BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c18182_g2_i1 len=239 path=[217:0-48 266:49-88 306:89-238]

Length=239
                                                                      Score     E

ref|XP_002529598.1|  receptor-kinase, putative                        47.4    6e-04   Ricinus communis
ref|XP_004983380.1|  PREDICTED: receptor-like protein kinase-like     47.0    7e-04   



>ref|XP_002529598.1| receptor-kinase, putative [Ricinus communis]
 gb|EEF32790.1| receptor-kinase, putative [Ricinus communis]
Length=1028

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 46/80 (58%), Gaps = 2/80 (3%)
 Frame = -3

Query  237  LYLNNCNFGGVLPRFIANF-PQLVHFQIKENVIGGYLPSEIHllenleylylsenqLGGT  61
            L +   N GGVLP  ++NF  +LVH     N I G +PSEI  L  LE L    N+L G+
Sbjct  351  LAITENNLGGVLPEMLSNFSTKLVHMAFGRNKIRGRIPSEIDNLIRLEALGFERNELTGS  410

Query  60   IPSSWGGSLQQLIGLHLGGN  1
            IPSS  G L+ LI L+L  N
Sbjct  411  IPSSL-GKLKNLIKLYLNDN  429



>ref|XP_004983380.1| PREDICTED: receptor-like protein kinase-like [Setaria italica]
Length=1111

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 44/79 (56%), Gaps = 1/79 (1%)
 Frame = -3

Query  237  LYLNNCNFGGVLPRFIANFPQLVHFQIKENVIGGYLPSEIHllenleylylsenqLGGTI  58
            LYL+  NF G +P FI+NF +L  F +  N I G +P EI   + L  L L  N L GTI
Sbjct  331  LYLDGNNFTGSIPVFISNFSRLQMFSVAHNGISGRIPPEIGNCQELVELKLQNNSLSGTI  390

Query  57   PSSWGGSLQQLIGLHLGGN  1
            P    G L QL GL+L  N
Sbjct  391  PPEI-GKLSQLQGLYLYKN  408



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517576194536