+ YIRPESERP+LSEV  C+DVP++DLGC +R+ IV QIG+ACR
Sbjct  1     MDRKVLSSGIRYSNLPESYIRPESERPRLSEVLECEDVPIVDLGCENRAQIVHQIGEACR  60

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              YGFFQV+NHGV  + + +M +VAH FF L +EEK+KLYS+DPSKT RLSTSFNV KETV
Sbjct  61    LYGFFQVMNHGVDVEAVREMTEVAHGFFKLPLEEKLKLYSEDPSKTTRLSTSFNVNKETV  120

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
             HNWRDYLRLHCYPL KY PEWPSNPP+ ++ VK Y  EVR++G +IEE + +  G+  + 
Sbjct  121   HNWRDYLRLHCYPLDKYVPEWPSNPPSFKERVKKYCEEVRELGLRIEEYLGKEFGVGERL  180

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              K  +G              P+P         TDPNALTILLQDL+V GLQV K+G WLA
Sbjct  181   XKECVGGNKATHGSELLSTRPQPRTHLC----TDPNALTILLQDLKVFGLQVFKNGNWLA  236

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             VKP+P+AFVINIGDQLQALSNG YKSVWHRA+VN DKPR+S ASFLCP + A+IS  KPL
Sbjct  237   VKPQPNAFVINIGDQLQALSNGLYKSVWHRAVVNVDKPRLSGASFLCPNDQALISPAKPL  296

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
              +D S    R ++Y EYY KFW R+L+ E CLE FKN
Sbjct  297   TEDGSGTKDRGYSYGEYYKKFWGRDLDPEPCLEIFKN  333



>gb|EYU45321.1| hypothetical protein MIMGU_mgv1a018206mg [Erythranthe guttata]
Length=294

 Score =   422 bits (1086),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 196/302 (65%), Positives = 239/302 (79%), Gaps = 19/302 (6%)
 Frame = -3

Query  1759  PVIDLGCGDRSFIVRQIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKL  1580
             P+IDLGCGDR +IVRQI  AC  YGFFQVINHGV K+ +E ML+V+ EFF+L VEEKMKL
Sbjct  9     PMIDLGCGDRDYIVRQIAHACHQYGFFQVINHGVSKETMEKMLQVSKEFFDLPVEEKMKL  68

Query  1579  YSDDPSKTMRLSTSFNVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTE  1400
             YS+DP+KT+RLSTS N++KE +HNWRDYLRLHC+PL K+  EWP+NP + +++V  Y  E
Sbjct  69    YSNDPTKTIRLSTSSNLQKEKIHNWRDYLRLHCHPLDKFTNEWPTNPTSFKEIVSNYCME  128

Query  1399  VRQVGFKIEEAISESLGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNAL  1220
             +R++G K+EEAISE                 QHMA+N+YP CPEPELTYGLPAHTDPN L
Sbjct  129   IRELGLKLEEAISER----------------QHMAINYYPQCPEPELTYGLPAHTDPNTL  172

Query  1219  TILLQDLQVAGLQVLKDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKP  1040
             TILLQD QV GLQ+LKDGKWL+VKP P+A V+N+GDQLQALSN KYKS WHRA+VN  K 
Sbjct  173   TILLQDTQVTGLQLLKDGKWLSVKPFPNALVVNVGDQLQALSNSKYKSSWHRAVVNAHKA  232

Query  1039  RMSVASFLCPGEDAVISAPK---PLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHF  869
             R+S+A+FLCP  DAVI AP+      +++S A+YRD+TY EYY+KFWSRNL+Q HCLE F
Sbjct  233   RISIATFLCPSNDAVIKAPRELIEEEEEDSEAIYRDYTYAEYYTKFWSRNLDQGHCLELF  292

Query  868   KN  863
             KN
Sbjct  293   KN  294



>gb|ABF93708.1| oxidoreductase, 2OG-Fe oxygenase family protein, expressed [Oryza 
sativa Japonica Group]
Length=286

 Score =   422 bits (1085),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 194/275 (71%), Positives = 229/275 (83%), Gaps = 0/275 (0%)
 Frame = -3

Query  1687  GFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHN  1508
             G  QV+NHGVP ++   +L VAH+FF L  EEK KLYSDDP+K +RLSTSFNV+KETVHN
Sbjct  6     GVDQVLNHGVPVELTLSVLAVAHDFFRLPAEEKAKLYSDDPAKKIRLSTSFNVRKETVHN  65

Query  1507  WRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFK  1328
             WRDYLRLHCYPL +Y P+WPSNPP+ R+++  Y  EVR++GF++  AISESLGL+    K
Sbjct  66    WRDYLRLHCYPLHRYLPDWPSNPPSFREIISTYCKEVRELGFRLYGAISESLGLEQDYIK  125

Query  1327  NVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVK  1148
              VLGEQ QHMAVNFYP CPEPELT+GLPAHTDPNALTILL D QVAGLQVLK+G+W+AV 
Sbjct  126   KVLGEQEQHMAVNFYPKCPEPELTFGLPAHTDPNALTILLMDQQVAGLQVLKEGRWIAVN  185

Query  1147  PRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLD  968
             P+P+A VINIGDQLQALSNG+YKSVWHRA+VN+DK RMSVASFLCP  D +I   + L+ 
Sbjct  186   PQPNALVINIGDQLQALSNGRYKSVWHRAVVNSDKARMSVASFLCPCNDVLIGPAQKLIT  245

Query  967   DESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             D SPAVYR++TY EYY KFWSRNL+QEHCLE F+ 
Sbjct  246   DGSPAVYRNYTYDEYYKKFWSRNLDQEHCLELFRT  280



>gb|EEE51319.1| hypothetical protein OsJ_32283 [Oryza sativa Japonica Group]
Length=308

 Score =   422 bits (1086),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 200/332 (60%), Positives = 242/332 (73%), Gaps = 34/332 (10%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACRHYGFF  1679
             L S   + T+P KY+RPES+RP+L  V                                 
Sbjct  11    LLSTAVHDTMPGKYVRPESQRPRLDLV---------------------------------  37

Query  1678  QVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRD  1499
              V+NHG+   +I  +++V  EFF L  EEK KLYSDDP+K +RLSTSFNV+KETVHNWRD
Sbjct  38    -VVNHGIDAALIASVMEVGREFFRLPAEEKAKLYSDDPAKKIRLSTSFNVRKETVHNWRD  96

Query  1498  YLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVL  1319
             YLRLHCYPL ++ P+WPSNPP+ ++++  Y TEVR++GF++ EAISESLGL+    +  L
Sbjct  97    YLRLHCYPLHQFVPDWPSNPPSFKEIIGTYCTEVRELGFRLYEAISESLGLEGGYMRETL  156

Query  1318  GEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRP  1139
             GEQ QHMAVN+YP CPEPELTYGLPAHTDPNALTILL D QVAGLQVL DGKW+AV P+P
Sbjct  157   GEQEQHMAVNYYPQCPEPELTYGLPAHTDPNALTILLMDDQVAGLQVLNDGKWIAVNPQP  216

Query  1138  DAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDES  959
              A VINIGDQLQALSNGKY+SVWHRA+VN+D+ RMSVASFLCP     +   K L+ D+S
Sbjct  217   GALVINIGDQLQALSNGKYRSVWHRAVVNSDRERMSVASFLCPCNSVELGPAKKLITDDS  276

Query  958   PAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             PAVYR++TY EYY KFWSRNL+QEHCLE F+ 
Sbjct  277   PAVYRNYTYDEYYKKFWSRNLDQEHCLELFRT  308



>ref|XP_010241046.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like isoform 
X2 [Nelumbo nucifera]
Length=260

 Score =   406 bits (1044),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 192/259 (74%), Positives = 218/259 (84%), Gaps = 2/259 (1%)
 Frame = -3

Query  1636  MLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLHCYPLQKYAP  1457
             M ++A  FF L VEEKMK YSDDPSKT+RLSTSFNVKKETVHNWRDYLRLHCYPL +Y  
Sbjct  1     MFEMARGFFQLPVEEKMKYYSDDPSKTLRLSTSFNVKKETVHNWRDYLRLHCYPLDQYVR  60

Query  1456  EWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQHMAVNFYPP  1277
             EWPS+P + +++V  Y  EVRQ+G ++ E +SESLGL+    + VLGEQGQHMAVN+YPP
Sbjct  61    EWPSSPSSFKEIVSSYCKEVRQLGLRLLEYVSESLGLEGDYMEKVLGEQGQHMAVNYYPP  120

Query  1276  CPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVINIGDQLQAL  1097
             CPEPELTYGLPAHTDPNA+TILLQD QV GLQVLKDGKWLAV P P+AFVINIGDQLQAL
Sbjct  121   CPEPELTYGLPAHTDPNAITILLQDQQVTGLQVLKDGKWLAVNPHPNAFVINIGDQLQAL  180

Query  1096  SNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPA--VYRDFTYPEY  923
             SNG+YKSVWHRA+VN DKPR+SVASFLCP  DAVI+  K L DD +PA  +YR FTY EY
Sbjct  181   SNGRYKSVWHRAVVNCDKPRISVASFLCPANDAVIAPAKGLTDDGTPAPPLYRSFTYDEY  240

Query  922   YSKFWSRNLNQEHCLEHFK  866
             Y KFWSRNL+Q+HCLE FK
Sbjct  241   YKKFWSRNLDQQHCLELFK  259



>gb|ABB20895.1| flavanone 3-hydroxylase [Triticum aestivum]
Length=318

 Score =   404 bits (1037),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 190/314 (61%), Positives = 243/314 (77%), Gaps = 1/314 (0%)
 Frame = -3

Query  1807  ESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACRHYGFFQVINHGVPKKVIEDMLK  1628
             E++R +L++V T  ++P+IDL   D+  ++ +I  ACR YGFFQ+INHG+ ++++E ++ 
Sbjct  1     ENDRRQLADVVTDSNIPLIDLASPDKHRVIAEIDQACRTYGFFQIINHGISEELLEKVMA  60

Query  1627  VAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLHCYPLQKYAPEWP  1448
             V  EFF L  EEK KLYSD+PSK +RLSTSFNV+KETVHNWRDYLRLHC+PL+++ P+WP
Sbjct  61    VGLEFFRLPPEEKAKLYSDEPSKKIRLSTSFNVRKETVHNWRDYLRLHCHPLEEFVPDWP  120

Query  1447  SNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQHMAVNFYPPCPE  1268
             SNP T ++++  Y  EVR +G ++  AIS  LGL+    +NVLGEQ QHMAVN+YP CPE
Sbjct  121   SNPETFKEIISTYCREVRLLGLRLLGAISLGLGLEEDYIENVLGEQEQHMAVNYYPRCPE  180

Query  1267  PELTYGLPAHTDPNALTILLQDLQVAGLQVLKDG-KWLAVKPRPDAFVINIGDQLQALSN  1091
             P+LTYGLP HTDPNALTILL D  V+GLQVLKDG +W+AV PRP+A V+N+GDQLQA+SN
Sbjct  181   PDLTYGLPKHTDPNALTILLMDPHVSGLQVLKDGTQWIAVDPRPNALVVNLGDQLQAVSN  240

Query  1090  GKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYRDFTYPEYYSKF  911
             G YKSVWHRA+VN  + R+SVASFLCP   AVI     L+ D    VYR +TY EYY KF
Sbjct  241   GAYKSVWHRAVVNAARERLSVASFLCPCNSAVIGPADKLVGDGDEPVYRSYTYDEYYKKF  300

Query  910   WSRNLNQEHCLEHF  869
             W RNL+Q+HCLE F
Sbjct  301   WXRNLDQDHCLELF  314



>ref|XP_006421688.1| hypothetical protein CICLE_v10005149mg [Citrus clementina]
 gb|ESR34928.1| hypothetical protein CICLE_v10005149mg [Citrus clementina]
Length=386

 Score =   406 bits (1043),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 194/343 (57%), Positives = 250/343 (73%), Gaps = 8/343 (2%)
 Frame = -3

Query  1876  SMTTQLLFS--GTPYSTLPQKYIRPESERPKLSEVTTCD-DVPVIDLGCGD---RSFIVR  1715
             + TT+LL S   +   ++P  YIRP S+RP L+EV   D  +P++DL   +   R   ++
Sbjct  42    AATTKLLLSDLASTVKSVPSNYIRPISDRPNLTEVQISDGSIPLVDLQVLNGPSRLDTIK  101

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             QIG AC+H GFFQV NHG+P+ +I +ML +A  FF L   E++K YSDDPSK+ RLSTSF
Sbjct  102   QIGQACQHDGFFQVRNHGIPETIINNMLTIARAFFKLPESERLKSYSDDPSKSTRLSTSF  161

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             NV  E + NWRDYLRLHCYPLQ Y  EWPSNPP++R+VV  Y T VR +  ++ EAISES
Sbjct  162   NVNTEKISNWRDYLRLHCYPLQDYMHEWPSNPPSVREVVAEYCTSVRGLVLRLLEAISES  221

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL        LG+ GQHMA+N+YPPCP+P+LTYGLP HTDPN +T+LLQD  V GLQVL
Sbjct  222   LGLQRDFIDKALGKHGQHMALNYYPPCPQPDLTYGLPGHTDPNLITVLLQD-DVPGLQVL  280

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             ++GKWL V P P+ F++NIGDQ+Q LSN +YKSV HRA+VN D+ R+S+ +F CP  DAV
Sbjct  281   RNGKWLPVSPIPNTFIVNIGDQMQVLSNDRYKSVLHRALVNCDRERISIPTFYCPSPDAV  340

Query  994   ISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             I+  K L+D+  PAVY++FTY EYY KFW+R L+ E CL+ FK
Sbjct  341   IAPAKDLIDERHPAVYKNFTYAEYYQKFWNRGLD-ERCLDLFK  382



>ref|XP_006490103.1| PREDICTED: hyoscyamine 6-dioxygenase-like [Citrus sinensis]
Length=347

 Score =   403 bits (1036),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 194/343 (57%), Positives = 248/343 (72%), Gaps = 8/343 (2%)
 Frame = -3

Query  1876  SMTTQLLFS--GTPYSTLPQKYIRPESERPKLSEVTTCD-DVPVIDLGCGD---RSFIVR  1715
             + TT+LL S   +   ++P  YIRP S+RP L+EV   D  +P++DL   +   R   ++
Sbjct  3     AATTKLLLSDLASTVKSVPSSYIRPISDRPNLTEVQISDGSIPLVDLQVLNGPSRLDTIK  62

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             QIG AC+H GFFQV NHG+P+ +I +ML +A  FF     E++K YSDDPSK+ RLSTSF
Sbjct  63    QIGQACQHDGFFQVRNHGIPETIINNMLTIARAFFKSPESERLKSYSDDPSKSTRLSTSF  122

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             NV  E + NWRDYLRLHCYPLQ Y  EWPSNPP+ R+VV  Y T VR +  ++ EAISES
Sbjct  123   NVNTEKISNWRDYLRLHCYPLQDYMHEWPSNPPSFREVVAEYCTSVRGLVLRLLEAISES  182

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL        LG+ GQHMA+N+YPPCP+P+LTYGLP HTDPN +T+LLQD  V GLQVL
Sbjct  183   LGLQRDFIDKALGKHGQHMALNYYPPCPQPDLTYGLPGHTDPNLITVLLQD-DVPGLQVL  241

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             ++GKWL V P P+ F++NIGDQ+Q LSN +YKSV HRA+VN DK R+S+ +F CP  DAV
Sbjct  242   RNGKWLPVSPIPNTFIVNIGDQMQVLSNDRYKSVLHRALVNCDKERISIPTFYCPSPDAV  301

Query  994   ISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             I+  K L+D+  PAVY++FTY EYY KFW+R L+ E CL+ FK
Sbjct  302   IAPAKDLIDERHPAVYKNFTYAEYYQKFWNRGLD-ERCLDLFK  343



>gb|KDO65452.1| hypothetical protein CISIN_1g019027mg [Citrus sinensis]
Length=347

 Score =   403 bits (1035),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 194/343 (57%), Positives = 248/343 (72%), Gaps = 8/343 (2%)
 Frame = -3

Query  1876  SMTTQLLFS--GTPYSTLPQKYIRPESERPKLSEVTTCD-DVPVIDLGCGD---RSFIVR  1715
             + TT+LL S   +   ++P  YIRP S+RP L+EV   D  +P++DL   +   R   ++
Sbjct  3     AATTKLLLSDLASTVKSVPSNYIRPISDRPNLTEVQISDGSIPLVDLQVLNGPSRLDTIK  62

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             QIG AC+H GFFQV NHG+P+ +I +ML +A  FF     E++K YSDDPSK+ RLSTSF
Sbjct  63    QIGQACQHDGFFQVRNHGIPETIINNMLTIARAFFKSPESERLKSYSDDPSKSTRLSTSF  122

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             NV  E + NWRDYLRLHCYPLQ Y  EWPSNPP+ R+VV  Y T VR +  ++ EAISES
Sbjct  123   NVNTEKISNWRDYLRLHCYPLQDYMHEWPSNPPSFREVVAEYCTSVRGLVLRLLEAISES  182

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL        LG+ GQHMA+N+YPPCP+P+LTYGLP HTDPN +T+LLQD  V GLQVL
Sbjct  183   LGLQRDFIDKALGKHGQHMALNYYPPCPQPDLTYGLPGHTDPNLITVLLQD-DVPGLQVL  241

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             ++GKWL V P P+ F++NIGDQ+Q LSN +YKSV HRA+VN DK R+S+ +F CP  DAV
Sbjct  242   RNGKWLPVSPIPNTFIVNIGDQMQVLSNDRYKSVLHRALVNCDKERISIPTFYCPSPDAV  301

Query  994   ISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             I+  K L+D+  PAVY++FTY EYY KFW+R L+ E CL+ FK
Sbjct  302   IAPAKDLIDERHPAVYKNFTYAEYYQKFWNRGLD-ERCLDLFK  343



>ref|XP_002317046.2| hypothetical protein POPTR_0011s15310g [Populus trichocarpa]
 gb|EEE97658.2| hypothetical protein POPTR_0011s15310g [Populus trichocarpa]
Length=350

 Score =   402 bits (1032),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 197/342 (58%), Positives = 248/342 (73%), Gaps = 8/342 (2%)
 Frame = -3

Query  1870  TTQLLFSGTPYS---TLPQKYIRPESERPKLSEVTTCD-DVPVIDLGCGD---RSFIVRQ  1712
             T +LL +    S    +P  +IRP S+RP LS+V   D  +P+IDL   D    S I+ Q
Sbjct  4     TAKLLLADLASSGVKQIPSNFIRPISDRPNLSDVQISDGSIPLIDLHGLDGPNHSTIIEQ  63

Query  1711  IGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFN  1532
             IG AC+  GFFQV NHG+P+++I  +L +A +FF L   E++K YSDDP+KT RLSTSFN
Sbjct  64    IGQACQRDGFFQVKNHGIPEEMISIILNIARQFFKLPESERLKNYSDDPTKTTRLSTSFN  123

Query  1531  VKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESL  1352
             +K E V +WRD+LRLHCYPL+ Y  EWPSNPP+ R  V  Y T VR +  ++ EAISESL
Sbjct  124   IKTEQVSSWRDFLRLHCYPLEDYVHEWPSNPPSFRKDVAEYCTSVRGLVLRLLEAISESL  183

Query  1351  GLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLK  1172
             GL+       LG  GQHMA+N+YPPCP+PELTYGLP HTDPN +TILLQD  V GLQVL+
Sbjct  184   GLERDYIDKKLGGHGQHMAMNYYPPCPQPELTYGLPGHTDPNLITILLQD-HVPGLQVLR  242

Query  1171  DGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVI  992
             +GKW+AV P P+ F++NIGDQ+Q LSN +YKSV HRA+VN+DK R+S+ +F CP  DAVI
Sbjct  243   NGKWIAVNPIPNTFIVNIGDQMQVLSNDRYKSVLHRAVVNSDKDRISIPTFYCPSPDAVI  302

Query  991   SAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
               PK L+DDE PAVYRDFTY EYY KFW++ L +E CL+ FK
Sbjct  303   GPPKELVDDEHPAVYRDFTYGEYYEKFWNKGLVKECCLDLFK  344



>gb|AGX27514.1| PRXQ2 [Populus tomentosa]
Length=350

 Score =   401 bits (1030),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 197/342 (58%), Positives = 248/342 (73%), Gaps = 8/342 (2%)
 Frame = -3

Query  1870  TTQLLFSGTPYS---TLPQKYIRPESERPKLSEVTTCD-DVPVIDLGCGD---RSFIVRQ  1712
             T +LL +    S    +P  YIRP S+RP LS+V   D  +P+IDL   D    S I++Q
Sbjct  4     TAKLLLADLASSGVKQIPSNYIRPISDRPNLSDVQISDGSIPLIDLQGLDGPNHSTIIQQ  63

Query  1711  IGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFN  1532
             IG AC+  GFFQV NHG+ +++I  +L +A +FF L   E++K YSDDP+KT RLSTSFN
Sbjct  64    IGQACQRDGFFQVKNHGIAEEMISIILDIARQFFKLPESERLKNYSDDPTKTTRLSTSFN  123

Query  1531  VKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESL  1352
             +K E V +WRD+LRLHCYPL+ Y  EWPSNPP+ R  V  Y T VR +  ++ EAISESL
Sbjct  124   IKTEQVSSWRDFLRLHCYPLEDYVHEWPSNPPSFRKDVAEYCTSVRGLVLRLLEAISESL  183

Query  1351  GLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLK  1172
             GL+       LG  GQHMA+N+YPPCP+PELTYGLP HTDPN +TILLQD  V GLQVL+
Sbjct  184   GLERDYIDKKLGGHGQHMAMNYYPPCPQPELTYGLPGHTDPNLITILLQD-HVPGLQVLR  242

Query  1171  DGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVI  992
             +GKW+AV P P+ F++NIGDQ+Q LSN +YKSV HRA+VN+DK R+S+ +F CP  DAVI
Sbjct  243   NGKWIAVNPIPNTFIVNIGDQMQVLSNDRYKSVLHRAVVNSDKDRISIPTFYCPSPDAVI  302

Query  991   SAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
               PK L+DDE PAVYRDFTY EYY KFW++ L +E CL+ FK
Sbjct  303   GPPKELVDDEHPAVYRDFTYGEYYEKFWNKGLVKECCLDLFK  344



>ref|XP_010941174.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Elaeis 
guineensis]
Length=346

 Score =   400 bits (1029),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/329 (58%), Positives = 240/329 (73%), Gaps = 7/329 (2%)
 Frame = -3

Query  1837  STLPQKYIRPESERPKLSEVTTCD-DVPVIDL----GCGDRSFIVRQIGDACRHYGFFQV  1673
             S++P  +IRP S+RP L +V T D  +P+IDL    G G RS ++++IG AC   GFFQV
Sbjct  18    SSIPSNFIRPISDRPNLHDVKTSDASIPLIDLQGLAGPG-RSKLIKEIGAACLKDGFFQV  76

Query  1672  INHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYL  1493
              NHG+P+ VI++ML V+ EFF+L   E++K YSDDP KT RLSTSFN+K E V +WRDYL
Sbjct  77    KNHGIPESVIDNMLCVSKEFFHLPEHERLKNYSDDPMKTSRLSTSFNIKTEKVGSWRDYL  136

Query  1492  RLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGE  1313
             RLHCYPL+ +  EWP NP   R VV  Y   VR++  +I EAISESLGL+      VLG 
Sbjct  137   RLHCYPLEDFVHEWPGNPSAFRQVVSEYCKHVRELALRILEAISESLGLESDSMNKVLGS  196

Query  1312  QGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDA  1133
               QHMA+N+YPPCP+PELTYGLP H DPN +T+LLQD  V+GLQVL+DGKW+A+ P P  
Sbjct  197   HAQHMAINYYPPCPQPELTYGLPGHKDPNVITLLLQD-GVSGLQVLRDGKWVAINPEPYN  255

Query  1132  FVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPA  953
              VIN+GDQ+Q LSNGKYKSV HRA+VN++  R+SV +F CP  DAVI  P+ L+D+E P+
Sbjct  256   LVINLGDQMQVLSNGKYKSVLHRAVVNSNSERISVPTFYCPSPDAVIKPPESLVDEEHPS  315

Query  952   VYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             +YR FTY EYY KFW   LN E CL+ FK
Sbjct  316   IYRSFTYAEYYEKFWDHGLNSESCLDMFK  344



>ref|XP_010040087.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Eucalyptus 
grandis]
 gb|KCW45491.1| hypothetical protein EUGRSUZ_L00789 [Eucalyptus grandis]
Length=349

 Score =   400 bits (1029),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 189/343 (55%), Positives = 251/343 (73%), Gaps = 7/343 (2%)
 Frame = -3

Query  1876  SMTTQLLFSGTP-YSTLPQKYIRPESERPKLSEVTTCD--DVPVIDLGC---GDRSFIVR  1715
             + T  LL    P  + +P  YIRP+++RP L+EV   D   +P+IDL      +R  I+R
Sbjct  4     AATKLLLIDRVPGINRVPNSYIRPQADRPNLTEVEASDASTIPLIDLQGLFGPNRDDIIR  63

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             QIG AC+  GFFQ+ NHG+P++V++ ++ +A EFF L   E++K YSDDPSK+ RLSTSF
Sbjct  64    QIGKACQRDGFFQIKNHGIPEEVVQAIMNIAGEFFRLPESERLKNYSDDPSKSTRLSTSF  123

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             N+K E V NWRD+LRLHCYPL++Y  EWP+NPP+ R  V  Y T VR++  K+ EAISES
Sbjct  124   NIKTEKVSNWRDFLRLHCYPLEEYMHEWPTNPPSFRKEVGEYCTRVRELALKLLEAISES  183

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL+ +     LG+ GQHMA+N+YPPCP+PELTYGLP HTD N +TILLQD +V GLQVL
Sbjct  184   LGLEREYISKNLGKHGQHMAMNYYPPCPQPELTYGLPGHTDQNLITILLQD-EVPGLQVL  242

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             +DGKW+AV P P+ F++NIGDQ+Q +SN KYKS+ HRA+VN D+ R+S+ +F CP  +A+
Sbjct  243   RDGKWIAVNPIPNTFIVNIGDQMQVISNDKYKSILHRAVVNCDRERISIPTFYCPSPEAL  302

Query  994   ISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             I   + L+D ++PAVYR FTY EYY KFW+R L  E CL+ FK
Sbjct  303   IGPAQGLIDHDNPAVYRSFTYEEYYHKFWNRGLRTECCLDMFK  345



>gb|ABG66223.1| oxidoreductase, 2OG-Fe oxygenase family protein, expressed [Oryza 
sativa Japonica Group]
Length=257

 Score =   397 bits (1019),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/256 (71%), Positives = 214/256 (84%), Gaps = 0/256 (0%)
 Frame = -3

Query  1633  LKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLHCYPLQKYAPE  1454
             ++V  EFF L  EEK KLYSDDP+K +RLSTSFNV+KETVHNWRDYLRLHCYPL ++ P+
Sbjct  1     MEVGREFFRLPAEEKAKLYSDDPAKKIRLSTSFNVRKETVHNWRDYLRLHCYPLHQFVPD  60

Query  1453  WPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQHMAVNFYPPC  1274
             WPSNPP+ ++++  Y TEVR++GF++ EAISESLGL+    +  LGEQ QHMAVN+YP C
Sbjct  61    WPSNPPSFKEIIGTYCTEVRELGFRLYEAISESLGLEGGYMRETLGEQEQHMAVNYYPQC  120

Query  1273  PEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVINIGDQLQALS  1094
             PEPELTYGLPAHTDPNALTILL D QVAGLQVL DGKW+AV P+P A VINIGDQLQALS
Sbjct  121   PEPELTYGLPAHTDPNALTILLMDDQVAGLQVLNDGKWIAVNPQPGALVINIGDQLQALS  180

Query  1093  NGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYRDFTYPEYYSK  914
             NGKY+SVWHRA+VN+D+ RMSVASFLCP     +   K L+ D+SPAVYR++TY EYY K
Sbjct  181   NGKYRSVWHRAVVNSDRERMSVASFLCPCNSVELGPAKKLITDDSPAVYRNYTYDEYYKK  240

Query  913   FWSRNLNQEHCLEHFK  866
             FWSRNL+QEHCLE F+
Sbjct  241   FWSRNLDQEHCLELFR  256



>ref|XP_010251334.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Nelumbo 
nucifera]
Length=359

 Score =   400 bits (1027),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/341 (56%), Positives = 246/341 (72%), Gaps = 6/341 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCD-DVPVIDL-GCGD---RSFIVRQIGDACRHYGFFQVIN  1667
             +P  Y+RP S+RP L  V   +  +PVIDL G  D   R  IV++IG AC H GFFQ+ N
Sbjct  19    VPSNYVRPISDRPNLHVVQPAEGSIPVIDLQGLDDDNNRCDIVKEIGKACEHAGFFQIKN  78

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HG+P+ VI++ML+V+ EFF L   E++K YS+DPSK++RLSTSFN+  E V NWRD+LRL
Sbjct  79    HGIPQNVIDNMLRVSREFFRLPESERLKSYSNDPSKSVRLSTSFNISSEKVSNWRDFLRL  138

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HCYPL+ Y  +WPSNPP  R+ V  Y T+VR +  ++ EAISESLGL+ +  +  LG+QG
Sbjct  139   HCYPLEDYLEQWPSNPPCFREEVANYSTKVRGLALRLLEAISESLGLERESIEKALGKQG  198

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMA+N+YP CPEPELTYGLP H+DPN +TILLQD  V GLQ+L +G+W+AV P P+ F+
Sbjct  199   QHMAINYYPTCPEPELTYGLPVHSDPNVITILLQD-DVPGLQLLNNGRWVAVNPIPNTFI  257

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             INIGDQ+Q LSNG+YKSV HRA+VN DK R+SV +F CP  +AVI     L+DD  PA+Y
Sbjct  258   INIGDQIQVLSNGRYKSVLHRAVVNCDKERISVPTFYCPSPEAVIEPIGGLIDDNHPAIY  317

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFKN*LALNATQVELVG  824
             + FTY EYY KFW R L  E+CL+ F+    L     E VG
Sbjct  318   KSFTYTEYYEKFWKRGLAIENCLDLFRTTQPLQVGNGEGVG  358



>ref|XP_010040086.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Eucalyptus 
grandis]
 gb|KCW45489.1| hypothetical protein EUGRSUZ_L00786 [Eucalyptus grandis]
Length=349

 Score =   399 bits (1026),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 190/343 (55%), Positives = 249/343 (73%), Gaps = 7/343 (2%)
 Frame = -3

Query  1876  SMTTQLLFSGTP-YSTLPQKYIRPESERPKLSEVTTCD--DVPVIDLGC---GDRSFIVR  1715
             + T  LL    P  + +P  YIRPE++RP L+EV   D   +P+IDL      +R  I+R
Sbjct  4     AATKLLLIDRVPGINRVPNSYIRPEADRPNLTEVEASDASTIPLIDLQGLFGPNRDDIIR  63

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
              IG+AC+  GFFQ+ NHG+P++V++ ++ +A EFF L   E++K YSDDPSK+ RLSTSF
Sbjct  64    LIGEACQQDGFFQIKNHGIPEEVVQAIMNIAGEFFRLPESERLKNYSDDPSKSTRLSTSF  123

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             N+K E V NWRD+LRLHCYPL++Y  EWP+NPP+ R  V  Y T VR++  K+ EAISES
Sbjct  124   NIKTEKVSNWRDFLRLHCYPLEEYMHEWPTNPPSFRKEVGEYCTRVRELALKLLEAISES  183

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL+ +     LG+ GQHMA+N+YPPCP+PELTYGLP HTD N +TILLQD  V GLQVL
Sbjct  184   LGLEREYISKNLGKHGQHMAMNYYPPCPQPELTYGLPGHTDRNLITILLQD-DVPGLQVL  242

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             +DGKW+AV P P+ F++NIGDQ+Q +SN KYKS+ HRA+VN D+ R+S+ +F CP  +A+
Sbjct  243   RDGKWIAVNPIPNTFIVNIGDQMQVISNDKYKSILHRAVVNCDRERISIPTFYCPSPEAL  302

Query  994   ISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             I   + L+D E PAVYR FTY EYY KFW+R L  E CL+ FK
Sbjct  303   IGPAQGLIDHEHPAVYRSFTYEEYYHKFWNRGLRTECCLDMFK  345



>ref|XP_002300519.1| hypothetical protein POPTR_0001s45610g [Populus trichocarpa]
 gb|EEE85324.1| hypothetical protein POPTR_0001s45610g [Populus trichocarpa]
Length=349

 Score =   397 bits (1020),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/334 (57%), Positives = 244/334 (73%), Gaps = 5/334 (1%)
 Frame = -3

Query  1855  FSGTPYSTLPQKYIRPESERPKLSEVTTCD-DVPVIDL---GCGDRSFIVRQIGDACRHY  1688
              + T    +P  YIRP S+RP LS+V   D  +P+IDL      + S I+ QI  AC + 
Sbjct  12    LASTGVKQIPTSYIRPISDRPNLSDVQISDVPIPLIDLHGLNGPNHSLIIEQISQACEND  71

Query  1687  GFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHN  1508
             GFFQV NHG+P+++I +++ +A +FF+L   E++K YSDDP+K  RLSTSFNVK E + +
Sbjct  72    GFFQVKNHGIPEEMIGNVMNIARQFFHLPASERLKNYSDDPTKNTRLSTSFNVKTEQISS  131

Query  1507  WRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFK  1328
             WRD+LRLHCYPL+ Y  EWP NPP+ R  V  Y T +R +  K+ EAISESLGL+     
Sbjct  132   WRDFLRLHCYPLEDYIHEWPCNPPSFRRDVAEYCTSIRGLVLKLLEAISESLGLERDHID  191

Query  1327  NVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVK  1148
               LG+ GQHMA+N+YPPCP+PELTYGLP HTDPN +TILLQD  V GLQVL++GKW+AV 
Sbjct  192   KNLGKHGQHMAMNYYPPCPQPELTYGLPGHTDPNLITILLQD-DVPGLQVLRNGKWIAVN  250

Query  1147  PRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLD  968
             P P+ F+INIGDQ+Q LSN +YKSV HRA+VN +K R+S+ +F CP +DAVI  PK L+D
Sbjct  251   PIPNTFIINIGDQMQVLSNDRYKSVLHRAVVNCNKERISIPTFYCPSKDAVIGPPKELID  310

Query  967   DESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             D+ PAVYRDFTY EYY +FW+R L +E CL+ FK
Sbjct  311   DDHPAVYRDFTYGEYYERFWNRGLVKECCLDLFK  344



>gb|KDP27711.1| hypothetical protein JCGZ_19834 [Jatropha curcas]
Length=344

 Score =   397 bits (1019),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 188/326 (58%), Positives = 240/326 (74%), Gaps = 5/326 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCD-DVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVINH  1664
             +P  YIRP S+RP LS+V   D  +P+IDL      +RS +++QIG+AC+  GFFQV NH
Sbjct  19    IPSNYIRPLSDRPNLSDVQISDGSIPLIDLEGINGPNRSLVIQQIGEACQCDGFFQVKNH  78

Query  1663  GVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLH  1484
             G+P+  +  ML+ A EFF L   E++K YSDDP+KT RLSTSFNVK E V NWRD+LRLH
Sbjct  79    GLPEHAVHKMLETATEFFRLPESERLKNYSDDPTKTTRLSTSFNVKTEKVSNWRDFLRLH  138

Query  1483  CYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQ  1304
             CYPLQ Y  EWPSNPP+ R+ V  Y T VR +   + EAISESLGL+       L + GQ
Sbjct  139   CYPLQDYIKEWPSNPPSFRNNVAEYCTRVRVLVLTLLEAISESLGLERDYIDKSLSKHGQ  198

Query  1303  HMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVI  1124
             HMA+N+YPPCP+P+LTYGLP HTDPN +TILLQD QV GLQVL++GKW+AV P P+ F++
Sbjct  199   HMAINYYPPCPQPQLTYGLPGHTDPNLITILLQD-QVPGLQVLRNGKWVAVNPIPNTFIV  257

Query  1123  NIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYR  944
             NIGDQ+Q +SNG+YKS+ HRA+VN +K R+S+ +F CP  DA+I   + L+D   PAVY+
Sbjct  258   NIGDQMQVISNGRYKSILHRAVVNCEKERISIPTFYCPSPDALIGPAEELVDAHHPAVYK  317

Query  943   DFTYPEYYSKFWSRNLNQEHCLEHFK  866
              FTY EYY KFW+R L +E CL+ FK
Sbjct  318   HFTYAEYYEKFWNRGLTKECCLDLFK  343



>ref|XP_011038018.1| PREDICTED: hyoscyamine 6-dioxygenase-like [Populus euphratica]
Length=345

 Score =   395 bits (1016),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 187/327 (57%), Positives = 241/327 (74%), Gaps = 5/327 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCD-DVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVINH  1664
             +P  YIRP S+RP LS+V   D  +P+IDL      + S I+ QI  AC + GFFQV NH
Sbjct  20    IPTNYIRPISDRPNLSDVQISDVSIPLIDLHGLNGPNHSLIIEQISQACENDGFFQVKNH  79

Query  1663  GVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLH  1484
             G+P+ +I +++ +A +FFNL   E++K YSDDP K  RLSTSFNVK E + +WRD+LRLH
Sbjct  80    GIPEVIIGNVMNIARQFFNLPASERLKNYSDDPYKNTRLSTSFNVKTEQISSWRDFLRLH  139

Query  1483  CYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQ  1304
             CYPL+ Y  EWP NPP+ R  V  Y T +R +  K+ E ISESLGL+       LG+ GQ
Sbjct  140   CYPLEDYMHEWPCNPPSFRRDVAEYCTSIRGLVLKLLEVISESLGLERDYIDKKLGKHGQ  199

Query  1303  HMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVI  1124
             HMA+N+YPPCP+PELTYGLP HTDPN +TILLQD  V GLQVL++GKW+AV P P+ F+I
Sbjct  200   HMAMNYYPPCPQPELTYGLPGHTDPNLITILLQD-DVPGLQVLRNGKWIAVNPIPNTFII  258

Query  1123  NIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYR  944
             NIGDQ+Q LSN +YKSV HRA+VN +K R+S+ +F CP +DAV++ PK L+DD+ PAVYR
Sbjct  259   NIGDQMQVLSNDRYKSVLHRAVVNCNKERISIPTFYCPSKDAVVAPPKELIDDDHPAVYR  318

Query  943   DFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             DFTY EYY +FW+R L +E CL+ FK+
Sbjct  319   DFTYGEYYERFWNRGLVKECCLDLFKD  345



>ref|XP_007211193.1| hypothetical protein PRUPE_ppa008100mg [Prunus persica]
 gb|EMJ12392.1| hypothetical protein PRUPE_ppa008100mg [Prunus persica]
Length=345

 Score =   395 bits (1015),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/335 (57%), Positives = 245/335 (73%), Gaps = 7/335 (2%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCD-DVPVIDLG---CGDRSFIVRQIGDACRH  1691
             L SG  +  +P  Y+RP S+RP LS+V   D  +P+IDL      + S I++QIG AC+ 
Sbjct  12    LMSGVNH--VPSNYVRPISDRPNLSDVQISDASIPLIDLKDLHGHNHSNIIKQIGLACQT  69

Query  1690  YGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVH  1511
              GFFQV NHGVP+++I+DML +A EFF L   E++K+YSDDPSKT RLSTSFNV+ E + 
Sbjct  70    DGFFQVKNHGVPEEMIKDMLSIAREFFKLPESERLKMYSDDPSKTTRLSTSFNVRTEKLS  129

Query  1510  NWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCF  1331
             NWRD+LRLHCYPL+ Y  EWP+NPP+ R+ V  Y T VR +  ++  AISESLGL+    
Sbjct  130   NWRDFLRLHCYPLEDYVQEWPNNPPSFREQVGEYCTTVRGLVLRLLGAISESLGLEKNYI  189

Query  1330  KNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAV  1151
                LG+QGQHMA+N+YPPCPEPELTYGLP HTD N +TILLQD  VAGLQVL++GKW+AV
Sbjct  190   VEALGKQGQHMALNYYPPCPEPELTYGLPGHTDCNLITILLQD-DVAGLQVLRNGKWVAV  248

Query  1150  KPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLL  971
              P P+ F++NIGD +Q +SN KYKSV HRA+VN +  R+S+ +F CP  DAVI   K L+
Sbjct  249   NPIPNTFIVNIGDMMQVISNDKYKSVLHRAVVNCNSERISIPTFYCPSPDAVIGPAKDLI  308

Query  970   DDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
               + PA+YR+FTY EY+ KFW+R L  E CL+ FK
Sbjct  309   SHDQPAMYRNFTYAEYFEKFWNRGLATECCLDLFK  343



>ref|XP_006397057.1| hypothetical protein EUTSA_v10028770mg [Eutrema salsugineum]
 gb|ESQ38510.1| hypothetical protein EUTSA_v10028770mg [Eutrema salsugineum]
Length=351

 Score =   395 bits (1015),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/345 (55%), Positives = 245/345 (71%), Gaps = 9/345 (3%)
 Frame = -3

Query  1876  SMTTQLLFSGTPYST--LPQKYIRPESERPKLSEV-TTCDDVPVIDLGCGD---RSFIVR  1715
             S T++LL S    S   +P  Y+RP S+RP LSEV T+ + +P+IDL   D   R+ I+ 
Sbjct  4     SATSKLLVSDIASSVDHVPSNYVRPISDRPNLSEVETSGESIPLIDLRELDGPNRADIIH  63

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             Q   AC  YGFFQ+ NHGVP+K IE M+ VA EFF     E++K YS D  KT RLSTSF
Sbjct  64    QFAHACSSYGFFQIKNHGVPEKTIERMMTVAREFFRQPENERVKHYSTDTKKTTRLSTSF  123

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             NV  E V NWRD+LRLHC+P++ +  EWPSNP + R++   Y T VR +   + EAISES
Sbjct  124   NVGSEKVSNWRDFLRLHCFPIEDFIDEWPSNPVSFREITSDYATSVRSLVLTLLEAISES  183

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL+     N LG+ GQHMA+N+YPPCP+P+LT+GLP H DPN +T+LLQD +V+GLQV 
Sbjct  184   LGLEKDRVSNTLGKHGQHMALNYYPPCPQPDLTFGLPGHKDPNLITVLLQD-EVSGLQVF  242

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             KDGKW+AV P P+ F++NIGDQ+Q +SN KYKSV HRA+VN+DK R+S+ +F CP  DAV
Sbjct  243   KDGKWVAVHPVPNTFIVNIGDQMQVISNDKYKSVLHRAVVNSDKERISIPTFYCPSADAV  302

Query  994   ISAPKPLLDDE--SPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             I  P+ L+++E  SPAVY+ FTY EYY KFW R L  E CL+ FK
Sbjct  303   IGPPQELINEEEGSPAVYKSFTYAEYYEKFWDRALATESCLDLFK  347



>ref|XP_002278004.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase [Vitis vinifera]
 emb|CBI34621.3| unnamed protein product [Vitis vinifera]
Length=348

 Score =   395 bits (1014),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 192/344 (56%), Positives = 249/344 (72%), Gaps = 9/344 (3%)
 Frame = -3

Query  1876  SMTTQLLFSGTPYST--LPQKYIRPESERPKLSEVTTCD-DVPVIDL----GCGDRSFIV  1718
             + TT+LL +        +P  Y+RP SERP   +V   D  +P+IDL    G G R  +V
Sbjct  3     TSTTKLLLTDMVLGVDHVPSNYVRPPSERPNFKDVQASDVSIPLIDLQDLQGPG-RPDVV  61

Query  1717  RQIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTS  1538
             +QIG AC+H GFFQ+ NHGV + +I +ML++A +FF L   E++K YSD+PSKT RLSTS
Sbjct  62    KQIGQACQHDGFFQIKNHGVSETMISNMLRLARDFFQLPESERLKNYSDNPSKTTRLSTS  121

Query  1537  FNVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISE  1358
             FNVK E V NWRD+LRLHCYPL+ Y  EWPSNPPT R+ V  Y T  R++  ++ EAISE
Sbjct  122   FNVKTEKVANWRDFLRLHCYPLEDYVHEWPSNPPTFREDVAEYCTSTRELVLRLLEAISE  181

Query  1357  SLGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQV  1178
             SLGL+    K VL +QGQHMA+N+YPPCP+PELTYGLP HTDPN +T+LLQD  V GLQV
Sbjct  182   SLGLEKNYVKGVLSKQGQHMAMNYYPPCPQPELTYGLPGHTDPNLITVLLQD-DVPGLQV  240

Query  1177  LKDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDA  998
             L++ KW+AV P P+ F+INIGDQ+Q +SN +YKSV HRA+VN +K R+S+ +F CP  DA
Sbjct  241   LRNEKWVAVNPIPNTFIINIGDQMQVISNDRYKSVLHRAVVNCNKDRISIPTFYCPSPDA  300

Query  997   VISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             VI     L+ D+ PAVY++FTY +YY++FW+R L  E CL+ FK
Sbjct  301   VIGPAPELVKDDRPAVYKNFTYGDYYTQFWNRGLATECCLDTFK  344



>ref|XP_007209285.1| hypothetical protein PRUPE_ppa008091mg [Prunus persica]
 gb|EMJ10484.1| hypothetical protein PRUPE_ppa008091mg [Prunus persica]
Length=345

 Score =   394 bits (1013),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 191/335 (57%), Positives = 244/335 (73%), Gaps = 7/335 (2%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCD-DVPVIDLG---CGDRSFIVRQIGDACRH  1691
             L SG  +  +P  Y+RP S+RP LS+V   D  +P+IDL      + S I++QIG AC+ 
Sbjct  12    LMSGVNH--VPSNYVRPISDRPNLSDVQISDASIPLIDLKDLHGHNHSNIIKQIGLACQT  69

Query  1690  YGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVH  1511
              GFFQV NHGVP+++I+DML +A EFF L   E++K+YSDDPSKT RLSTSFNV+ E + 
Sbjct  70    DGFFQVKNHGVPEEMIKDMLSIAREFFKLPESERLKMYSDDPSKTTRLSTSFNVRTEKLS  129

Query  1510  NWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCF  1331
             NWRD+LRLHCYPL+ Y  EWP+NPP+ R+ V  Y T VR +  ++  AISESLGL+    
Sbjct  130   NWRDFLRLHCYPLEDYVQEWPNNPPSFREQVGEYCTTVRGLVLRLLGAISESLGLEKNYI  189

Query  1330  KNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAV  1151
                LG+QGQHMA+N+YPPCPEPELTYGLP HTD N +TILLQD  VAGLQVL++GKW+AV
Sbjct  190   VEALGKQGQHMALNYYPPCPEPELTYGLPGHTDCNLITILLQD-DVAGLQVLRNGKWVAV  248

Query  1150  KPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLL  971
              P P+ F++NIGD +Q +SN KYKSV HRA+VN    R+S+ +F CP  DAVI   K L+
Sbjct  249   NPIPNTFIVNIGDMMQVISNDKYKSVLHRAVVNCKSERISIPTFYCPSPDAVIGPAKDLI  308

Query  970   DDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
               + PA+YR+FTY EY+ KFW+R L  E CL+ FK
Sbjct  309   SHDQPAMYRNFTYAEYFEKFWNRGLATECCLDLFK  343



>ref|XP_004985922.1| PREDICTED: uncharacterized protein LOC101778942 [Setaria italica]
Length=1230

 Score =   420 bits (1080),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 236/303 (78%), Gaps = 3/303 (1%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACRHYGFF  1679
             L S   +  LP+ Y+RPE++RP+L EV +   +PV+DL   D + +V  IG+AC  +GFF
Sbjct  5     LISTAVHEELPENYVRPEAQRPRLHEVVSDAQIPVVDLADPDPAAVVASIGEACTTHGFF  64

Query  1678  QVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRD  1499
             QV+NHGVP +++  ML VA+EFF L  EEK KLYSDDP K MRLSTSFNV+KETVHNWRD
Sbjct  65    QVLNHGVPVELMVAMLAVAYEFFRLPAEEKAKLYSDDPGKKMRLSTSFNVRKETVHNWRD  124

Query  1498  YLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVL  1319
             YLRLHCYPL++Y P+WP+NPP+ R++V  Y  EVR +GF++ EAIS SLGL+    K  L
Sbjct  125   YLRLHCYPLEQYVPDWPANPPSFREIVSAYCREVRALGFRLYEAISASLGLEDDYVKRTL  184

Query  1318  GEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRP  1139
             GEQ QHMAVNFYP CP PELTYGLPAHTDPNALTILL D QVAGLQVL DG+W+AV PRP
Sbjct  185   GEQEQHMAVNFYPRCPAPELTYGLPAHTDPNALTILLMDQQVAGLQVLNDGRWIAVNPRP  244

Query  1138  DAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDES  959
             +A VINIGDQLQALSNG+YKSVWHRA++N+D+P MSVASFLCP  D  I    P L   S
Sbjct  245   NALVINIGDQLQALSNGRYKSVWHRAVLNSDRPWMSVASFLCPCNDVRIG---PALSVLS  301

Query  958   PAV  950
             P++
Sbjct  302   PSI  304



>ref|XP_010104902.1| Hyoscyamine 6-dioxygenase [Morus notabilis]
 gb|EXC02138.1| Hyoscyamine 6-dioxygenase [Morus notabilis]
Length=344

 Score =   394 bits (1011),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 188/342 (55%), Positives = 248/342 (73%), Gaps = 9/342 (3%)
 Frame = -3

Query  1870  TTQLLFS--GTPYSTLPQKYIRPESERPKLSEV-TTCDDVPVIDL----GCGDRSFIVRQ  1712
              T+LL +   +    +P  YIRP S+RP L +V T+   +P+IDL    G   R  IV+Q
Sbjct  3     ATKLLLADLASDVKYVPSNYIRPMSDRPNLDKVHTSGASIPLIDLQGLRGPNHRD-IVKQ  61

Query  1711  IGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFN  1532
             IG AC+H GFFQV NHG+P++++ +ML++A EFF L   E++K YSDDPSKT RLSTSFN
Sbjct  62    IGQACQHDGFFQVTNHGIPEEIVNNMLRLAREFFRLPESERLKNYSDDPSKTTRLSTSFN  121

Query  1531  VKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESL  1352
             VK E V NWRD+LRL+CYPL+ +  EWP+NPP+ R  V  Y T VR +  ++ EAISESL
Sbjct  122   VKTEKVANWRDFLRLYCYPLEDFINEWPTNPPSFRKDVANYCTSVRGLVLRLLEAISESL  181

Query  1351  GLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLK  1172
             GL+    +N LG  GQHMA+N+YPPCP+P+LTYGLP HTDPN +T+LLQD  V GLQVL+
Sbjct  182   GLNVGYIENALGRHGQHMAMNYYPPCPQPDLTYGLPGHTDPNLITVLLQD-DVPGLQVLR  240

Query  1171  DGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVI  992
             +G W+AV P P+ F++NIGDQ+Q +SN +YKSV HRA+VN +K R+S+ +F CP  DA++
Sbjct  241   NGNWVAVNPIPNTFIVNIGDQMQVISNDRYKSVLHRAVVNCNKERISIPTFYCPSPDAIV  300

Query  991   SAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
                K L++++ PAVYR FTY E+Y KFW R L  E CL+ FK
Sbjct  301   EPAKHLINEDEPAVYRSFTYAEFYKKFWDRGLATECCLDMFK  342



>ref|XP_004309513.1| PREDICTED: hyoscyamine 6-dioxygenase-like [Fragaria vesca subsp. 
vesca]
Length=345

 Score =   393 bits (1009),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 190/327 (58%), Positives = 238/327 (73%), Gaps = 6/327 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCDD--VPVIDL---GCGDRSFIVRQIGDACRHYGFFQVIN  1667
             +P  YIRP S+RP L++V    +  +P+IDL      + S I++QI  AC++ GFFQV N
Sbjct  18    VPSNYIRPISDRPNLADVQASSEGSIPLIDLQGLNGPNHSDIIQQIAQACQNDGFFQVKN  77

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HGVP ++I+ ML +A EFF L   E+MK+YSDDPSKT RLSTSFNVK E   NWRD+LRL
Sbjct  78    HGVPAEMIDGMLNIAREFFRLPESERMKMYSDDPSKTTRLSTSFNVKTEKTANWRDFLRL  137

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HCYPL+ Y  EWPSNPP+ R+ V  Y T VR +  K+ EAISESLGL        LG+Q 
Sbjct  138   HCYPLEDYVHEWPSNPPSFREEVGEYCTSVRGLVLKLLEAISESLGLQKDYIVKALGKQA  197

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMA+N+YPPCPEPELTYGLP HTD N +TILLQD  V GLQVL+ GKW+AV P P+ ++
Sbjct  198   QHMALNYYPPCPEPELTYGLPGHTDGNLITILLQD-DVPGLQVLRKGKWVAVNPIPNTYI  256

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             +NIGDQ+Q +SN +YKSV HRA+VN +K R+SV +F CP  DA+I   K L+  + PAVY
Sbjct  257   VNIGDQMQVISNDRYKSVLHRAVVNYNKERISVPTFYCPSPDALIGPAKELVSHDQPAVY  316

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             R+FTY E+YSKFW R L +E CL+ FK
Sbjct  317   RNFTYAEFYSKFWDRGLAKECCLDLFK  343



>ref|XP_009388156.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 5-like [Musa 
acuminata subsp. malaccensis]
Length=350

 Score =   392 bits (1008),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 189/344 (55%), Positives = 243/344 (71%), Gaps = 9/344 (3%)
 Frame = -3

Query  1876  SMTTQLLFSG--TPYSTLPQKYIRPESERPKLSEVTTCD-DVPVIDL----GCGDRSFIV  1718
             + TT+LL     +    +P +Y+RP S RP LS V   +  +PV+DL    G G R+ +V
Sbjct  3     TTTTRLLLGDLVSHAKNVPLRYVRPPSARPHLSAVEKSNATIPVVDLQELSGSG-RAMVV  61

Query  1717  RQIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTS  1538
             + IG AC+  GFFQV NHG+P  VI  ML+V+ EFF L   E++K YSDDPS+T RLSTS
Sbjct  62    KAIGSACQSDGFFQVKNHGIPDDVIGAMLRVSKEFFRLPESERLKSYSDDPSRTTRLSTS  121

Query  1537  FNVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISE  1358
             FNV+ E V NWRD+LR HCYPL+ Y  EWPSNP   R+VV  Y    RQ+  ++ EAISE
Sbjct  122   FNVRTEEVCNWRDFLRFHCYPLKDYVHEWPSNPSVFREVVGDYCKHARQLALRLLEAISE  181

Query  1357  SLGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQV  1178
             SLGL+    +  L +Q QHMA+N+YPPCP+PELTYGLP+H DPNA+T+LLQD  V+GLQV
Sbjct  182   SLGLEKDYMEKALAKQAQHMAINYYPPCPQPELTYGLPSHKDPNAITLLLQD-GVSGLQV  240

Query  1177  LKDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDA  998
              ++GKW+AV P P+A VINIGDQ+Q LSN +YKSV HRA+VN    R+S+ +F CP  DA
Sbjct  241   FRNGKWVAVDPIPNALVINIGDQIQVLSNDRYKSVLHRAVVNDSSERISIPTFYCPSPDA  300

Query  997   VISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             VI   + L+D++ PAVYR FTY EYY  FW+R L +E CL+ F+
Sbjct  301   VIGPAQALVDEQHPAVYRSFTYGEYYDAFWNRGLQRESCLDMFR  344



>ref|XP_008797635.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 5-like isoform 
X1 [Phoenix dactylifera]
Length=346

 Score =   392 bits (1007),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 188/326 (58%), Positives = 235/326 (72%), Gaps = 5/326 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCDDVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVINHG  1661
             +P  YIRP S+RP L  V +   + +IDL    C DRS +VR+IG ACR+ GFFQV NHG
Sbjct  21    VPHNYIRPLSDRPDLLNVESNATIALIDLQGLTCEDRSQVVREIGLACRNDGFFQVKNHG  80

Query  1660  VPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLHC  1481
             +PK V++ ML+VA +FF+L   E++K YS DP++T RLSTSFNVK E V +WRDYLRLHC
Sbjct  81    IPKDVVDGMLRVAKDFFHLPESERLKSYSQDPTRTTRLSTSFNVKTEKVSSWRDYLRLHC  140

Query  1480  YPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQH  1301
             YPL+ +A EWPSNPP  R VV  Y    R++  ++ EAISESLGL+    +  LG+QGQH
Sbjct  141   YPLEDFAHEWPSNPPCFRQVVGEYCKNARELALRLLEAISESLGLESDYMEKALGKQGQH  200

Query  1300  MAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL-KDGKWLAVKPRPDAFVI  1124
             MA+N+YPPCP+PELTYGLP H DPNA+TILLQD  V+GLQVL ++GKW+AV P PD  VI
Sbjct  201   MAINYYPPCPQPELTYGLPGHKDPNAITILLQD-GVSGLQVLIRNGKWVAVNPVPDTLVI  259

Query  1123  NIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYR  944
             NIGD +Q LSN +YKSV HR IVN    R+SV +F CP  DA+I   + + D+E P +YR
Sbjct  260   NIGDMIQVLSNDRYKSVLHRVIVNDTSERISVPTFYCPSPDALIKPAEAIADEEHPPIYR  319

Query  943   DFTYPEYYSKFWSRNLNQEHCLEHFK  866
              FTY +YY KFW R L    CL+ FK
Sbjct  320   SFTYGDYYEKFWKRGLQSASCLDVFK  345



>ref|XP_006465312.1| PREDICTED: hyoscyamine 6-dioxygenase-like [Citrus sinensis]
Length=354

 Score =   392 bits (1008),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/345 (57%), Positives = 241/345 (70%), Gaps = 9/345 (3%)
 Frame = -3

Query  1876  SMTTQLLFS--GTPYSTLPQKYIRPESERPKLSEVTTCDD--VPVIDLGC---GDRSFIV  1718
             +  T+LL S        +P  YIRP S+RP L++     D  +P+IDL       RS I+
Sbjct  6     TTATKLLLSDLAPTLKNVPSDYIRPISDRPNLTDQAHISDGSIPLIDLQGLYGPRRSDII  65

Query  1717  RQIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTS  1538
             +QIG AC+H GFFQV NHG+ + +I +ML +A  FF L   E++K+YSDDPSK  RLSTS
Sbjct  66    KQIGQACQHCGFFQVKNHGISEAMINNMLSIARTFFKLPESERLKIYSDDPSKPTRLSTS  125

Query  1537  FNVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISE  1358
             FNVK E V NWRD+LRLHCYPLQ Y  +WP NPP+ R+ V  Y T VR +  ++ EAISE
Sbjct  126   FNVKTEKVSNWRDFLRLHCYPLQDYVHDWPLNPPSFREDVGDYCTSVRGLVLRLIEAISE  185

Query  1357  SLGLDPQCF-KNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQ  1181
             SLGL      K  LG+ GQHMA+N+YPPCP+PELTYGLP HTDPN +TILLQD  V GLQ
Sbjct  186   SLGLPSDYIDKEALGKHGQHMALNYYPPCPQPELTYGLPGHTDPNLITILLQD-DVPGLQ  244

Query  1180  VLKDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGED  1001
             VL+DG W+ V P P  F++NIGDQ+Q LSN +YKSV HRA+V+ DK R+S+ +F CP  D
Sbjct  245   VLRDGNWVPVNPIPSTFIVNIGDQMQVLSNDRYKSVLHRAVVSRDKERISIPTFYCPSSD  304

Query  1000  AVISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             AVI   K L+D + PAVYRDFTY EYY KFW+R L  E CL+ FK
Sbjct  305   AVIGPAKGLVDQDLPAVYRDFTYAEYYKKFWNRGLATECCLDMFK  349



>gb|KEH18558.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
Length=343

 Score =   392 bits (1006),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/326 (56%), Positives = 244/326 (75%), Gaps = 5/326 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLS-EVTTCDDVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVINH  1664
             +P  +IRP  +RP L  + TT D +P IDL      +RS I+++I  ACR+YGFFQ++NH
Sbjct  18    VPSNFIRPIGDRPDLQLQFTTTDSIPTIDLQGLDASNRSEIIQKIAHACRNYGFFQIVNH  77

Query  1663  GVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLH  1484
             GVP++VI +M+ V+ EFFNL   E+MK YSDDP KT RLSTSFNVK E V NWRDYLRLH
Sbjct  78    GVPEEVINNMMSVSKEFFNLPESERMKNYSDDPLKTTRLSTSFNVKTEKVSNWRDYLRLH  137

Query  1483  CYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQ  1304
             C+PL+ Y  EWP+NPP+ R+ V  Y  ++R++  ++ +AISESLGL+     N LG+ GQ
Sbjct  138   CHPLEDYVHEWPANPPSFREDVAEYSRQLRRLALRLLDAISESLGLEKDYINNTLGKHGQ  197

Query  1303  HMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVI  1124
             HMA+N+YPPCPEP+LTYGLPAH DPN +TILLQ+  VAGLQVLKDGKW+ + P P+ F++
Sbjct  198   HMAINYYPPCPEPDLTYGLPAHADPNVITILLQN-DVAGLQVLKDGKWVTINPVPNTFIV  256

Query  1123  NIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYR  944
             NIGDQ+Q +SN +YKSV HRA+VN++K RMS+ +F CP  DA+I     L+D+     Y+
Sbjct  257   NIGDQIQVISNDRYKSVLHRALVNSEKERMSIPTFYCPSPDAIIRPAPQLIDNYHTVQYK  316

Query  943   DFTYPEYYSKFWSRNLNQEHCLEHFK  866
             +F Y EYY+KFW+R L++E C++ FK
Sbjct  317   EFEYNEYYNKFWNRGLSKETCVDMFK  342



>ref|XP_006427307.1| hypothetical protein CICLE_v10025958mg [Citrus clementina]
 gb|ESR40547.1| hypothetical protein CICLE_v10025958mg [Citrus clementina]
Length=354

 Score =   391 bits (1005),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 194/345 (56%), Positives = 243/345 (70%), Gaps = 9/345 (3%)
 Frame = -3

Query  1876  SMTTQLLFS--GTPYSTLPQKYIRPESERPKLSEVTTCDD--VPVIDLGCGD---RSFIV  1718
             +  T+LL S      + +P  YIRP S+RP L++ T   D  +P+IDL   +   RS I+
Sbjct  6     TTATKLLLSDLAPTLTNVPSDYIRPISDRPSLTDQTHISDGSIPLIDLQGLNGPRRSDII  65

Query  1717  RQIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTS  1538
             +QIG AC+H GFFQV NHG+ + +I +ML +A  FF L   E++K+YSDDPSK  RLSTS
Sbjct  66    KQIGQACQHCGFFQVKNHGISEAMINNMLSIARTFFKLPESERLKIYSDDPSKPTRLSTS  125

Query  1537  FNVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISE  1358
             FNVK E V NWRD+LRLHCYPLQ Y  +WP NPP+ R+ V  Y T VR +  ++ +AISE
Sbjct  126   FNVKTEKVSNWRDFLRLHCYPLQDYVHDWPLNPPSFREDVGDYCTSVRGLVLRLIQAISE  185

Query  1357  SLGLDPQCF-KNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQ  1181
             SLGL      K  LG+ GQHMA+N+YPPCP+PELTYGLP HTDPN +T+LLQD  V GLQ
Sbjct  186   SLGLPSDYIDKEALGKHGQHMALNYYPPCPQPELTYGLPGHTDPNLITLLLQD-DVPGLQ  244

Query  1180  VLKDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGED  1001
             VL+DG W+ V P P  F++NIGDQ+Q LSN +YKSV HRA+V+ DK R+S+ +F C   D
Sbjct  245   VLRDGNWVPVNPIPSTFIVNIGDQMQVLSNDRYKSVLHRAVVSRDKERISIPTFYCSSPD  304

Query  1000  AVISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             AVI   K L+D + PAVYRDFTY EYY KFW+R L  E CLE FK
Sbjct  305   AVIGPAKGLVDQDHPAVYRDFTYAEYYKKFWNRGLATECCLEMFK  349



>ref|XP_010040085.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Eucalyptus 
grandis]
 gb|KCW45488.1| hypothetical protein EUGRSUZ_L00783 [Eucalyptus grandis]
Length=349

 Score =   391 bits (1005),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 182/327 (56%), Positives = 242/327 (74%), Gaps = 6/327 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCD--DVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVIN  1667
             +P  YIR E++RP L+EV   D   +P++DL      +R  I+RQIG AC+  GFFQ+ N
Sbjct  20    VPDNYIRSEADRPNLTEVEASDASSIPLVDLQGLSGPNRDDIIRQIGRACQQDGFFQIKN  79

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HG+P++ ++ ++ +A EFF+L   E++K YSDDP+K+ RLSTSFN+K ETV NWRD+LRL
Sbjct  80    HGIPEEKVQAIMNIAREFFHLPESERLKNYSDDPTKSTRLSTSFNLKTETVSNWRDFLRL  139

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HCYPL++Y  EWP+NPP+ R  V  Y T VR++  K+ EAISESLGL+ +     LG+ G
Sbjct  140   HCYPLEEYMQEWPTNPPSFRKEVGEYCTRVRELVLKLLEAISESLGLEREYISQNLGKHG  199

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMA+N+YPPCP+PELTYGLP HTDPN +TILLQD  V GLQVL++GKW+AV P P+ F+
Sbjct  200   QHMAMNYYPPCPQPELTYGLPGHTDPNLITILLQD-DVPGLQVLRNGKWVAVNPIPNTFI  258

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             +NIGDQ+Q +SN KYKSV HRA+VN +  R+S+ +F CP  + +I   + L+D E PAVY
Sbjct  259   VNIGDQMQVISNDKYKSVLHRAVVNCNTERISIPTFYCPSPEGLIRPAQGLIDHEHPAVY  318

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             + FTY EYY KFW+R L  E CL+ FK
Sbjct  319   KSFTYEEYYHKFWNRGLRTECCLDMFK  345



>ref|XP_008392657.1| PREDICTED: hyoscyamine 6-dioxygenase-like [Malus domestica]
Length=346

 Score =   390 bits (1003),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 184/327 (56%), Positives = 242/327 (74%), Gaps = 6/327 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCD--DVPVIDLG---CGDRSFIVRQIGDACRHYGFFQVIN  1667
             +P KYIRP ++RP L++    D   +P+IDL        S I++QIG AC+  GFFQV N
Sbjct  19    IPSKYIRPITDRPNLTDFQISDTSSIPLIDLKDLHGPTHSDIIKQIGLACQTDGFFQVKN  78

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HGVP+ +I++ML +A EFF L   E++K+YSDDPSKT RLSTSFNV+ E + NWRD+LRL
Sbjct  79    HGVPETMIKNMLTIAREFFQLPESERLKMYSDDPSKTTRLSTSFNVRTEKLSNWRDFLRL  138

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HCYPLQ Y  EWP+NPP  R+ V  Y T VR++  ++ EAISESLGL+       LG+QG
Sbjct  139   HCYPLQDYVQEWPNNPPLFREQVGEYCTNVRELVLRLLEAISESLGLEKNYIVKALGKQG  198

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMA+N+YPPCP+PELTYGLP HTD N +TILLQD +V GLQVL++GKW+AV P P+ F+
Sbjct  199   QHMALNYYPPCPQPELTYGLPGHTDANLITILLQD-EVPGLQVLRNGKWVAVNPIPNTFI  257

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             +NIGD +Q +SN +YKSV HRA+VN +  R+S+ +F CP  DAVI   + L++ ++PA+Y
Sbjct  258   VNIGDMMQVISNNRYKSVLHRAVVNCNSERISIPTFYCPSPDAVIGPAEELINYDNPAMY  317

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             R+FTY EYY KFW++ L  E CL+ FK
Sbjct  318   RNFTYAEYYEKFWNKGLATECCLDLFK  344



>ref|XP_007039318.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007039319.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY23819.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY23820.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
Length=346

 Score =   390 bits (1002),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 192/341 (56%), Positives = 240/341 (70%), Gaps = 7/341 (2%)
 Frame = -3

Query  1870  TTQLLFSGTPYST--LPQKYIRPESERPKLSEVTTCD-DVPVIDLG---CGDRSFIVRQI  1709
              T+LL +    S   +P  YIRP S+RP LS+V   D  +P+IDL      +RS I++QI
Sbjct  3     ATKLLLTDLASSVKQVPFNYIRPISDRPNLSDVQVSDVSLPLIDLQDLYGPNRSDILKQI  62

Query  1708  GDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNV  1529
               AC H GFFQV NHG+ + +I +ML++A EFF L   E++K YSDDPSK  RLSTSFNV
Sbjct  63    ALACEHDGFFQVKNHGISEALINNMLRLAREFFRLPKSERLKNYSDDPSKANRLSTSFNV  122

Query  1528  KKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLG  1349
             K E V NWRD+LRLHCYPL+ +  EWPSNPP+ R+    Y T VR +  ++ EAISESLG
Sbjct  123   KTEKVANWRDFLRLHCYPLKDHVHEWPSNPPSFREDAAEYCTRVRGLVLRLLEAISESLG  182

Query  1348  LDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKD  1169
             L        L + GQHMA+N+YPPCPEPELTYGLP HTDPN +TILLQD  V GLQVL++
Sbjct  183   LKRDHIDKTLSKHGQHMALNYYPPCPEPELTYGLPGHTDPNLITILLQD-DVPGLQVLRN  241

Query  1168  GKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVIS  989
             GKW+AV P P+ F++NIGDQ+Q +SN +YKSV HRA+VN +K R+S+ +F CP  DA+I 
Sbjct  242   GKWVAVNPIPNTFIVNIGDQMQVISNDRYKSVLHRAVVNCNKERISIPTFYCPSNDALIG  301

Query  988   APKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
                 L+DDE PAVYR F Y E+Y KFW R L  E CL+ FK
Sbjct  302   PATELIDDEHPAVYRSFAYGEFYEKFWKRGLATECCLDKFK  342



>ref|XP_003548081.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Glycine 
max]
 gb|KHN15872.1| Flavonol synthase/flavanone 3-hydroxylase [Glycine soja]
Length=345

 Score =   390 bits (1001),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/326 (56%), Positives = 238/326 (73%), Gaps = 5/326 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEV-TTCDDVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVINH  1664
             +P  +IRP  +RP L ++ ++   +P+IDL   G  + S I++ I  AC++YGFFQ++NH
Sbjct  18    VPSNFIRPIGDRPNLQQLHSSIASIPIIDLQGLGGSNHSQIIQNIAHACQNYGFFQIVNH  77

Query  1663  GVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLH  1484
             G+P++V+  M+ V+ EFF L   E++K YSDDP+KT RLSTSFNVK E V NWRD+LRLH
Sbjct  78    GIPEEVVSKMVNVSKEFFGLPESERLKNYSDDPTKTTRLSTSFNVKTEKVSNWRDFLRLH  137

Query  1483  CYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQ  1304
             C+PL+ Y  EWP NPP+ R+ V  Y  ++R +  K+ EAISESLGL+       LG+ GQ
Sbjct  138   CHPLEDYIQEWPGNPPSFREDVAEYSRKMRGLSLKLLEAISESLGLEKDYIDKALGKHGQ  197

Query  1303  HMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVI  1124
             HMA+N+YPPCPEPELTYGLPAH DPNA+TILLQ+ QV GLQVL DGKWL V P P+ F++
Sbjct  198   HMAINYYPPCPEPELTYGLPAHADPNAITILLQN-QVPGLQVLHDGKWLTVNPVPNTFIV  256

Query  1123  NIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYR  944
             NI DQ+Q +SN +YKSV HRA+VN +K RMS+ +F CP  DA+I     L+D E PA Y 
Sbjct  257   NIADQIQVISNDRYKSVLHRALVNCEKERMSIPTFYCPSPDALIKPAPQLVDKEHPAQYT  316

Query  943   DFTYPEYYSKFWSRNLNQEHCLEHFK  866
             +FTY EYY KFW R L++E C++ FK
Sbjct  317   NFTYREYYDKFWIRGLSKETCVDMFK  342



>ref|XP_010054742.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Eucalyptus 
grandis]
Length=425

 Score =   392 bits (1008),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 185/332 (56%), Positives = 243/332 (73%), Gaps = 6/332 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCD--DVPVIDLGC---GDRSFIVRQIGDACRHYGFFQVIN  1667
             +P  YIRP+++RP L+EV   D   +P+IDL      +R  I+RQIG ACR  GFFQ+ N
Sbjct  14    VPNNYIRPQADRPNLTEVEASDASTIPLIDLQGLFGPNRDDIIRQIGKACRRDGFFQIKN  73

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HG+P++V++ ++ +A EFF L   E++K YSDDPSK+ RLSTSFN+K E V NWRD+LRL
Sbjct  74    HGIPEEVVQAIMNIAEEFFRLPESERLKNYSDDPSKSTRLSTSFNIKTEKVSNWRDFLRL  133

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HCY L++Y  EWP+NPP+ R  V  Y T VR++  K+ EAISESLGL+ +     LG+ G
Sbjct  134   HCYTLEEYMHEWPTNPPSFRKEVGEYCTRVRELALKLLEAISESLGLEREYISKNLGKHG  193

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMA+N+YP CP+PELTYGL  HTD N +TILLQD +V GLQVL+DGKW+AV P P+ F+
Sbjct  194   QHMAMNYYPLCPQPELTYGLLGHTDQNLITILLQD-EVPGLQVLRDGKWIAVDPIPNTFI  252

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             +NIGDQ+Q +SN KYKS+ HRA+VN D+ R+S+ +F CP  +A+    + L+D E+PAVY
Sbjct  253   VNIGDQMQVISNDKYKSILHRAVVNCDRERISIPTFYCPSPEALFGPAQGLIDHENPAVY  312

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFKN*LAL  851
             R FTY EYY KFW+R L  E CL+ FK   AL
Sbjct  313   RSFTYEEYYHKFWNRGLRTECCLDMFKKPSAL  344



>ref|XP_008375465.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Malus 
domestica]
Length=373

 Score =   390 bits (1002),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 192/368 (52%), Positives = 256/368 (70%), Gaps = 9/368 (2%)
 Frame = -3

Query  1945  PAPRKIQLHNR*LYNLLSFR*PD-SMTTQLLFSG--TPYSTLPQKYIRPESERPKLSEVT  1775
             P PR + L    +  L S      + TT+LL +   +  S +P  YIRP S+RP L++V 
Sbjct  5     PKPRSLNLQVSLVLQLFSSVVSKMASTTKLLLTDLMSGMSHVPSNYIRPFSDRPNLTDVQ  64

Query  1774  TCD--DVPVIDLG---CGDRSFIVRQIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFF  1610
             T D   +P+IDL        S I++QIG AC+  GFFQV NHGVP+ +I++ML +A EFF
Sbjct  65    TSDASSIPLIDLKDLHSPKHSDIIQQIGLACQTDGFFQVKNHGVPETMIKNMLSIAREFF  124

Query  1609  NLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTL  1430
                  E++K+YSDDP KT RLSTSFNV+ E + NWRD+LRLHC+PLQ Y  EWP+NPP  
Sbjct  125   KFPESERLKMYSDDPFKTTRLSTSFNVRTEKLSNWRDFLRLHCFPLQDYVQEWPNNPPLF  184

Query  1429  RDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYG  1250
             R+ V  Y T VR +  ++ EAISESLGL+       LG+QGQHMA+N+YPPCP+PELTYG
Sbjct  185   REQVGEYCTSVRGLVLRLLEAISESLGLEKNYIVKALGKQGQHMALNYYPPCPQPELTYG  244

Query  1249  LPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVW  1070
             LP HTD N +TILLQD +V GLQVL++GKW+AV P P+ F++NIGD +Q +SN +YKSV 
Sbjct  245   LPGHTDANLITILLQD-EVPGLQVLRNGKWVAVNPIPNTFIVNIGDMMQVISNSRYKSVL  303

Query  1069  HRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQ  890
             HRA+VN +  R+S+ +F CP  DA+I   + L++ + PA++R+FTY EY+ KFW+R L  
Sbjct  304   HRAVVNCNSERISIPTFYCPAPDAMIGPARELINHDHPAMFRNFTYAEYFEKFWNRGLAT  363

Query  889   EHCLEHFK  866
             E CL+ FK
Sbjct  364   ECCLDLFK  371



>ref|XP_010039652.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Eucalyptus 
grandis]
 gb|KCW45839.1| hypothetical protein EUGRSUZ_L00353 [Eucalyptus grandis]
Length=349

 Score =   389 bits (1000),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/327 (55%), Positives = 241/327 (74%), Gaps = 6/327 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCD--DVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVIN  1667
             +P  YIR E++RP L++V   D   +P++DL      +R  I+RQIG AC+  GFFQ+ N
Sbjct  20    VPDNYIRSEADRPNLTDVEASDASSIPLVDLQGLSGPNRDDIIRQIGRACQQDGFFQIKN  79

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HG+P++ ++ ++ +A EFF L   E++K YSDDP+K+ RLSTSFN+K ETV NWRD+LRL
Sbjct  80    HGIPEEKVQAIMNIAREFFQLPESERLKNYSDDPTKSTRLSTSFNLKTETVSNWRDFLRL  139

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HCYPL++Y  EWP+NPP+ R  +  Y T VR++  K+ EAISESLGL+ +     LG+ G
Sbjct  140   HCYPLEEYMHEWPTNPPSFRKEMGEYCTRVRELVLKLLEAISESLGLEREYISQNLGKHG  199

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMA+N+YPPCP+PELTYGLP HTDPN +TILLQD  V GLQVL++GKW+AV P P+ F+
Sbjct  200   QHMAMNYYPPCPQPELTYGLPGHTDPNLITILLQD-DVPGLQVLRNGKWVAVNPIPNTFI  258

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             +NIGDQ+Q +SN KYKSV HRA+VN +  R+S+ +F CP  + +I   + L+D E PAVY
Sbjct  259   VNIGDQMQVISNDKYKSVLHRAVVNCNTERISIPTFYCPSPEGLIRPAQGLIDHEHPAVY  318

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             R FTY EYY KFW+R L  E CL+ FK
Sbjct  319   RSFTYEEYYHKFWNRGLRTECCLDMFK  345



>ref|XP_010039651.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Eucalyptus 
grandis]
 gb|KCW45837.1| hypothetical protein EUGRSUZ_L00350 [Eucalyptus grandis]
Length=349

 Score =   389 bits (999),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 182/327 (56%), Positives = 240/327 (73%), Gaps = 6/327 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCD--DVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVIN  1667
             +P  YIR E++RP L+EV   D   +P++DL      +R  I+RQIG AC+  GFFQ+ N
Sbjct  20    VPDNYIRSEADRPNLTEVEASDASSIPLVDLQGLSGPNRDDIIRQIGRACQQDGFFQIKN  79

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HG+P++ ++ ++ +A EFF L   E++K YSDDP+K+ RLSTSFN+K E V NWRD+LRL
Sbjct  80    HGIPEEKVQAIMNIAREFFRLPESERLKNYSDDPTKSTRLSTSFNLKTEKVSNWRDFLRL  139

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HCYPL++Y  EWP+NPP+ R  V  Y T VR++ FK+ EAISESLGL+ +     LG+ G
Sbjct  140   HCYPLEEYMHEWPTNPPSFRKEVGEYCTRVRELVFKLLEAISESLGLEREYISQNLGKHG  199

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMA+N+YPPCP+PELTYGLP HTDPN +TILLQD  V GLQVL++GKW+AV P P+ F+
Sbjct  200   QHMAMNYYPPCPQPELTYGLPGHTDPNLITILLQD-DVPGLQVLRNGKWVAVNPIPNTFI  258

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             +NIGDQ+Q +SN KYKSV HRA+VN +  R+S+ +F CP  + +I   + L+D   PAVY
Sbjct  259   VNIGDQMQVISNDKYKSVLHRAVVNCNTERISIPTFYCPSPEGLIRPAQGLIDHGHPAVY  318

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             R FTY EYY KFW+R L  E CL+ FK
Sbjct  319   RSFTYEEYYHKFWNRGLRTECCLDMFK  345



>ref|XP_008775841.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Phoenix 
dactylifera]
Length=346

 Score =   389 bits (999),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 183/329 (56%), Positives = 236/329 (72%), Gaps = 7/329 (2%)
 Frame = -3

Query  1837  STLPQKYIRPESERPKLSEVTTCD-DVPVIDL----GCGDRSFIVRQIGDACRHYGFFQV  1673
             S++P  +IRP S+RP L +V T D  +P+IDL    G G RS ++++IG AC   GFFQV
Sbjct  18    SSIPSNFIRPISDRPNLHDVKTSDASIPLIDLQGLTGPG-RSKLIKEIGAACLKDGFFQV  76

Query  1672  INHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYL  1493
              NHG+P+ VI+DML V+ EFF+L   E++K YSDDP KT RLSTSFN+K E V +WRDYL
Sbjct  77    KNHGIPEAVIDDMLCVSKEFFHLPESERLKKYSDDPMKTCRLSTSFNIKTEKVGSWRDYL  136

Query  1492  RLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGE  1313
             R+HCYPL+ +  EWP +PP  R VV  Y   VR++  ++ EAISESL L+      VL  
Sbjct  137   RIHCYPLEDFVHEWPDSPPCFRQVVSEYCKSVRELALRVLEAISESLDLERDFMNKVLSS  196

Query  1312  QGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDA  1133
               QHMA+N+YPPCP+PELTYGLP H DPN +++L+QD  V+GLQ L+DGKW+A+ P P  
Sbjct  197   HAQHMAINYYPPCPQPELTYGLPGHKDPNVISLLIQD-GVSGLQALRDGKWVAINPEPYN  255

Query  1132  FVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPA  953
              VIN+GDQ+Q LSNGKYKSV HRA+VN++  R+S+ +F CP  DAVI  P  L+D E P+
Sbjct  256   LVINLGDQMQVLSNGKYKSVLHRAVVNSNSARISIPTFYCPSSDAVIKPPGSLVDQEHPS  315

Query  952   VYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             +YR FTY EYY KFW   +N E CL+ FK
Sbjct  316   IYRSFTYAEYYEKFWDHGMNSESCLDMFK  344



>ref|XP_011042696.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Populus 
euphratica]
Length=344

 Score =   389 bits (998),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 187/329 (57%), Positives = 239/329 (73%), Gaps = 5/329 (2%)
 Frame = -3

Query  1837  STLPQKYIRPESERPKLSEVTTCD-DVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVI  1670
             S +P  YIRP S+RPKLSEV + D  +P+IDL   G   RS IV +IG AC+ +GFFQV 
Sbjct  17    SDVPSNYIRPVSDRPKLSEVLSSDGSIPLIDLQGLGGPHRSSIVGEIGRACQTHGFFQVK  76

Query  1669  NHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLR  1490
             NHG+P KVI+  L+V+ EFF+L+  E++K YSDDP KT RLSTSFNVK E V +WRD+LR
Sbjct  77    NHGIPNKVIDGTLRVSKEFFHLTERERLKNYSDDPMKTTRLSTSFNVKTEIVSSWRDFLR  136

Query  1489  LHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQ  1310
             LHCYPL+ Y  EWP+NPP+ R+ V  Y    R++  ++  AISESL L+       L + 
Sbjct  137   LHCYPLEDYIHEWPNNPPSFREDVAEYCRNARELSIRLLGAISESLCLETDYICKALSKH  196

Query  1309  GQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAF  1130
             GQHMAVN+YPPCP+P+LTYGLPAH DPNA+TILLQD  V GLQVL++ KW+A+ P P  F
Sbjct  197   GQHMAVNYYPPCPQPQLTYGLPAHADPNAITILLQD-DVPGLQVLQNDKWVAINPIPYTF  255

Query  1129  VINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAV  950
             ++NIGDQ+Q +SN +Y+SV HRA+V+ DK R+S+ +F CP  DAVI     L+DD+ PA+
Sbjct  256   IVNIGDQIQVISNDRYRSVLHRAVVDRDKERISIPTFYCPSHDAVIGPAPSLIDDDHPAL  315

Query  949   YRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             YR+F Y EYY KFW+  L  E CL  FKN
Sbjct  316   YRNFAYSEYYQKFWNHGLATETCLGMFKN  344



>ref|XP_008392659.1| PREDICTED: hyoscyamine 6-dioxygenase-like [Malus domestica]
Length=346

 Score =   388 bits (997),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 183/327 (56%), Positives = 238/327 (73%), Gaps = 6/327 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLS--EVTTCDDVPVIDLG---CGDRSFIVRQIGDACRHYGFFQVIN  1667
             +P  YIRP S+RP  +  +V+    +P+IDL        S I++QIG AC+  GFF+V N
Sbjct  19    IPSNYIRPISDRPNFTDFQVSDASSIPLIDLKDLHGPTHSDIIKQIGLACQTDGFFEVKN  78

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HGVP+ +I+DML +A EFF L   E++K+YSDDPSKT RLSTSFNV+ E + NWRD+LRL
Sbjct  79    HGVPEIMIKDMLNIAREFFQLPESERLKMYSDDPSKTTRLSTSFNVRTEKLSNWRDFLRL  138

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HCYPLQ Y  EWP+NPP  R+ V  Y T VR +  ++ EAISESLGL+  C    LG+QG
Sbjct  139   HCYPLQDYVQEWPNNPPLFREQVGEYCTNVRGLVLRLLEAISESLGLEKNCIVKALGKQG  198

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMA+N+YPPCP+PELTYGLP HTD N +T+LLQD +V GLQVL++GKW+AV P P+ F+
Sbjct  199   QHMALNYYPPCPQPELTYGLPGHTDANLITVLLQD-EVPGLQVLRNGKWVAVNPIPNTFI  257

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             +NIGD +Q +SN +YKSV HRA+ N +  R+S+ +F CP  DAVI   K L + + PA+Y
Sbjct  258   VNIGDMMQVISNNRYKSVLHRAVXNCNSERISIPTFYCPSPDAVIGPAKELXNYDHPAMY  317

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             R+FTY EYY KFW++ L  E CL+ FK
Sbjct  318   RNFTYAEYYEKFWNKGLATECCLDLFK  344



>ref|XP_009348691.1| PREDICTED: hyoscyamine 6-dioxygenase-like [Pyrus x bretschneideri]
Length=346

 Score =   388 bits (997),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 183/327 (56%), Positives = 241/327 (74%), Gaps = 6/327 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCD--DVPVIDLG---CGDRSFIVRQIGDACRHYGFFQVIN  1667
             +P  YIRP ++RP L++    D   +P+IDL        S I++QIG AC+  GFFQV N
Sbjct  19    IPSNYIRPITDRPNLTDFQISDTSSIPLIDLKDLHGPTHSDIIKQIGLACQTDGFFQVKN  78

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HGVP+ +I++ML +A EFF L   E++K+YSDDPSKT RLSTSFNV+ E + NWRD+LRL
Sbjct  79    HGVPETMIKNMLTIAREFFQLPESERLKMYSDDPSKTTRLSTSFNVRTEKLSNWRDFLRL  138

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HCYPLQ Y  EWP+NPP  R+ V  Y T VR++  ++ EAISESLGL+       LG+QG
Sbjct  139   HCYPLQDYVQEWPNNPPLFREQVGEYCTNVRELVLRLLEAISESLGLEKSYIVKALGKQG  198

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMA+N+YPPCP+PELTYGLP HTD N +TILLQD +V GLQVL++GKW+AV P P+ F+
Sbjct  199   QHMALNYYPPCPQPELTYGLPGHTDANLITILLQD-EVPGLQVLRNGKWVAVNPIPNTFI  257

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             +NIGD +Q +SN +YKSV HRA+VN +  R+S+ +F CP  DAVI   + L++ ++PA+Y
Sbjct  258   VNIGDMMQVISNNRYKSVLHRAVVNCNSERISIPTFYCPSPDAVIGPAEELINYDNPAMY  317

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             R+FTY EYY KFW++ L  E CL+ FK
Sbjct  318   RNFTYAEYYEKFWNKGLAIECCLDLFK  344



>ref|XP_002518945.1| 1-aminocyclopropane-1-carboxylate oxidase, putative [Ricinus 
communis]
 gb|EEF43478.1| 1-aminocyclopropane-1-carboxylate oxidase, putative [Ricinus 
communis]
Length=346

 Score =   388 bits (996),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 187/342 (55%), Positives = 242/342 (71%), Gaps = 7/342 (2%)
 Frame = -3

Query  1870  TTQLLFS--GTPYSTLPQKYIRPESERPKLSEVTTCD-DVPVIDLG---CGDRSFIVRQI  1709
             +T+LL +   +    +P KYIRP S+RP LS+V   D  + +IDL      +R+ +++QI
Sbjct  3     STKLLLADLASGVRHVPSKYIRPVSDRPNLSDVHKSDGSIRLIDLKGLRSPNRALVIKQI  62

Query  1708  GDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNV  1529
             G AC+  GFFQV NHG+P ++I  +++ A EFF L   E++K YS+DP+KT RLSTSFNV
Sbjct  63    GQACQTDGFFQVKNHGLPDEMINSIMRTAREFFKLPESERLKCYSNDPTKTTRLSTSFNV  122

Query  1528  KKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLG  1349
             K E V NWRD+LRLHCYPL  Y  EWP NPP  R  V  Y T VR++   + EAISESLG
Sbjct  123   KTEKVSNWRDFLRLHCYPLADYIQEWPCNPPLFRKNVSEYSTSVRRLVLTLLEAISESLG  182

Query  1348  LDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKD  1169
             L     +  L +QGQHMA+N+YPPCP+PELTYGLP HTDPN +TILLQD  V GLQVL++
Sbjct  183   LKRDYIEKTLSKQGQHMAMNYYPPCPQPELTYGLPGHTDPNLITILLQD-HVPGLQVLRN  241

Query  1168  GKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVIS  989
             GKW+A+ P P  F++NIGDQ+Q +SN +YKSV HRA+VN+ + R+S+ +F CP  DAVI 
Sbjct  242   GKWIAINPIPSTFIVNIGDQMQVISNDRYKSVLHRAVVNSYEERISIPTFYCPSPDAVIG  301

Query  988   APKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
               K L+D + PA YR+FTY EYY KFW R L +E CL+ FK 
Sbjct  302   PAKDLIDPDHPAAYREFTYAEYYEKFWDRGLAKECCLDLFKT  343



>ref|XP_003528757.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase isoformX1 
[Glycine max]
 gb|KHN06377.1| Naringenin,2-oxoglutarate 3-dioxygenase [Glycine soja]
Length=345

 Score =   387 bits (995),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/326 (55%), Positives = 240/326 (74%), Gaps = 5/326 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEV-TTCDDVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVINH  1664
             +P  +IRP  +RPKL ++ ++   +P+IDL   G  + S I++ I  AC+ YGFFQ++NH
Sbjct  18    VPSNFIRPIGDRPKLHQLHSSLASIPIIDLQGLGGSNHSQIIQNIAHACQTYGFFQIVNH  77

Query  1663  GVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLH  1484
             G+ ++V+  M+ V+ EFF L   E++K +SDDPSKT RLSTSFNVK E V NWRD+LRLH
Sbjct  78    GIQEEVVSKMVNVSKEFFGLPESERLKNFSDDPSKTTRLSTSFNVKTEKVSNWRDFLRLH  137

Query  1483  CYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQ  1304
             C+PL+ Y  EWP NPP+ R+ V  Y  ++R +  K+ EAISESLGL+       LG+ GQ
Sbjct  138   CHPLEDYIQEWPGNPPSFREDVAEYSRKMRGLSLKLLEAISESLGLERDYIDKALGKHGQ  197

Query  1303  HMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVI  1124
             H+A+N+YPPCPEPELTYGLPAH DPNA+TILLQ+ +V GLQVL DGKWL V P P+ F++
Sbjct  198   HLAINYYPPCPEPELTYGLPAHADPNAITILLQN-EVPGLQVLYDGKWLTVNPVPNTFIV  256

Query  1123  NIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYR  944
             NIGDQ+Q +SN +YKSV HRA+VN +K RMS+ +F CP  DA+I     L+D+E PA Y 
Sbjct  257   NIGDQIQVISNDRYKSVLHRALVNCEKERMSIPTFYCPSPDALIKPAPKLVDNEHPAQYT  316

Query  943   DFTYPEYYSKFWSRNLNQEHCLEHFK  866
             +FTY EYY KFW+R L++E C++ FK
Sbjct  317   NFTYREYYDKFWNRGLSKETCVDMFK  342



>ref|XP_008245738.1| PREDICTED: hyoscyamine 6-dioxygenase-like isoform X2 [Prunus 
mume]
Length=346

 Score =   386 bits (992),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 186/336 (55%), Positives = 242/336 (72%), Gaps = 8/336 (2%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCD--DVPVIDLG---CGDRSFIVRQIGDACR  1694
             L SG  +  +P  Y+RP S+RP L +V   D   +P+IDL      + S I++QIG AC+
Sbjct  12    LMSGVNH--VPSNYVRPISDRPNLRDVQISDASSIPLIDLKDLHGHNHSNIIKQIGLACQ  69

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
               GFFQV NHGVP+++I+DM  +A +FF L   E++K+YSDDPSKT RLSTSFNV+ E +
Sbjct  70    TDGFFQVKNHGVPEEMIKDMSSIARKFFKLPESERLKMYSDDPSKTTRLSTSFNVRTEKL  129

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
              NWRD+LRLHCYPL+ Y  EWP+NPP+ R+ V  Y T VR +  ++  AISESLGL+   
Sbjct  130   SNWRDFLRLHCYPLEDYVQEWPNNPPSFREQVGEYCTSVRGLVLRLLGAISESLGLEKNY  189

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
                 LG+QGQHMA+N+YPPCPEPELTYGLP HTD N +TILLQD  V GLQVL++GKW+A
Sbjct  190   IVEALGKQGQHMALNYYPPCPEPELTYGLPGHTDCNLITILLQD-DVPGLQVLRNGKWVA  248

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V P P+ F++NIGD +Q +SN KYKSV HRA+VN +  R+S+ +F CP  DAV+   K L
Sbjct  249   VNPIPNTFIVNIGDMMQVISNDKYKSVLHRAVVNCNSERISIPTFYCPSPDAVVGPAKDL  308

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             +  + PA+YR+FTY EY+ KFW+R L  E CL+ FK
Sbjct  309   ISHDQPAMYRNFTYAEYFEKFWNRGLATECCLDLFK  344



>ref|XP_010941175.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Elaeis 
guineensis]
Length=346

 Score =   385 bits (990),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 186/329 (57%), Positives = 235/329 (71%), Gaps = 7/329 (2%)
 Frame = -3

Query  1837  STLPQKYIRPESERPKLSEVTTCD-DVPVIDL----GCGDRSFIVRQIGDACRHYGFFQV  1673
             S++P  +IRP S+R  L  V T D  +P+IDL    G G RS ++++IG AC   GFFQV
Sbjct  18    SSVPSNFIRPISDRHNLHGVKTSDASIPLIDLQGLTGPG-RSKLIKEIGAACLKDGFFQV  76

Query  1672  INHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYL  1493
              NHG+P+ VI++ML V+ EFF+L   E++K YSDDP KT RLSTSFN+K E V +WRDYL
Sbjct  77    KNHGIPESVIDNMLCVSKEFFHLPEHERLKNYSDDPMKTSRLSTSFNIKTEKVGSWRDYL  136

Query  1492  RLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGE  1313
             R+HCYPL+ +  EWP NPP  R VV  Y   VR++  +I EAISESLGL+       LG 
Sbjct  137   RIHCYPLEDFIHEWPDNPPCFRQVVGEYCKNVRELALRILEAISESLGLEKDFMNKALGS  196

Query  1312  QGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDA  1133
              GQH+A+N+YPPCP+PELTYGLP H D N +T+LLQD  V+GLQVL DGKW+ V P P  
Sbjct  197   HGQHLAINYYPPCPQPELTYGLPGHKDNNVITLLLQD-GVSGLQVLHDGKWVTVNPEPYN  255

Query  1132  FVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPA  953
              VIN+GDQ+Q LSNGKY SV HRA+VN++  R+S+ +F CP  DAVI  P+ L+D+E P+
Sbjct  256   LVINLGDQIQVLSNGKYNSVLHRAVVNSNSERISIPTFYCPSPDAVIKPPESLVDEEHPS  315

Query  952   VYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             +YR FTY EYY KFW   LN E CL+ FK
Sbjct  316   IYRSFTYAEYYEKFWDHGLNSESCLDLFK  344



>ref|XP_010455445.1| PREDICTED: hyoscyamine 6-dioxygenase-like [Camelina sativa]
Length=351

 Score =   385 bits (990),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 186/345 (54%), Positives = 240/345 (70%), Gaps = 9/345 (3%)
 Frame = -3

Query  1876  SMTTQLLFS--GTPYSTLPQKYIRPESERPKLSEVTTC-DDVPVIDLG---CGDRSFIVR  1715
             S T++LL S   +    LP  Y+RP S+RP +S+V T  D +P+IDL      +R+ I+ 
Sbjct  4     SQTSKLLVSDIASIVDHLPSNYVRPVSDRPNMSDVATSGDSIPLIDLKDLHGPNRTDIIN  63

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             Q   AC  YGFFQ+ NHGVP++ I+ M+ VA EFF     E++K YS D  KT RLSTSF
Sbjct  64    QFAYACSSYGFFQIKNHGVPEETIKKMMNVAREFFRQPESERVKHYSSDTKKTTRLSTSF  123

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             NV  E V NWRD+LRLHCYP++ +  EWPS P + R+V   Y T VR +   + EAISES
Sbjct  124   NVCTEKVSNWRDFLRLHCYPIEDFINEWPSTPISFREVTAEYATSVRALVLTLLEAISES  183

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL      N LG+ GQHMA+N+YPPCPEPELTYGLP H D N +T+LLQD +V+GLQV 
Sbjct  184   LGLVKDRVSNTLGKHGQHMAINYYPPCPEPELTYGLPGHKDANLITVLLQD-EVSGLQVY  242

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             KDGKW+AV P P+ F++N+GDQ+Q +SN KYKSV HRA+VN+DK R+S+ +F CP EDAV
Sbjct  243   KDGKWVAVHPVPNTFIVNLGDQMQVISNDKYKSVLHRAVVNSDKERISIPTFYCPSEDAV  302

Query  994   ISAPKPLLDDE--SPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             IS  + L+++E  SPA+YR FTY EY+ KFW      E C++ FK
Sbjct  303   ISPAQELINEEEDSPAIYRSFTYAEYFEKFWETGFATESCIDSFK  347



>gb|KFK31848.1| hypothetical protein AALP_AA6G166400 [Arabis alpina]
Length=351

 Score =   385 bits (989),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 184/328 (56%), Positives = 236/328 (72%), Gaps = 7/328 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEV-TTCDDVPVIDLG---CGDRSFIVRQIGDACRHYGFFQVINH  1664
             +P  Y+RP S+RP LSEV T+ D +P+IDLG     +R+ I+ Q+  AC  YGFFQ+ NH
Sbjct  21    VPSNYVRPISDRPNLSEVETSGDSIPLIDLGELHGPNRAEIIHQVAHACSSYGFFQIKNH  80

Query  1663  GVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLH  1484
             GVP+K IE M+ VA EFF     E++K YS D  KT RLSTSFNV  E V NWRD+LRLH
Sbjct  81    GVPEKTIERMMTVAREFFRQPESERVKHYSADTKKTTRLSTSFNVGSEKVSNWRDFLRLH  140

Query  1483  CYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQ  1304
             C P++ +  EWP +P + R+V   Y T VR +   + EAISESLGL      + LG+ GQ
Sbjct  141   CLPIEDFINEWPLSPVSFREVTAEYATSVRALVLILLEAISESLGLAKNRVSDTLGKHGQ  200

Query  1303  HMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVI  1124
             HMA+N+YPPCP+P+LT+GLP H DPN +TILLQD +V+GLQV KDGKW+AV P  + F+I
Sbjct  201   HMALNYYPPCPQPDLTFGLPGHKDPNLITILLQD-EVSGLQVFKDGKWIAVHPVSNTFII  259

Query  1123  NIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDE--SPAV  950
             NIGDQ+Q +SN KYKSV HRA+VN+DK R+S+ +F CP EDAV+  P+ L+++E  SPAV
Sbjct  260   NIGDQMQVISNDKYKSVLHRAVVNSDKERISIPTFYCPSEDAVVGPPQELINEEDGSPAV  319

Query  949   YRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             Y+ FTY EYY KFW + L  E CL+ FK
Sbjct  320   YKSFTYAEYYDKFWDKALATETCLDLFK  347



>gb|KDP28403.1| hypothetical protein JCGZ_14174 [Jatropha curcas]
Length=345

 Score =   385 bits (988),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 185/328 (56%), Positives = 239/328 (73%), Gaps = 7/328 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCDD---VPVIDL---GCGDRSFIVRQIGDACRHYGFFQVI  1670
             +P  YIR   +RP L EV    D   +P+IDL      +RS +VR+IG AC+ YGFFQV 
Sbjct  18    VPPNYIRDLHDRPNLREVVETLDGSNIPLIDLQGLNGPNRSSLVREIGQACQDYGFFQVK  77

Query  1669  NHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLR  1490
             NHG+ K+VI++ML+VA EFF+L   E++K YSDDP KT RLSTSFNV+ E V +WRD+LR
Sbjct  78    NHGISKEVIDEMLRVATEFFHLPESERLKNYSDDPVKTTRLSTSFNVRTEKVSSWRDFLR  137

Query  1489  LHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQ  1310
             LHC+PL+ Y  EWP+NPP+ R+ V  Y    R++  K+ +AISESLGL+       LG+ 
Sbjct  138   LHCFPLEDYLQEWPTNPPSFRESVAEYCRNARELALKLLDAISESLGLERDYINKALGKH  197

Query  1309  GQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAF  1130
              QHMA+N+YPPCP+P+LTYGLPAH DPNA+TILLQD QV GLQVL++G W+AVKP PD F
Sbjct  198   AQHMAINYYPPCPQPDLTYGLPAHADPNAITILLQD-QVPGLQVLQNGHWVAVKPIPDTF  256

Query  1129  VINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAV  950
             ++NIGDQ+Q +SN +YKSV HRAIVN D  R+SV +F CP  DAV+     L+DD+ P +
Sbjct  257   IVNIGDQMQVISNNRYKSVLHRAIVNCDNERISVPTFYCPSPDAVMGPAPLLVDDDHPPL  316

Query  949   YRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             + +FTY EYY KFW+  L Q+ CL+ FK
Sbjct  317   HGNFTYNEYYHKFWNCGLTQKTCLDMFK  344



>ref|XP_009348690.1| PREDICTED: hyoscyamine 6-dioxygenase-like [Pyrus x bretschneideri]
Length=346

 Score =   384 bits (987),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 182/327 (56%), Positives = 237/327 (72%), Gaps = 6/327 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLS--EVTTCDDVPVIDLG---CGDRSFIVRQIGDACRHYGFFQVIN  1667
             +P  YIRP S+RP L+  +V+    +P+IDL        S I++QIG AC+  GFFQV  
Sbjct  19    IPSNYIRPISDRPNLTDFQVSDASSIPLIDLKDLHGPKHSDIIKQIGLACQTDGFFQVKT  78

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HGVP+ +I++ML +A EFF L   E++K+YSDDPSKT RLSTSFNV+ E + NWRD+LRL
Sbjct  79    HGVPEIMIKNMLNIAREFFQLPESERLKMYSDDPSKTTRLSTSFNVRTEKLSNWRDFLRL  138

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HCYPLQ Y  EWP NPP  R+ V  Y T VR    ++ EAISE LGL+       LG+QG
Sbjct  139   HCYPLQDYVQEWPKNPPLFREQVGEYCTNVRGWVLRLLEAISERLGLEKNSIVKALGKQG  198

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMA+N+YPPCP+PELTYGLP HTD N +T+LLQD +V GLQVL++GKW+AV P P+ F+
Sbjct  199   QHMALNYYPPCPQPELTYGLPGHTDANLITVLLQD-EVPGLQVLRNGKWIAVNPIPNTFI  257

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             +NIGD +Q +SN +YKSV HRA+VN++  R+S+ +F CP  DAVI   K L++ + PA+Y
Sbjct  258   VNIGDMMQVISNNRYKSVLHRAVVNSNSERISIPTFYCPSPDAVIGPAKELINYDHPAMY  317

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             R+FTY EYY KFW++ L  E CL+ FK
Sbjct  318   RNFTYAEYYEKFWNKGLATECCLDLFK  344



>ref|XP_004510617.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Cicer 
arietinum]
Length=345

 Score =   384 bits (987),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 177/328 (54%), Positives = 239/328 (73%), Gaps = 7/328 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLS-EVTTCDDVPVIDL-GCGD----RSFIVRQIGDACRHYGFFQVI  1670
             +P  +IRP  +RP L  + +T D +P+IDL G  D    R  I++ I  AC++YGFFQ++
Sbjct  18    VPSNFIRPIDDRPNLEFQSSTNDSIPIIDLHGLEDDDSNRCQIIQSIAQACQNYGFFQIV  77

Query  1669  NHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLR  1490
             NHGVP++V+++M+ V+ EFFNL   E+MK YSDDP KT RLSTSFN++ E + NWRD+LR
Sbjct  78    NHGVPEEVVDNMVNVSKEFFNLPESERMKNYSDDPLKTTRLSTSFNLRTENISNWRDFLR  137

Query  1489  LHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQ  1310
             LHC+PL+ Y  EWPSNPP+ R+ V  Y  E+R++  ++ EAISESLGL+       +G+ 
Sbjct  138   LHCHPLEDYVHEWPSNPPSFREDVAEYSKEMRKLALRLVEAISESLGLEKNYINKAIGKH  197

Query  1309  GQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAF  1130
             GQHMA+N+YPPCPEPELTYGLPAH DPN +TILLQ+  V GLQVLKD KW+ V P P+ F
Sbjct  198   GQHMAINYYPPCPEPELTYGLPAHADPNVITILLQN-DVPGLQVLKDAKWVTVSPVPNTF  256

Query  1129  VINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAV  950
             ++NIGDQ+Q +SN KYKSV HRA+VN++K RMS+ +F CP  DA++     L++ + PA 
Sbjct  257   IVNIGDQIQVISNDKYKSVLHRALVNSEKERMSIPTFYCPSPDAIMKPAPQLINSDHPAQ  316

Query  949   YRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             Y DFTY +YY  FW+  L+++ CL  F 
Sbjct  317   YIDFTYDDYYKTFWNGGLSKQTCLHMFN  344



>ref|XP_009360216.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2-like [Pyrus x bretschneideri]
Length=346

 Score =   383 bits (984),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 184/342 (54%), Positives = 246/342 (72%), Gaps = 8/342 (2%)
 Frame = -3

Query  1870  TTQLLFSG--TPYSTLPQKYIRPESERPKLSEVTTCD--DVPVIDLG---CGDRSFIVRQ  1712
             TT+LL +   +  + +P  YIRP S+RP L++V T D   +P+IDL        S I++Q
Sbjct  4     TTKLLLTDLMSGVNHVPSNYIRPFSDRPNLTDVQTSDASSIPLIDLKDLHGPKHSDIIKQ  63

Query  1711  IGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFN  1532
             IG AC+  GFF+V NHGV + ++++ML +A EFF L   E++K+YSDDPSKT RLSTSFN
Sbjct  64    IGLACQIDGFFRVKNHGVLETMVKNMLSIASEFFKLPESERLKMYSDDPSKTTRLSTSFN  123

Query  1531  VKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESL  1352
             V+ E + NWRD+LRLHC+PLQ Y  EWP+NPP  R+ V  Y T VR +  ++ E ISESL
Sbjct  124   VRTEKLSNWRDFLRLHCFPLQDYVQEWPNNPPLFREQVGEYCTSVRGLVLRLLEGISESL  183

Query  1351  GLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLK  1172
             GL+       LG+QGQHMA+N+YPPCP+PELTYGLP HTD N +TILLQD +V GLQVL+
Sbjct  184   GLEKNYIVKALGKQGQHMALNYYPPCPQPELTYGLPGHTDANLITILLQD-EVPGLQVLR  242

Query  1171  DGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVI  992
             +GKW+AV P P+ F++NIGD +Q +SNGKYKSV HRA+VN +  R+S+ +F CP  DA+I
Sbjct  243   NGKWVAVNPIPNTFIVNIGDMMQVISNGKYKSVLHRAVVNCNSERISIPTFYCPAPDAMI  302

Query  991   SAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
                K L++ +  A++R+FTY EY+  FW+R L  E CL+ FK
Sbjct  303   GPAKELINHDHLAMFRNFTYAEYFKNFWNRGLESECCLDLFK  344



>ref|XP_002872518.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48777.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=351

 Score =   384 bits (985),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 182/345 (53%), Positives = 241/345 (70%), Gaps = 9/345 (3%)
 Frame = -3

Query  1876  SMTTQLLFS--GTPYSTLPQKYIRPESERPKLSEVTT-CDDVPVIDLG---CGDRSFIVR  1715
             S T++LL S   +    +P  Y+RP S+RP +SEV T  D +P+IDL      +R+ I+ 
Sbjct  4     SATSKLLVSDIASVVDHVPSNYVRPVSDRPNMSEVETFGDSIPLIDLQDLHGPNRANIIN  63

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             Q   AC  YGFFQ+ NHGVP+++I+ M+ V  EFF+ S  E++K YS D  KT RLSTSF
Sbjct  64    QFAHACSSYGFFQIKNHGVPEEIIKQMMNVGREFFHQSESERVKHYSADTKKTTRLSTSF  123

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             NV KE V NWRD+LRLHCYP++ +  EWPS P + R+V   Y T VR +   + EAISES
Sbjct  124   NVSKEKVSNWRDFLRLHCYPIEDFIHEWPSTPVSFREVTAEYATSVRALVLTLLEAISES  183

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL      N LG+ GQHMA+N+YPPCP+PELTYGLP H D N +T+LLQD +V+GLQV 
Sbjct  184   LGLVKDRVSNTLGKHGQHMAINYYPPCPQPELTYGLPGHKDANLITVLLQD-EVSGLQVF  242

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             +DGKW+AV P P+ F++N+GDQ+Q +SN KYKSV HRA+VN DK R+S+ +F CP EDA+
Sbjct  243   EDGKWIAVNPIPNTFIVNLGDQMQVISNDKYKSVLHRAVVNIDKERISIPTFYCPSEDAM  302

Query  994   ISAPKPLLDDE--SPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             I   + L+++E  S A+YR+FTY EY+ KFW      E C++ FK
Sbjct  303   IGPAQELINEEEDSHAIYRNFTYAEYFEKFWDTAFATESCIDSFK  347



>ref|XP_010042284.1| PREDICTED: 2'-deoxymugineic-acid 2'-dioxygenase-like, partial 
[Eucalyptus grandis]
Length=361

 Score =   384 bits (986),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 180/327 (55%), Positives = 241/327 (74%), Gaps = 6/327 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCDD--VPVIDL---GCGDRSFIVRQIGDACRHYGFFQVIN  1667
             +P  YIR E++RP L+EV   D   +P++DL      +R  I+RQIG AC+  GFFQ+ N
Sbjct  32    VPDNYIRSEADRPNLTEVEASDASYIPLVDLQGLSGPNRDDIIRQIGRACQQDGFFQIKN  91

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HG+P++ ++ ++ +A EFF+L   E++K YSDDP+K+ RLSTSFN+K E V NWRD+LRL
Sbjct  92    HGIPEEKVQAIMNIAREFFHLPESERLKNYSDDPTKSTRLSTSFNLKTEKVSNWRDFLRL  151

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HCYPL++Y  EWP+NPP+ R  V  Y T VR++ FK+ EAISESLGL+ +     LGE G
Sbjct  152   HCYPLEEYMHEWPTNPPSFRKEVGEYCTRVRELVFKLLEAISESLGLEREYISQNLGEHG  211

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMA+N+YPPCP+PELTYGLP+HTDPN +TILLQD  V GLQVL++GKW+AV P P+ F+
Sbjct  212   QHMAMNYYPPCPQPELTYGLPSHTDPNLITILLQD-DVPGLQVLRNGKWVAVNPIPNTFI  270

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             +NIGDQ+Q +SN KYKSV HRA+VN +  R+S+ +F CP  + +I   + L+D E P VY
Sbjct  271   VNIGDQMQVISNDKYKSVLHRAVVNRNTERISIPTFCCPSPEGLIQPAQGLIDHEHPPVY  330

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             R FT+ E+Y KF+ R L  E CL+ FK
Sbjct  331   RSFTWEEFYQKFYHRGLRTECCLDMFK  357



>ref|XP_004308273.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Fragaria 
vesca subsp. vesca]
Length=345

 Score =   383 bits (983),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 183/343 (53%), Positives = 244/343 (71%), Gaps = 9/343 (3%)
 Frame = -3

Query  1876  SMTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCD-DVPVIDLGCGD---RSFIVRQI  1709
             ++T+ L++  T    +P +Y+RPE +RP L +V   D  +P+IDL   D    S I++QI
Sbjct  7     ALTSDLVYGAT---HVPSQYVRPEHDRPNLGQVIQSDISIPLIDLQGFDGSRHSEIIKQI  63

Query  1708  GDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNV  1529
             G AC+  GFFQV NHG+ + VI++ML VA EFF+L   E+MK+YS+DP +T+RLSTSFNV
Sbjct  64    GLACQESGFFQVKNHGIDEAVIDNMLAVAKEFFHLPESERMKVYSEDPYRTIRLSTSFNV  123

Query  1528  KKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLG  1349
             + E + +WRDYLRLHC+PL+ Y  EWP+NPP+ R+ V  Y  EVR +  ++   ISESLG
Sbjct  124   RAEEIASWRDYLRLHCHPLEDYIHEWPANPPSFREDVGEYCKEVRGLAVRLLHGISESLG  183

Query  1348  LDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKD  1169
             L+       L + GQHMA+N+YPPCP+PELTYGLP H DPN +T+LLQD  V GLQVLK 
Sbjct  184   LEEHYINKALAKHGQHMAINYYPPCPQPELTYGLPGHADPNVVTLLLQD-DVEGLQVLKG  242

Query  1168  GKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVIS  989
             GKW+AVKP P  F++N+GDQ+Q +SN +YKSV HRA+VN++K R+S+ +F CP  DAVI 
Sbjct  243   GKWVAVKPIPHTFIVNLGDQIQVISNDRYKSVLHRAVVNSNKERISIPTFYCPSYDAVIE  302

Query  988   APKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEH-CLEHFKN  863
                 L+DD+ PAVYR FTY E+Y  FW +  N+   CL  FKN
Sbjct  303   PAPKLVDDDHPAVYRSFTYGEFYGNFWDKGPNKNGTCLGIFKN  345



>ref|XP_010437070.1| PREDICTED: hyoscyamine 6-dioxygenase-like [Camelina sativa]
Length=351

 Score =   383 bits (983),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 186/345 (54%), Positives = 237/345 (69%), Gaps = 9/345 (3%)
 Frame = -3

Query  1876  SMTTQLLFS--GTPYSTLPQKYIRPESERPKLSEVTTC-DDVPVIDLG---CGDRSFIVR  1715
             S TT+LL S   +    +P  Y+RP S+RP +S V T  D +P+IDL      +R+ I+ 
Sbjct  4     SATTKLLVSDIASVVDHVPSNYVRPISDRPNMSNVATSGDSIPLIDLKDLHGPNRANIIN  63

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             Q   AC  YGFFQ+ NHGVP++ I+ M+ VA EFF     E++K YS D  KT RLSTSF
Sbjct  64    QFAYACSSYGFFQIKNHGVPEETIKKMMNVAREFFRQPESERVKHYSADTKKTTRLSTSF  123

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             NV  E V NWRD+LRLHCYP++ +  EWPS P + R+V   Y T VR +   + EAISES
Sbjct  124   NVCTEKVSNWRDFLRLHCYPIEDFINEWPSTPISFREVTAEYATSVRALVLTLLEAISES  183

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL      N LG+ GQHMA+N+YPPCPEPELTYGLP H D N +T+LLQD +V GLQV 
Sbjct  184   LGLVKDRVSNTLGKHGQHMAINYYPPCPEPELTYGLPGHKDANLITVLLQD-EVPGLQVY  242

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             KDGKW+AV P P+ F++N+GDQ+Q +SN KYKSV HRA+VN+DK R+S+ +F CP EDAV
Sbjct  243   KDGKWVAVHPVPNTFIVNLGDQMQVISNDKYKSVLHRAVVNSDKERISIPTFYCPSEDAV  302

Query  994   ISAPKPLLDDE--SPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             IS  + L+ +E  SPA+YR FTY EY+ KFW      E C++ FK
Sbjct  303   ISPAQELISEEEDSPAIYRSFTYAEYFEKFWETGFATESCIDSFK  347



>ref|XP_009335249.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Pyrus 
x bretschneideri]
Length=345

 Score =   382 bits (981),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 189/342 (55%), Positives = 239/342 (70%), Gaps = 9/342 (3%)
 Frame = -3

Query  1873  MTTQL--LFSGTPYSTLPQKYIRPESERPKLSEVTTCD-DVPVIDL-GCGD--RSFIVRQ  1712
             M T L  L SG  +  +P  Y+RP  +RP L  V + D  +P+I+L G  D  RS I++Q
Sbjct  1     MATLLSDLVSGATH--VPSNYVRPAHDRPNLDRVQSSDHSIPLINLQGLEDPRRSDIIKQ  58

Query  1711  IGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFN  1532
             IG AC+ YGFFQV NHG+ + VI++ML V+ EFF+L   E++K +SDDP KT RLSTSFN
Sbjct  59    IGLACQDYGFFQVQNHGIEEAVIDNMLSVSKEFFHLPESERLKSFSDDPLKTTRLSTSFN  118

Query  1531  VKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESL  1352
             VK E V +WRDYLRLHCYPL+ Y  EWPSNPP+ R+ V  Y   VR +  ++ E ISESL
Sbjct  119   VKTEEVSSWRDYLRLHCYPLEDYMHEWPSNPPSFREDVAEYCRNVRGLAVRLLEYISESL  178

Query  1351  GLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLK  1172
             GL+       LG+ GQHMA+N+YP CP+PELTYGLP H DPN +T+LLQD  VAGLQVL 
Sbjct  179   GLEEDYMNKALGKHGQHMAINYYPTCPQPELTYGLPGHADPNVITVLLQD-DVAGLQVLN  237

Query  1171  DGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVI  992
             +GKW+AVKP P  F++NI DQ+Q LSN +YKSV HRA+VN +K R+S+ +F CP  DAV+
Sbjct  238   NGKWVAVKPIPHTFIVNIADQIQVLSNDRYKSVLHRAVVNCNKERISIPTFYCPSYDAVM  297

Query  991   SAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
                  L+DD  P +YR FTY E+Y KFW R LN    L+ FK
Sbjct  298   EPAPQLIDDHHPPLYRSFTYAEFYEKFWDRGLNTRSSLDLFK  339



>ref|XP_003581564.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Brachypodium 
distachyon]
Length=348

 Score =   382 bits (980),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 181/329 (55%), Positives = 231/329 (70%), Gaps = 6/329 (2%)
 Frame = -3

Query  1837  STLPQKYIRPESERPKLSEV--TTCDDVPVIDLGCGD---RSFIVRQIGDACRHYGFFQV  1673
              T+P  +IRP  +RP L++V   +   +P+IDL   D   R  +V  IG AC   GFF V
Sbjct  18    GTVPSSHIRPVGDRPDLADVDHESGAGIPLIDLKHLDGPERRRVVEAIGSACETDGFFMV  77

Query  1672  INHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYL  1493
              NHG+P+ V+E ML+VA EFF+L   E++K YSDDP K +RLSTSFNV+ E V NWRD+L
Sbjct  78    TNHGIPEAVVEGMLRVAKEFFHLPESERLKCYSDDPKKAIRLSTSFNVRTEKVSNWRDFL  137

Query  1492  RLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGE  1313
             RLHCYPLQ +  +WPSNPP  R+VV  Y TE R +  ++ EAISESLGL+ +     +G 
Sbjct  138   RLHCYPLQSFIDQWPSNPPAFREVVGAYSTEARALALRLLEAISESLGLERRHMVTAMGG  197

Query  1312  QGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDA  1133
               QHMAVN+YPPCP+PELTYGLP H DPNA+T+LLQD  V+GLQV + G+W+AV P P+A
Sbjct  198   HAQHMAVNYYPPCPQPELTYGLPGHKDPNAVTLLLQD-GVSGLQVQRGGRWVAVNPVPNA  256

Query  1132  FVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPA  953
              VINIGDQLQALSN +YKSV HR IVN++  R+SV +F CP  DAV++  + L+D   P 
Sbjct  257   LVINIGDQLQALSNDRYKSVLHRVIVNSESERISVPTFYCPSPDAVVAPAEALVDGSHPL  316

Query  952   VYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
              YR FTY EYY +FW+  L    CL+ F+
Sbjct  317   AYRPFTYQEYYEEFWNMGLESASCLDRFR  345



>ref|NP_192787.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 gb|AAD03424.1| contains similarity to Iron/Ascorbate family of oxidoreductases 
(Pfam: PF00671, Score=307.1, E=2.2e-88, N=1) [Arabidopsis 
thaliana]
 emb|CAB40042.1| putative flavanone 3-beta-hydroxylase [Arabidopsis thaliana]
 emb|CAB78172.1| putative flavanone 3-beta-hydroxylase [Arabidopsis thaliana]
 gb|AAO41989.1| putative flavanone 3-beta-hydroxylase [Arabidopsis thaliana]
 gb|AAO50563.1| putative flavanone 3-beta-hydroxylase [Arabidopsis thaliana]
 gb|AEE82890.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=348

 Score =   382 bits (980),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 178/328 (54%), Positives = 234/328 (71%), Gaps = 7/328 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEV-TTCDDVPVIDLG---CGDRSFIVRQIGDACRHYGFFQVINH  1664
             +P  Y+RP S+RPK+SEV T+ D +P+IDL      +R+ I+ Q   AC   GFFQ+ NH
Sbjct  18    VPSNYVRPVSDRPKMSEVQTSGDSIPLIDLHDLHGPNRADIINQFAHACSSCGFFQIKNH  77

Query  1663  GVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLH  1484
             GVP++ I+ M+  A EFF  S  E++K YS D  KT RLSTSFNV KE V NWRD+LRLH
Sbjct  78    GVPEETIKKMMNAAREFFRQSESERVKHYSADTKKTTRLSTSFNVSKEKVSNWRDFLRLH  137

Query  1483  CYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQ  1304
             CYP++ +  EWPS P + R+V   Y T VR +   + EAISESLGL      N +G+ GQ
Sbjct  138   CYPIEDFINEWPSTPISFREVTAEYATSVRALVLTLLEAISESLGLAKDRVSNTIGKHGQ  197

Query  1303  HMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVI  1124
             HMA+N+YP CP+PELTYGLP H D N +T+LLQD +V+GLQV KDGKW+AV P P+ F++
Sbjct  198   HMAINYYPRCPQPELTYGLPGHKDANLITVLLQD-EVSGLQVFKDGKWIAVNPVPNTFIV  256

Query  1123  NIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDE--SPAV  950
             N+GDQ+Q +SN KYKSV HRA+VN+D  R+S+ +F CP EDAVIS  + L+++E  SPA+
Sbjct  257   NLGDQMQVISNEKYKSVLHRAVVNSDMERISIPTFYCPSEDAVISPAQELINEEEDSPAI  316

Query  949   YRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             YR+FTY EY+ KFW    + E C++ FK
Sbjct  317   YRNFTYAEYFEKFWDTAFDTESCIDSFK  344



>ref|XP_002278024.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase [Vitis vinifera]
Length=348

 Score =   381 bits (979),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 183/342 (54%), Positives = 245/342 (72%), Gaps = 9/342 (3%)
 Frame = -3

Query  1870  TTQLLFSGTPYST--LPQKYIRPESERPKLSEVTTCD-DVPVIDL----GCGDRSFIVRQ  1712
             TT+LL +        +P  Y+RP SERP   +V   D  +P+IDL    G G R  +V+Q
Sbjct  5     TTKLLLTDMVLGVDHVPSNYVRPPSERPNFKDVQASDVSIPLIDLQDLQGPG-RPDVVKQ  63

Query  1711  IGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFN  1532
             IG AC+H GFFQ+ NHGV + +I ++L++A +FF L   E++K YSD+PS  +RLSTSFN
Sbjct  64    IGQACQHSGFFQIQNHGVSETMISNILRLARDFFQLPESERLKNYSDNPSNPVRLSTSFN  123

Query  1531  VKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESL  1352
             VK E V NWRD+LRLHCYPL+ Y  +WPSNPP+ R+ V  Y T +R +  ++ E ISESL
Sbjct  124   VKTEKVANWRDFLRLHCYPLEDYVHQWPSNPPSFREDVAEYCTSIRALVLRLLETISESL  183

Query  1351  GLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLK  1172
             GL+      VLG+ GQHMA+N+YPPCP+PELTYGLP HTD + +T+LLQD  V GLQVL+
Sbjct  184   GLEKNYVSGVLGKHGQHMAMNYYPPCPQPELTYGLPGHTDCSLITVLLQD-DVPGLQVLR  242

Query  1171  DGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVI  992
             +GKW++V P P++F++NIGD +Q +SN +YKSV HRA+VN +K R+S+ +F CP  DAVI
Sbjct  243   NGKWVSVNPIPNSFIVNIGDHMQVISNDRYKSVLHRAVVNCNKDRISIPTFYCPSPDAVI  302

Query  991   SAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
                  L+DD+ PAVYR+FT  EYY++FW+R L  E CL+ FK
Sbjct  303   GPSPELVDDDHPAVYRNFTCEEYYTQFWNRGLATESCLDTFK  344



>ref|XP_002267625.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 5 [Vitis 
vinifera]
 emb|CBI38725.3| unnamed protein product [Vitis vinifera]
Length=344

 Score =   381 bits (978),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 238/343 (69%), Gaps = 8/343 (2%)
 Frame = -3

Query  1870  TTQLLFS--GTPYSTLPQKYIRPESERPKLSEVTTCDD--VPVIDLG---CGDRSFIVRQ  1712
               +LL S   +    +P +Y+RP ++RP L EV +  D  +P+IDL       RS +++Q
Sbjct  3     NAKLLLSDLASSIDCVPSRYVRPVNDRPNLDEVQSSLDGSIPLIDLQDLHGPSRSHVIKQ  62

Query  1711  IGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFN  1532
             I +AC+  GFF+V NHG+P+ VI  ML +  EFF+L   E++K YSDDP KTMRLSTSFN
Sbjct  63    IAEACQIDGFFRVKNHGIPESVIHGMLSITKEFFHLPESERLKNYSDDPLKTMRLSTSFN  122

Query  1531  VKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESL  1352
             VK E V NWRD+LRL+CYPL+ Y  EWPSNPP+ R+VV  Y  E R++   + EAISESL
Sbjct  123   VKTEQVSNWRDFLRLYCYPLEDYIQEWPSNPPSFREVVAEYCKEARKLALLLLEAISESL  182

Query  1351  GLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLK  1172
             GL+       LG+  Q MA+N+YPPCP+PELT+GLP H DPNALTILLQD  V GLQVLK
Sbjct  183   GLERNHIDKALGKHSQQMALNYYPPCPQPELTFGLPGHADPNALTILLQD-DVPGLQVLK  241

Query  1171  DGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVI  992
             DGKW+A+ P P+ F++NIGDQ+Q LSN  YKS  HRA+VN  K R+S+ +F CP  DAVI
Sbjct  242   DGKWVAIHPIPNTFIVNIGDQIQVLSNDCYKSAVHRAVVNCQKERISIPTFYCPSPDAVI  301

Query  991   SAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
                  L+D   PA+YR FTY EY+ KFW+R L  + CL+ FK 
Sbjct  302   GPAPGLVDHGHPALYRKFTYSEYFGKFWNRGLATQSCLDMFKT  344



>ref|XP_002320903.2| hypothetical protein POPTR_0014s10230g [Populus trichocarpa]
 gb|EEE99218.2| hypothetical protein POPTR_0014s10230g [Populus trichocarpa]
Length=347

 Score =   381 bits (978),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 185/332 (56%), Positives = 236/332 (71%), Gaps = 8/332 (2%)
 Frame = -3

Query  1837  STLPQKYIRPESERPKLSEVTTCD-DVPVIDLGC---GDRSFIVRQIGDACRHY---GFF  1679
             S +P  YIRP S RPK SEV + D  +P+IDL      +RS IV +IG AC+ +    + 
Sbjct  17    SYVPSNYIRPVSARPKFSEVLSSDGSIPLIDLQGLEGPNRSSIVGEIGQACQTHDIVNYI  76

Query  1678  QVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRD  1499
              V NHG+P KVI+  L+V+ EFF+L+  E++K YSDDP+KT RLSTSFNVK ETV +WRD
Sbjct  77    MVKNHGIPNKVIDGTLRVSKEFFHLTERERLKNYSDDPTKTTRLSTSFNVKTETVSSWRD  136

Query  1498  YLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVL  1319
             +LRLHCYPL+ Y  EWPSNPP+ R+ V  Y    R++  ++ EAISESL L+       L
Sbjct  137   FLRLHCYPLEDYIHEWPSNPPSFREDVAEYCRNARELSLRLLEAISESLCLETDYISKAL  196

Query  1318  GEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRP  1139
                GQHMAVN+YPPCP+PELTYGLPAH DPNA+TILLQD  V GLQVL++ KW+A+ P P
Sbjct  197   SNHGQHMAVNYYPPCPQPELTYGLPAHADPNAITILLQD-DVPGLQVLQNDKWVAINPIP  255

Query  1138  DAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDES  959
               F++NIGDQ+Q +SN +Y+SV HRA+V+ DK R+S+ +F CP  DAVI     L+DD+ 
Sbjct  256   YTFIVNIGDQIQVISNDRYRSVLHRAVVDRDKERISIPTFYCPSHDAVIGPAPSLIDDDH  315

Query  958   PAVYRDFTYPEYYSKFWSRNLNQEHCLEHFKN  863
             PA+YR+F Y EYY KFW+  L  E CL  FKN
Sbjct  316   PALYRNFAYSEYYQKFWNHGLATETCLGMFKN  347



>ref|XP_009113617.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Brassica 
rapa]
Length=378

 Score =   382 bits (981),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 183/345 (53%), Positives = 240/345 (70%), Gaps = 9/345 (3%)
 Frame = -3

Query  1876  SMTTQLLFSGTPYST--LPQKYIRPESERPKLSEV-TTCDDVPVIDLG---CGDRSFIVR  1715
             S T++LL S    S   +P  Y+RP S+RP LSE+ T+ D +P+IDL      +R+ ++ 
Sbjct  31    SATSKLLVSDIASSVDHVPSNYVRPISDRPNLSEIETSGDSIPMIDLQELHGPNRADVIY  90

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             Q+  AC  YGFFQ+ NHGVP+K IE M+ VA EFF     E++K YS D  KT RLSTSF
Sbjct  91    QVAHACASYGFFQIKNHGVPEKTIERMMTVAREFFRQPESERVKHYSADTKKTTRLSTSF  150

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             NV  E   NWRD+LRLHC P++ +  EWPS+P + R+V   Y T VR +   + EAISES
Sbjct  151   NVGSEKFSNWRDFLRLHCLPIEDFISEWPSSPVSFREVTAEYATSVRALVLVLLEAISES  210

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL      N LG+ GQHMA+N+YPPCP+P+LT+GLP H DPN +T+LLQD +V+GLQV 
Sbjct  211   LGLAKDSVSNTLGKHGQHMALNYYPPCPQPDLTFGLPGHKDPNLITVLLQD-EVSGLQVF  269

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             KDG W+AV P P+ F++N+GDQ+Q +SN KYKSV HRA+VN+DK R+S+ +F CP  DAV
Sbjct  270   KDGNWIAVHPVPNTFIVNMGDQMQVISNDKYKSVLHRAVVNSDKERISIPTFYCPSLDAV  329

Query  994   ISAPKPLL--DDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             +   + L+  ++ESPAVYR F Y EYY KFW R L  E C++ FK
Sbjct  330   VGPQQELINEEEESPAVYRSFIYAEYYEKFWDRALATESCIDLFK  374



>tpg|DAA36335.1| TPA: hypothetical protein ZEAMMB73_926701 [Zea mays]
Length=351

 Score =   381 bits (978),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 180/327 (55%), Positives = 227/327 (69%), Gaps = 6/327 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEV--TTCDDVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVIN  1667
             +P  +IRP  +RP L+ V   +   +P+IDL      +R  +V  IG AC   GFF V N
Sbjct  20    VPSSHIRPVGDRPDLANVDNESGAGIPLIDLKKLNGPERRKVVEAIGKACESDGFFMVTN  79

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HG+P  V+E ML+VA EFF+L   E++K YSDDP+K +RLSTSFNV+ E V NWRD+LRL
Sbjct  80    HGIPAAVVEGMLRVAREFFHLPESERLKCYSDDPNKAIRLSTSFNVRTEKVSNWRDFLRL  139

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HCYPLQ +  +WPSNPP+ R VV  Y TE R +  ++ EAISESLGL+       +G   
Sbjct  140   HCYPLQSFVDQWPSNPPSFRQVVGTYATEARALALRLLEAISESLGLERSHMVAAMGRHA  199

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMAVN+YPPCP+PELTYGLP H DPNA+T+LLQD  V+GLQV + G+W+AV P P+A V
Sbjct  200   QHMAVNYYPPCPQPELTYGLPGHKDPNAITLLLQD-GVSGLQVQRGGRWVAVNPVPNALV  258

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             INIGDQ+QALSN +YKSV HR IVN++  R+SV +F CP  DAVI+    L+DD  P  Y
Sbjct  259   INIGDQMQALSNDRYKSVLHRVIVNSESERISVPTFYCPSPDAVIAPADALVDDGHPLAY  318

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             R FTY EYY  FW+  L    CL+ F+
Sbjct  319   RPFTYQEYYDAFWNMGLQSASCLDRFR  345



>ref|XP_010919037.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Elaeis 
guineensis]
Length=345

 Score =   380 bits (976),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/340 (54%), Positives = 236/340 (69%), Gaps = 7/340 (2%)
 Frame = -3

Query  1867  TQLLFS---GTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDL---GCGDRSFIVRQIG  1706
             T+LL +    +  + +P  YIRP S+RP L  V +   + +IDL      +RS +V++IG
Sbjct  6     TKLLLTDLVSSHVNQVPYNYIRPLSDRPDLLNVESNATIALIDLQGLTGANRSQVVKEIG  65

Query  1705  DACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVK  1526
              AC++ GFFQV NHG+PK V++ ML+VA EFF+L   E++K YS DP KT RLSTSFNVK
Sbjct  66    LACQNDGFFQVKNHGIPKDVVDGMLRVAKEFFHLPESERLKTYSQDPRKTTRLSTSFNVK  125

Query  1525  KETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGL  1346
              E V NWRDYLRLHCYPL+ +  EWPSNPP  R VV  Y    R++  ++ EAISESLGL
Sbjct  126   TEKVSNWRDYLRLHCYPLENFVHEWPSNPPCFRQVVGEYCKNTRELALRLLEAISESLGL  185

Query  1345  DPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDG  1166
             +    +  LG+Q QHMA+N+YPPCP+PELTYGLP H DPNA+TILLQD  V+GLQV ++G
Sbjct  186   ESDYMEKALGKQAQHMAINYYPPCPQPELTYGLPGHKDPNAITILLQD-GVSGLQVFRNG  244

Query  1165  KWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISA  986
             KW+AV P PD  VINIGD +Q LSN ++ SV HRAIVN    R+SV +F CP  DA+I  
Sbjct  245   KWVAVNPIPDTLVINIGDMMQVLSNDRFNSVLHRAIVNGTSERISVPTFYCPSPDALIKP  304

Query  985   PKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
              + + D+E P +YR FTY +YY  FW + L    CL+ FK
Sbjct  305   AEAIADEEHPPMYRSFTYEDYYVNFWDQGLQFASCLDVFK  344



>ref|XP_002448382.1| hypothetical protein SORBIDRAFT_06g026350 [Sorghum bicolor]
 gb|EES12710.1| hypothetical protein SORBIDRAFT_06g026350 [Sorghum bicolor]
Length=351

 Score =   380 bits (975),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 179/327 (55%), Positives = 227/327 (69%), Gaps = 6/327 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEV--TTCDDVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVIN  1667
             +P  +IRP  +RP L+ V   +   +P+IDL      +R  +V  IG AC   GFF V N
Sbjct  20    VPSSHIRPVGDRPDLANVDNESGAGIPLIDLKMLNGPERRKVVEAIGRACESDGFFMVTN  79

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HG+P  V+E ML+VA EFF+L   E++K YSDDP K +RLSTSFNV+ E V+NWRD+LRL
Sbjct  80    HGIPAAVVEGMLRVAREFFHLPESERLKCYSDDPKKAIRLSTSFNVRTEKVNNWRDFLRL  139

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HCYPL+ +  +WPSNPP+ R VV  Y TE R +  ++ EAISESLGL+       +G   
Sbjct  140   HCYPLESFVDQWPSNPPSFRQVVGTYATEARALALRLLEAISESLGLERSHMVRAMGRHA  199

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMAVN+YPPCP+PELTYGLP H DPNA+T+LLQD  V+GLQV + G+W+AV P PDA V
Sbjct  200   QHMAVNYYPPCPQPELTYGLPGHKDPNAITLLLQD-GVSGLQVQRGGRWVAVNPVPDALV  258

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             INIGDQ+QALSN +YKSV HR IVN++  R+SV +F CP  D VI+    L+DD  P  Y
Sbjct  259   INIGDQMQALSNDRYKSVLHRVIVNSESERISVPTFYCPSPDGVIAPADALVDDAHPLAY  318

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             R FTY EYY +FW+  L    CL+ F+
Sbjct  319   RPFTYQEYYDEFWNMGLQSASCLDRFR  345



>ref|XP_002515091.1| 1-aminocyclopropane-1-carboxylate oxidase, putative [Ricinus 
communis]
 gb|EEF47075.1| 1-aminocyclopropane-1-carboxylate oxidase, putative [Ricinus 
communis]
Length=344

 Score =   379 bits (974),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 180/329 (55%), Positives = 231/329 (70%), Gaps = 6/329 (2%)
 Frame = -3

Query  1837  STLPQKYIRPESERPKLSEVTTCDD--VPVIDLGCGD---RSFIVRQIGDACRHYGFFQV  1673
             +++P  +IRP S+RP  +EV    D  +P+IDL   D   RS +V++IG AC+ YGFFQV
Sbjct  16    TSVPSNFIRPLSDRPNFNEVIQTSDCSIPLIDLQGLDGPLRSTLVKEIGQACQGYGFFQV  75

Query  1672  INHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYL  1493
              NHG+P+ VI+ ML V+ EFF+L   E+MK YSDDP    RLSTSFNV+ E   NWRD+L
Sbjct  76    KNHGIPEDVIDKMLSVSREFFHLPESERMKNYSDDPMMRTRLSTSFNVRTEKTSNWRDFL  135

Query  1492  RLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGE  1313
             RLHCYPL  Y  EWP+NPP+ R+ V  Y   VR +  ++ EAISESLGL+       L +
Sbjct  136   RLHCYPLDDYMQEWPTNPPSFREDVGEYCRNVRDLAVRLLEAISESLGLERDYINKALDK  195

Query  1312  QGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDA  1133
               QH+AVN+YP CP+PELTYGLP H DPN +TILLQD  V GLQVLKDGKW+AV P P  
Sbjct  196   HAQHLAVNYYPSCPQPELTYGLPVHADPNVITILLQD-DVPGLQVLKDGKWVAVSPVPHT  254

Query  1132  FVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPA  953
             F++NIGDQ+Q +SN +YKSV HRA+VN++K R+S+ +F CP  DA I    PL+D+  P 
Sbjct  255   FIVNIGDQIQVISNDRYKSVLHRAVVNSNKERISIPTFYCPSPDAAIGPAPPLVDNHHPL  314

Query  952   VYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             +Y +FTY +YY KFW+R L    CL+ FK
Sbjct  315   LYTNFTYSQYYHKFWNRGLATHTCLDMFK  343



>ref|XP_010934019.1| PREDICTED: LOW QUALITY PROTEIN: naringenin,2-oxoglutarate 3-dioxygenase-like 
[Elaeis guineensis]
Length=350

 Score =   380 bits (975),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 185/326 (57%), Positives = 230/326 (71%), Gaps = 5/326 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCDD-VPVIDL---GCGDRSFIVRQIGDACRHYGFFQVINH  1664
             +P KYIRPES+RP    V   +  +PVIDL      +R  +V +IG AC++ GFFQV NH
Sbjct  25    VPSKYIRPESDRPDQFNVEKSNAAIPVIDLQGLAGANRPQVVEEIGLACQNDGFFQVKNH  84

Query  1663  GVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLH  1484
             G+P  VIE ML VA EFF+L   E++K YSDDP KT RLSTSFNVK E V NWRDYLRLH
Sbjct  85    GIPMDVIEGMLHVAKEFFHLPESERLKSYSDDPKKTTRLSTSFNVKTEKVSNWRDYLRLH  144

Query  1483  CYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQ  1304
             CYPL+ +A EWPSNP   R VV  Y   VR++  K+ EAISESLGL+       LG+Q Q
Sbjct  145   CYPLENFADEWPSNPVYFRQVVGEYCKNVRELALKLLEAISESLGLERDYMVKALGKQAQ  204

Query  1303  HMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVI  1124
             HMA+N+YPPCP+PELTYGLP H DPNA+TILLQD  V+GLQVL++GKW+AV P P   VI
Sbjct  205   HMAINYYPPCPQPELTYGLPGHKDPNAITILLQD-GVSGLQVLRNGKWVAVDPVPATLVI  263

Query  1123  NIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYR  944
             NIGD +Q LSN ++KSV HR +VN    R+SV +F CP  +A+I   + ++D+E P++YR
Sbjct  264   NIGDMIQVLSNDRFKSVLHRVVVNNTSERISVPTFYCPSPNALIKQAEAVVDEEHPSIYR  323

Query  943   DFTYPEYYSKFWSRNLNQEHCLEHFK  866
              FTY +YY  FW + L    CL+ FK
Sbjct  324   SFTYEDYYVNFWDQGLQFASCLDVFK  349



>ref|XP_007135331.1| hypothetical protein PHAVU_010G120300g [Phaseolus vulgaris]
 gb|ESW07325.1| hypothetical protein PHAVU_010G120300g [Phaseolus vulgaris]
Length=353

 Score =   379 bits (974),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/326 (55%), Positives = 236/326 (72%), Gaps = 5/326 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTT-CDDVPVIDLGCGD---RSFIVRQIGDACRHYGFFQVINH  1664
             +P  +IRP S+RP L ++ +    +P+IDL   D   R  I++ I  AC+HYGFFQ++NH
Sbjct  28    VPSNFIRPLSDRPNLHQLHSFSASIPIIDLHDFDGPNRPKIIQNIAHACQHYGFFQIVNH  87

Query  1663  GVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLH  1484
             G+P++++  M+ V+ EFF L   E++K YSDDP KT RLSTSFNVK E V NWRD+LRLH
Sbjct  88    GIPEELVSKMVNVSKEFFGLPESERLKNYSDDPCKTTRLSTSFNVKTEKVSNWRDFLRLH  147

Query  1483  CYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQ  1304
             C+PL+ Y  EWP+NPP+ R+ V  Y  ++R +  K+ E ISESLGL+    +  LG+ GQ
Sbjct  148   CHPLEDYILEWPANPPSFREDVAEYSRKMRGLSVKLLEGISESLGLERDYIEKALGKHGQ  207

Query  1303  HMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVI  1124
             HMA+N+YPPCPEPELTYGLP H DPNA+TILLQ+  V GLQVL DG WL+V P P+ F++
Sbjct  208   HMAMNYYPPCPEPELTYGLPPHADPNAITILLQN-DVPGLQVLYDGHWLSVNPVPNTFIV  266

Query  1123  NIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYR  944
             NIGDQ+Q +SN +YKSV HRA+VN +K RMS+ +F CP  DA I     L+DD+ P  Y+
Sbjct  267   NIGDQIQVISNDRYKSVLHRALVNCEKERMSIPTFYCPSPDATIKPAPQLVDDDHPVQYK  326

Query  943   DFTYPEYYSKFWSRNLNQEHCLEHFK  866
              FTY EYY KFW+R L++E C++ FK
Sbjct  327   SFTYREYYDKFWNRGLSKETCVDMFK  352



>ref|XP_010538868.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Tarenaya 
hassleriana]
Length=342

 Score =   378 bits (970),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 174/326 (53%), Positives = 234/326 (72%), Gaps = 5/326 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEV-TTCDDVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVINH  1664
             +P+K++RP S+RP LSE   + D +P+IDL       R+ +V Q+  AC  YGFFQ+ NH
Sbjct  14    VPEKFVRPISDRPTLSEADNSGDSIPLIDLRELHGSRRTDVVLQLAHACHSYGFFQIKNH  73

Query  1663  GVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLH  1484
             GVP+  + +ML VA EFF     E+++ Y+ D +KT RLSTSFNV  E V NWRD+LRLH
Sbjct  74    GVPETTVSNMLTVAREFFRQPESERLRHYTADTTKTTRLSTSFNVNSEKVSNWRDFLRLH  133

Query  1483  CYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQ  1304
             C+PL+++  EWPS+PP+ RD V  Y T VR++   + EAISESLGL     +  LG  GQ
Sbjct  134   CHPLEEFRHEWPSSPPSFRDTVAEYSTAVRKLVLDLLEAISESLGLSSDGVEKKLGGHGQ  193

Query  1303  HMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVI  1124
             HMA+N+YPPCP+PELT+GLP HTDPN +T+LLQD  V+GLQV ++GKW++V P P+ F++
Sbjct  194   HMAINYYPPCPQPELTFGLPGHTDPNLITVLLQD-DVSGLQVFRNGKWVSVHPVPNTFIV  252

Query  1123  NIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYR  944
             NIGDQ+Q +SN KYKSV HRA+VN++K R+S+ +F CP  DAV+     L+ D SP+VYR
Sbjct  253   NIGDQMQVISNDKYKSVLHRAVVNSEKERISIPTFYCPSPDAVVGPADELITDLSPSVYR  312

Query  943   DFTYPEYYSKFWSRNLNQEHCLEHFK  866
              F+Y EYY +FW+R L    CL+ FK
Sbjct  313   SFSYSEYYDRFWNRGLANVTCLDLFK  338



>ref|XP_008244203.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Prunus 
mume]
Length=343

 Score =   377 bits (969),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 183/340 (54%), Positives = 237/340 (70%), Gaps = 6/340 (2%)
 Frame = -3

Query  1873  MTTQLLFS-GTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGD---RSFIVRQIG  1706
             M  +LL    +  + +P  Y+RP  +RP L  +     +P+I+L C D   R  I+ QIG
Sbjct  1     MAAKLLSDLASGVTCVPSNYVRPVHDRPSLV-MPPDHSIPLINLHCFDGSRRHEIINQIG  59

Query  1705  DACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVK  1526
              AC++YGFFQV NH + + VI++MLKVA EFF+L   E++K +SDDP KT RLSTSFNVK
Sbjct  60    LACQNYGFFQVQNHAIEEAVIDNMLKVAREFFHLPESERLKCFSDDPLKTTRLSTSFNVK  119

Query  1525  KETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGL  1346
              E V +WRDYLRLHCYPL+ Y  EWPSNPP+ R+ V  Y   V+ +  ++ EAISESLGL
Sbjct  120   TEAVSSWRDYLRLHCYPLEDYMHEWPSNPPSFREDVAEYCRNVKGLAERLLEAISESLGL  179

Query  1345  DPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDG  1166
             +       LG+ GQHMA+N+YPPCP+PELTYGLP H DPN +T+LLQD  VAGLQV  +G
Sbjct  180   EKDYMNRALGKHGQHMAINYYPPCPQPELTYGLPGHADPNVVTLLLQD-DVAGLQVFNNG  238

Query  1165  KWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISA  986
             +W+AVKP P  F++NIGDQ+Q +SN +YKSV HRA+VN DK R+S+ +F CP  DAV+  
Sbjct  239   RWVAVKPMPHTFIVNIGDQIQIVSNDRYKSVLHRAVVNCDKERVSIPTFYCPSYDAVMEP  298

Query  985   PKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
                L+D+  P +YR FTY E+Y KFW R LN    L+ FK
Sbjct  299   APQLVDNHHPPLYRSFTYAEFYEKFWDRGLNTRSSLDLFK  338



>ref|XP_009134194.1| PREDICTED: hyoscyamine 6-dioxygenase [Brassica rapa]
Length=351

 Score =   378 bits (970),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 182/345 (53%), Positives = 240/345 (70%), Gaps = 9/345 (3%)
 Frame = -3

Query  1876  SMTTQLLFSGTPYST--LPQKYIRPESERPKLSEV-TTCDDVPVIDLG---CGDRSFIVR  1715
             S T++LL S    S   +P  YIR  S+RP +S+V  + D +P+IDL       R+ I+ 
Sbjct  4     STTSKLLVSDIASSVDRVPSSYIRQISDRPNISDVDISGDSIPLIDLQELYGPSRANIIH  63

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             Q   AC  Y FFQ+ NHGVP+K IE M+ VA EFF+    E++K YS D  KT RLSTSF
Sbjct  64    QFAHACSSYSFFQIKNHGVPEKTIERMMTVAREFFHQPESERVKHYSADTKKTTRLSTSF  123

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             NV  E V NWRD+LRLHC P++ +  EWPS+P + R++   Y T VR +   + EAISES
Sbjct  124   NVGSEKVSNWRDFLRLHCLPIEDFINEWPSHPVSFREITAEYATSVRALVLILLEAISES  183

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL+     N LG+ GQHMA+N+YPPCP+P+LT+GLP H DPN +T+LLQD +V+GLQV 
Sbjct  184   LGLEKDRVSNTLGKHGQHMALNYYPPCPQPDLTFGLPGHKDPNLITVLLQD-EVSGLQVF  242

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             KDGKW+AV P P+ F++N+GDQ+Q +SN KYKSV HRA+VN+DK R+S+ +F CP  DAV
Sbjct  243   KDGKWIAVHPIPNTFIVNMGDQMQVISNDKYKSVLHRAVVNSDKERISIPTFYCPSFDAV  302

Query  994   ISAPKPLLDDE--SPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             +   + L+++E  SPA+YR FTY EYY KFW R L  E C++ FK
Sbjct  303   VGPQQELINEEEDSPAIYRSFTYAEYYEKFWDRALATESCIDTFK  347



>ref|XP_007219345.1| hypothetical protein PRUPE_ppa019415mg [Prunus persica]
 gb|EMJ20544.1| hypothetical protein PRUPE_ppa019415mg [Prunus persica]
Length=345

 Score =   377 bits (967),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/341 (54%), Positives = 237/341 (70%), Gaps = 6/341 (2%)
 Frame = -3

Query  1873  MTTQLLFS-GTPYSTLPQKYIRPESERPKLSEVTTCD-DVPVIDLGCGD---RSFIVRQI  1709
             M  +LL    +  + +P  Y+RP  +RP L +V   D  +P+I+L   D   R  I+ QI
Sbjct  1     MAAKLLSDLASGVTCVPSNYVRPVHDRPSLDQVQPSDHSIPLINLHGFDGSRRHEIINQI  60

Query  1708  GDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNV  1529
             G AC++YGFFQV NH + + VI++MLKVA EFF+L   E++K +S+DP KT RLSTSFNV
Sbjct  61    GLACQNYGFFQVQNHAIEEAVIDNMLKVAREFFHLPESERLKCFSEDPLKTTRLSTSFNV  120

Query  1528  KKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLG  1349
             K E V +WRDYLRLHCYPL+ Y  EWPSNPP+ R+ V  Y   V+ +  ++ EAISESLG
Sbjct  121   KTEEVSSWRDYLRLHCYPLEDYMHEWPSNPPSFREDVAEYCRNVKGLAERLLEAISESLG  180

Query  1348  LDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKD  1169
             L+       LG+ GQHMA+N+YPPC +PELTYGLP H DPN +T+LLQD  VAGLQV  +
Sbjct  181   LEKDYMNRALGKHGQHMAINYYPPCHQPELTYGLPGHADPNVVTLLLQD-DVAGLQVFNN  239

Query  1168  GKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVIS  989
             G+W+AVKP P  F++NIGDQ+Q +SN +YKSV HRA+VN DK R+S+ +F CP  DAV+ 
Sbjct  240   GRWVAVKPMPHTFIVNIGDQIQVVSNDRYKSVLHRAVVNCDKERISIPTFYCPSYDAVME  299

Query  988   APKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
                 L+DD  P +YR FTY E+Y KFW R LN    L+ FK
Sbjct  300   PAPQLVDDHHPPLYRSFTYAEFYEKFWDRGLNTRSSLDLFK  340



>ref|XP_008245737.1| PREDICTED: hyoscyamine 6-dioxygenase-like isoform X1 [Prunus 
mume]
Length=358

 Score =   377 bits (967),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 186/348 (53%), Positives = 242/348 (70%), Gaps = 20/348 (6%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCD--DVPVIDLG---CGDRSFIVRQIGDACR  1694
             L SG  +  +P  Y+RP S+RP L +V   D   +P+IDL      + S I++QIG AC+
Sbjct  12    LMSGVNH--VPSNYVRPISDRPNLRDVQISDASSIPLIDLKDLHGHNHSNIIKQIGLACQ  69

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
               GFFQV NHGVP+++I+DM  +A +FF L   E++K+YSDDPSKT RLSTSFNV+ E +
Sbjct  70    TDGFFQVKNHGVPEEMIKDMSSIARKFFKLPESERLKMYSDDPSKTTRLSTSFNVRTEKL  129

Query  1513  HNWRDYLRLHCYPLQKY------------APEWPSNPPTLRDVVKIYVTEVRQVGFKIEE  1370
              NWRD+LRLHCYPL+ Y              EWP+NPP+ R+ V  Y T VR +  ++  
Sbjct  130   SNWRDFLRLHCYPLEDYFLRLHCSPLEDYVQEWPNNPPSFREQVGEYCTSVRGLVLRLLG  189

Query  1369  AISESLGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVA  1190
             AISESLGL+       LG+QGQHMA+N+YPPCPEPELTYGLP HTD N +TILLQD  V 
Sbjct  190   AISESLGLEKNYIVEALGKQGQHMALNYYPPCPEPELTYGLPGHTDCNLITILLQD-DVP  248

Query  1189  GLQVLKDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCP  1010
             GLQVL++GKW+AV P P+ F++NIGD +Q +SN KYKSV HRA+VN +  R+S+ +F CP
Sbjct  249   GLQVLRNGKWVAVNPIPNTFIVNIGDMMQVISNDKYKSVLHRAVVNCNSERISIPTFYCP  308

Query  1009  GEDAVISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
               DAV+   K L+  + PA+YR+FTY EY+ KFW+R L  E CL+ FK
Sbjct  309   SPDAVVGPAKDLISHDQPAMYRNFTYAEYFEKFWNRGLATECCLDLFK  356



>emb|CDY05103.1| BnaC03g29010D [Brassica napus]
Length=351

 Score =   376 bits (966),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/345 (53%), Positives = 239/345 (69%), Gaps = 9/345 (3%)
 Frame = -3

Query  1876  SMTTQLLFSGTPYST--LPQKYIRPESERPKLSEVTT-CDDVPVIDLG---CGDRSFIVR  1715
             S T++LL S    S   +P  YIR  S+RP +S+V    D +P+IDL       R+ I+ 
Sbjct  4     STTSKLLVSDIASSVDRVPSSYIRQISDRPNISDVDIFGDSIPLIDLQELYGPSRANIIH  63

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             Q   AC  Y FFQ+ NHGVP+K IE M+ VA EFF+    E++K YS D  KT RLSTSF
Sbjct  64    QFAHACSSYSFFQIKNHGVPEKTIERMMTVAREFFHQPESERVKHYSADTKKTTRLSTSF  123

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             NV  E V NWRD+LRLHC P++ +  EWPS+P + R++   Y T VR +   + EAISES
Sbjct  124   NVGSEKVSNWRDFLRLHCLPIEDFINEWPSHPVSFREITAEYATSVRALVLILLEAISES  183

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL+     N LG+ GQHMA+N+YPPCP+P+LT+GLP H DPN +T+LLQD +V+GLQV 
Sbjct  184   LGLEKDRVSNTLGKHGQHMALNYYPPCPQPDLTFGLPGHKDPNLITVLLQD-EVSGLQVF  242

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             KDGKW+AV P P+ F++N+GDQ+Q +SN KYKSV HRA+VN+DK R+S+ +F CP  DAV
Sbjct  243   KDGKWIAVHPIPNTFIVNMGDQMQVISNDKYKSVLHRAVVNSDKERISIPTFYCPSFDAV  302

Query  994   ISAPKPLLDDE--SPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             +   + L+++E  SPA+YR FTY EYY KFW R L  E C++ FK
Sbjct  303   VGPQQELINEEEDSPAIYRSFTYAEYYEKFWDRALATESCIDTFK  347



>ref|XP_007219505.1| hypothetical protein PRUPE_ppa022381mg [Prunus persica]
 gb|EMJ20704.1| hypothetical protein PRUPE_ppa022381mg [Prunus persica]
Length=345

 Score =   376 bits (965),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 183/341 (54%), Positives = 237/341 (70%), Gaps = 6/341 (2%)
 Frame = -3

Query  1873  MTTQLLFS-GTPYSTLPQKYIRPESERPKLSEVTTCD-DVPVIDLGCGD---RSFIVRQI  1709
             M  +LL    +  + +P  Y+RP  +RP L +V   D  +P+I+L   D   R  I+ QI
Sbjct  1     MAAKLLSDLASGVTCVPSNYVRPVHDRPSLDQVQPSDHSIPLINLRGFDGSRRHEIINQI  60

Query  1708  GDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNV  1529
             G AC++YGFFQV NH + + VI++MLKVA EFF+L   E++K +SDDP KT RLSTSFNV
Sbjct  61    GLACQNYGFFQVQNHAIEEVVIDNMLKVAREFFHLPENERLKCFSDDPLKTTRLSTSFNV  120

Query  1528  KKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLG  1349
             K E V +WRDYLRLHCYPL+ Y  EWPSNPP+ R+ V  Y   V+ +  ++ EAISESLG
Sbjct  121   KTEKVSSWRDYLRLHCYPLEDYMHEWPSNPPSFREDVAEYCRNVKGLAERLLEAISESLG  180

Query  1348  LDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKD  1169
             L+       LG+ GQHMA+N+YPPC +PELTYGLP H DPN +T+LLQD  VAGLQV  +
Sbjct  181   LEKDYMNRALGKHGQHMAINYYPPCHQPELTYGLPGHADPNVVTLLLQD-DVAGLQVFNN  239

Query  1168  GKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVIS  989
             G+W+AVKP P  F++NIGDQ+Q +SN +YKSV HRA+VN DK R+S+ +F CP  DAV+ 
Sbjct  240   GRWVAVKPMPHTFIVNIGDQIQVVSNDRYKSVLHRAVVNCDKERISIPTFYCPSYDAVME  299

Query  988   APKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
                 L+DD  P +YR FTY E+Y KFW R LN    L+ F+
Sbjct  300   PAPQLVDDHHPPLYRSFTYAEFYEKFWDRGLNTRSSLDLFQ  340



>ref|XP_006421681.1| hypothetical protein CICLE_v10007009mg [Citrus clementina]
 gb|ESR34921.1| hypothetical protein CICLE_v10007009mg [Citrus clementina]
Length=326

 Score =   373 bits (958),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 182/325 (56%), Positives = 228/325 (70%), Gaps = 7/325 (2%)
 Frame = -3

Query  1876  SMTTQLLFS--GTPYSTLPQKYIRPESERPKLSEVTTCD-DVPVIDLGCGD---RSFIVR  1715
             + TT+LL S   +   ++P  YIRP S+RP L+EV   D  +P+IDL   D   R  I++
Sbjct  3     AATTKLLLSDLASTVKSVPSNYIRPISDRPNLTEVQISDGSIPLIDLQVLDGPRRLDIIK  62

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             QIG AC+H G FQV NHG+P+ +I  ML +   FF L   E++K YSDDPSK+ RLSTSF
Sbjct  63    QIGQACQHDGVFQVKNHGIPETIINSMLSITRAFFKLPESERLKSYSDDPSKSTRLSTSF  122

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             NV  E V NWRDYLRLHCYPLQ Y  EWPSNPP+ R+VV  Y T  R +  ++ EAISES
Sbjct  123   NVNTEKVSNWRDYLRLHCYPLQDYIHEWPSNPPSFREVVAEYCTSARGLVLRLLEAISES  182

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL        LG+  QHMA+N+YP CP+P+LTYGLP H DPN +T+LLQD  V GLQVL
Sbjct  183   LGLQRDYIDKALGKHRQHMALNYYPHCPQPDLTYGLPGHIDPNLITVLLQD-DVPGLQVL  241

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             + GKWL V P P+ F++ IGDQ+Q LSN +YKSV HRA+VN DK R+S+ +F CP  DAV
Sbjct  242   RKGKWLPVSPIPNTFIVKIGDQMQVLSNDRYKSVLHRALVNCDKERISIPTFYCPSPDAV  301

Query  994   ISAPKPLLDDESPAVYRDFTYPEYY  920
             I+  K L+D+  PAVY++FTY EYY
Sbjct  302   IAPAKDLIDERHPAVYKNFTYSEYY  326



>ref|XP_006288068.1| hypothetical protein CARUB_v10001301mg [Capsella rubella]
 gb|EOA20966.1| hypothetical protein CARUB_v10001301mg [Capsella rubella]
Length=350

 Score =   373 bits (957),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 178/344 (52%), Positives = 241/344 (70%), Gaps = 8/344 (2%)
 Frame = -3

Query  1876  SMTTQLLFS--GTPYSTLPQKYIRPESERPKLSEVTTC-DDVPVIDLG---CGDRSFIVR  1715
             S T++LL S   +  S +P  Y+RP S+RP LS+V +  D +P+IDL      +R+ IV 
Sbjct  4     SATSKLLVSDFASTISHIPSSYVRPISDRPNLSDVASSGDSIPLIDLRDLYGPNRAAIVH  63

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             Q+  AC  YGFFQ+ NHGVP   IE M+ VA EFF+    E++K YS DP+KT R+STSF
Sbjct  64    QLAKACSTYGFFQIKNHGVPDTTIEKMITVAREFFHQPESERVKHYSADPTKTTRVSTSF  123

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             N+  + + NWRD+LR+HC+P++ +  EWP++P + R+V   Y T +R +  ++ EAISES
Sbjct  124   NISADKILNWRDFLRIHCFPIEDFIQEWPTSPVSFREVTAEYATSLRALILRLLEAISES  183

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL+     N+LG+  QHMA N+YPPCPEPELTYGLP H DP  +T+LLQD QV+GLQV 
Sbjct  184   LGLERDHISNILGQHAQHMAFNYYPPCPEPELTYGLPGHKDPTVITVLLQD-QVSGLQVF  242

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             KD KW++VKP P+ F++NIGDQ+Q +SN KYKSV HRAIVNT+K R+S+ +F  P  +AV
Sbjct  243   KDDKWVSVKPIPNTFIVNIGDQMQVISNDKYKSVLHRAIVNTEKERLSIPTFCFPAAEAV  302

Query  994   ISAPKPLLD-DESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             IS    L+   +S AVYR F + EY+ KFW+R+L    CL+ FK
Sbjct  303   ISPAHELISKQDSLAVYRSFPFVEYWDKFWNRSLATASCLDAFK  346



>ref|XP_002872519.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48778.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=350

 Score =   372 bits (955),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 178/344 (52%), Positives = 242/344 (70%), Gaps = 8/344 (2%)
 Frame = -3

Query  1876  SMTTQLLFSG--TPYSTLPQKYIRPESERPKLSEV-TTCDDVPVIDL---GCGDRSFIVR  1715
             S T++LL S   +  S +P  Y+RP  +RP LSEV ++ D +P+IDL      +R+ +V+
Sbjct  4     SATSKLLVSDFDSSVSHIPSNYVRPILDRPNLSEVESSSDSIPLIDLRELHGPNRAEVVQ  63

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             Q+  AC  YGFFQ+ NHGVP   ++ ML VA EFF+    E++K YS DP+KT R+STSF
Sbjct  64    QLDSACSTYGFFQIKNHGVPDTTVDKMLTVAREFFHQPESERVKHYSADPTKTTRVSTSF  123

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             N+  + + NWRD+LRLHC+P++ +  EWPS+P + ++V   Y T VR +  ++ EAISES
Sbjct  124   NIGADKILNWRDFLRLHCFPIEDFIEEWPSSPNSFKEVTAEYATSVRALVLRLLEAISES  183

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL+     N+LG+  QHMA N+YPPCPEPELTYGLP H DP  +T+LLQD QV+GLQV 
Sbjct  184   LGLESDHISNILGKHAQHMAFNYYPPCPEPELTYGLPGHKDPTVITVLLQD-QVSGLQVF  242

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             KD KW+AV P P+ F++NIGDQ+Q +SN KYKSV HRA+VNT+K R+S+ +F  P  DAV
Sbjct  243   KDNKWVAVNPIPNTFIVNIGDQMQVISNDKYKSVLHRAVVNTEKERLSIPTFYFPSTDAV  302

Query  994   ISAPKPLLDD-ESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             I     L+++ ES AVYR F + EY+ KFW+R+L    CL+ FK
Sbjct  303   IGPAHELINEQESLAVYRTFPFVEYWDKFWNRSLATASCLDAFK  346



>emb|CAH67943.1| H0303A11-B0406H05.3 [Oryza sativa Indica Group]
 gb|EAY95275.1| hypothetical protein OsI_17098 [Oryza sativa Indica Group]
Length=352

 Score =   372 bits (954),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/328 (55%), Positives = 228/328 (70%), Gaps = 7/328 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEV--TTCDDVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVIN  1667
             +P  +IRP  +RP L  V   +   +PVIDL      DR  +V  IG AC   GFF V N
Sbjct  20    VPSSHIRPVGDRPDLDNVDHESGAGIPVIDLKQLDGPDRRKVVEAIGSACETDGFFMVKN  79

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HG+P++V+E ML+VA EFF++   E++K YSDDP K +RLSTSFNV+ E V NWRD+LRL
Sbjct  80    HGIPEEVVEGMLRVAREFFHMPESERLKCYSDDPKKAIRLSTSFNVRTEKVSNWRDFLRL  139

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HCYPL+ +  +WPSNPP+ R VV  Y  E R +  ++ EAISESLGL+     + +G Q 
Sbjct  140   HCYPLESFIDQWPSNPPSFRQVVGTYSREARALALRLLEAISESLGLERGHMVSAMGRQA  199

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMAVN+YPPCP+PELTYGLP H DPNA+T+LLQD  V+GLQV ++G+W+AV P PDA V
Sbjct  200   QHMAVNYYPPCPQPELTYGLPGHKDPNAITLLLQD-GVSGLQVQRNGRWVAVNPVPDALV  258

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDE-SPAV  950
             INIGDQ+QALSN +YKSV HR IVN++  R+SV +F CP  DAVI+    L+D    P  
Sbjct  259   INIGDQIQALSNDRYKSVLHRVIVNSESERISVPTFYCPSPDAVIAPAGALVDGALHPLA  318

Query  949   YRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             YR FTY  YY +FW+  L    CL+ F+
Sbjct  319   YRPFTYQAYYDEFWNMGLQSASCLDRFR  346



>ref|XP_007051408.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX95565.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
Length=343

 Score =   371 bits (952),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 183/327 (56%), Positives = 237/327 (72%), Gaps = 4/327 (1%)
 Frame = -3

Query  1837  STLPQKYIRPESERPKLSEVTTCDDVPVIDLGC---GDRSFIVRQIGDACRHYGFFQVIN  1667
             S++P  Y+RPES+RPKL+EVT    +P++DL      + S ++++IG+AC++YGFFQV N
Sbjct  17    SSVPPNYVRPESDRPKLNEVTFDHSIPLLDLQGLHGPNHSSVIKEIGEACQNYGFFQVKN  76

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HG+  +VI+ ML V+ EFF+L   E++K YSDDP KT RLSTSFNVK E V +WRDYLRL
Sbjct  77    HGISPEVIDKMLHVSKEFFHLPESERLKNYSDDPMKTTRLSTSFNVKTENVSSWRDYLRL  136

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HC+PL+ Y  EWP+NPP+ R+    Y    R +  ++ EAISESLGL+     + LG+  
Sbjct  137   HCFPLEDYVHEWPTNPPSFREAAADYCKNTRGLALRLLEAISESLGLERDYMNSALGKHA  196

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMA+N YPPCPEPELTYGLPAH DPN +TILLQ   V GLQVLKDGKW AV P P  F+
Sbjct  197   QHMAINCYPPCPEPELTYGLPAHADPNVITILLQ-ADVPGLQVLKDGKWTAVSPVPYTFI  255

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             +NIGDQ+Q +SN +YKSV HRA+VN  + R+S+ +F CP  DAV+     L+DD+ P +Y
Sbjct  256   VNIGDQIQVVSNDRYKSVLHRAVVNCKEERISIPTFYCPSPDAVMRPAPQLIDDDHPPLY  315

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             R ++Y EYY KFW R LN E CL+ FK
Sbjct  316   RSYSYSEYYQKFWKRGLNAETCLDMFK  342



>ref|XP_008783539.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Phoenix 
dactylifera]
 ref|XP_008783540.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Phoenix 
dactylifera]
 ref|XP_008783541.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Phoenix 
dactylifera]
Length=352

 Score =   370 bits (951),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 179/326 (55%), Positives = 225/326 (69%), Gaps = 5/326 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCDD-VPVIDL---GCGDRSFIVRQIGDACRHYGFFQVINH  1664
             +P  YIRP S+RP L  V T D  +P++DL      +RS +V +IG AC + GFFQV NH
Sbjct  26    VPSNYIRPASDRPDLLNVETSDTTIPIVDLQGLAGTNRSRVVEEIGIACENDGFFQVTNH  85

Query  1663  GVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLH  1484
             G+PK VIE ML+VA EFF+L   E++K YSDDP+KT RLSTSFNVK E   +WRDYLRLH
Sbjct  86    GIPKDVIEGMLRVAKEFFHLPESERLKSYSDDPAKTTRLSTSFNVKTEKASSWRDYLRLH  145

Query  1483  CYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQ  1304
             CYPL+ +  EWP NPP  R VV  Y    R++  ++ EAISESL L+       LG+Q Q
Sbjct  146   CYPLENFVDEWPCNPPCFRQVVAEYCKNARELVLRLLEAISESLELEGDYMVKALGKQAQ  205

Query  1303  HMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVI  1124
             HMA+N+YPPCP+PELTYGLP H DPNA+TILLQD  V GLQVL+ GKW+ V P PD  VI
Sbjct  206   HMAINYYPPCPQPELTYGLPGHKDPNAITILLQD-GVPGLQVLRKGKWVTVNPDPDTLVI  264

Query  1123  NIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYR  944
             NIGD +Q LSN ++KSV HR +V+    R+SV +F CP  DA+I   + +++   P +YR
Sbjct  265   NIGDMIQVLSNDRFKSVLHRVVVSKTSERISVPTFYCPSPDALIKPAEVVVEKGHPPIYR  324

Query  943   DFTYPEYYSKFWSRNLNQEHCLEHFK  866
              FTY EYY KFW++ L     L+ FK
Sbjct  325   SFTYAEYYEKFWNQGLQSASWLDVFK  350



>ref|XP_006583203.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase isoform X2 
[Glycine max]
Length=338

 Score =   370 bits (950),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 177/326 (54%), Positives = 234/326 (72%), Gaps = 12/326 (4%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEV-TTCDDVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVINH  1664
             +P  +IRP  +RPKL ++ ++   +P+IDL   G  + S I++ I  AC+ YGFFQ    
Sbjct  18    VPSNFIRPIGDRPKLHQLHSSLASIPIIDLQGLGGSNHSQIIQNIAHACQTYGFFQ----  73

Query  1663  GVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLH  1484
                ++V+  M+ V+ EFF L   E++K +SDDPSKT RLSTSFNVK E V NWRD+LRLH
Sbjct  74    ---EEVVSKMVNVSKEFFGLPESERLKNFSDDPSKTTRLSTSFNVKTEKVSNWRDFLRLH  130

Query  1483  CYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQ  1304
             C+PL+ Y  EWP NPP+ R+ V  Y  ++R +  K+ EAISESLGL+       LG+ GQ
Sbjct  131   CHPLEDYIQEWPGNPPSFREDVAEYSRKMRGLSLKLLEAISESLGLERDYIDKALGKHGQ  190

Query  1303  HMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVI  1124
             H+A+N+YPPCPEPELTYGLPAH DPNA+TILLQ+ +V GLQVL DGKWL V P P+ F++
Sbjct  191   HLAINYYPPCPEPELTYGLPAHADPNAITILLQN-EVPGLQVLYDGKWLTVNPVPNTFIV  249

Query  1123  NIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYR  944
             NIGDQ+Q +SN +YKSV HRA+VN +K RMS+ +F CP  DA+I     L+D+E PA Y 
Sbjct  250   NIGDQIQVISNDRYKSVLHRALVNCEKERMSIPTFYCPSPDALIKPAPKLVDNEHPAQYT  309

Query  943   DFTYPEYYSKFWSRNLNQEHCLEHFK  866
             +FTY EYY KFW+R L++E C++ FK
Sbjct  310   NFTYREYYDKFWNRGLSKETCVDMFK  335



>dbj|BAJ94485.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97756.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=349

 Score =   370 bits (950),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 176/327 (54%), Positives = 226/327 (69%), Gaps = 6/327 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEV--TTCDDVPVIDLGCGD---RSFIVRQIGDACRHYGFFQVIN  1667
             +P  +IR   +RP L+ V   +   +P+IDL   D   R  +V  IG AC + GFF V N
Sbjct  21    VPSSHIRAVGDRPDLANVDHESGAGIPLIDLKHLDGPGRRRVVEAIGSACENDGFFMVTN  80

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HG+P+ V++ ML+VA EFF+L   E++K YSDDP K +RLSTSFNV+ E V NWRD+LRL
Sbjct  81    HGIPEAVVDGMLRVAREFFHLPESERLKCYSDDPKKAIRLSTSFNVRTEKVSNWRDFLRL  140

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HCYPL+ +  +WPSNPP  R+ V  Y TE R +  ++ EAISESLGL+       +G   
Sbjct  141   HCYPLESFIDQWPSNPPAFREAVGTYSTEARALALRLLEAISESLGLERGHMVKAMGRHA  200

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMAVN+YPPCP+PELTYGLP H DPNA+T+LLQD  V+GLQV +DG+W+AV P P A V
Sbjct  201   QHMAVNYYPPCPQPELTYGLPGHKDPNAVTLLLQD-GVSGLQVRRDGRWVAVNPVPGALV  259

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             INIGDQLQALSN +YKSV HR IVN++  R+SV +F CP  DAV++  + L+D      Y
Sbjct  260   INIGDQLQALSNDRYKSVLHRVIVNSESERISVPTFYCPSPDAVVAPAEALVDGGHRLAY  319

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             R FTY EYY +FW+  L    CL+ F+
Sbjct  320   RPFTYQEYYEEFWNMGLEAASCLDRFR  346



>gb|KFK31850.1| hypothetical protein AALP_AA6G166600 [Arabis alpina]
Length=350

 Score =   370 bits (950),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 182/344 (53%), Positives = 238/344 (69%), Gaps = 8/344 (2%)
 Frame = -3

Query  1876  SMTTQLLFS--GTPYSTLPQKYIRPESERPKLSEV-TTCDDVPVIDLGCGD---RSFIVR  1715
             S T++LL S   +  S +P  Y+RP S+RP LSEV T+ D +P+IDL   D   R+ IV 
Sbjct  4     SATSKLLLSDFASSVSHVPSNYVRPISDRPNLSEVETSGDSIPLIDLCDLDGSKRAEIVH  63

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             Q+  AC  YGFFQ+ NHGVP   IE ML V  EFF+    E++K YS DP+KT R+STSF
Sbjct  64    QLAYACSTYGFFQIKNHGVPDTTIEKMLTVGREFFHQPESERIKHYSADPTKTTRVSTSF  123

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             NV  + + NWRDYLRLHC+P++ +  EWPS+P + R+V   Y T VR +  ++ EA+SES
Sbjct  124   NVSADKILNWRDYLRLHCFPIEDFIGEWPSSPISFREVTAEYATNVRALVLRLLEALSES  183

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LG++     N LG+  QHMA N+YPPCPEPELTYGLP H DP  +T+LLQD QV+GLQV 
Sbjct  184   LGVERDHISNRLGQHAQHMAFNYYPPCPEPELTYGLPGHKDPTVITVLLQD-QVSGLQVF  242

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             KD KW+AV P P+ F++NIGDQ+Q +SN  YKSV HRAIVNT+K R+S+ +F  P  DAV
Sbjct  243   KDDKWIAVNPIPNTFIVNIGDQMQVISNDLYKSVLHRAIVNTEKERLSIPTFYFPSTDAV  302

Query  994   ISAPKPLLDDE-SPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             I     L++++ S AVY+ F + EY+ KFW R+L    CL+ FK
Sbjct  303   IGPASELINEQDSLAVYKSFPFVEYWDKFWDRSLATASCLDAFK  346



>ref|NP_001053652.1| Os04g0581100 [Oryza sativa Japonica Group]
 emb|CAD41170.2| OSJNBa0064M23.15 [Oryza sativa Japonica Group]
 dbj|BAF15566.1| Os04g0581100 [Oryza sativa Japonica Group]
 gb|EAZ31745.1| hypothetical protein OsJ_15897 [Oryza sativa Japonica Group]
 dbj|BAG94799.1| unnamed protein product [Oryza sativa Japonica Group]
Length=352

 Score =   370 bits (949),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 178/328 (54%), Positives = 227/328 (69%), Gaps = 7/328 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEV--TTCDDVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVIN  1667
             +P  +IRP  +RP L  V   +   +PVIDL      DR  +V  IG AC   GFF V N
Sbjct  20    VPSSHIRPVGDRPDLDNVDHESGAGIPVIDLKQLDGPDRRKVVEAIGSACETDGFFMVKN  79

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HG+P++V+E ML+VA EFF++   E++K YSDDP K +RLSTSFNV+ E V NWRD+LRL
Sbjct  80    HGIPEEVVEGMLRVAREFFHMPESERLKCYSDDPKKAIRLSTSFNVRTEKVSNWRDFLRL  139

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HCYPL+ +  +WPSNPP+ R VV  Y  E R +  ++ EAISESLGL+     + +G Q 
Sbjct  140   HCYPLESFIDQWPSNPPSFRQVVGTYSREARALALRLLEAISESLGLERGHMVSAMGRQA  199

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMAVN+YPPCP+PELTYGLP H DPNA+T+LLQD  V+GLQV ++G+W+AV P PDA V
Sbjct  200   QHMAVNYYPPCPQPELTYGLPGHKDPNAITLLLQD-GVSGLQVQRNGRWVAVNPVPDALV  258

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDE-SPAV  950
             INIGDQ+QALSN +YKSV HR IVN++  R+SV +F CP  DAVI+    L+D    P  
Sbjct  259   INIGDQIQALSNDRYKSVLHRVIVNSESERISVPTFYCPSPDAVIAPAGALVDGALHPLA  318

Query  949   YRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             YR F Y  YY +FW+  L    CL+ F+
Sbjct  319   YRPFKYQAYYDEFWNMGLQSASCLDRFR  346



>ref|XP_006397055.1| hypothetical protein EUTSA_v10028774mg [Eutrema salsugineum]
 gb|ESQ38508.1| hypothetical protein EUTSA_v10028774mg [Eutrema salsugineum]
Length=350

 Score =   369 bits (946),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 178/344 (52%), Positives = 239/344 (69%), Gaps = 8/344 (2%)
 Frame = -3

Query  1876  SMTTQLLFS--GTPYSTLPQKYIRPESERPKLSEV-TTCDDVPVIDL---GCGDRSFIVR  1715
             S T++LL S   +  + +P  Y+RP  +RP LSEV T+ D +P+IDL      +R+ I+ 
Sbjct  4     SATSKLLVSDFASSVTHIPLTYVRPILDRPNLSEVETSGDSIPLIDLRDLHGPNRAEIIH  63

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             Q+ +AC  YGFFQ+ NHGVP+  I+ ML VA EFF+    E+MK YS D +K  R+STSF
Sbjct  64    QLANACSTYGFFQIKNHGVPETTIDKMLNVAREFFHQPESERMKHYSTDSTKKTRVSTSF  123

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             NV ++ + NWRDYLR+HC+P++ +  EWPS P + +D+   Y T VR +   + EAISES
Sbjct  124   NVSEDKILNWRDYLRIHCFPIEDFINEWPSKPVSFKDITAEYATRVRALVLNLLEAISES  183

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL+     N LG   QHMA N+YPPCPEPELTYGLP H DP  +T+LLQD QV+GLQV 
Sbjct  184   LGLEKDHISNRLGTHAQHMAFNYYPPCPEPELTYGLPGHKDPTVVTVLLQD-QVSGLQVF  242

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             KD KW+AV P P+ F++NIGDQ+Q +SN KYKSV HRA+VNT+K R+S+ +F  P  DAV
Sbjct  243   KDDKWVAVYPIPNTFIVNIGDQMQVISNEKYKSVLHRAVVNTEKERLSIPTFYFPSTDAV  302

Query  994   ISAPKPLLDDE-SPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             I   + L++++ SPAVY+ F + EY+ KFW R+L    CL+ FK
Sbjct  303   IGPAQELINEQDSPAVYKSFPFVEYWDKFWDRSLATASCLDAFK  346



>ref|XP_006653701.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Oryza 
brachyantha]
Length=352

 Score =   369 bits (946),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 177/327 (54%), Positives = 227/327 (69%), Gaps = 6/327 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEV--TTCDDVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVIN  1667
             +P  +IRP  +RP L  V   +   +P+IDL      DR  +V  IG AC   GFF V N
Sbjct  20    VPPSHIRPVGDRPDLDNVDHESGAGIPLIDLKQLDGPDRRRVVEAIGSACETDGFFMVRN  79

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HG+P++V+E ML+VA EFF++S  E++K YSDDP K +RLSTSFNV+ E V NWRD+LRL
Sbjct  80    HGIPEEVVEGMLRVAREFFHMSESERLKCYSDDPKKAIRLSTSFNVRTEKVSNWRDFLRL  139

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HCYPL+ +  +WPSNP + R VV  Y TE R +  ++ EAISESLGL+     + +G Q 
Sbjct  140   HCYPLEDFIDQWPSNPHSFRQVVGTYSTEARALALRLLEAISESLGLERGHMVSAMGRQA  199

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMA  + PPCP+PELTYGLP H DPNA+T+LLQD  V+GLQV ++G+W+AV P PDA V
Sbjct  200   QHMAXXYSPPCPQPELTYGLPGHKDPNAITLLLQD-GVSGLQVQRNGRWVAVNPVPDALV  258

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             INIGDQ+QALSN +YKSV HR IVN++  R+SV +F CP  DAVI+    L+DD  P  Y
Sbjct  259   INIGDQVQALSNDRYKSVLHRVIVNSESERISVPTFYCPSPDAVIAPADGLVDDGHPLAY  318

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             R FTY  YY +FW+  L    CL+ F+
Sbjct  319   RPFTYQAYYDEFWNMGLESASCLDRFR  345



>ref|NP_192788.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 gb|AAD03425.1| contains similarity to Iron/Ascorbate family of oxidoreductases 
(Pfam: PF00671, Score=297.8, E=1.3e-85, N=1) [Arabidopsis 
thaliana]
 emb|CAB40043.1| putative Fe(II)/ascorbate oxidase [Arabidopsis thaliana]
 emb|CAB78173.1| putative Fe(II)/ascorbate oxidase [Arabidopsis thaliana]
 gb|AAQ65160.1| At4g10500 [Arabidopsis thaliana]
 dbj|BAD44441.1| putative Fe(II)/ascorbate oxidase [Arabidopsis thaliana]
 dbj|BAD44674.1| putative Fe(II)/ascorbate oxidase [Arabidopsis thaliana]
 gb|AEE82891.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=349

 Score =   368 bits (944),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 178/343 (52%), Positives = 238/343 (69%), Gaps = 7/343 (2%)
 Frame = -3

Query  1876  SMTTQLLFSGTPYST-LPQKYIRPESERPKLSEV-TTCDDVPVIDL---GCGDRSFIVRQ  1712
             S  ++LL S    S  +P  Y+RP S+RP LSEV ++ D +P+IDL      +R+ IV+Q
Sbjct  4     SAISKLLVSDFASSVHIPSNYVRPISDRPNLSEVESSGDSIPLIDLRDLHGPNRAVIVQQ  63

Query  1711  IGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFN  1532
             +  AC  YGFFQ+ NHGVP   +  M  VA EFF+    E++K YS DP+KT RLSTSFN
Sbjct  64    LASACSTYGFFQIKNHGVPDTTVNKMQTVAREFFHQPESERVKHYSADPTKTTRLSTSFN  123

Query  1531  VKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESL  1352
             V  + V NWRD+LRLHC+P++ +  EWPS+P + R+V   Y T VR +  ++ EAISESL
Sbjct  124   VGADKVLNWRDFLRLHCFPIEDFIEEWPSSPISFREVTAEYATSVRALVLRLLEAISESL  183

Query  1351  GLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLK  1172
             GL+     N+LG+  QHMA N+YPPCPEPELTYGLP H DP  +T+LLQD QV+GLQV K
Sbjct  184   GLESDHISNILGKHAQHMAFNYYPPCPEPELTYGLPGHKDPTVITVLLQD-QVSGLQVFK  242

Query  1171  DGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVI  992
             D KW+AV P P+ F++NIGDQ+Q +SN KYKSV HRA+VNT+  R+S+ +F  P  DAVI
Sbjct  243   DDKWVAVSPIPNTFIVNIGDQMQVISNDKYKSVLHRAVVNTENERLSIPTFYFPSTDAVI  302

Query  991   SAPKPLLDDE-SPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
                  L++++ S A+YR + + EY+ KFW+R+L    CL+ FK
Sbjct  303   GPAHELVNEQDSLAIYRTYPFVEYWDKFWNRSLATASCLDAFK  345



>ref|XP_009134195.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase [Brassica 
rapa]
Length=350

 Score =   367 bits (943),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/343 (52%), Positives = 238/343 (69%), Gaps = 8/343 (2%)
 Frame = -3

Query  1873  MTTQLLFSGTPYST--LPQKYIRPESERPKLSEV-TTCDDVPVIDLG---CGDRSFIVRQ  1712
             +T++LL S    S   +P  Y+RP S+RP+LS V  + D +P+IDL      +R+ I+RQ
Sbjct  5     LTSKLLVSDFASSVRHIPLTYVRPISDRPQLSLVENSGDTIPLIDLRDLYGPNRTKIIRQ  64

Query  1711  IGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFN  1532
             I  AC  YGFFQ+ NHGV +  +  ML VA EFF+    E+MK YS D +KT R+STSFN
Sbjct  65    ISHACSTYGFFQIKNHGVSETTVNKMLTVAREFFHQPEGERMKHYSTDSTKTTRVSTSFN  124

Query  1531  VKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESL  1352
             V  + + NWRDYLRLHC+P+Q +  EWP NP + +++   Y T VR +  ++ EAISESL
Sbjct  125   VSADKILNWRDYLRLHCFPIQDFINEWPENPVSFKEITAEYATSVRALVLRLLEAISESL  184

Query  1351  GLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLK  1172
             GL+     N LG   QHMA N+YPPCPEPELTYGLP H DP A+T+LLQD QV+GLQV K
Sbjct  185   GLERDHISNRLGTHAQHMAFNYYPPCPEPELTYGLPGHKDPTAITVLLQD-QVSGLQVFK  243

Query  1171  DGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVI  992
             D +W+AV P P+ F++NIGDQ+Q +SN +YKSV HRA+VNT+K R+S+ +F  P  DAVI
Sbjct  244   DDEWIAVYPIPNTFIVNIGDQMQVISNERYKSVLHRAVVNTEKERLSIPTFYFPSTDAVI  303

Query  991   SAPKPLLDDE-SPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             S  + L+D + SPAVY+ + + EY+ KFW R+L    CL+ FK
Sbjct  304   SPAQELIDGQTSPAVYKSYPFVEYWDKFWDRSLATASCLDAFK  346



>emb|CDX90761.1| BnaA03g24410D [Brassica napus]
Length=350

 Score =   367 bits (942),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/343 (52%), Positives = 238/343 (69%), Gaps = 8/343 (2%)
 Frame = -3

Query  1873  MTTQLLFSGTPYST--LPQKYIRPESERPKLSEV-TTCDDVPVIDLG---CGDRSFIVRQ  1712
             +T++LL S    S   +P  Y+RP S+RP+LS V  + D +P+IDL      +R+ I+RQ
Sbjct  5     LTSKLLVSDFASSVRHIPLTYVRPISDRPQLSLVENSGDTIPLIDLRDLYGPNRTKIIRQ  64

Query  1711  IGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFN  1532
             I  AC  YGFFQ+ NHGV +  +  ML VA EFF+    E+MK YS D +KT R+STSFN
Sbjct  65    ISHACSTYGFFQIKNHGVSETTVNKMLTVAREFFHQPEGERMKHYSADSTKTTRVSTSFN  124

Query  1531  VKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESL  1352
             V  + + NWRDYLRLHC+P+Q +  EWP NP + +++   Y T VR +  ++ EAISESL
Sbjct  125   VSADKILNWRDYLRLHCFPIQDFINEWPENPVSFKEITAEYATSVRALVLRLLEAISESL  184

Query  1351  GLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLK  1172
             GL+     N LG   QHMA N+YPPCPEPELTYGLP H DP A+T+LLQD QV+GLQV K
Sbjct  185   GLERDHISNRLGTHAQHMAFNYYPPCPEPELTYGLPGHKDPTAITVLLQD-QVSGLQVFK  243

Query  1171  DGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVI  992
             D +W+AV P P+ F++NIGDQ+Q +SN +YKSV HRA+VNT+K R+S+ +F  P  DAVI
Sbjct  244   DDEWIAVYPIPNTFIVNIGDQMQVISNERYKSVLHRAVVNTEKERLSIPTFYFPSTDAVI  303

Query  991   SAPKPLLDDE-SPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             S  + L+D + SPAVY+ + + EY+ KFW R+L    CL+ FK
Sbjct  304   SPAQELIDGQTSPAVYKSYPFVEYWDKFWDRSLATASCLDAFK  346



>ref|XP_008360739.1| PREDICTED: hyoscyamine 6-dioxygenase-like [Malus domestica]
Length=326

 Score =   366 bits (940),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/312 (55%), Positives = 227/312 (73%), Gaps = 1/312 (0%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACRHYGFFQVINHGVPK  1652
             +P K+    +   K+S+ ++   + + DL     S I++QIG AC+  GFF V NHGVP+
Sbjct  13    IPPKFKYFNNVHEKVSBASSIPLIDLKDLHGPTHSDIIKQIGLACQTDGFFXVKNHGVPE  72

Query  1651  KVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLHCYPL  1472
              +I+DML +A EFF L   E++K+YSDDPSKT RLSTSFNV+ E + NWRD+LRLHCYPL
Sbjct  73    IMIKDMLNIAREFFQLPESERLKMYSDDPSKTTRLSTSFNVRTEKLSNWRDFLRLHCYPL  132

Query  1471  QKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQHMAV  1292
             Q Y  EWP+NPP  R+ V  Y T VR +  ++ EAISESLGL+  C    LG+QGQHMA+
Sbjct  133   QDYVQEWPNNPPLFREQVGEYCTNVRGLVLRLLEAISESLGLEKNCIVKALGKQGQHMAL  192

Query  1291  NFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVINIGD  1112
             N+YPPCP+PELTYGLP HTD N +T+LLQD +V GLQVL++GKW+AV P P+ F++NIGD
Sbjct  193   NYYPPCPQPELTYGLPGHTDANLITVLLQD-EVPGLQVLRNGKWVAVNPIPNTFIVNIGD  251

Query  1111  QLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYRDFTY  932
              +Q +SN +YKSV HRA+ N +  R+S+ +F CP  DAVI   K L++ + PA+YR+FTY
Sbjct  252   MMQVISNNRYKSVLHRAVXNCNSERISIPTFYCPSPDAVIGPAKELVNYDHPAMYRNFTY  311

Query  931   PEYYSKFWSRNL  896
              EYY KFW++ L
Sbjct  312   AEYYEKFWNKGL  323



>gb|KHN16398.1| Flavonol synthase/flavanone 3-hydroxylase [Glycine soja]
Length=335

 Score =   365 bits (938),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 233/332 (70%), Gaps = 11/332 (3%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCDDV--PVIDLG---CGDRSFIVRQIGDACRHYGFFQVIN  1667
             +P  +IRP  +RP L  V    DV  P+IDL      +RS I++QI  AC++YGFFQV N
Sbjct  4     VPSNFIRPLGDRPNLQGVVQSSDVCIPLIDLQDLHGPNRSHIIQQIDQACQNYGFFQVTN  63

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HGVP+ VIE ++KV  EFF L   EK+K YS DP K  RLSTSFNV  E V NWRD+LRL
Sbjct  64    HGVPEGVIEKIMKVTREFFGLPESEKLKSYSTDPFKASRLSTSFNVNSEKVSNWRDFLRL  123

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVL----  1319
             HC+P++ Y  EWPSNPP+LR+ V  Y  ++R V  K+ EAISESLGL+      V+    
Sbjct  124   HCHPIEDYIKEWPSNPPSLREDVAEYCRKMRGVSLKLVEAISESLGLETDYINRVVGGKK  183

Query  1318  GEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRP  1139
             G++ QH+A+N+YP CPEPELTYGLP HTDP  +TILLQD +V GLQVLKDGKW+AV P P
Sbjct  184   GQEQQHLAMNYYPACPEPELTYGLPGHTDPTVITILLQD-EVPGLQVLKDGKWVAVNPIP  242

Query  1138  DAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVIS-APKPLLDDE  962
             + FV+N+GDQ+Q +SN KYKSV HRA+VN +K R+S+ +F  P  DA+I  AP+ +    
Sbjct  243   NTFVVNVGDQIQVISNDKYKSVLHRAVVNCNKDRISIPTFYFPSNDAIIGPAPQLIHHHH  302

Query  961   SPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
              P  Y +FTY EYY  FW+R L++E CL+ FK
Sbjct  303   HPPQYNNFTYNEYYQNFWNRGLSKETCLDIFK  334



>ref|XP_010437037.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Camelina 
sativa]
Length=350

 Score =   366 bits (939),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 179/344 (52%), Positives = 237/344 (69%), Gaps = 8/344 (2%)
 Frame = -3

Query  1876  SMTTQLLFS--GTPYSTLPQKYIRPESERPKLSEV-TTCDDVPVIDL---GCGDRSFIVR  1715
             S T++LL S   +  S +P  Y+RP S+RP L +V ++ D +P+IDL      +R+  V 
Sbjct  4     SATSKLLLSDFASSISRIPPNYVRPISDRPNLLDVESSGDSIPLIDLRELHGPNRAESVH  63

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             Q+ +AC  YGFFQ+ NHGVP K I+ ML VA EFF+    E++K YS D +KT R+STSF
Sbjct  64    QLANACSTYGFFQIKNHGVPDKTIDKMLTVAREFFHQPESERVKHYSADSTKTTRVSTSF  123

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             NV  + V NWRD+LRLHC+P++ +  EWPS+P + ++V   Y T VR +   + EAISES
Sbjct  124   NVSADKVLNWRDFLRLHCFPIEDFIQEWPSSPVSFKEVTAEYATSVRALILTLLEAISES  183

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL+     N+LG+  QHMA N+YPPCPEPELTYGLP H DP  +T+LLQD QV+GLQV 
Sbjct  184   LGLESDHISNILGQHAQHMAFNYYPPCPEPELTYGLPGHKDPTVITVLLQD-QVSGLQVF  242

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             KD KW +V P P+ F +NIGDQ+Q +SN KYKSV HRAIVNT + R+S+ +F  P  DAV
Sbjct  243   KDDKWFSVNPIPNTFTVNIGDQMQVISNDKYKSVLHRAIVNTKRERLSIPTFYFPSTDAV  302

Query  994   ISAPKPLLDD-ESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             I     L+++ ES AVYR F + EY+ KFW+R+L    CL+ FK
Sbjct  303   IGPANELINEQESLAVYRTFPFVEYWDKFWNRSLATASCLDAFK  346



>gb|KCW77284.1| hypothetical protein EUGRSUZ_D01643 [Eucalyptus grandis]
Length=343

 Score =   365 bits (938),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 172/327 (53%), Positives = 236/327 (72%), Gaps = 6/327 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCD--DVPVIDLGC---GDRSFIVRQIGDACRHYGFFQVIN  1667
             +P  YI P+++RP L+EV   D   +P+IDL      +R  I+RQIG AC+  GFFQ+ N
Sbjct  14    VPNNYIWPQADRPNLTEVEASDASTIPLIDLQGLFGPNRDDIIRQIGKACQQDGFFQIKN  73

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HG+ +++++ ++ +A EFF L   E++K YSDD S++ RL TSFN+K E V  WR++LRL
Sbjct  74    HGIQEEMVQAIMNIAGEFFRLPESERLKNYSDDRSESTRLWTSFNIKTEKVSYWREFLRL  133

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
              CYPL++Y  EWP+NPP+ R  V  Y T VR++  K+ EAISESLGL+ +     LG+ G
Sbjct  134   LCYPLEEYMHEWPTNPPSFRKEVGEYCTRVRELALKLLEAISESLGLEREYISENLGKHG  193

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             Q MA+N+YPPCP+PELTYGL  HTDPN +TILLQD  V GLQVL++GKW+AV P P+ F+
Sbjct  194   QRMAMNYYPPCPQPELTYGLLCHTDPNLITILLQD-DVPGLQVLRNGKWIAVNPIPNTFI  252

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             +N+GDQ+Q +SN KYKS+ HRA+VN+D+ R+S+ +F CP  +A+I   + L+D E PAVY
Sbjct  253   VNMGDQMQVISNDKYKSILHRAVVNSDRERISIPTFYCPSPEALIGPAQGLIDHEHPAVY  312

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             R FTY EYY  FW++ L  E CL+ FK
Sbjct  313   RSFTYKEYYHTFWNKGLMTECCLDMFK  339



>emb|CDX86858.1| BnaA09g22480D [Brassica napus]
Length=339

 Score =   365 bits (937),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 179/342 (52%), Positives = 233/342 (68%), Gaps = 15/342 (4%)
 Frame = -3

Query  1876  SMTTQLLFSGTPYST--LPQKYIRPESERPKLSEV-TTCDDVPVIDLGCGDRSFIVRQIG  1706
             S T++LL S    S   +P  Y+RP S+RP LSE+ T+ D +P+IDL         +++ 
Sbjct  4     SATSKLLVSDIASSVDHVPSNYVRPISDRPNLSEIETSGDSIPMIDL---------QELH  54

Query  1705  DACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVK  1526
                R    +Q+ NHGVP+K IE M+ VA EFF     E++K YS D  KT RLSTSFNV 
Sbjct  55    GPNRAGVIYQIKNHGVPEKTIERMMTVAREFFRQPESERVKHYSADTKKTTRLSTSFNVG  114

Query  1525  KETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGL  1346
              E   NWRD+LRLHC P++ +  EWPS+P + RDV   Y T VR +   + EAISESLGL
Sbjct  115   SEKFSNWRDFLRLHCLPIEDFISEWPSSPVSFRDVTAEYATSVRALVLVLLEAISESLGL  174

Query  1345  DPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDG  1166
                   N LG+ GQHMA+N+YPPCP+P+LT+GLP H DPN +T+LLQD +V+GLQV KDG
Sbjct  175   AKDSVSNTLGKHGQHMALNYYPPCPQPDLTFGLPGHKDPNLITLLLQD-EVSGLQVFKDG  233

Query  1165  KWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISA  986
             KW+AV P P+ F++NIGDQ+Q +SN KYKSV HRA+VN+DK R+S+ +F CP  DAV+  
Sbjct  234   KWIAVHPVPNTFIVNIGDQMQVISNDKYKSVLHRAVVNSDKERISIPTFYCPSLDAVVGP  293

Query  985   PKPLL--DDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
              + L+  ++ESPAVYR F Y EYY KFW R L  E C++ FK
Sbjct  294   QQELINEEEESPAVYRSFIYAEYYEKFWDRALATESCIDLFK  335



>ref|XP_006288121.1| hypothetical protein CARUB_v10001353mg [Capsella rubella]
 gb|EOA21019.1| hypothetical protein CARUB_v10001353mg [Capsella rubella]
Length=341

 Score =   365 bits (936),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 179/345 (52%), Positives = 235/345 (68%), Gaps = 19/345 (6%)
 Frame = -3

Query  1876  SMTTQLLFS--GTPYSTLPQKYIRPESERPKLSEV-TTCDDVPVIDLG---CGDRSFIVR  1715
             S T++LL S   +    +P  Y+RP S+RP +SEV T+ + +P+IDL      +R+ I+ 
Sbjct  4     SATSKLLVSDIASVVDHVPSNYVRPISDRPNMSEVETSGETIPLIDLQDLHGPNRADIIN  63

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             Q   AC  YGFFQ+ NHGVP++ I+ M+            E++K YS D  KT RLSTSF
Sbjct  64    QFAHACSSYGFFQIKNHGVPEETIKRMMN----------SERVKHYSADTKKTTRLSTSF  113

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             NV KE V NWRD+LRLHCYP++ +  EWPS P + R+V   Y T VR +   + EAISES
Sbjct  114   NVCKEKVSNWRDFLRLHCYPIEDFINEWPSTPLSFREVTAEYATSVRALVLTLLEAISES  173

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL        LG+ GQHMA+N+YPPCP+PELTYGLP H D N +T+LLQD  V+GLQV 
Sbjct  174   LGLPKDRVSKTLGKHGQHMAINYYPPCPQPELTYGLPGHKDANLITVLLQD-DVSGLQVF  232

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             KD KW+AVKP P+ F++N+GDQ+Q +SN KYKSV HRA+VN+DK R+S+ +F CP EDAV
Sbjct  233   KDDKWVAVKPVPNTFIVNLGDQMQVISNDKYKSVLHRAVVNSDKERISIPTFYCPSEDAV  292

Query  994   ISAPKPLLDDE--SPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             IS  + L+++E  SPA+YR FTY EY+ KFW      E C++ FK
Sbjct  293   ISPAQELINEEEDSPAIYRSFTYAEYFEKFWDTAFATESCVDSFK  337



>ref|XP_010054743.1| PREDICTED: 2'-deoxymugineic-acid 2'-dioxygenase-like [Eucalyptus 
grandis]
Length=371

 Score =   366 bits (939),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 172/327 (53%), Positives = 236/327 (72%), Gaps = 6/327 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCD--DVPVIDLGC---GDRSFIVRQIGDACRHYGFFQVIN  1667
             +P  YI P+++RP L+EV   D   +P+IDL      +R  I+RQIG AC+  GFFQ+ N
Sbjct  42    VPNNYIWPQADRPNLTEVEASDASTIPLIDLQGLFGPNRDDIIRQIGKACQQDGFFQIKN  101

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HG+ +++++ ++ +A EFF L   E++K YSDD S++ RL TSFN+K E V  WR++LRL
Sbjct  102   HGIQEEMVQAIMNIAGEFFRLPESERLKNYSDDRSESTRLWTSFNIKTEKVSYWREFLRL  161

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
              CYPL++Y  EWP+NPP+ R  V  Y T VR++  K+ EAISESLGL+ +     LG+ G
Sbjct  162   LCYPLEEYMHEWPTNPPSFRKEVGEYCTRVRELALKLLEAISESLGLEREYISENLGKHG  221

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             Q MA+N+YPPCP+PELTYGL  HTDPN +TILLQD  V GLQVL++GKW+AV P P+ F+
Sbjct  222   QRMAMNYYPPCPQPELTYGLLCHTDPNLITILLQD-DVPGLQVLRNGKWIAVNPIPNTFI  280

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             +N+GDQ+Q +SN KYKS+ HRA+VN+D+ R+S+ +F CP  +A+I   + L+D E PAVY
Sbjct  281   VNMGDQMQVISNDKYKSILHRAVVNSDRERISIPTFYCPSPEALIGPAQGLIDHEHPAVY  340

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             R FTY EYY  FW++ L  E CL+ FK
Sbjct  341   RSFTYKEYYHTFWNKGLMTECCLDMFK  367



>ref|XP_003521829.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase [Glycine 
max]
Length=349

 Score =   365 bits (937),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 186/349 (53%), Positives = 239/349 (68%), Gaps = 14/349 (4%)
 Frame = -3

Query  1873  MTTQLLFSGTPYSTL---PQKYIRPESERPKLSEVTTCDDV--PVIDLG---CGDRSFIV  1718
             M  +L+      ST+   P  +IRP  +RP L  V    DV  P+IDL      +RS I+
Sbjct  1     MAEKLVLVSDMASTMKQVPSNFIRPLGDRPNLQGVVQSSDVCIPLIDLQDLHGPNRSHII  60

Query  1717  RQIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTS  1538
             +QI  AC++YGFFQV NHGVP+ VIE ++KV  EFF L   EK+K YS DP K  RLSTS
Sbjct  61    QQIDQACQNYGFFQVTNHGVPEGVIEKIMKVTREFFGLPESEKLKSYSTDPFKASRLSTS  120

Query  1537  FNVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISE  1358
             FNV  E V +WRD+LRLHC+P++ Y  EWPSNPP+LR+ V  Y  ++R V  K+ EAISE
Sbjct  121   FNVNSEKVSSWRDFLRLHCHPIEDYIKEWPSNPPSLREDVAEYCRKMRGVSLKLVEAISE  180

Query  1357  SLGLDPQCFKNVL----GEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVA  1190
             SLGL+      V+    G++ QH+A+N+YP CPEPELTYGLP HTDP  +TILLQD +V 
Sbjct  181   SLGLERDYINRVVGGKKGQEQQHLAMNYYPACPEPELTYGLPGHTDPTVITILLQD-EVP  239

Query  1189  GLQVLKDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCP  1010
             GLQVLKDGKW+AV P P+ FV+N+GDQ+Q +SN KYKSV HRA+VN +K R+S+ +F  P
Sbjct  240   GLQVLKDGKWVAVNPIPNTFVVNVGDQIQVISNDKYKSVLHRAVVNCNKDRISIPTFYFP  299

Query  1009  GEDAVIS-APKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
               DA+I  AP+ +     P  Y +FTY EYY  FW+R L++E CL+ FK
Sbjct  300   SNDAIIGPAPQLIHHHHHPPQYNNFTYNEYYQNFWNRGLSKETCLDIFK  348



>ref|XP_004145878.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Cucumis 
sativus]
 gb|KGN49964.1| hypothetical protein Csa_5G146870 [Cucumis sativus]
Length=347

 Score =   363 bits (932),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 175/327 (54%), Positives = 224/327 (69%), Gaps = 6/327 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCD--DVPVIDLGCGD---RSFIVRQIGDACRHYGFFQVIN  1667
             +P +Y+RP S+RP  S+V   +     VIDL   D   R  ++ QI  AC   GFF V N
Sbjct  21    VPSRYVRPISDRPNSSDVRPSNTYSFSVIDLHALDGPSRPDVIYQIRRACERDGFFLVKN  80

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HGVP+++I  ++++  EFF L   E++K YSDDP+K  RLSTSFNVK E V NWRD+LRL
Sbjct  81    HGVPEEMINGVMRITREFFRLPESERLKSYSDDPTKKTRLSTSFNVKTEKVANWRDFLRL  140

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HCYPL  Y  EWPSNPP+ R  V  Y T +RQ+  K+ EAISESLGL      N +G  G
Sbjct  141   HCYPLHLYVDEWPSNPPSFRKEVAEYCTTMRQLTLKLLEAISESLGLPKDSIANSIGSHG  200

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMA+N+YPPCP+P+LTYGLP HTDPN +T+LLQD QV GLQV +DG W+A+ P P+ F+
Sbjct  201   QHMALNYYPPCPQPDLTYGLPCHTDPNLITLLLQD-QVPGLQVHRDGAWVALNPIPNTFI  259

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             INIGDQ+Q LSN +YKSV HRA+VN    R+S+ +F CP  +A+I   K L+ DE    +
Sbjct  260   INIGDQMQVLSNDRYKSVLHRAVVNNSTERISIPTFYCPSPEAMIGPAKELIHDEHRPAF  319

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             R+FTY EYY  FWS  L+   CL+ F+
Sbjct  320   RNFTYSEYYQTFWSGELDTRRCLDLFR  346



>ref|XP_004165509.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Cucumis 
sativus]
Length=347

 Score =   363 bits (931),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 175/327 (54%), Positives = 224/327 (69%), Gaps = 6/327 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCD--DVPVIDLGCGD---RSFIVRQIGDACRHYGFFQVIN  1667
             +P +Y+RP S+RP  S+V   +     VIDL   D   R  ++ QI  AC   GFF V N
Sbjct  21    VPSRYVRPISDRPNSSDVRPSNTYSFSVIDLHALDGPSRPDVIYQIRRACERDGFFLVKN  80

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HGVP+++I  ++++  EFF L   E++K YSDDP+K  RLSTSFNVK E V NWRD+LRL
Sbjct  81    HGVPEEMINGVMRITREFFRLPESERLKSYSDDPTKKTRLSTSFNVKTEKVANWRDFLRL  140

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HCYPL  Y  EWPSNPP+ R  V  Y T +RQ+  K+ EAISESLGL      N +G  G
Sbjct  141   HCYPLHLYVDEWPSNPPSFRKEVAEYCTTMRQLTLKLLEAISESLGLPKDSIANSIGSHG  200

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMA+N+YPPCP+P+LTYGLP HTDPN +T+LLQD QV GLQV +DG W+A+ P P+ F+
Sbjct  201   QHMALNYYPPCPQPDLTYGLPCHTDPNLITLLLQD-QVPGLQVHRDGAWVALNPIPNTFI  259

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             INIGDQ+Q LSN +YKSV HRA+VN    R+S+ +F CP  +A+I   K L+ DE    +
Sbjct  260   INIGDQMQVLSNDRYKSVLHRAVVNNATERISIPTFYCPSPEAMIGPAKELIHDEHRPAF  319

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             R+FTY EYY  FWS  L+   CL+ F+
Sbjct  320   RNFTYSEYYQTFWSGELDTRRCLDLFR  346



>ref|XP_008437463.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Cucumis 
melo]
Length=349

 Score =   363 bits (931),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 181/344 (53%), Positives = 227/344 (66%), Gaps = 8/344 (2%)
 Frame = -3

Query  1876  SMTTQLLFS--GTPYSTLPQKYIRPESERPKLSEV--TTCDDVPVIDLGCGD---RSFIV  1718
             S+ T+LL +        +P +Y+RP S+RP  S+V  +      VIDL   D   RS +V
Sbjct  4     SVDTKLLVTDLAATVQQVPSRYVRPISDRPNFSDVRPSHAYSFSVIDLHALDGPSRSDVV  63

Query  1717  RQIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTS  1538
              QIG AC   GFF V NHGV +++I  M+ +  EFF L   E++K YSDDP+K  RLSTS
Sbjct  64    DQIGRACERDGFFLVKNHGVSEEMINGMMSITKEFFRLPETERLKSYSDDPTKKTRLSTS  123

Query  1537  FNVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISE  1358
             FNVK E V NWRD+LRLHCYPL  Y  EWPSNP   R  V  Y T +RQ+  K+ EAISE
Sbjct  124   FNVKTEKVANWRDFLRLHCYPLHLYVDEWPSNPSFFRKEVAEYCTSMRQLTLKLLEAISE  183

Query  1357  SLGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQV  1178
             SLGL      N +G  GQHMA+N+YPPCP+P+LTYGLP HTDPN +T+LLQD QV GLQV
Sbjct  184   SLGLPKDSIANSIGSHGQHMALNYYPPCPQPDLTYGLPCHTDPNLITLLLQD-QVPGLQV  242

Query  1177  LKDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDA  998
              +DG W+A+ P P+ F+INIGDQ+Q LSN +YKSV HRA+VN    R+S+ +F CP  +A
Sbjct  243   HRDGAWVALDPIPNTFIINIGDQMQVLSNDRYKSVLHRAVVNNATERISIPTFYCPSPEA  302

Query  997   VISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
              I   K L+D E    +R FTY EYY  FWS  L+   CL+ F+
Sbjct  303   TIRPAKELIDGEHRPAFRQFTYSEYYQTFWSGELDTRRCLDLFR  346



>gb|AAP54811.2| oxidoreductase, 2OG-Fe oxygenase family protein, expressed [Oryza 
sativa Japonica Group]
Length=270

 Score =   359 bits (922),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 200/252 (79%), Gaps = 0/252 (0%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACRHYGFF  1679
             L S   + T+P KY+RPES+RP+L  V +   +PV+DL   DR+ +V  +GDACR +GFF
Sbjct  11    LLSTAVHDTMPGKYVRPESQRPRLDLVVSDARIPVVDLASPDRAAVVSAVGDACRTHGFF  70

Query  1678  QVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRD  1499
             QV+NHG+   +I  +++V  EFF L  EEK KLYSDDP+K +RLSTSFNV+KETVHNWRD
Sbjct  71    QVVNHGIDAALIASVMEVGREFFRLPAEEKAKLYSDDPAKKIRLSTSFNVRKETVHNWRD  130

Query  1498  YLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVL  1319
             YLRLHCYPL ++ P+WPSNPP+ ++++  Y TEVR++GF++ EAISESLGL+    +  L
Sbjct  131   YLRLHCYPLHQFVPDWPSNPPSFKEIIGTYCTEVRELGFRLYEAISESLGLEGGYMRETL  190

Query  1318  GEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRP  1139
             GEQ QHMAVN+YP CPEPELTYGLPAHTDPNALTILL D QVAGLQVL DGKW+AV P+P
Sbjct  191   GEQEQHMAVNYYPQCPEPELTYGLPAHTDPNALTILLMDDQVAGLQVLNDGKWIAVNPQP  250

Query  1138  DAFVINIGDQLQ  1103
              A VINIGDQLQ
Sbjct  251   GALVINIGDQLQ  262



>ref|XP_002300518.1| hypothetical protein POPTR_0001s45600g [Populus trichocarpa]
 gb|EEE85323.1| hypothetical protein POPTR_0001s45600g [Populus trichocarpa]
Length=346

 Score =   362 bits (929),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/338 (52%), Positives = 232/338 (69%), Gaps = 7/338 (2%)
 Frame = -3

Query  1873  MTTQLLFSGTPYST---LPQKYIRPESERPKLSEVTTCDDVPVIDL---GCGDRSFIVRQ  1712
             M T+LL +    S    +P  YIRP S+RP  SEV     +P++DL       RS I+ Q
Sbjct  1     MATKLLLTDVAASCVKQIPSNYIRPISDRPNFSEVERSGSIPLVDLEGLHSHRRSEIIMQ  60

Query  1711  IGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFN  1532
             IG AC+ YGFF V NHGVP+K++ + L +A EFF L   E+MK YSDD  +++RLST+FN
Sbjct  61    IGQACQDYGFFLVRNHGVPEKMMNNALLMAKEFFKLPENERMKYYSDDHRRSIRLSTTFN  120

Query  1531  VKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESL  1352
             VK E V+ WRD+LR H  PL+ Y  EWP NPP+ R  V  Y T VR +  ++ EAISESL
Sbjct  121   VKTEKVYIWRDFLRFHSNPLEDYVHEWPPNPPSFRKDVGEYCTGVRALVLRLLEAISESL  180

Query  1351  GLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLK  1172
             GL+       LG+ GQH+++N+YPPCP+PELT+G+P HTDP  +T+LL + +V GLQV K
Sbjct  181   GLEKDYINKALGKHGQHVSMNYYPPCPQPELTFGVPGHTDPTMITVLLPN-EVPGLQVFK  239

Query  1171  DGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVI  992
             +GKW+AV   P+ FVINIGDQ+Q LSN +YKSV HRA+VN DK R+S+A+F  P  DA +
Sbjct  240   NGKWMAVNSVPNTFVINIGDQMQVLSNDRYKSVLHRAVVNCDKERISIATFYYPSLDATM  299

Query  991   SAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCL  878
                K L+DD++PA YR+ ++ E+Y KFW+R L  E CL
Sbjct  300   GPAKELIDDDNPAAYRNHSFSEFYEKFWNRGLATECCL  337



>emb|CDX99548.1| BnaC09g24440D [Brassica napus]
Length=339

 Score =   359 bits (922),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 176/342 (51%), Positives = 233/342 (68%), Gaps = 15/342 (4%)
 Frame = -3

Query  1876  SMTTQLLFSGTPYST--LPQKYIRPESERPKLSEV-TTCDDVPVIDLGCGDRSFIVRQIG  1706
             S T++LL S    S   +P  Y+RP S+RP LS++ T+ D +P+IDL         +++ 
Sbjct  4     SATSKLLVSDIASSVDHVPSNYVRPISDRPNLSKIETSGDSIPMIDL---------QELH  54

Query  1705  DACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVK  1526
              + R    +Q+ NHGVP+K IE M+ VA EFF     E++K YS D  KT RLSTSFNV 
Sbjct  55    GSNRADVIYQIKNHGVPEKTIERMMTVAREFFRQPESERVKHYSADTKKTTRLSTSFNVG  114

Query  1525  KETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGL  1346
              E V NWRD+LRLHC P++ +  EWPS+P + R+V   Y T VR +   + EAISESLGL
Sbjct  115   SEKVSNWRDFLRLHCLPIEDFISEWPSSPVSFREVTAEYATSVRALVLVLLEAISESLGL  174

Query  1345  DPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDG  1166
                   N LG+ GQHMA+N+YPPCP+P+LT+GLP H DPN +T LLQD +V+GLQV KDG
Sbjct  175   AKDSVSNTLGKHGQHMALNYYPPCPQPDLTFGLPGHKDPNLITALLQD-EVSGLQVFKDG  233

Query  1165  KWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISA  986
             KW+AV P P+ F++N+GDQ+Q +SN KYKSV  RA+VN+DK R+S+ +F CP  DAV+  
Sbjct  234   KWIAVHPVPNTFIVNVGDQMQVISNDKYKSVLQRAVVNSDKERISIPTFYCPSLDAVVGP  293

Query  985   PKPLL--DDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
              + L+  ++ES AVYR FTY EYY KFW R L  E C++ FK
Sbjct  294   QQELINEEEESHAVYRSFTYAEYYEKFWDRALATESCIDLFK  335



>ref|XP_010421965.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Camelina 
sativa]
Length=350

 Score =   358 bits (918),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 175/344 (51%), Positives = 235/344 (68%), Gaps = 8/344 (2%)
 Frame = -3

Query  1876  SMTTQLLFS--GTPYSTLPQKYIRPESERPKLSEV-TTCDDVPVIDLG---CGDRSFIVR  1715
             S T++LL S   +  S +P  Y+RP S+RP L +V ++ D +P+IDL      +R+ IV 
Sbjct  4     SATSKLLVSDFASSISHVPPNYVRPISDRPNLLDVESSGDSIPLIDLQELHGPNRAEIVH  63

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             Q+ +AC  YGFFQ+ NHGV  K I+ ML VA +FF+    E++K YS D +KT R+STSF
Sbjct  64    QLANACSTYGFFQIKNHGVSDKTIDKMLTVARDFFHQPESERVKHYSADSTKTTRVSTSF  123

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             NV  + V NWRD+LRLHC+P++ +  EWPS+P + ++V   Y T VR +   + EAISES
Sbjct  124   NVSADKVLNWRDFLRLHCFPIKDFIEEWPSSPNSFKEVTAEYATSVRALILTLLEAISES  183

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL+     N+L +  QHMA N+YPPCPEPELTYGLP H DP  +T+LLQD  V+GLQV 
Sbjct  184   LGLESDHISNILRQHAQHMAFNYYPPCPEPELTYGLPGHKDPTVITVLLQD-HVSGLQVF  242

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             KD KW +V P P+ F +NIGDQ+Q +SN KYKSV HRA+VNT++ R+S+ +F  P  DAV
Sbjct  243   KDDKWFSVNPIPNTFTVNIGDQMQVISNDKYKSVLHRAVVNTERERLSIPTFYFPSTDAV  302

Query  994   ISAPKPLLDD-ESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             I     L+++ ES AVYR F + EY+ KFW R+L    CL+ FK
Sbjct  303   IGPANELINEQESLAVYRTFPFVEYWDKFWKRSLATASCLDAFK  346



>ref|XP_010455446.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Camelina 
sativa]
Length=350

 Score =   357 bits (915),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 175/344 (51%), Positives = 236/344 (69%), Gaps = 8/344 (2%)
 Frame = -3

Query  1876  SMTTQLLFSG--TPYSTLPQKYIRPESERPKLSEV-TTCDDVPVIDL---GCGDRSFIVR  1715
             S T++LL S   +  S +P  Y+RP S+RP L +V ++ D +P+IDL      +R+ IV 
Sbjct  4     SATSKLLVSDFDSSISHVPPNYVRPISDRPNLLDVESSGDSIPLIDLRELHGPNRAEIVH  63

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             Q+ +A   YGFFQ+ NHGVP K I+ ML VA +FF+    E++K YS D +KT R+STSF
Sbjct  64    QLANASSTYGFFQIKNHGVPDKTIDQMLAVARDFFHQPESERVKHYSADSTKTTRVSTSF  123

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             NV  + V NWRD+LRLHC+P++ +  EWPS+P + ++V   Y T VR +   + EAISES
Sbjct  124   NVSADKVLNWRDFLRLHCFPIKDFIQEWPSSPDSFKEVTAEYATSVRALILTLLEAISES  183

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL+     N+L +  QHMA N+YPPCPEPELTYGLP H DP  +T+LLQD QV+GLQV 
Sbjct  184   LGLESDHISNILRQHAQHMAFNYYPPCPEPELTYGLPEHKDPTVITVLLQD-QVSGLQVF  242

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             KD KW +V P P+ F +NIGDQ+Q +SN KYKSV HRA+VNT++ R+S+ +F  P  DAV
Sbjct  243   KDDKWFSVNPIPNTFTVNIGDQMQVISNDKYKSVIHRAVVNTERERLSIPTFYFPSTDAV  302

Query  994   ISAPKPLLDD-ESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             I     L+++ ES AVYR F + EY+  FW+R+L    CL+ FK
Sbjct  303   IGPANELINEQESLAVYRTFPFVEYWDTFWNRSLATASCLDAFK  346



>gb|KDO39552.1| hypothetical protein CISIN_1g020127mg [Citrus sinensis]
Length=330

 Score =   354 bits (908),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 181/343 (53%), Positives = 226/343 (66%), Gaps = 25/343 (7%)
 Frame = -3

Query  1876  SMTTQLLFS--GTPYSTLPQKYIRPESERPKLSEVTTCD-DVPVIDLGCGD---RSFIVR  1715
             + TT+LL S   +   ++P  YIRP S+RP L+EV   D  +P+IDL   D   R  I++
Sbjct  3     AATTKLLLSDLASTVKSVPSNYIRPISDRPNLTEVQISDGSIPLIDLQVLDGPRRLDIIK  62

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             QIG AC+H GFFQV NHG+P+ +I  ML +   FF L   E++K YSDDPSK+ RLSTSF
Sbjct  63    QIGQACQHDGFFQVKNHGIPETIINSMLSITRAFFKLPESERLKSYSDDPSKSTRLSTSF  122

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             NV  E V NWRDYLRLHCYPLQ Y  EWPSNPP+ R          R +  ++ EAISES
Sbjct  123   NVNTEKVSNWRDYLRLHCYPLQDYIHEWPSNPPSFR------YNYARGLVLRLLEAISES  176

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
             LGL        LG+  QHMA+N+YP CP+P+LTYGLP H DPN +T+LLQD  V GLQVL
Sbjct  177   LGLQRDYIDKALGKHRQHMALNYYPHCPQPDLTYGLPGHIDPNLITVLLQD-DVPGLQVL  235

Query  1174  KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAV  995
             + GKWL V P P+ F++ IGDQ+Q LSN +YKSV HRA+VN DK R+S+ +F CP  DAV
Sbjct  236   RKGKWLPVNPIPNTFIVKIGDQMQVLSNDRYKSVLHRALVNCDKERISIPTFYCPSPDAV  295

Query  994   ISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             I+  K L+D+  PA            KFW+R L  E CL+ FK
Sbjct  296   IAPAKDLIDERHPA------------KFWNRGLVDECCLDLFK  326



>emb|CDX99550.1| BnaC09g24420D [Brassica napus]
Length=341

 Score =   345 bits (886),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 175/345 (51%), Positives = 231/345 (67%), Gaps = 19/345 (6%)
 Frame = -3

Query  1876  SMTTQLLFSGTPYST--LPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGD  1703
             S T++LL S    S   +P  Y+RP S+RP LS  T+ D +P+IDL         +++  
Sbjct  4     SATSKLLVSDIASSVDHVPSNYVRPISDRPNLSIETSGDSIPMIDL---------QELHG  54

Query  1702  ACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKK  1523
               R    +Q+ NHGVP+K IE M+ VA EFF     E++K YS D  KT RLSTSFNV  
Sbjct  55    PNRADVIYQIKNHGVPEKTIERMMTVAREFFRQPESERVKHYSADTKKTTRLSTSFNVGS  114

Query  1522  ETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGL-  1346
             E V NWR++LRLHC P++ +  EWPS+P + R+V   Y T VR +   + E ISESLGL 
Sbjct  115   EKVSNWREFLRLHCLPIEDFISEWPSSPVSFREVTAEYATSVRALVLVLLEEISESLGLA  174

Query  1345  -DPQC-FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLK  1172
              D  C   N LG+  QHMA+N+YPPCP+P+LT+GLP H DPN +T+LLQD +V+GLQV K
Sbjct  175   KDSDCKASNTLGKHSQHMALNYYPPCPQPDLTFGLPGHKDPNLITVLLQD-EVSGLQVFK  233

Query  1171  DGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVI  992
             DGKW+AV P P+ F++N+GDQ+Q +SN KYKS  HRA+VN+DK  + + +F CP  DAV+
Sbjct  234   DGKWIAVHPVPNTFIVNMGDQMQVISNDKYKSELHRAVVNSDKEWILIPTFYCPSLDAVV  293

Query  991   SAPKPLL---DDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
               P+P+L   ++ES AVYR FTY EYY KFW R L  E C++ FK
Sbjct  294   -GPQPMLINEEEESHAVYRSFTYAEYYEKFWDRALATESCIDLFK  337



>emb|CBI34622.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   343 bits (881),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 166/313 (53%), Positives = 223/313 (71%), Gaps = 9/313 (3%)
 Frame = -3

Query  1870  TTQLLFSGTPYST--LPQKYIRPESERPKLSEVTTCD-DVPVIDL----GCGDRSFIVRQ  1712
             TT+LL +        +P  Y+RP SERP   +V   D  +P+IDL    G G R  +V+Q
Sbjct  5     TTKLLLTDMVLGVDHVPSNYVRPPSERPNFKDVQASDVSIPLIDLQDLQGPG-RPDVVKQ  63

Query  1711  IGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFN  1532
             IG AC+H GFFQ+ NHGV + +I ++L++A +FF L   E++K YSD+PS  +RLSTSFN
Sbjct  64    IGQACQHSGFFQIQNHGVSETMISNILRLARDFFQLPESERLKNYSDNPSNPVRLSTSFN  123

Query  1531  VKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESL  1352
             VK E V NWRD+LRLHCYPL+ Y  +WPSNPP+ R+ V  Y T +R +  ++ E ISESL
Sbjct  124   VKTEKVANWRDFLRLHCYPLEDYVHQWPSNPPSFREDVAEYCTSIRALVLRLLETISESL  183

Query  1351  GLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLK  1172
             GL+      VLG+ GQHMA+N+YPPCP+PELTYGLP HTD + +T+LLQD  V GLQVL+
Sbjct  184   GLEKNYVSGVLGKHGQHMAMNYYPPCPQPELTYGLPGHTDCSLITVLLQD-DVPGLQVLR  242

Query  1171  DGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVI  992
             +GKW++V P P++F++NIGD +Q +SN +YKSV HRA+VN +K R+S+ +F CP  DAVI
Sbjct  243   NGKWVSVNPIPNSFIVNIGDHMQVISNDRYKSVLHRAVVNCNKDRISIPTFYCPSPDAVI  302

Query  991   SAPKPLLDDESPA  953
                  L+DD+ PA
Sbjct  303   GPSPELVDDDHPA  315



>dbj|BAJ95938.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=272

 Score =   338 bits (868),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/270 (57%), Positives = 196/270 (73%), Gaps = 1/270 (0%)
 Frame = -3

Query  1675  VINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDY  1496
             V NHG+P+ V++ ML+VA EFF+L   E++K YSDDP K +RLSTSFNV+ E V NWRD+
Sbjct  1     VTNHGIPEAVVDGMLRVAREFFHLPESERLKCYSDDPKKAIRLSTSFNVRTEKVSNWRDF  60

Query  1495  LRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLG  1316
             LRLHCYPL+ +  +WPSNPP  R+ V  Y TE R +  ++ EAISESLGL+       +G
Sbjct  61    LRLHCYPLESFIDQWPSNPPAFREAVGTYSTEARALALRLLEAISESLGLERGHMVKAMG  120

Query  1315  EQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPD  1136
                QHMAVN+YPPCP+PELTYGLP H DPNA+T+LLQD  V+GLQV +DG+W+AV P P 
Sbjct  121   RHAQHMAVNYYPPCPQPELTYGLPGHKDPNAVTLLLQD-GVSGLQVRRDGRWVAVNPVPG  179

Query  1135  AFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESP  956
             A VINIGDQLQALSN +YKSV HR IVN++  R+SV +F CP  DAV++  + L+D    
Sbjct  180   ALVINIGDQLQALSNDRYKSVLHRVIVNSESERISVPTFYCPSPDAVVAPAEALVDGGHR  239

Query  955   AVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
               YR FTY EYY +FW+  L    CL+ F+
Sbjct  240   LAYRPFTYQEYYEEFWNMGLEAASCLDRFR  269



>gb|KCW45490.1| hypothetical protein EUGRSUZ_L00788 [Eucalyptus grandis]
Length=329

 Score =   340 bits (871),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 169/327 (52%), Positives = 222/327 (68%), Gaps = 26/327 (8%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCD--DVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVIN  1667
             +P  YIR E++RP L+EV   D   +P++DL      +R  I+RQIG AC+  GFFQ+ N
Sbjct  20    VPDNYIRSEADRPNLTEVEASDASSIPLVDLQGLSGPNRDDIIRQIGRACQQDGFFQIKN  79

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HG+P++                  E++K Y DDP+K+ RLSTSFN+  ETV NWRD+L L
Sbjct  80    HGIPEEK----------------SERLKNYCDDPTKSTRLSTSFNLNTETVSNWRDFLSL  123

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HC+ L     EWP+NPP+ R  V  Y T VR++  K+ EAISESLGL+ +     LG+ G
Sbjct  124   HCHSLH----EWPTNPPSFRKEVGEYCTRVRELVLKLLEAISESLGLEREYISQNLGKHG  179

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMA+N+YPPCP+PELTYGLP HTDPN +TILLQD  V GLQVLK+GKW+AV P  + F+
Sbjct  180   QHMAMNYYPPCPQPELTYGLPGHTDPNLITILLQD-DVPGLQVLKNGKWVAVNPIHNTFI  238

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             +NIGDQ+Q +SN KYKSV HRA+VN +  R+S+ +F CP  + +I   + L+D E PAVY
Sbjct  239   VNIGDQMQVISNDKYKSVLHRAVVNCNTERISIPTFYCPSPEGLIRPAQGLIDHEHPAVY  298

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             + FT+ EYY KF+ R L  E CL+ FK
Sbjct  299   KSFTWEEYYHKFYYRVLRTECCLDMFK  325



>ref|XP_006421685.1| hypothetical protein CICLE_v10006618mg [Citrus clementina]
 gb|ESR34925.1| hypothetical protein CICLE_v10006618mg [Citrus clementina]
Length=339

 Score =   340 bits (871),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 176/349 (50%), Positives = 222/349 (64%), Gaps = 42/349 (12%)
 Frame = -3

Query  1876  SMTTQLLFS--GTPYSTLPQKYIRPESERPKLSEVTTCD-DVPVIDLGCGD---RSFIVR  1715
             + TT+LL S   +   ++P  YIRP S+RP L+EV   D  +P+IDL   D   R  I++
Sbjct  3     AATTKLLLSDLASTVKSVPSNYIRPISDRPNLTEVQISDGSIPLIDLQVLDGPRRLDIIK  62

Query  1714  QIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSF  1535
             QIG AC+H GFFQV NHG+P+ +I +ML +A  FF L   E++K YSDDPSK+ RLSTSF
Sbjct  63    QIGQACQHDGFFQVKNHGIPETIINNMLSIARAFFKLPESERLKSYSDDPSKSTRLSTSF  122

Query  1534  NVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISES  1355
             NV  E V N RDYLRLHCYPLQ Y  EWPSNPP+ R+VV  Y T  R            +
Sbjct  123   NVNTEKVSNRRDYLRLHCYPLQDYIHEWPSNPPSFREVVAEYCTSARG-----------A  171

Query  1354  LGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL  1175
              GL        LG+ GQHMA+N+YPPCP+P+LTYGLP HTDPN +T+LLQD  V GLQVL
Sbjct  172   WGLQRDYIDKALGKHGQHMALNYYPPCPQPDLTYGLPGHTDPNLITVLLQD-DVPGLQVL  230

Query  1174  KDGKW------------------------LAVKPRPDAFVINIGDQLQALSNGKYKSVWH  1067
             + GKW                        LA+   P+ F++NIGDQ+Q LSN +YKSV H
Sbjct  231   RKGKWLPFSLDYDFRIGYRPHTHIHNFESLAICLIPNTFIVNIGDQMQVLSNDRYKSVLH  290

Query  1066  RAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYRDFTYPEYY  920
             RA+VN DK  +S+ +F C   DAVI+  K L+D+  P VY++FTY EYY
Sbjct  291   RALVNCDKEHISILTFYCSSPDAVIAHAKDLIDERHPTVYKNFTYSEYY  339



>gb|KCW45838.1| hypothetical protein EUGRSUZ_L00351 [Eucalyptus grandis]
Length=418

 Score =   338 bits (868),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/309 (53%), Positives = 215/309 (70%), Gaps = 18/309 (6%)
 Frame = -3

Query  1783  EVTTCDDVPVIDLGC---GDRSFIVRQIGDACRHYGFFQVINHGVPKKVIEDMLKVAHEF  1613
             E +    +P+IDL      +R  I+RQIG+AC+  GFFQ+ NHG+P++V++ ++ +A EF
Sbjct  121   EASDASTIPLIDLQGLFGPNRDDIIRQIGEACQQDGFFQIKNHGIPEEVVQAIMNIAGEF  180

Query  1612  FNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLHCYPLQKYAPEWPSNPPT  1433
             F L   E++K YSDDPSK+ RLSTSFN+K E V NWRD+LRLHCYPL++Y  EWP+NPP+
Sbjct  181   FRLPESERLKNYSDDPSKSTRLSTSFNIKTEKVSNWRDFLRLHCYPLEEYMHEWPTNPPS  240

Query  1432  LRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTY  1253
              R  V  Y T VR++  K+ EAISESLGL+ +     L                 PELTY
Sbjct  241   FRKEVGEYCTRVRELALKLLEAISESLGLEREYISKNLASM--------------PELTY  286

Query  1252  GLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSV  1073
             GLP HTD N +TILLQD  V GLQVL+DGKW+AV P P+ F++NIGDQ+Q +SN KYKS+
Sbjct  287   GLPGHTDQNLITILLQD-DVPGLQVLRDGKWIAVDPIPNTFIVNIGDQMQVISNDKYKSI  345

Query  1072  WHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLN  893
              HRA+VN D+ R+S+ +F CP  +A+I   + L+D ++PAVYR FTY EYY KFW+R L 
Sbjct  346   LHRAVVNCDRERISIPTFYCPSPEALIGPAQGLIDHDNPAVYRSFTYEEYYHKFWNRGLR  405

Query  892   QEHCLEHFK  866
              E CL+ FK
Sbjct  406   TECCLDMFK  414



>gb|ADE77790.1| unknown [Picea sitchensis]
Length=357

 Score =   328 bits (841),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/337 (44%), Positives = 225/337 (67%), Gaps = 5/337 (1%)
 Frame = -3

Query  1864  QLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLG----CGDRSFIVRQIGDAC  1697
             +L+ SG   S +  +YI P  ERP++SEV   + +PV+DLG      +R+ ++++I  AC
Sbjct  17    KLISSGINSSEVQDRYILPPHERPRMSEVCYSECIPVVDLGDLIDGPNRTRVIQEIRRAC  76

Query  1696  RHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKET  1517
                GFFQ+INHGV + +++ M+ +A EFF + VE +   YS+DP + +R+STSFN+ KE 
Sbjct  77    EENGFFQIINHGVKETIMKSMMGIAKEFFEMPVENRACFYSEDPMQPVRVSTSFNICKEK  136

Query  1516  VHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQ  1337
             V +WRDYLR  CYPL++    WP  P   R++   Y  EVR +  ++  +ISE+LGLD  
Sbjct  137   VQHWRDYLRHPCYPLEEVMGSWPEKPAGYREIAGKYSAEVRALILRLLSSISEALGLDSD  196

Query  1336  CFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWL  1157
                 + G   Q M +N+YP CP P+LT+GLP H+DP+ +T+L+QD +V+GLQV K+GKW+
Sbjct  197   YLNRIFGTHNQAMVINYYPSCPNPDLTFGLPGHSDPDGITVLMQD-EVSGLQVFKNGKWI  255

Query  1156  AVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKP  977
             AV+P  +AFV+N+GDQ+Q +SNG+++SV HRA+ N    R+S+  F  P EDA I+    
Sbjct  256   AVQPLANAFVVNLGDQIQVVSNGRFRSVEHRAVTNASSARISIPMFCTPAEDAFIAPAAS  315

Query  976   LLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             L+D++ P VYR + + E++  FWS+ L ++  L+ FK
Sbjct  316   LVDEQHPPVYRGYKFEEFWKAFWSQVLGRKTVLDTFK  352



>gb|ABK26685.1| unknown [Picea sitchensis]
Length=363

 Score =   323 bits (828),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/336 (43%), Positives = 226/336 (67%), Gaps = 4/336 (1%)
 Frame = -3

Query  1864  QLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGD---RSFIVRQIGDACR  1694
             +L+ +G  +  +   YI P SERP+LSEV+  + +PV+DL   D   R+ +V++I  AC 
Sbjct  20    KLMSNGINHLQVQDTYILPPSERPRLSEVSYSESIPVVDLQDLDGPNRTRVVQEICLACE  79

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
               GFFQ++NHGVP+  ++ M+ +A EFF + VE++  LYS+D ++ +RLSTSFN+ KE V
Sbjct  80    EDGFFQILNHGVPEATMKSMMGIAKEFFEMPVEDRACLYSEDTNQRVRLSTSFNISKEKV  139

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
              NWRDYL   C+PL+++   WP  P   R++   Y  E+R +  ++  A+SE+LGLD   
Sbjct  140   LNWRDYLLHPCHPLEEFIGSWPEKPAAYREIAGNYAAEMRALILRLMAAVSEALGLDSDY  199

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
                + G+  Q M + +YPPCP P++T G P H+D   +T+L+Q   V+GLQVL++GKW+A
Sbjct  200   LNRIFGKHSQLMDIMYYPPCPNPDITLGTPRHSDARGITVLMQG-NVSGLQVLRNGKWVA  258

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V+P P+AFV+N+GDQLQ +SNG+++SV HRA+ NT   R+S+ +F  P E+A I+  + L
Sbjct  259   VEPIPNAFVVNMGDQLQVVSNGRFRSVEHRAVTNTSTARISIPTFYGPSEEAFIAPAESL  318

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             +D++ PA+Y+ F + E+   FW + L  +  L+HFK
Sbjct  319   VDEQHPALYKGFKFGEFMKIFWGQELKNKTVLDHFK  354



>ref|XP_002321354.2| hypothetical protein POPTR_0015s00510g [Populus trichocarpa]
 gb|EEF05481.2| hypothetical protein POPTR_0015s00510g [Populus trichocarpa]
Length=195

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = -3

Query  1429  RDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYG  1250
             R++V+ Y  +VR++GF+I+E ISESLGL+    KNVLGEQGQHMAVNFYPPCPEPELTYG
Sbjct  6     REIVRSYSIQVRELGFRIQELISESLGLEKDHIKNVLGEQGQHMAVNFYPPCPEPELTYG  65

Query  1249  LPAHTDPNALTILLQDLQVAGLQVL-KDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSV  1073
             LPAHTDPNALTILLQDL VAGLQVL KDGKW+AV P PDAFVINIGDQLQALSNG+YKSV
Sbjct  66    LPAHTDPNALTILLQDLSVAGLQVLLKDGKWVAVNPHPDAFVINIGDQLQALSNGRYKSV  125

Query  1072  WHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLN  893
             WHRAI NTDK RMSVASFLCP ++A+I+ PK L DD + A+YRDFTY EYY KFWSRNL+
Sbjct  126   WHRAITNTDKARMSVASFLCPFDNALITPPKALTDDGTGAIYRDFTYAEYYKKFWSRNLD  185

Query  892   QEHCLEHFKN  863
             QEHCLE FKN
Sbjct  186   QEHCLELFKN  195



>ref|XP_002318498.2| hypothetical protein POPTR_0012s00660g [Populus trichocarpa]
 gb|EEE96718.2| hypothetical protein POPTR_0012s00660g [Populus trichocarpa]
Length=195

 Score =   313 bits (802),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -3

Query  1429  RDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYG  1250
             RD+V  Y  +VR++GF+I+E ISESLGL+    KNVLGEQGQHMAVNFYPPCPEPELT+G
Sbjct  6     RDIVSSYCIQVRELGFRIQELISESLGLEKDHVKNVLGEQGQHMAVNFYPPCPEPELTFG  65

Query  1249  LPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVW  1070
             LP HTDPNALTILLQD  VAGLQVLKDGKW+AV P PDAFVINIGDQLQALSNG+YKSVW
Sbjct  66    LPGHTDPNALTILLQDQSVAGLQVLKDGKWVAVDPHPDAFVINIGDQLQALSNGRYKSVW  125

Query  1069  HRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQ  890
             HRAI NTDK RMSVASFLCP ++A+I+ PK L DD + AVYRDFTY EYY KFWSR+L+Q
Sbjct  126   HRAITNTDKARMSVASFLCPYDNALITPPKALTDDGTGAVYRDFTYAEYYKKFWSRDLDQ  185

Query  889   EHCLEHFKN  863
             EHCLE FKN
Sbjct  186   EHCLELFKN  194



>ref|XP_011038017.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 5-like [Populus 
euphratica]
Length=350

 Score =   318 bits (815),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 210/316 (66%), Gaps = 5/316 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCDD-VPVIDLGCGD---RSFIVRQIGDACRHYGFFQVINH  1664
             +P   I P  + PKLSE+   DD +P+IDL   D   RS I+ QIG AC  YGFF V NH
Sbjct  19    VPSNNINPIFDLPKLSELDASDDSIPLIDLDGLDGPNRSLIINQIGQACEEYGFFMVKNH  78

Query  1663  GVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLH  1484
             G+P+  I ++   A +FF L  +E++K  S DP+KT+RL+T FN K + V  WR+ L+ H
Sbjct  79    GIPEATINNIQSTAMKFFKLPNDERLKFQSIDPTKTIRLTTGFNNKNQKVFVWRESLKFH  138

Query  1483  CYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQ  1304
              YP++ Y  EWPSNPP+ ++ V  Y T VR + F + EAISESLGL+       L   GQ
Sbjct  139   SYPIEDYEHEWPSNPPSFKEDVANYGTSVRGLEFALLEAISESLGLERDYIDKTLSMHGQ  198

Query  1303  HMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVI  1124
              +A+N+YPPCP+PELT+GLP HTDP+ +TILL D  V GLQVLK+GKW+ ++P P+ FV+
Sbjct  199   GIALNYYPPCPQPELTFGLPGHTDPSIITILLID-DVPGLQVLKNGKWVNIRPIPNTFVV  257

Query  1123  NIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYR  944
             N+GDQ+Q LSN +YKSV HR +VN DK R+S+ SF     DAVI   K L+D++ PA+YR
Sbjct  258   NVGDQIQVLSNDRYKSVLHRVVVNCDKERISIPSFYYSSPDAVIGPAKDLIDNDHPAIYR  317

Query  943   DFTYPEYYSKFWSRNL  896
               T   +  + W+  L
Sbjct  318   KSTCRAFNERMWNGGL  333



>gb|KCW46636.1| hypothetical protein EUGRSUZ_K004471, partial [Eucalyptus grandis]
Length=190

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = -3

Query  1426  DVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGL  1247
             + V  Y  EVR++G+++EE ISESLGL+    +N+LGEQGQHMAVNFYPPCPEPELTYGL
Sbjct  1     EFVSNYCREVRRLGYRLEELISESLGLEKDAVRNILGEQGQHMAVNFYPPCPEPELTYGL  60

Query  1246  PAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVWH  1067
             P HTDPNALTILLQDL VAGLQVLKDGKW+A+ P P+AFVINIGDQLQALSNG+YKSVWH
Sbjct  61    PGHTDPNALTILLQDLHVAGLQVLKDGKWVAIDPHPNAFVINIGDQLQALSNGRYKSVWH  120

Query  1066  RAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQE  887
             RAIVN DKPRMS+ASFLCP +DA+IS+P  LLD+     YRDFTY EYY KFWSRNL+QE
Sbjct  121   RAIVNADKPRMSIASFLCPSDDALISSPVSLLDNGCGPTYRDFTYAEYYKKFWSRNLDQE  180

Query  886   HCLEHFKN  863
             HCLE FKN
Sbjct  181   HCLELFKN  188



>ref|XP_002300517.2| hypothetical protein POPTR_0001s45580g [Populus trichocarpa]
 gb|EEE85322.2| hypothetical protein POPTR_0001s45580g [Populus trichocarpa]
Length=351

 Score =   315 bits (806),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/317 (49%), Positives = 210/317 (66%), Gaps = 6/317 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCDD-VPVIDL---GCGDRSFIVRQIGDACRHYGFFQVI-N  1667
             +P   I P  + PKLSE+   DD +P+IDL      +RS I+ QIG AC  YGFF V+ N
Sbjct  19    VPSNNINPIFDLPKLSELDASDDSIPLIDLDGLNGPNRSLIINQIGQACEEYGFFMVVKN  78

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HG+P+  I ++   A +FF L  EE++K  S DP+KT+RL+T FN K + V  WR+ L+ 
Sbjct  79    HGIPEATINNIQSTAMKFFKLPNEERLKFQSIDPTKTIRLTTGFNNKNQKVFVWRESLKF  138

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             H YP++ Y  EWPSNPP+ ++ V  Y T VR + F + EAISESLGL+       LG  G
Sbjct  139   HSYPIEDYEHEWPSNPPSFKEDVANYGTSVRGLEFALLEAISESLGLERDYIDKTLGMHG  198

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             Q +A+N+YPPCP+PELT+GLP HTDP+ +TILL D  V GLQVLK+GKW+ ++P P+ FV
Sbjct  199   QGIALNYYPPCPQPELTFGLPGHTDPSIITILLID-DVPGLQVLKNGKWVNIRPIPNTFV  257

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             +N+GDQ+Q LSN +YKSV HR +VN DK R+S+ SF     D VI   K L+D++ PA+Y
Sbjct  258   VNVGDQIQVLSNDRYKSVVHRVVVNCDKERISIPSFYYSSPDTVIGPAKDLIDNDHPAIY  317

Query  946   RDFTYPEYYSKFWSRNL  896
             R      +  + W+  L
Sbjct  318   RKSACRAFNERMWNGGL  334



>gb|KHG05802.1| Gibberellin 20 oxidase 2 [Gossypium arboreum]
 gb|KHG18066.1| Gibberellin 20 oxidase 2 [Gossypium arboreum]
Length=210

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = -3

Query  1432  LRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTY  1253
              R +V  Y  +VR++G++++E ISESLGL+    K VLGEQGQHMAVN+YPPCPEPELTY
Sbjct  21    FRQIVSDYCVQVRELGYRLQELISESLGLEKDYIKKVLGEQGQHMAVNYYPPCPEPELTY  80

Query  1252  GLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSV  1073
             GLP HTDPNALTILLQDLQVAGLQVLKDGKWLAV P+P+AFVINIGDQLQALSNG YKSV
Sbjct  81    GLPGHTDPNALTILLQDLQVAGLQVLKDGKWLAVNPQPNAFVINIGDQLQALSNGTYKSV  140

Query  1072  WHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLN  893
             WHRAIVN D+PRMSVASFLCP + A+IS  KPL      AVYRDFTY EYYSKFW RNL+
Sbjct  141   WHRAIVNADRPRMSVASFLCPYDHALISPAKPLTQYGCGAVYRDFTYAEYYSKFWGRNLD  200

Query  892   QEHCLEHFKN  863
             QEHCLE FKN
Sbjct  201   QEHCLELFKN  210



>ref|XP_008797638.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like isoform 
X3 [Phoenix dactylifera]
Length=286

 Score =   308 bits (790),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 148/247 (60%), Positives = 185/247 (75%), Gaps = 5/247 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCDDVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVINHG  1661
             +P  YIRP S+RP L  V +   + +IDL    C DRS +VR+IG ACR+ GFFQV NHG
Sbjct  21    VPHNYIRPLSDRPDLLNVESNATIALIDLQGLTCEDRSQVVREIGLACRNDGFFQVKNHG  80

Query  1660  VPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLHC  1481
             +PK V++ ML+VA +FF+L   E++K YS DP++T RLSTSFNVK E V +WRDYLRLHC
Sbjct  81    IPKDVVDGMLRVAKDFFHLPESERLKSYSQDPTRTTRLSTSFNVKTEKVSSWRDYLRLHC  140

Query  1480  YPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQH  1301
             YPL+ +A EWPSNPP  R VV  Y    R++  ++ EAISESLGL+    +  LG+QGQH
Sbjct  141   YPLEDFAHEWPSNPPCFRQVVGEYCKNARELALRLLEAISESLGLESDYMEKALGKQGQH  200

Query  1300  MAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL-KDGKWLAVKPRPDAFVI  1124
             MA+N+YPPCP+PELTYGLP H DPNA+TILLQD  V+GLQVL ++GKW+AV P PD  VI
Sbjct  201   MAINYYPPCPQPELTYGLPGHKDPNAITILLQD-GVSGLQVLIRNGKWVAVNPVPDTLVI  259

Query  1123  NIGDQLQ  1103
             NIGD +Q
Sbjct  260   NIGDMIQ  266



>ref|XP_008797637.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like isoform 
X2 [Phoenix dactylifera]
Length=344

 Score =   309 bits (791),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/249 (60%), Positives = 186/249 (75%), Gaps = 5/249 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCDDVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVINHG  1661
             +P  YIRP S+RP L  V +   + +IDL    C DRS +VR+IG ACR+ GFFQV NHG
Sbjct  21    VPHNYIRPLSDRPDLLNVESNATIALIDLQGLTCEDRSQVVREIGLACRNDGFFQVKNHG  80

Query  1660  VPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLHC  1481
             +PK V++ ML+VA +FF+L   E++K YS DP++T RLSTSFNVK E V +WRDYLRLHC
Sbjct  81    IPKDVVDGMLRVAKDFFHLPESERLKSYSQDPTRTTRLSTSFNVKTEKVSSWRDYLRLHC  140

Query  1480  YPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQH  1301
             YPL+ +A EWPSNPP  R VV  Y    R++  ++ EAISESLGL+    +  LG+QGQH
Sbjct  141   YPLEDFAHEWPSNPPCFRQVVGEYCKNARELALRLLEAISESLGLESDYMEKALGKQGQH  200

Query  1300  MAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVL-KDGKWLAVKPRPDAFVI  1124
             MA+N+YPPCP+PELTYGLP H DPNA+TILLQD  V+GLQVL ++GKW+AV P PD  VI
Sbjct  201   MAINYYPPCPQPELTYGLPGHKDPNAITILLQD-GVSGLQVLIRNGKWVAVNPVPDTLVI  259

Query  1123  NIGDQLQAL  1097
             NIGD +Q L
Sbjct  260   NIGDMIQLL  268



>gb|EMS45572.1| Naringenin,2-oxoglutarate 3-dioxygenase [Triticum urartu]
Length=349

 Score =   307 bits (786),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 182/256 (71%), Gaps = 25/256 (10%)
 Frame = -3

Query  1798  RPKLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACRHYGFFQVINHGVPKKVIEDMLKVAH  1619
             RP+  EV    D+PV+DL   DR+ +V QIG AC  +GFFQV+NHG+P +V+   + VAH
Sbjct  93    RPRRDEVVPDADIPVVDLANPDRAAVVAQIGAACSSHGFFQVLNHGLPVEVMLAAMAVAH  152

Query  1618  EFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLHCYPLQKYAPEWPSNP  1439
             +FF LS EEK KLYSDDP+K  RLSTSFNV+KETVHNWRDYLRLHC+P      E P+NP
Sbjct  153   DFFRLSPEEKAKLYSDDPAKKTRLSTSFNVRKETVHNWRDYLRLHCHP------EGPANP  206

Query  1438  PTLR-------------------DVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLG  1316
             P  R                   DV+  Y  EV+++GF+   A+SESLGL+    K VLG
Sbjct  207   PPFRYFSPIPAISLSSSLPENRMDVISTYCKEVQELGFRFYAALSESLGLEQDYIKMVLG  266

Query  1315  EQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPD  1136
             EQ QHMAVNFYP CP PELTYGLPAHT PNALTIL+ D QVAGLQVLK+G+W+AV P+P+
Sbjct  267   EQEQHMAVNFYPKCPSPELTYGLPAHTVPNALTILMMDEQVAGLQVLKEGRWIAVNPQPN  326

Query  1135  AFVINIGDQLQALSNG  1088
             AF+IN+GDQLQ  + G
Sbjct  327   AFIINLGDQLQVRAAG  342



>gb|KCW45836.1| hypothetical protein EUGRSUZ_L00350 [Eucalyptus grandis]
Length=380

 Score =   304 bits (779),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/248 (57%), Positives = 187/248 (75%), Gaps = 6/248 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCD--DVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVIN  1667
             +P  YIR E++RP L+EV   D   +P++DL      +R  I+RQIG AC+  GFFQ+ N
Sbjct  20    VPDNYIRSEADRPNLTEVEASDASSIPLVDLQGLSGPNRDDIIRQIGRACQQDGFFQIKN  79

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HG+P++ ++ ++ +A EFF L   E++K YSDDP+K+ RLSTSFN+K E V NWRD+LRL
Sbjct  80    HGIPEEKVQAIMNIAREFFRLPESERLKNYSDDPTKSTRLSTSFNLKTEKVSNWRDFLRL  139

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
             HCYPL++Y  EWP+NPP+ R  V  Y T VR++ FK+ EAISESLGL+ +     LG+ G
Sbjct  140   HCYPLEEYMHEWPTNPPSFRKEVGEYCTRVRELVFKLLEAISESLGLEREYISQNLGKHG  199

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             QHMA+N+YPPCP+PELTYGLP HTDPN +TILLQD  V GLQVL++GKW+AV P P+ F+
Sbjct  200   QHMAMNYYPPCPQPELTYGLPGHTDPNLITILLQD-DVPGLQVLRNGKWVAVNPIPNTFI  258

Query  1126  INIGDQLQ  1103
             +NIGDQ+Q
Sbjct  259   VNIGDQMQ  266



>ref|XP_008356982.1| PREDICTED: naringenin,2-oxoglutarate 3-dioxygenase-like [Malus 
domestica]
Length=262

 Score =   299 bits (766),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 186/256 (73%), Gaps = 7/256 (3%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCD-DVPVIDL-GCGD--RSFIVRQIGDACRH  1691
             L SG  +  +P  Y+RP  +RP L +V + D  +P+I+L G  D  RS I++QIG AC+ 
Sbjct  8     LVSGATH--VPSNYVRPAHDRPNLDQVQSSDHSIPLINLQGLEDSRRSDIIKQIGLACQD  65

Query  1690  YGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVH  1511
             YGFFQV NHG+ + VI +ML V+ EFF+L   E++K +SDDP KT RLSTSFNVK E + 
Sbjct  66    YGFFQVQNHGIEEAVIGNMLSVSKEFFHLPESERLKSFSDDPLKTTRLSTSFNVKTEEIS  125

Query  1510  NWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCF  1331
             +WRDYLRLHCYPL+ Y  EWPSNPP+ R+ V  Y   VR +  ++ EAISESLGL+    
Sbjct  126   SWRDYLRLHCYPLEDYMHEWPSNPPSFREGVAGYCRNVRGLAVRLLEAISESLGLEGDYM  185

Query  1330  KNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAV  1151
                LG+ GQHMA+N+YP CP+PELTYGLP H DPN +T+LLQD  VAGLQVL +GKW+AV
Sbjct  186   NKALGKHGQHMAINYYPTCPQPELTYGLPGHADPNVITVLLQD-DVAGLQVLNNGKWVAV  244

Query  1150  KPRPDAFVINIGDQLQ  1103
             KP P  F++N+GDQ+Q
Sbjct  245   KPIPHTFIVNLGDQIQ  260



>ref|XP_009109951.1| PREDICTED: gibberellin 20 oxidase 2-like [Brassica rapa]
Length=199

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 158/192 (82%), Gaps = 3/192 (2%)
 Frame = -3

Query  1429  RDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYG  1250
             R+VV  Y TEVR++GF IEE ISESLGL+    + VLGEQGQHMAVN+YPPCPEPEL YG
Sbjct  7     REVVSRYSTEVRELGFTIEELISESLGLEKDHMRKVLGEQGQHMAVNYYPPCPEPELNYG  66

Query  1249  LPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVW  1070
             LPAHTDPNALTILLQD  V GLQ+L DG+W AV P PDAFVINIGDQ QALSNG YKSVW
Sbjct  67    LPAHTDPNALTILLQDATVCGLQILIDGQWFAVNPHPDAFVINIGDQFQALSNGVYKSVW  126

Query  1069  HRAIVNTDKPRMSVASFLCPGEDAVISAPKPLL---DDESPAVYRDFTYPEYYSKFWSRN  899
             HRA+ NT+KPR+SVASFLCP + AVIS  KPL    DDE+  +YRD+TY EYY KFWSRN
Sbjct  127   HRAVTNTEKPRLSVASFLCPADCAVISPAKPLWEAEDDEAKPIYRDYTYAEYYKKFWSRN  186

Query  898   LNQEHCLEHFKN  863
             L+QEHCLE+F N
Sbjct  187   LDQEHCLENFLN  198



>ref|XP_008245821.1| PREDICTED: hyoscyamine 6-dioxygenase-like [Prunus mume]
Length=269

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/261 (56%), Positives = 188/261 (72%), Gaps = 8/261 (3%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCD--DVPVIDLG---CGDRSFIVRQIGDACR  1694
             L SG  +  +P  Y+RP S+RP L +V   D   +P+IDL      + S I++QIG AC+
Sbjct  12    LMSGVNH--VPSNYVRPISDRPNLRDVQISDASSIPLIDLKDLHGHNHSNIIKQIGLACQ  69

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
               GFFQV NHGVP+++I+DM  +A +FF L   E++K+YSDDPSKT RLSTSFNV+ E +
Sbjct  70    TDGFFQVKNHGVPEEMIKDMSSIARKFFKLPESERLKMYSDDPSKTTRLSTSFNVRTEKL  129

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
              NWRD+LRLHCYPL+ Y  EWP+NPP+ R+ V  Y T VR +  ++  AISESLGL+   
Sbjct  130   SNWRDFLRLHCYPLEDYVQEWPNNPPSFREQVGEYCTSVRGLVLRLLGAISESLGLEKNY  189

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
                 LG+QGQHMA+N+YPPCPEPELTYGLP HTD N +TILLQD  V GLQVL++GKW+A
Sbjct  190   IVEALGKQGQHMALNYYPPCPEPELTYGLPGHTDCNLITILLQD-DVPGLQVLRNGKWVA  248

Query  1153  VKPRPDAFVINIGDQLQALSN  1091
             V P P+ F++NIGD +Q   N
Sbjct  249   VNPIPNTFIVNIGDMMQVKIN  269



>gb|ACU23251.1| unknown [Glycine max]
Length=263

 Score =   298 bits (763),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/247 (56%), Positives = 183/247 (74%), Gaps = 5/247 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEV-TTCDDVPVIDL---GCGDRSFIVRQIGDACRHYGFFQVINH  1664
             +P  +IRP  +RPKL ++ ++   +P+IDL   G  + S I++ I  AC+ YGFFQ++NH
Sbjct  18    VPSNFIRPIGDRPKLHQLHSSLASIPIIDLQGLGGSNHSQIIQNIAHACQTYGFFQIVNH  77

Query  1663  GVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLH  1484
             G+ ++V+  M+ V+ EFF L   E++K +SDDPSKT RLSTSFNVK E V NWRD+LRLH
Sbjct  78    GIQEEVVSKMVNVSKEFFGLPESERLKNFSDDPSKTTRLSTSFNVKTEKVSNWRDFLRLH  137

Query  1483  CYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQ  1304
             C+PL+ Y  EWP NPP+ R+ V  Y  ++R +  K+ EAISESLGL+       LG+ GQ
Sbjct  138   CHPLEDYIQEWPGNPPSFREDVAEYSRKMRGLSLKLLEAISESLGLERDYIDKALGKHGQ  197

Query  1303  HMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVI  1124
             H+A+N+YPPCPEPELTYGLPAH DPNA+TILLQ+ +V GLQVL DGKWL V P P+ F++
Sbjct  198   HLAINYYPPCPEPELTYGLPAHADPNAITILLQN-EVPGLQVLYDGKWLTVNPVPNTFIV  256

Query  1123  NIGDQLQ  1103
             NIGDQ+Q
Sbjct  257   NIGDQIQ  263



>ref|XP_007039320.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 3, partial [Theobroma cacao]
 gb|EOY23821.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 3, partial [Theobroma cacao]
Length=301

 Score =   297 bits (761),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/262 (57%), Positives = 186/262 (71%), Gaps = 7/262 (3%)
 Frame = -3

Query  1867  TQLLFSGTPYST--LPQKYIRPESERPKLSEVTTCD-DVPVIDLG---CGDRSFIVRQIG  1706
             T+LL +    S   +P  YIRP S+RP LS+V   D  +P+IDL      +RS I++QI 
Sbjct  1     TKLLLTDLASSVKQVPFNYIRPISDRPNLSDVQVSDVSLPLIDLQDLYGPNRSDILKQIA  60

Query  1705  DACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVK  1526
              AC H GFFQV NHG+ + +I +ML++A EFF L   E++K YSDDPSK  RLSTSFNVK
Sbjct  61    LACEHDGFFQVKNHGISEALINNMLRLAREFFRLPKSERLKNYSDDPSKANRLSTSFNVK  120

Query  1525  KETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGL  1346
              E V NWRD+LRLHCYPL+ +  EWPSNPP+ R+    Y T VR +  ++ EAISESLGL
Sbjct  121   TEKVANWRDFLRLHCYPLKDHVHEWPSNPPSFREDAAEYCTRVRGLVLRLLEAISESLGL  180

Query  1345  DPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDG  1166
                     L + GQHMA+N+YPPCPEPELTYGLP HTDPN +TILLQD  V GLQVL++G
Sbjct  181   KRDHIDKTLSKHGQHMALNYYPPCPEPELTYGLPGHTDPNLITILLQD-DVPGLQVLRNG  239

Query  1165  KWLAVKPRPDAFVINIGDQLQA  1100
             KW+AV P P+ F++NIGDQ+Q 
Sbjct  240   KWVAVNPIPNTFIVNIGDQMQV  261



>ref|XP_002888500.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64759.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=256

 Score =   293 bits (749),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/256 (53%), Positives = 178/256 (70%), Gaps = 8/256 (3%)
 Frame = -3

Query  1627  VAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLHCYPLQKYAPEWP  1448
             + H FF  S+   +  +S +       STSFNV KE V NWRD+LRLHCYP++ +  EWP
Sbjct  3     IKHTFF-FSLSLSVHFFSVN----QFFSTSFNVSKEKVSNWRDFLRLHCYPIEDFIHEWP  57

Query  1447  SNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQHMAVNFYPPCPE  1268
             S P + R+V   Y T VR +   + EAISESLGL      N LG+ GQHMA+N+YPPCP+
Sbjct  58    STPVSFREVTAEYATSVRALVLTLLEAISESLGLVKDRVSNTLGKHGQHMAINYYPPCPQ  117

Query  1267  PELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVINIGDQLQALSNG  1088
             PELTYGLP H D N +T+LLQD +V+GLQV KDGKW+AV P P+ F++N+GDQ+Q +SN 
Sbjct  118   PELTYGLPGHKDANLITVLLQD-EVSGLQVFKDGKWIAVNPVPNTFIVNLGDQMQVISND  176

Query  1087  KYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDE--SPAVYRDFTYPEYYSK  914
             KYKSV HRA+VN DK R+S+ +F CP EDA+I   + L+++E  S A+YR+FTY EY+ K
Sbjct  177   KYKSVLHRAVVNIDKERISILTFYCPSEDAMIGPAQELINEEEDSHAIYRNFTYAEYFEK  236

Query  913   FWSRNLNQEHCLEHFK  866
             FW      E C++ FK
Sbjct  237   FWDTAFATESCIDSFK  252



>ref|XP_008382909.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 5-like, 
partial [Malus domestica]
Length=217

 Score =   290 bits (743),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 161/191 (84%), Gaps = 0/191 (0%)
 Frame = -3

Query  1435  TLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELT  1256
             + RD V  Y  EVR++G+++EE +S SLGL+    ++ LGEQGQHMAVNFYPPCP+PELT
Sbjct  23    SCRDTVGNYCREVRELGYRLEELVSXSLGLEKDYIRSTLGEQGQHMAVNFYPPCPQPELT  82

Query  1255  YGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVINIGDQLQALSNGKYKS  1076
             YGLPAHTDPNALTILLQDL VAGLQVLKDGKW+AV P+P+AFVINIGDQLQALSNG YKS
Sbjct  83    YGLPAHTDPNALTILLQDLGVAGLQVLKDGKWVAVNPQPNAFVINIGDQLQALSNGIYKS  142

Query  1075  VWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNL  896
             VWHRAI NT++PR+SVASF CP +DA+IS  K L++D S A+YR +TY EYY KFW+R+L
Sbjct  143   VWHRAITNTERPRLSVASFFCPQDDALISPAKALIEDGSAAIYRGYTYTEYYKKFWTRDL  202

Query  895   NQEHCLEHFKN  863
              ++HCL+ F+ 
Sbjct  203   EKDHCLDLFRT  213



>ref|XP_008376267.1| PREDICTED: hyoscyamine 6-dioxygenase-like [Malus domestica]
Length=499

 Score =   300 bits (768),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 185/256 (72%), Gaps = 7/256 (3%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCD-DVPVIDL-GCGD--RSFIVRQIGDACRH  1691
             L SG  +  +P  Y+RP  +RP L +V + D  +P+I+L G  D  RS I++QIG AC+ 
Sbjct  8     LVSGATH--VPSNYVRPAHDRPNLDQVQSSDHSIPLINLQGLEDSRRSDIIKQIGLACQD  65

Query  1690  YGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVH  1511
             YGFFQV NHG+ + VI +ML V+ EFF+L   E++K +SDDP KT RLSTSFNVK E   
Sbjct  66    YGFFQVQNHGIEEAVIGNMLSVSKEFFHLPESERLKSFSDDPLKTTRLSTSFNVKTEEXS  125

Query  1510  NWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCF  1331
             +WRDYLRLHCYPL+ Y  EWPSNPP+ R+ V  Y   VR +  ++ EAISESLGL+    
Sbjct  126   SWRDYLRLHCYPLEDYMHEWPSNPPSFREXVAXYCRNVRGLAVRLLEAISESLGLEGDYM  185

Query  1330  KNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAV  1151
                LG+ GQHMA+N+YP CP+PELTYGLP H DPN +T+LLQD  VAGLQVL +GKW+AV
Sbjct  186   NKALGKHGQHMAINYYPTCPQPELTYGLPGHADPNVITVLLQD-DVAGLQVLNNGKWVAV  244

Query  1150  KPRPDAFVINIGDQLQ  1103
             KP P  F++N+GDQ+Q
Sbjct  245   KPIPHTFIVNLGDQIQ  260



>gb|AAN74829.1| Putative flavanone 3-hydroxylase [Oryza sativa Japonica Group]
Length=250

 Score =   290 bits (742),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = -3

Query  1429  RDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQHMAVNFYPPCPEPELTYG  1250
             ++++  Y  EVR++GF++  AISESLGL+    K VLGEQ QHMAVNFYP CPEPELT+G
Sbjct  56    KEIISTYCKEVRELGFRLYGAISESLGLEQDYIKKVLGEQEQHMAVNFYPKCPEPELTFG  115

Query  1249  LPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVINIGDQLQALSNGKYKSVW  1070
             LPAHTDPNALTILL D QVAGLQVLK+G+W+AV P+P+A VINIGDQLQALSNG+YKSVW
Sbjct  116   LPAHTDPNALTILLMDQQVAGLQVLKEGRWIAVNPQPNALVINIGDQLQALSNGRYKSVW  175

Query  1069  HRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYRDFTYPEYYSKFWSRNLNQ  890
             HRA+VN+DK RMSVASFLCP  D +I   + L+ D SPAVYR++TY EYY KFWSRNL+Q
Sbjct  176   HRAVVNSDKARMSVASFLCPCNDVLIGPAQKLITDGSPAVYRNYTYDEYYKKFWSRNLDQ  235

Query  889   EHCLEHFKN  863
             EHCLE F+ 
Sbjct  236   EHCLELFRT  244



>gb|ABK21816.1| unknown [Picea sitchensis]
Length=352

 Score =   291 bits (746),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/316 (42%), Positives = 210/316 (66%), Gaps = 4/316 (1%)
 Frame = -3

Query  1876  SMTTQLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGD---RSFIVRQIG  1706
             S+  +L+ +G     +  +YI P  ERP++SE++  + +PV+DL   D   R+ IV +I 
Sbjct  14    SIIEKLISNGINNLQVQDRYILPPHERPQMSEISHSECIPVVDLKDLDGPNRTTIVGEIR  73

Query  1705  DACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVK  1526
              AC   GFFQ++NHGVP+ V++ M+ +A EF+ + VE++   YS+D  + +RLSTSFN+ 
Sbjct  74    RACEEDGFFQILNHGVPENVMKSMMGIAKEFYEMPVEDRACFYSEDIKQPVRLSTSFNIG  133

Query  1525  KETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGL  1346
              + V NW DY    C+PL++    WP  P   RD+   Y  E+R +  ++  AISE+LGL
Sbjct  134   IDGVLNWVDYFSQPCHPLEEVIGSWPEKPAAYRDIAGKYAGEMRALILRLLAAISEALGL  193

Query  1345  DPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDG  1166
             D      VLG+  Q M +N+YP CP P+LT GL +H+D  A+T+L+Q+ +V+GLQV ++G
Sbjct  194   DSDYLNKVLGKHSQLMTLNYYPSCPNPDLTLGLSSHSDATAITVLMQN-EVSGLQVFRNG  252

Query  1165  KWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISA  986
             KW+AV+P  +AFV+N+GDQLQ +SNG+++S+ HRA+ N    R+S+ +F  PG++A I+ 
Sbjct  253   KWVAVEPIANAFVVNLGDQLQVVSNGRFRSIQHRAVTNMYTSRISIPTFYLPGDEAFIAP  312

Query  985   PKPLLDDESPAVYRDF  938
                ++D++ PAVYR +
Sbjct  313   ASSMVDEQQPAVYRGY  328



>gb|ABK22911.1| unknown [Picea sitchensis]
Length=312

 Score =   290 bits (741),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/310 (43%), Positives = 202/310 (65%), Gaps = 4/310 (1%)
 Frame = -3

Query  1789  LSEVTTCDDVPVIDLGCGD---RSFIVRQIGDACRHYGFFQVINHGVPKKVIEDMLKVAH  1619
             +SE++  + +PV+DL   D   R+ IV +I  AC   GFFQ++NHGVP+ V++ M+ +A 
Sbjct  1     MSEISHSECIPVVDLKDLDGPNRTTIVGEIRRACEEDGFFQIVNHGVPENVMKSMMGIAK  60

Query  1618  EFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLHCYPLQKYAPEWPSNP  1439
             EF+ + VE++   YS+D  K +RLSTSFN+  + V NW DYL   C+PL++    WP  P
Sbjct  61    EFYEMPVEDRACFYSEDIKKPVRLSTSFNIGIDKVLNWVDYLTQTCHPLEEVIGTWPEKP  120

Query  1438  PTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQHMAVNFYPPCPEPEL  1259
                RDV   Y  E+R +  ++  AISE+LGLD      +LG+  Q M +N+YP CP P+L
Sbjct  121   AAYRDVAGKYAGEMRALILRLLAAISEALGLDSDYLNKILGKHSQVMNINYYPSCPNPDL  180

Query  1258  TYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVINIGDQLQALSNGKYK  1079
             T G   H+D +A+T+L+Q   V+GLQV K+GKW+AV+P  +A V+N+GDQLQ +SNG+++
Sbjct  181   TLGAANHSDASAITVLMQS-DVSGLQVFKNGKWIAVEPIANALVVNLGDQLQVVSNGRFR  239

Query  1078  SVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYRDFTYPEYYSKFWSRN  899
             SV HRA+ N    R+S+ +F  PG+DA I+    ++D++ PA+YR + + E+   FW + 
Sbjct  240   SVEHRAVTNIYTARISIPTFYLPGDDAFIAPASSMVDEQQPALYRGYKFEEFLGAFWRQG  299

Query  898   LNQEHCLEHF  869
             L  +  L+ F
Sbjct  300   LKGKSVLDRF  309



>ref|XP_006421684.1| hypothetical protein CICLE_v10007024mg [Citrus clementina]
 gb|ESR34924.1| hypothetical protein CICLE_v10007024mg [Citrus clementina]
Length=280

 Score =   283 bits (725),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 152/312 (49%), Positives = 194/312 (62%), Gaps = 37/312 (12%)
 Frame = -3

Query  1876  SMTTQLLFS--GTPYSTLPQKYIRPESERPKLSEVTTCD-DVPVIDLGCGDRSFIVRQIG  1706
             + TT+LL S   +   +    YIRP S+RP L+EV   D  +P IDL   D   +++QIG
Sbjct  3     AATTKLLLSDLASTVESFTSNYIRPISDRPNLTEVQISDGSIPHIDLHVLD---LIKQIG  59

Query  1705  DACRHYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVK  1526
              AC+H GFFQV NHG+P+ +I +ML +A  FF L   E++K YSDDPSK+ RLSTSFNV 
Sbjct  60    QACQHDGFFQVKNHGIPETIINNMLSIAGAFFKLPESERLKSYSDDPSKSKRLSTSFNVN  119

Query  1525  KETVHNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGL  1346
              E                              ++VV  Y T VR +  K+ EAISESLGL
Sbjct  120   TE------------------------------KEVVAEYCTSVRGLELKLLEAISESLGL  149

Query  1345  DPQCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDG  1166
                     LG+ GQHMA+N+ PPCP+P+LTYGLP HTDPN +T+LLQD  V  LQVL+ G
Sbjct  150   QRDYIDKALGKHGQHMALNYCPPCPQPDLTYGLPGHTDPNLITVLLQD-DVPRLQVLRTG  208

Query  1165  KWLAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISA  986
             KW  V P P+ F++NIGDQ+Q LSN  YKSV HRA+VN DK R+S+ +F CP  DAVI+ 
Sbjct  209   KWFPVSPIPNTFIVNIGDQMQVLSNDLYKSVLHRALVNCDKERISIPTFYCPSPDAVIAP  268

Query  985   PKPLLDDESPAV  950
              K L+D+   AV
Sbjct  269   AKDLIDERHLAV  280



>ref|XP_011038015.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Populus 
euphratica]
Length=348

 Score =   285 bits (730),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 145/328 (44%), Positives = 209/328 (64%), Gaps = 9/328 (3%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCD-DVPVIDLGC---GDRSFIVRQIGDACRHYGFFQVINH  1664
             L   Y  P S +P + E   CD  +P+IDL       RS IV+Q+G AC+H GFF V NH
Sbjct  20    LSPTYENPISTQPTVPEAELCDGSIPIIDLEALHGPRRSHIVKQLGHACQHKGFFAVKNH  79

Query  1663  GVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLH  1484
             G+PK  + ++   + EFF+L  EE+MK Y+ DP+  +RL T++  + E V   R+ L+ H
Sbjct  80    GIPKTTVNNIFDTSREFFHLPEEERMKFYTPDPNSDIRLMTAYKDEVENVFVARESLKFH  139

Query  1483  CYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQ  1304
             C+P++ Y  +WP+NPP+ R     Y+  VR+V   + +AISESLGL+    +  LG  G 
Sbjct  140   CHPVEDYVNKWPTNPPSFRKKAAEYLRNVRRVEMTLLDAISESLGLERDYIEKRLG--GH  197

Query  1303  HMAVNFYPPC--PEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAF  1130
             ++++N+Y  C   E ELTYG+ +HTDP  +T+LLQD  V GLQVL +GKW+ V P PD  
Sbjct  198   YVSLNYYRACEQSELELTYGVRSHTDPTIITMLLQD-DVPGLQVLSEGKWMDVNPIPDTV  256

Query  1129  VINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAV  950
             V+++GD LQA+SN +YKS+ HRA VN +K RMS+AS+  P  DA I  PK L+D++ PA+
Sbjct  257   VVHVGDLLQAISNHRYKSLLHRATVNCEKERMSIASYCYPSSDATIGPPKKLIDNDHPAI  316

Query  949   YRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             Y+DFT+ E+  + W      +  L+ FK
Sbjct  317   YKDFTFGEFSKQMWKVITPTDKRLDFFK  344



>ref|XP_011038122.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Populus 
euphratica]
Length=351

 Score =   285 bits (729),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 151/325 (46%), Positives = 203/325 (62%), Gaps = 10/325 (3%)
 Frame = -3

Query  1819  YIRPESERPKLSEVTTCDD--VPVID---LGCGDRSFIVRQIGDACRHYGFFQVINHGVP  1655
             Y  P SE P LS V    D   P+ID   L    RS  VRQIG AC + GFF V NHG+P
Sbjct  26    YTDPLSEVPTLSGVDASVDGSTPIIDMEGLLGPQRSEFVRQIGHACENNGFFAVKNHGIP  85

Query  1654  KKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLHCYP  1475
             K  I +ML  A +FF+L  EE++K  S DP+  +RL T F  K   +   R  L+ HC+P
Sbjct  86    KMKINNMLDTARDFFHLPEEERLKFRSSDPNSIIRLVTGFQDKTRNIFVSRQSLKFHCHP  145

Query  1474  LQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQHMA  1295
             ++ +  +WPS PP+ R+ V  Y   VR+V   I EAISESLGL+      +L  +G +++
Sbjct  146   VEDFKNQWPSTPPSFREKVGEYCASVRKVEVAILEAISESLGLERDYIGKIL--KGHYVS  203

Query  1294  VNFYPPCPEPEL--TYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVIN  1121
             +NFYP C E EL  TYG+  HTDP  +TIL+QD  V GLQV+ D KW+ V P P+A V++
Sbjct  204   INFYPACQESELDVTYGVRTHTDPTLITILMQD-DVPGLQVINDDKWIDVNPIPNAVVVH  262

Query  1120  IGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYRD  941
             +GD LQALSN +YKS+ H+AIVN +K R+S+AS+  P +DA I   K L+DD+ PA+Y+D
Sbjct  263   VGDMLQALSNCRYKSLLHQAIVNCEKERVSIASYCYPSDDAEIGPAKKLIDDDHPAIYKD  322

Query  940   FTYPEYYSKFWSRNLNQEHCLEHFK  866
             FTY E++   W    +    L+ FK
Sbjct  323   FTYKEFHESMWRVKCSTAKRLDLFK  347



>ref|XP_011028793.1| PREDICTED: 2'-deoxymugineic-acid 2'-dioxygenase-like [Populus 
euphratica]
Length=341

 Score =   283 bits (723),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 151/338 (45%), Positives = 204/338 (60%), Gaps = 7/338 (2%)
 Frame = -3

Query  1864  QLLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLG---CGDRSFIVRQIGDACR  1694
             +LL S +   +LP+KYI PE  RP    +  C+ +PVIDLG     +R+ I ++I  A +
Sbjct  3     KLLSSRSNLQSLPKKYIFPEKIRPGKVAIALCESIPVIDLGDIAGQNRANITQEILKASQ  62

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFN-VKKET  1517
              +GFFQVINHGV K+++ D + V +E F +  E+   +YS+DP ++ RL TS N    E 
Sbjct  63    EFGFFQVINHGVSKELMNDTMTVFNEVFEMPTEDLAGIYSEDPDRSCRLFTSSNSYANED  122

Query  1516  VHNWRDYLRLHCYP-LQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDP  1340
             VHNWRD+LR  C+P L     +WP  P   R VV  Y TEV ++   I E ISE LGL+ 
Sbjct  123   VHNWRDFLRHPCHPDLDACIQQWPEKPTRYRQVVGNYSTEVMKLASGILELISEGLGLES  182

Query  1339  QCFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKW  1160
               F   L E    ++VN YPPCP+P LT GLP H DPN +TILLQ   V GLQV KDG+W
Sbjct  183   GYFGGTLSEN-SLLSVNRYPPCPDPSLTLGLPKHCDPNLITILLQG-DVCGLQVFKDGEW  240

Query  1159  LAVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPK  980
             + V P P+AFVINIG QLQ +SN K K   HRA+ N+   R S A F+ P  D+++   +
Sbjct  241   IGVGPVPNAFVINIGYQLQIISNNKVKGAEHRAVTNSKDARTSAAFFVSPSRDSIVEPAR  300

Query  979   PLLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
              L+   +  +YR F + E++S + +   N E  LE FK
Sbjct  301   ELIKAGNRPLYRAFEFREFFSNYMNEKGNSEVVLEPFK  338



>ref|XP_009354968.1| PREDICTED: hyoscyamine 6-dioxygenase-like [Pyrus x bretschneideri]
Length=338

 Score =   281 bits (720),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 144/325 (44%), Positives = 203/325 (62%), Gaps = 4/325 (1%)
 Frame = -3

Query  1834  TLPQKYIRPESERP-KLSEVTTCDDVPVIDLGCGDRSFIVRQIGDACRHYGFFQVINHGV  1658
             TLP+ YI P   RP KL+   +CD++PVIDLG GD++ I++QI  A   +GFFQVINHG+
Sbjct  13    TLPENYIFPPDARPGKLTTAPSCDNIPVIDLG-GDQTCIIQQILKASHEFGFFQVINHGI  71

Query  1657  PKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRL-STSFNVKKETVHNWRDYLRLHC  1481
              + +++D + V  EFF L  E+K  +YS+DP K  RL ++S N   E VH WRD LR  C
Sbjct  72    SESLLKDTMGVFKEFFELPAEDKAAVYSEDPKKICRLFTSSGNYDWEDVHLWRDNLRHPC  131

Query  1480  YPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQH  1301
              PL++    WP  P T R++V    +++R++   I E ISE LGL    F++ L  +   
Sbjct  132   LPLEESMQHWPQQPSTYRELVGTCSSQIRKLALNILELISEGLGLGTGYFRDEL-LKNML  190

Query  1300  MAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFVIN  1121
             ++VN YPPC +P LT G+  H DPN +TILLQ+  V GLQV  DG+W+ VKP  DA VIN
Sbjct  191   LSVNHYPPCSDPSLTLGVSKHCDPNLITILLQEEHVNGLQVFIDGEWIGVKPLSDALVIN  250

Query  1120  IGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVYRD  941
             IG QLQ +SNGK KS  HRA+ ++   R S A F+ P +D ++     L++  +P ++R 
Sbjct  251   IGYQLQIISNGKLKSAEHRAVTSSSNARTSAAFFIAPSDDCIVEPAGDLINASNPQLFRP  310

Query  940   FTYPEYYSKFWSRNLNQEHCLEHFK  866
             F Y E+   ++++    E  LE FK
Sbjct  311   FQYKEFIMNYFTKQGKTEVVLEPFK  335



>gb|AHW42451.1| GA2ox1 [Pinus tabuliformis]
Length=361

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/336 (42%), Positives = 210/336 (63%), Gaps = 10/336 (3%)
 Frame = -3

Query  1858  LFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLGCGDRSFIVRQ-----IGDACR  1694
             L      +++P KY+ P+  RP  +E+   + +P+ID+   D++   RQ     +G ACR
Sbjct  24    LVDSGALNSVPIKYVFPQHSRPSAAEIAEGESIPIIDVSGLDKTPAERQEAIKNLGQACR  83

Query  1693  HYGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETV  1514
              +GFFQV+NHG+P+ +I  ML  A++FF+LS EEKMK  + D    +R  TSFNV+ E +
Sbjct  84    DWGFFQVVNHGIPESLISSMLDAAYQFFSLSSEEKMKYETRDVLNPLRYGTSFNVEAEQI  143

Query  1513  HNWRDYLRLHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQC  1334
              NWRDYL+  C+P + Y P+   NPP  R+V + Y  E R++  ++  AISESLGL    
Sbjct  144   FNWRDYLKHFCHP-ELYTPD---NPPIYREVAEQYFKETRKLALRLIGAISESLGLKSDY  199

Query  1333  FKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLA  1154
              + V  +  Q   +N YPPCPEP+ T G+  H+D   LTILL++  V GLQVL +G W+A
Sbjct  200   IQTVFNDCFQMAVLNLYPPCPEPDQTMGIARHSDHGVLTILLEN-DVGGLQVLHEGHWVA  258

Query  1153  VKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPL  974
             V+P P+AF++N+GD L+ LSNG+YKSV HRA+VN+++ R+S+A+   P  D+++     L
Sbjct  259   VEPSPNAFIVNVGDHLEILSNGRYKSVEHRAVVNSERTRISIAAPNGPSMDSLVFPAPQL  318

Query  973   LDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             +D+  P +Y+  +Y EY     S  L  +  LE  K
Sbjct  319   IDEIHPPLYKSRSYEEYMRDQQSARLRGKGTLESVK  354



>ref|XP_007199354.1| hypothetical protein PRUPE_ppa025199mg [Prunus persica]
 gb|EMJ00553.1| hypothetical protein PRUPE_ppa025199mg [Prunus persica]
Length=342

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/328 (44%), Positives = 202/328 (62%), Gaps = 8/328 (2%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCDDVPVIDLGCG-----DRSFIVRQIGDACRHYGFFQVIN  1667
             LP  YI P   RP   +V  C+++PVID+G       DR+ I++Q+ +A   +GFFQVIN
Sbjct  14    LPDNYIFPPDARPGKLDVPLCNNIPVIDMGGAGAEAHDRTSIIQQMLNASEEFGFFQVIN  73

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRL-STSFNVKKETVHNWRDYLR  1490
             HG+P+ +++D ++V  EFF L +E+K  LYS+DP+K  RL ++S N   E  H WRD LR
Sbjct  74    HGIPENLLKDTMRVFKEFFELPLEDKASLYSEDPNKNCRLFTSSGNYDWEEAHFWRDILR  133

Query  1489  LHCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQ  1310
               C+PL++    WP  P T R+ V    T+VR+V   I + ISE LGL+P  F++ L  Q
Sbjct  134   HCCHPLEQCIQFWPQKPITYREHVGACSTQVREVALNILQLISEGLGLEPGYFRDELS-Q  192

Query  1309  GQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAF  1130
                ++VN+YPPCP+P LT G+P H DPN +TILLQ   V GLQV KDG+W+ V+P P A 
Sbjct  193   VSLLSVNYYPPCPDPSLTLGVPKHCDPNLITILLQG-DVNGLQVFKDGEWIGVEPLPSAL  251

Query  1129  VINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAV  950
             V+NIG QLQ +SNGK K   HRA+ N+   R S A F  P  D +I     L++  +P  
Sbjct  252   VVNIGYQLQIISNGKLKCAEHRAVTNSRNARTSTAFFFTPSPDCLIKPAGALINASNPQR  311

Query  949   YRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             Y+ F Y E+ + +  +    +  LE FK
Sbjct  312   YKAFQYKEFITNYAMKQGKTDIVLEPFK  339



>ref|XP_011040623.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Populus 
euphratica]
Length=350

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/328 (45%), Positives = 205/328 (63%), Gaps = 10/328 (3%)
 Frame = -3

Query  1828  PQKYIRPESERPKLSEVTTCDD--VPVIDLGC---GDRSFIVRQIGDACRHYGFFQVINH  1664
             P  Y  P SE P LS V    D   P++D+       RS I++QIG AC   GFF V NH
Sbjct  22    PYTYTDPLSEVPTLSGVDVSADGSTPIVDMEALLGPHRSEIIKQIGLACEKNGFFAVKNH  81

Query  1663  GVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLH  1484
             G+P+  I +ML  A EFF+L  EE++K  S DP+  +RL T F  +   +   R  L+ H
Sbjct  82    GIPEMKINNMLDTAREFFHLPDEERLKFRSTDPNSVIRLVTGFEDRTRNIFVSRQSLKFH  141

Query  1483  CYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQ  1304
              +P+++Y  +WPSNPP+ R+ V  Y   VR+V   I EAISESLGL+      +L  +G 
Sbjct  142   SHPVEEYMSQWPSNPPSFRENVGEYCASVREVEVAILEAISESLGLERDYIDKIL--KGH  199

Query  1303  HMAVNFYPPCPEPEL--TYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAF  1130
             ++++N+YP C E EL  TYG+  HTDP  +TIL+QD  V GLQV+ D KW+ V P P+A 
Sbjct  200   YVSINYYPACRESELDVTYGVRTHTDPTIITILMQD-DVPGLQVINDDKWINVNPLPNAV  258

Query  1129  VINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAV  950
             V+++GD LQALSN +YKS+ H+AIVN +K R+S+AS+  P +DA+I   K L+D + PA+
Sbjct  259   VVHVGDILQALSNYRYKSLLHQAIVNCEKERVSIASYCYPSDDAMIGPAKKLVDRDHPAI  318

Query  949   YRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             Y+DFTY E++   W    +    L+ FK
Sbjct  319   YKDFTYREFHESMWRVKCSTAKRLDLFK  346



>ref|XP_010111901.1| Hyoscyamine 6-dioxygenase [Morus notabilis]
 gb|EXC31935.1| Hyoscyamine 6-dioxygenase [Morus notabilis]
Length=340

 Score =   280 bits (715),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 147/327 (45%), Positives = 201/327 (61%), Gaps = 6/327 (2%)
 Frame = -3

Query  1834  TLPQKYIRPESERPKLSEVTTCDDVPVIDLGC---GDRSFIVRQIGDACRHYGFFQVINH  1664
             ++P  YI P   RP  +EV  C  +PVID       D + +++QI +A   +G FQ+INH
Sbjct  13    SVPDSYILPPDSRPGETEVPLCKTIPVIDCKGEFGRDPTKLIQQIIEASTEFGLFQLINH  72

Query  1663  GVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLH  1484
             GV +K+++D LKVA EFF L  E+K  L+SDDP K+ RL TS +  KE VH WRD LR  
Sbjct  73    GVEEKLLQDALKVAKEFFGLPDEDKAILFSDDPKKSCRLYTSIDYMKEEVHYWRDSLRHP  132

Query  1483  CYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLG-EQG  1307
             C+PL+++   WP  P   RDV+  Y  EVR++   + + I + LGL+P  F+N     + 
Sbjct  133   CHPLEEHRQFWPEKPAQYRDVMGSYSAEVRKLSLYLLDMICDGLGLEPGYFRNSTQLTEV  192

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             Q MA N YPPCP+P LT GLP H D N +TILLQ++   GLQVLKDG+WLAV+P P+AFV
Sbjct  193   QLMAANHYPPCPDPSLTLGLPKHGDFNLITILLQEMD--GLQVLKDGQWLAVEPLPNAFV  250

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             +NIG  LQ +SNGK KS  HR + N    R +V SF+ P     I   K L+    P +Y
Sbjct  251   VNIGHTLQIISNGKLKSAEHRVVTNRKLARTTVTSFIAPSNSCQIEPAKELVKKFIPPLY  310

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             R FTY ++ + + +    ++  LE +K
Sbjct  311   RAFTYKDFLATYVTDTYQRKPPLERYK  337



>gb|ABK22784.1| unknown [Picea sitchensis]
Length=368

 Score =   280 bits (717),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 145/327 (44%), Positives = 201/327 (61%), Gaps = 8/327 (2%)
 Frame = -3

Query  1834  TLPQKYIRPESERPKLSEVTTCDDVPVIDL----GCGDRSFIVRQIGDACRHYGFFQVIN  1667
             TLPQ Y++P  ER  ++  +    +P+IDL    G G RS  V  IG ACR +GFF V N
Sbjct  42    TLPQIYVKPPDERLVIN--SDQQQIPLIDLSELEGAG-RSATVEAIGRACRDWGFFLVKN  98

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HGV +  +E+ ++V  EFF+L  EEKM+ +S D    MR +TSFNVK++   NWRD+LR 
Sbjct  99    HGVSESTMENEMRVGREFFHLPTEEKMRYFSTDHKSRMRYATSFNVKEDKTLNWRDFLRY  158

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
              C PL++  P WP  P   R     Y+ ++  +   +  AISESLGL  +    V G+  
Sbjct  159   SCKPLEEMVPLWPDKPTDFRKENAEYIRKIGDLASILLSAISESLGLPSEYINEVYGDYS  218

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             Q+MA NFYP CP PE T GLP H+DP  LT+L+QD  V GLQVL +  W+ V+P P+  V
Sbjct  219   QYMAYNFYPACPNPEQTLGLPGHSDPGGLTLLMQD-DVGGLQVLHEDHWVVVRPVPNTLV  277

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             IN+GDQLQ LSN  YKSV HRA+VN+++ R+SVA+   P    +I+    L++  SPAVY
Sbjct  278   INLGDQLQILSNDIYKSVEHRAVVNSNRERISVATAYGPSMSTLIAPAPQLVNSSSPAVY  337

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             +   Y ++     S +L+++  L+  K
Sbjct  338   KGCVYGDFLDSLESGSLHKKSVLDCLK  364



>ref|XP_011010090.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Populus 
euphratica]
Length=350

 Score =   279 bits (713),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 146/328 (45%), Positives = 205/328 (63%), Gaps = 10/328 (3%)
 Frame = -3

Query  1828  PQKYIRPESERPKLSEVTTCDD--VPVIDLGC---GDRSFIVRQIGDACRHYGFFQVINH  1664
             P  Y  P SE P  S+V    D   P+ID+       RS I++QIG AC   GFF V NH
Sbjct  22    PYTYTDPLSEVPTPSDVDVSADGSTPIIDMEALLGPHRSEIIKQIGLACEKNGFFAVKNH  81

Query  1663  GVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLH  1484
             G+P+  I +ML  A EFF+L  EE++K  S DP+  +RL T F  +   +   R  L+ H
Sbjct  82    GIPEMKINNMLDTAREFFHLPDEERLKFRSTDPNSVIRLVTGFEDRTRNIFVSRQSLKFH  141

Query  1483  CYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQ  1304
              +P+++Y  +WPSNPP+ R+ V  Y   VR+V   I EAISESLGL+      +L  +G 
Sbjct  142   SHPVEEYMSQWPSNPPSFRENVGEYCASVREVEVAILEAISESLGLERDYIDKIL--KGH  199

Query  1303  HMAVNFYPPCPEPEL--TYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAF  1130
             ++++N+YP C E EL  TYG+  HTDP  +TIL+QD  V GLQV+ D KW+ V P P+A 
Sbjct  200   YVSINYYPACRESELDVTYGVRTHTDPTVITILMQD-DVPGLQVINDDKWINVNPLPNAV  258

Query  1129  VINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAV  950
             V+++GD LQALSN +YKS+ H+AIVN +K R+S+AS+  P +DA+I   + L+D + PA+
Sbjct  259   VVHVGDILQALSNYRYKSLLHQAIVNCEKERVSIASYCYPSDDAMIGPARKLVDRDHPAI  318

Query  949   YRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             Y+DFTY E++   W    +    L+ FK
Sbjct  319   YKDFTYREFHESMWRVKCSTAKRLDLFK  346



>gb|ABK23053.1| unknown [Picea sitchensis]
Length=368

 Score =   279 bits (714),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/327 (44%), Positives = 201/327 (61%), Gaps = 8/327 (2%)
 Frame = -3

Query  1834  TLPQKYIRPESERPKLSEVTTCDDVPVIDL----GCGDRSFIVRQIGDACRHYGFFQVIN  1667
             TLPQ Y++P  ER  ++  +    +P+IDL    G G RS  V  IG ACR +GFF V N
Sbjct  42    TLPQIYVKPPDERLVIN--SDQQQIPLIDLSELEGAG-RSAKVEAIGRACRDWGFFLVKN  98

Query  1666  HGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRL  1487
             HGV +  +E+ ++V  EFF+L  EEKM+ +S D    MR +TSFNVK++   NWRD+LR 
Sbjct  99    HGVSESTMENEMRVGREFFHLPTEEKMRYFSTDHKSRMRYATSFNVKEDKTLNWRDFLRY  158

Query  1486  HCYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQG  1307
              C PL++  P WP  P   R     Y+ ++  +   +  AISESLGL  +    V G+  
Sbjct  159   SCKPLEEMVPLWPDKPTDFRKENSEYIRKIGDLASILLSAISESLGLPSEYINEVYGDYS  218

Query  1306  QHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAFV  1127
             Q+MA NFYP CP PE T GLP H+DP  LT+L+QD  V GLQVL +  W+ V+P P+  V
Sbjct  219   QYMAYNFYPACPNPEQTLGLPGHSDPGGLTLLMQD-DVGGLQVLHEDHWVVVRPVPNTLV  277

Query  1126  INIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAVY  947
             IN+GDQLQ LSN  YKSV HRA+VN+++ R+SVA+   P    +I+    L++  SPAVY
Sbjct  278   INLGDQLQILSNDIYKSVEHRAVVNSNRERISVATAYGPSMSTLIAPAPQLVNSSSPAVY  337

Query  946   RDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             +   Y ++     S +L+++  L+  K
Sbjct  338   KGCVYGDFLDSLESGSLHKKSVLDCLK  364



>ref|XP_002302052.2| hypothetical protein POPTR_0002s04070g [Populus trichocarpa]
 gb|EEE81325.2| hypothetical protein POPTR_0002s04070g [Populus trichocarpa]
Length=341

 Score =   278 bits (712),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/337 (44%), Positives = 204/337 (61%), Gaps = 7/337 (2%)
 Frame = -3

Query  1861  LLFSGTPYSTLPQKYIRPESERPKLSEVTTCDDVPVIDLG---CGDRSFIVRQIGDACRH  1691
             L+ S     +L +KYI PE  RP    +  C+ +PVIDLG     +R+ I ++I  A + 
Sbjct  4     LVSSRCNLQSLSEKYIFPEEIRPGKVAIALCESIPVIDLGDIAGQNRANIAQEILKASQE  63

Query  1690  YGFFQVINHGVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFN-VKKETV  1514
             +GFFQVINHGV K+++ D + V +E F +  E+   +YS+DP ++ RL TS N    E V
Sbjct  64    FGFFQVINHGVSKELMNDTMSVFNEVFEMPAEDLAGIYSEDPDRSCRLFTSSNSYASEDV  123

Query  1513  HNWRDYLRLHCYP-LQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQ  1337
             HNWRD+LR  C+P L     +WP  P   R VV  Y TEV ++   I E I+E LGL+ +
Sbjct  124   HNWRDFLRHPCHPDLDACIQQWPEKPTRYRQVVGNYSTEVMKLASGILELITEGLGLESR  183

Query  1336  CFKNVLGEQGQHMAVNFYPPCPEPELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWL  1157
              F   L E    +++N YPPCP+P LT GLP H DPN +TILLQ   V GLQV KDG+W+
Sbjct  184   YFGGKLSENA-FLSINRYPPCPDPSLTLGLPKHCDPNLITILLQG-DVCGLQVFKDGEWI  241

Query  1156  AVKPRPDAFVINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKP  977
              V P P+AFVINIG QLQ +SN K K   HRA+ N+   R S A F+ P  D+++   + 
Sbjct  242   GVGPVPNAFVINIGYQLQIISNNKLKGAEHRAVTNSKDARTSAAFFVSPSRDSIVEPARE  301

Query  976   LLDDESPAVYRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             L+ +++  +YR F + E++S + +   N E  LE FK
Sbjct  302   LIKEDNRPLYRAFEFTEFFSNYMNEKGNVEVVLEPFK  338



>ref|XP_002317047.2| hypothetical protein POPTR_0011s15320g [Populus trichocarpa]
 gb|EEE97659.2| hypothetical protein POPTR_0011s15320g [Populus trichocarpa]
Length=393

 Score =   280 bits (715),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 148/328 (45%), Positives = 204/328 (62%), Gaps = 10/328 (3%)
 Frame = -3

Query  1828  PQKYIRPESERPKLSEVTTCDD--VPVIDLGC---GDRSFIVRQIGDACRHYGFFQVINH  1664
             P  Y  P SE P LS V    D   P+ID+       RS I++QIG AC   GFF V NH
Sbjct  65    PYTYTDPLSEVPTLSGVDVSADGSTPIIDMEALLGPHRSEIIKQIGRACEKNGFFAVKNH  124

Query  1663  GVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLH  1484
             G+P+  I +ML  A EFF+L  EE++K  S DP+  +RL T F  K   +   R  L+ H
Sbjct  125   GIPEMKINNMLDTAREFFHLPDEERLKFRSTDPNSVIRLVTGFQDKTRNIFVSRQSLKFH  184

Query  1483  CYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQ  1304
              +P+++Y  +WPSNPP+ R+ V  Y   VR+V   I EAISESLGL+      +L  +G 
Sbjct  185   SHPVEEYKSQWPSNPPSFRENVGEYCASVREVEVAILEAISESLGLERDYIDKIL--KGH  242

Query  1303  HMAVNFYPPCPEPEL--TYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAF  1130
             ++++N+YP C E EL  TYG+  HTDP  +TIL+QD  V GLQV+ D KW+ V P P+A 
Sbjct  243   YVSINYYPACQESELDVTYGVRTHTDPTIITILMQD-DVPGLQVINDDKWINVNPLPNAV  301

Query  1129  VINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAV  950
             V+++GD LQALSN +YKS+ H+AIVN +K R+S+AS+  P +DA+I   K L+  + PA+
Sbjct  302   VVHVGDILQALSNYRYKSLLHQAIVNCEKERVSIASYCYPSDDAMIGPAKKLVGKDHPAI  361

Query  949   YRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             Y+DFTY E++   W    +    L+ FK
Sbjct  362   YKDFTYREFHESMWRVKCSTAKRLDLFK  389



>ref|XP_002317048.2| hypothetical protein POPTR_0011s15340g [Populus trichocarpa]
 gb|EEE97660.2| hypothetical protein POPTR_0011s15340g [Populus trichocarpa]
Length=349

 Score =   278 bits (710),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/328 (44%), Positives = 204/328 (62%), Gaps = 9/328 (3%)
 Frame = -3

Query  1831  LPQKYIRPESERPKLSEVTTCDD-VPVIDLGCGD---RSFIVRQIGDACRHYGFFQVINH  1664
             LP  Y  P S  P L E    D  +P+IDL       RS IV+Q+G AC+H GFF V NH
Sbjct  21    LPHTYKDPISNLPTLPEAQVSDSSIPIIDLEALHGPRRSDIVKQLGQACQHRGFFAVKNH  80

Query  1663  GVPKKVIEDMLKVAHEFFNLSVEEKMKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLH  1484
             G+P+  + ++     EFF+L  EE+MK Y+ DP+  +RL  ++  +   V   R+ L+ H
Sbjct  81    GIPRTAVSNIFDTTREFFHLPKEERMKFYTPDPNSDIRLMNAYKDEVANVFVARESLKFH  140

Query  1483  CYPLQKYAPEWPSNPPTLRDVVKIYVTEVRQVGFKIEEAISESLGLDPQCFKNVLGEQGQ  1304
             C+P++ Y  +WP+NPP+ R     Y+T VR+V   +  AISESLGL+    +  LG  G 
Sbjct  141   CHPVENYVNKWPTNPPSFRKYAAEYLTNVRRVEITLLGAISESLGLERDYIEKKLG--GH  198

Query  1303  HMAVNFYPPCPEP--ELTYGLPAHTDPNALTILLQDLQVAGLQVLKDGKWLAVKPRPDAF  1130
             + ++N+Y  C +   ELTYG+ AHTDP  +TILLQD  V GLQVL + KW+ V P P   
Sbjct  199   YASLNYYGACEQSDLELTYGVRAHTDPTIITILLQD-DVPGLQVLSEDKWMDVNPIPGTV  257

Query  1129  VINIGDQLQALSNGKYKSVWHRAIVNTDKPRMSVASFLCPGEDAVISAPKPLLDDESPAV  950
             V+++GD LQA+SN K+KS+ H+A+VN +K RMS+AS+  P  DA+I  PK L+D++ PAV
Sbjct  258   VVHVGDLLQAISNHKFKSLLHQAMVNCEKERMSIASYCYPSSDAMIGPPKKLIDNDHPAV  317

Query  949   YRDFTYPEYYSKFWSRNLNQEHCLEHFK  866
             Y+DFT+ E+  + W      +  L+ FK
Sbjct  318   YKDFTFKEFSEQMWKVITFTDTRLDSFK  345



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5958861500102